CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP020746	Bacillus mycoides strain Gnyt1 plasmid unnamed3, complete sequence	0 crisprs	RT,csa3	0	0
NZ_CP020751	Bacillus mycoides strain Gnyt1 plasmid unnamed8, complete sequence	0 crisprs	NA	0	0
NZ_CP020743	Bacillus mycoides strain Gnyt1 chromosome, complete genome	6 crisprs	cas3,WYL,csa3,Cas14u_CAS-V,RT,DinG,cas14k,cas14j,DEDDh,c2c9_V-U4	2	14
NZ_CP020745	Bacillus mycoides strain Gnyt1 plasmid unnamed2, complete sequence	0 crisprs	csa3	0	1
NZ_CP020749	Bacillus mycoides strain Gnyt1 plasmid unnamed6, complete sequence	0 crisprs	RT	0	1
NZ_CP020750	Bacillus mycoides strain Gnyt1 plasmid unnamed7, complete sequence	1 crisprs	NA	1	1
NZ_CP020747	Bacillus mycoides strain Gnyt1 plasmid unnamed4, complete sequence	0 crisprs	NA	0	0
NZ_CP020744	Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence	1 crisprs	cas14j,csa3,RT,Cas14u_CAS-V	1	5
NZ_CP020748	Bacillus mycoides strain Gnyt1 plasmid unnamed5, complete sequence	0 crisprs	csa3	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

34886 : 100352

Bacillus_phage(57.14%)

transposase,integrase

attL 32525:32540|attR 47351:47366

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
32525:32540	attL	NA	NA	NA	NA
WP_085313366.1\|34886_35837_+\|integrase	site-specific integrase	A0A1B1P793	Bacillus_phage	3.5e-69	45.1
WP_085313367.1\|36079_37246_+	ParM/StbA family protein	NA	NA	NA	NA
WP_085313368.1\|37270_37690_+	hypothetical protein	NA	NA	NA	NA
WP_085313369.1\|37745_38330_-	hypothetical protein	NA	NA	NA	NA
WP_085313370.1\|38649_38871_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_085313371.1\|38908_39127_-	hypothetical protein	NA	NA	NA	NA
WP_085313372.1\|39141_39798_-	replication-relaxation family protein	A0A1B1P7T2	Bacillus_phage	2.0e-79	66.2
WP_085313373.1\|39781_40954_-	DNA translocase FtsK	W8CYG2	Bacillus_phage	2.4e-160	71.9
WP_085313374.1\|40960_41284_-	hypothetical protein	A0A1B1P7T1	Bacillus_phage	6.8e-33	67.3
WP_085313375.1\|41295_41712_-	hypothetical protein	A0A1B1P7T3	Bacillus_phage	1.3e-49	73.8
WP_085308762.1\|42080_43310_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	1.7e-84	49.1
WP_085313376.1\|43858_44716_+	hypothetical protein	NA	NA	NA	NA
WP_085313377.1\|45192_45549_-	hypothetical protein	NA	NA	NA	NA
WP_085313428.1\|45629_46133_-	hypothetical protein	NA	NA	NA	NA
WP_085313378.1\|46420_46888_-	LacI family transcriptional regulator	A0A0N6W8H7	Bacillus_phage	1.4e-07	28.5
WP_085313379.1\|47054_47294_-	DUF3961 domain-containing protein	NA	NA	NA	NA
WP_085313380.1\|47390_47558_-	CopG family transcriptional regulator	NA	NA	NA	NA
47351:47366	attR	NA	NA	NA	NA
WP_085313381.1\|47664_48105_-	sporulation protein	F8WPS9	Bacillus_phage	2.7e-32	51.8
WP_085313382.1\|49216_51226_-	hypothetical protein	NA	NA	NA	NA
WP_085313383.1\|52382_53378_-	DUF4046 domain-containing protein	NA	NA	NA	NA
WP_085313384.1\|54056_55058_-	sphingomyelin phosphodiesterase	A0A1P8L6H7	Staphylococcus_phage	4.6e-88	56.1
WP_085313385.1\|55408_63031_-	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	1.0e-139	26.1
WP_085313386.1\|64124_64697_+	methyltransferase	NA	NA	NA	NA
WP_085313387.1\|65100_66501_+	phosphatidylinositol-specific phospholipase C	NA	NA	NA	NA
WP_085313388.1\|67394_68522_-	Ger(x)C family spore germination protein	NA	NA	NA	NA
WP_085313389.1\|68521_71125_-	endospore germination permease	NA	NA	NA	NA
WP_085313390.1\|71620_72664_+	Fic family protein	NA	NA	NA	NA
WP_085313391.1\|73496_75140_-	pesticidial crystal protein	NA	NA	NA	NA
WP_085313392.1\|75207_77142_-	hypothetical protein	NA	NA	NA	NA
WP_085313393.1\|77181_80163_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.1e-257	45.7
WP_000690668.1\|80175_80727_-	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	3.2e-43	53.3
WP_085313394.1\|81319_83296_+	hypothetical protein	NA	NA	NA	NA
WP_172805479.1\|83363_84947_+	pesticidial crystal protein	NA	NA	NA	NA
WP_157404955.1\|85592_85847_-	hypothetical protein	NA	NA	NA	NA
WP_085313396.1\|86312_86954_-	recombinase family protein	A0A1B0VBM1	Salmonella_phage	2.8e-14	34.5
WP_085313397.1\|87330_87543_+	hypothetical protein	NA	NA	NA	NA
WP_172805475.1\|88018_88369_+	hypothetical protein	NA	NA	NA	NA
WP_085313399.1\|88740_89646_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_085313400.1\|90014_90323_-	50S ribosomal protein L7ae	NA	NA	NA	NA
WP_085313401.1\|90391_90682_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_085313402.1\|91225_91666_-	hypothetical protein	NA	NA	NA	NA
WP_085313403.1\|93138_93552_-	hypothetical protein	NA	NA	NA	NA
WP_085313404.1\|93582_93894_-	zinc-finger domain-containing protein	NA	NA	NA	NA
WP_085313405.1\|94365_94797_-	DUF4879 domain-containing protein	NA	NA	NA	NA
WP_085313406.1\|96236_96545_-	50S ribosomal protein L7ae	NA	NA	NA	NA
WP_085313407.1\|96616_96907_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_085313408.1\|96981_97215_-	RNA chaperone Hfq	NA	NA	NA	NA
WP_085313409.1\|97256_97565_-\|transposase	transposase	NA	NA	NA	NA
WP_157404956.1\|97580_97847_-	hypothetical protein	NA	NA	NA	NA
WP_085313411.1\|97913_98147_-	hypothetical protein	NA	NA	NA	NA
WP_085313429.1\|98294_98894_+	hypothetical protein	NA	NA	NA	NA
WP_157404958.1\|98997_100352_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	7.6e-126	84.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP020749

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3681 : 54044

Bacillus_phage(50.0%)

terminase,transposase,holin,portal,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002141558.1\|3681_4179_+\|holin	phage holin family protein	A0A0M4R5G6	Bacillus_phage	6.6e-27	44.9
WP_085313657.1\|4259_5318_+	N-acetylmuramoyl-L-alanine amidase	A0A1B1P7Q1	Bacillus_phage	4.6e-147	72.9
WP_172805493.1\|5377_5515_-	hypothetical protein	NA	NA	NA	NA
WP_085313658.1\|5516_6605_-	hypothetical protein	A0A2H4J8G3	uncultured_Caudovirales_phage	2.2e-75	44.1
WP_085313659.1\|6894_7635_-	hypothetical protein	NA	NA	NA	NA
WP_085313661.1\|8152_8389_-	hypothetical protein	A0A1B1P789	Bacillus_phage	1.2e-15	48.1
WP_002167225.1\|8483_8723_-	hypothetical protein	NA	NA	NA	NA
WP_085313662.1\|8712_9723_-	plasmid segregation protein ParM	A0A2H4IZP5	uncultured_Caudovirales_phage	4.1e-28	28.0
WP_085313663.1\|9916_10531_-	DUF3967 domain-containing protein	NA	NA	NA	NA
WP_085313664.1\|10837_11047_+	preprotein translocase	NA	NA	NA	NA
WP_085313667.1\|12826_14038_-	NADH dehydrogenase	NA	NA	NA	NA
WP_085313706.1\|14891_15395_-	ribonuclease	NA	NA	NA	NA
WP_085313668.1\|15749_16094_-	helix-turn-helix transcriptional regulator	A0A2H4JAY7	uncultured_Caudovirales_phage	4.7e-08	35.0
WP_085313669.1\|16689_17877_+	hypothetical protein	D2XQ10	Bacillus_virus	2.9e-89	48.5
WP_172805492.1\|17896_18037_+	hypothetical protein	NA	NA	NA	NA
WP_001099889.1\|19796_19976_+	hypothetical protein	NA	NA	NA	NA
WP_001213815.1\|19996_20335_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_085313707.1\|20569_20758_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_085313670.1\|20833_21508_+	Rha family transcriptional regulator	A0A0U4IS08	Exiguobacterium_phage	1.0e-35	41.5
WP_001121080.1\|21531_21894_+	hypothetical protein	A0A0S2MVA8	Bacillus_phage	1.3e-40	66.9
WP_085313671.1\|21916_22264_+	hypothetical protein	A0A0S2MVM3	Bacillus_phage	3.0e-26	59.3
WP_085313672.1\|22433_22934_+	hypothetical protein	A0A0A7AQW2	Bacillus_phage	3.1e-61	70.6
WP_085313673.1\|22902_23319_+	cell division protein SepF	A0A0S2MVI0	Bacillus_phage	5.8e-45	62.8
WP_085313674.1\|23321_23789_+	hypothetical protein	A0A0S2MVB7	Bacillus_phage	3.3e-36	48.4
WP_085313675.1\|23995_24277_+	hypothetical protein	A0A0S2MVD9	Bacillus_phage	2.4e-18	56.1
WP_085313676.1\|24273_24723_+	hypothetical protein	A0A0S2MVJ1	Bacillus_phage	8.2e-69	80.7
WP_085313677.1\|24719_25298_+	dUTP diphosphatase	A0A0S2MVD0	Bacillus_phage	7.2e-86	80.3
WP_085313678.1\|25314_25824_+	hypothetical protein	A0A1C8E9A7	Bacillus_phage	1.4e-80	91.7
WP_085313679.1\|25807_26380_+	hypothetical protein	A0A1C8E9B1	Bacillus_phage	3.0e-84	81.6
WP_085313680.1\|26551_26770_+	DUF3797 domain-containing protein	A0A0H3UYX0	Geobacillus_virus	4.7e-06	42.9
WP_085313681.1\|27107_27443_+	DUF3307 domain-containing protein	D2XQ28	Bacillus_virus	2.0e-51	90.1
WP_085313682.1\|27823_28354_+	Holliday junction resolvase RecU	A0A1C8E9C3	Bacillus_phage	1.1e-83	87.1
WP_170969889.1\|28353_28689_+	zinc-finger domain-containing protein	NA	NA	NA	NA
WP_085313683.1\|28836_29337_+	sigma-70 family RNA polymerase sigma factor	A0A0S2MVE1	Bacillus_phage	1.4e-72	83.0
WP_085313684.1\|29861_30263_+	helix-turn-helix domain-containing protein	A0A142F1N8	Bacillus_phage	1.0e-06	53.3
WP_061129717.1\|30409_30985_+	recombinase family protein	A0A219Y9V9	Aeromonas_phage	5.1e-31	44.1
WP_085313685.1\|30984_31407_+	HNH endonuclease	NA	NA	NA	NA
WP_085311987.1\|31949_33248_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	8.5e-42	32.8
WP_000390758.1\|33530_33710_+	hypothetical protein	NA	NA	NA	NA
WP_085313686.1\|33731_34559_+\|terminase	terminase	A0A1L2JY44	Aeribacillus_phage	1.1e-34	37.7
WP_085313687.1\|34551_35829_+\|terminase	PBSX family phage terminase large subunit	S5MC58	Brevibacillus_phage	6.8e-153	64.2
WP_085313688.1\|35898_37380_+\|portal	phage portal protein	Q9HH53	Methanothermobacter_phage	1.5e-31	29.6
WP_085313689.1\|37493_38012_+\|capsid	minor capsid protein	Q1WDG7	Streptomyces_phage	4.9e-09	34.4
WP_085313690.1\|38125_39328_+	hypothetical protein	A0A1B1P7E4	Bacillus_phage	6.6e-57	40.9
WP_085313709.1\|39357_40335_+\|capsid	major capsid protein	H7BVA6	unidentified_phage	1.5e-70	44.5
WP_002135994.1\|40505_40670_+	hypothetical protein	NA	NA	NA	NA
WP_085313691.1\|40669_41206_+	hypothetical protein	NA	NA	NA	NA
WP_085313692.1\|41202_41574_+	hypothetical protein	NA	NA	NA	NA
WP_085313693.1\|41580_41991_+	hypothetical protein	NA	NA	NA	NA
WP_085313694.1\|41995_42418_+	hypothetical protein	NA	NA	NA	NA
WP_085313695.1\|42430_43033_+	hypothetical protein	D3W0E4	Lactococcus_phage	7.0e-15	28.0
WP_085313696.1\|43090_43609_+	hypothetical protein	NA	NA	NA	NA
WP_085313697.1\|43572_43995_+	hypothetical protein	NA	NA	NA	NA
WP_172805479.1\|46278_47862_-	pesticidial crystal protein	NA	NA	NA	NA
WP_085313394.1\|47929_49906_-	hypothetical protein	NA	NA	NA	NA
WP_000690668.1\|50498_51050_+	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	3.2e-43	53.3
WP_085313393.1\|51062_54044_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.1e-257	45.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP020750

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP020750_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP020750_1

8527-8610

Orphan

Consensus_repeat	Method
AAAAAAAGATACATTTATCCTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP020750_1

>merge|NZ_CP020750|1|8527-8610|CRISPRCasFinder
AAAAAAAGATACATTTATCCTTTTACTTTTTGTACAAGCCCATGTTATTATCAATTCGAGAATAAAAAGATAAAAAGATACATT

>NZ_CP020750|1|1|8527-8610|CRISPRCasFinder
AAAAAAAGATACATTTATCCTTT	TACTTTTTGTACAAGCCCATGTTATTATCAATTCGAGA
ATAAAAAGATAAAAAGATACATT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP020750.1\|WP_085313718.1\|9871_10156_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020750.1\|WP_085313724.1\|13300_18034_-\|phage-tail-protein	unknown	unknown	gnl\|CDD\|273743
NZ_CP020750.1\|WP_085313713.1\|2580_3807_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020750.1\|WP_085313711.1\|1380_1578_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP020750.1\|WP_085313725.1\|18033_19512_-\|phage-tail-family-protein	unknown	unknown	gnl\|CDD\|188159
NZ_CP020750.1\|WP_085313716.1\|6394_7066_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020750.1\|WP_085313715.1\|4999_6133_+\|excalibur-calcium-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|377566
NZ_CP020750.1\|WP_085313712.1\|1791_2139_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP020750.1\|WP_085313723.1\|13029_13263_-\|hemolysin-XhlA-family-protein	unknown	unknown	gnl\|CDD\|371241
NZ_CP020750.1\|WP_085313778.1\|9587_9839_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020750.1\|WP_085313722.1\|12788_13028_-\|holin	unknown	unknown	unknown
NZ_CP020750.1\|WP_085313720.1\|10991_11246_-\|DNA-binding-protein	unknown	unknown	gnl\|CDD\|378935
NZ_CP020750.1\|WP_170972591.1\|2144_2282_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020750.1\|WP_170972590.1\|2428_2584_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020750.1\|WP_085313721.1\|11727_12792_-\|N-acetylmuramoyl-L-alanine-amidase	unknown	unknown	gnl\|CDD\|133475
NZ_CP020750.1\|WP_085313717.1\|8656_9604_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|379293
NZ_CP020750.1\|WP_085313714.1\|4366_4684_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP020750.1\|WP_085313710.1\|520_1315_-\|phage-antirepressor-KilAC-domain-containing-protein	unknown	unknown	gnl\|CDD\|226144
NZ_CP020750.1\|WP_172805494.1\|269_494_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020750.1\|WP_085313719.1\|10309_10900_-\|DUF3967-domain-containing-protein	unknown	unknown	gnl\|CDD\|379171

Protein	Function_ID	Function_description	E-value
NZ_CP020750.1\|WP_085313719.1\|10309_10900_-\|DUF3967-domain-containing-protein	gnl\|CDD\|379171	pfam13411, MerR_1, MerR HTH family regulatory protein.	1.66733e-08
NZ_CP020750.1\|WP_085313724.1\|13300_18034_-\|phage-tail-protein	gnl\|CDD\|273743	TIGR01665, structural_protein, phage minor structural protein, N-terminal region. This model represents the conserved N-terminal region, typically from about residue 25 to about residue 350, of a family of uncharacterized phage proteins 500 to 1700 residues in length. [Mobile and extrachromosomal element functions, Prophage functions].	3.47304e-47
NZ_CP020750.1\|WP_085313711.1\|1380_1578_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	3.96239e-12
NZ_CP020750.1\|WP_085313725.1\|18033_19512_-\|phage-tail-family-protein	gnl\|CDD\|188159	TIGR01633, unnamed_protein_product, putative phage tail component, N-terminal domain. This model represents the best-conserved region of about 125 amino acids, toward the N-terminus, of a family of proteins from temperate phage of a number of Gram-positive bacteria. These phage proteins range in length from 230 to 525 amino acids. [Mobile and extrachromosomal element functions, Prophage functions].	4.48547e-36
NZ_CP020750.1\|WP_085313715.1\|4999_6133_+\|excalibur-calcium-binding-domain-containing-protein	gnl\|CDD\|377566	pfam05901, Excalibur, Excalibur calcium-binding domain. Extracellular Ca2+-dependent nuclease YokF from Bacillus subtilis and several other surface-exposed proteins from diverse bacteria are encoded in the genomes in two paralogous forms that differ by a ~45 amino acid fragment, which comprises a novel conserved domain. Sequence analysis of this domain revealed a conserved DxDxDGxxCE motif, which is strikingly similar to the Ca2+-binding loop of the calmodulin-like EF-hand domains, suggesting an evolutionary relationship between them. Functions of many of the other proteins in which the novel domain, named Excalibur (extracellular calcium-binding region), is found, as well as a structural model of its conserved motif are consistent with the notion that the Excalibur domain binds calcium. This domain is but one more example of the diversity of structural contexts surrounding the EF-hand-like calcium-binding loop in bacteria. This loop is thus more widespread than hitherto recognized and the evolution of EF-hand-like domains is probably more complex than previously appreciated.	1.94378e-16
NZ_CP020750.1\|WP_085313712.1\|1791_2139_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.46558e-08
NZ_CP020750.1\|WP_085313720.1\|10991_11246_-\|DNA-binding-protein	gnl\|CDD\|378935	pfam12728, HTH_17, Helix-turn-helix domain. This domain is a DNA-binding helix-turn-helix domain.	0.00398529
NZ_CP020750.1\|WP_085313721.1\|11727_12792_-\|N-acetylmuramoyl-L-alanine-amidase	gnl\|CDD\|133475	cd06583, PGRP, Peptidoglycan recognition proteins (PGRPs) are pattern recognition receptors that bind, and in certain cases, hydrolyze peptidoglycans (PGNs) of bacterial cell walls. PGRPs have been divided into three classes: short PGRPs (PGRP-S), that are small (20 kDa) extracellular proteins; intermediate PGRPs (PGRP-I) that are 40-45 kDa and are predicted to be transmembrane proteins; and long PGRPs (PGRP-L), up to 90 kDa, which may be either intracellular or transmembrane. Several structures of PGRPs are known in insects and mammals, some bound with substrates like Muramyl Tripeptide (MTP) or Tracheal Cytotoxin (TCT). The substrate binding site is conserved in PGRP-LCx, PGRP-LE, and PGRP-Ialpha proteins. This family includes Zn-dependent N-Acetylmuramoyl-L-alanine Amidase, EC:3.5.1.28. This enzyme cleaves the amide bond between N-acetylmuramoyl and L-amino acids, preferentially D-lactyl-L-Ala, in bacterial cell walls. The structure for the bacteriophage T7 lysozyme shows that two of the conserved histidines and a cysteine are zinc binding residues. Site-directed mutagenesis of T7 lysozyme indicates that two conserved residues, a Tyr and a Lys, are important for amidase activity.	2.76987e-21
NZ_CP020750.1\|WP_085313723.1\|13029_13263_-\|hemolysin-XhlA-family-protein	gnl\|CDD\|371241	pfam10779, XhlA, Haemolysin XhlA. XhlA is a cell-surface associated haemolysin that lyses the two most prevalent types of insect immune cells (granulocytes and plasmatocytes) as well as rabbit and horse erythrocytes. This family has had DUF1267, pfam06895, merged into it.	7.11416e-08
NZ_CP020750.1\|WP_085313717.1\|8656_9604_+\|AAA-family-ATPase	gnl\|CDD\|379293	pfam13614, AAA_31, AAA domain. This family includes a wide variety of AAA domains including some that have lost essential nucleotide binding residues in the P-loop.	2.03757e-37
NZ_CP020750.1\|WP_085313710.1\|520_1315_-\|phage-antirepressor-KilAC-domain-containing-protein	gnl\|CDD\|226144	COG3617, COG3617, Prophage antirepressor [Transcription].	8.44632e-38
NZ_CP020750.1\|WP_085313714.1\|4366_4684_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	5.97727e-16

>NZ_CP020750.1|WP_085313716.1|6394_7066_-|hypothetical-protein
MTNSLIDKNWIDDFIKTDTFSEALGMVWRNGYDKLGYFYFTHKSKDIVMRFSSFFGVKTRSRYRKEKGYTEWYCIFRSDHAFVLKINELGWNPIKEKSRPFPNGEFNKEIFVKTYILMRHDLGTIKEKKPKNKVYVRPRLRIHGSTDILEHLNEFMYEELGIKKKKLQTDGKIPKAKTLYFQSYKDIESILKYIGASETLETLYSFDLGFHDAQEFEETHLQK
>NZ_CP020750.1|WP_085313715.1|4999_6133_+|excalibur-calcium-binding-domain-containing-protein
MGKNKKEQKPSERELATQAIAKKYQEEFGITPIIVSANLPKMQPGYAAVTKEHIQIFKYDKTANGIVSISTYELSNYVSVNVDHYAVKAVFEFKGVNDTFTFIPVGKGKDIEQLIRTNTNIEIHKTERKWYQKILGFRSGNKAKMIIASLLYLVVVVSIFNTVTGKKEENKQEVKPAVTTNTAPVKEEKQVEPKSVEQPVDKKQEKINKFKDDTQKQLTETYKKIDGVNPKMDISEDGKLITIAFDLDAYAKYDKVDKSLSVSTFQAAIGPYERYKGEAFRAYGKDANIASKTDIAVKVVDSSNGEVIIENIGVSKEPLRMPKNTQQNEGTDQNLDTTVTYANCTEVRKAGKAPIKQGEPGYSKKLDKDGDGIACDK
>NZ_CP020750.1|WP_085313714.1|4366_4684_+|helix-turn-helix-transcriptional-regulator
MLGEQLVHLRKKQGLTQNDIAYRLNVARSTYTNWEAGRAEPDLKTLIDIANIYNVSLDNLVGRTYRMPPQFEVILDQISDLDTEPQKKALNLLVEYTYLIKKYFM
>NZ_CP020750.1|WP_085313713.1|2580_3807_-|hypothetical-protein
MDQTPIQKQKELERKRLMKFLSALIDEIDFQRRNQEDVAKELGIKGGSLSKNLSGKSQFNFWNMIKLLNILYDADVLKKKEMLHRFCIVTKSKQNMRIAMEYANAKGDLELLKLVVDKEKTSSLAINREWAYVYELVWMRSKGVVSGKALLEKLEDRKSSKVIKTQEMKVLYGILTFYTMYDLEKFNSLFEYAEVLQPEVEEIPDDFIRTAYSGRIKEGLSYAYLMQDNVEKSRELCHEILHLKDDKNCFSLLRASALVYLAESYTFESYERASWYITKSLEMLSDCHFERAIKRRENILNTHAFIKLVHNLELNDIQIFHPAEDAFLEIRKGNYKLAENILNGIKKERGYLVAIEYTYLGLATNDVGLIEKSISMFECEGNRFYCKFPRKMLVEFNKDGIIYMGDAK
>NZ_CP020750.1|WP_170972590.1|2428_2584_-|hypothetical-protein
MKKVLSLITSVALAGGFLFAPADNQKEQPKQVAKNAPIIMYQNEGPGGGMG
>NZ_CP020750.1|WP_170972591.1|2144_2282_-|hypothetical-protein
MEKLESKAVVDKFGDVLKEVMNSAEKGDSVSYDILSEIKKAIGSN
>NZ_CP020750.1|WP_085313712.1|1791_2139_+|helix-turn-helix-transcriptional-regulator
MDYKLISRRVKEIRTDLQLSQREFAEALGMQSRSAVSMWENEDSTKCPSKKMSLEIAKLANVSVSYVLGESNEKNPDVAAKDEWERLMMQVKTKSPKKQKELLDLITNLVKISGD
>NZ_CP020750.1|WP_085313711.1|1380_1578_-|helix-turn-helix-transcriptional-regulator
MKLNTEKIRELRLSKGFTQVEVAKTMGYTNRNSYSQVETGKREPNLHRLSLLAGLYDVTLDELTR
>NZ_CP020750.1|WP_085313710.1|520_1315_-|phage-antirepressor-KilAC-domain-containing-protein
MNQLQVFNNKEFGQVRTVVQGEDAWFVAKDVSDILGFSEASSMTRTLDEDEKGLHNIQTVQGVQKLTVINESGLYSSILRSRKPQAKAFKKWVTSEVLPSIRKHGAYMTPSTINALLQDPDLIIGLASQLKNEQQARQVAEQKNLMLTQQIAENASKITYLDQILQSQDTVTVSQVAADYGLSAVRLNKILNDEKVQYKVNKQWLLYSKYQNKGYTKSQTVDVIHTDGSRSVKMNTRWTQKGRLFIHEVLMKHGIIPEMDREAV
>NZ_CP020750.1|WP_172805494.1|269_494_-|hypothetical-protein
MHGVGGSHIIQRIRVFDGSDRQKVYEGGTKMTNKVEVAQVLLERISELTKVCNDAETALVIKDLSEARHILLNS
>NZ_CP020750.1|WP_085313717.1|8656_9604_+|AAA-family-ATPase
MKKGYVIINAQQKGGVGKTTDSCMESLVASLIFNKKVLFIDTDLQGNGTTFLAKSFNITEMQKTLMKCLEEGDLSSGVVQLHENLDMIPCGYDMRKYTDFLIENFNTIEDRTFYLSRLLEKIKFNYDYIFIDIPPSTDLKVDNAMVASDYIIVVQETQQFSYEGSQRLIFEYIQTLVDDFGSLVKMQVAGVLPVLLQQKRALHKEIVKSTITTFGEENVFTTIINNHARLEWYPRIGLQFEDHHDKRMLALFCDIFCELEERIHLFETEGDIEAGYRYTPRYLVDNKLTKLGKGIDISGFNQKGNTARTEDSTIC
>NZ_CP020750.1|WP_085313778.1|9587_9839_+|hypothetical-protein
MAQSANTERNFQTDSSPEKKSMKAHERKNIKVSPETFSKIKTICTMKSMKNYEFIDEILEFYITNNLTEREQRILKNITSNSK
>NZ_CP020750.1|WP_085313718.1|9871_10156_+|hypothetical-protein
MENKNNSFVVTVTPITDSLDSNTEMKLQTPEKKNFKNQQGSIKVSSQSKEELEALIKLTNAKYAHEIIDLLIESYVENELTLEQKRKFKLLTEL
>NZ_CP020750.1|WP_085313719.1|10309_10900_-|DUF3967-domain-containing-protein
MTDEIVYSASEVYKRLGISDSTLRKYMEVLQREGFVVKKDNRGRRQYTDSDIMVIEKLIELSKHDGMTLEKAAKMIAQQIEKVNPDLIKEEPEDTSLIPFHIQEQLQQQYNVMAQEMNQSMLAMEKRLSEQAERSSEEIKESIDQHNERVEKRLEARDETLMKTLREMQEAKRMMQEFRDEVAAAKEKKKPWWKFW
>NZ_CP020750.1|WP_085313720.1|10991_11246_-|DNA-binding-protein
MATYQFNSKEELMRFMENDIVTVTEASELMGFSRQRFNKLVSEGRLIPIMKAKSKKSPNLFLRSDVEQLHQELKELRGKYRPYE
>NZ_CP020750.1|WP_085313721.1|11727_12792_-|N-acetylmuramoyl-L-alanine-amidase
MKKTIKLASSVFMTLLLLLSFATGAFADRTLIIPDLPKQPYRYGVGAYEGVVAHSTATPEAPAINIQKYETRTWRNAFVHYAVDWNETIQIADTKYIAYGGGPGANKRFVHVELCETADYDKFKRSYDKYVKLLAKILRDRGLSVEKGLWTHYDVTKYLGGTDHEDPLDYLRSHGVSEAQFRADVQRAYNNSSVEVSVPEKPSKPAEVPTAVTDGVAYIEGKNVNLRKGPDTSYSKIRQLNKPESYVVWAEKDGWLNLGGEQWIKNDPSYVKFDKKSTVDSSIVGKRVLSKVDNLRFYDSASWSDKDVAGSVDVGLGFTIDAKINVNGSPQYKVHNSKGKTYYVTANEAYVYVK
>NZ_CP020750.1|WP_085313722.1|12788_13028_-|holin
MVEVSVIIAVVVALSQVAKMLGLQTKYIPLLNLTLGILLGVLFLPFDIKMNVFQGIIIGLSASGLYDHSKITKKDVDNK
>NZ_CP020750.1|WP_085313723.1|13029_13263_-|hemolysin-XhlA-family-protein
MHEIQDLKQEIQQIKSDQKDMQRDIRNLETRTTVNEKDIVNITKLLDKIGANTTWILRIIIGAIVTALIGVLLKGGV
>NZ_CP020750.1|WP_085313724.1|13300_18034_-|phage-tail-protein
MRKPSGDLHIVDYKTRRVIATIQPEDYIEDLRHWEIKNSVDILDFKVLESSPYAVYLQQQNLVLKEVRSGVIVPYVITEIEKDSASHLITVYASGEWTLLDKDSYFVPQRLESWTAKQYLDFATARTEWLVGNLEAKGTRTHTIKEFTSPLKLIHDASTLFDNMETQYRVIIQGGEITKKYIDLVEKRGRETGKEVTLGKDLLGVKRVENSENIITALVPYVMGQDEDGKDKFITIESVNNGLQYIVDEDAYQRWNVNGKHLFGFYTPETEDQDMTPQRLLTLAKTELRKRVQTIVTYEVDAVDASHVFGLDHEQINEGDTITIIDRGMNPPLYLEARAIAGDESHKDPRQNKYTFGNYREIVNQDDALRRMYQKMLTMVQDKVSKEWFDALEEKVTETNNKVDTAVKESQAAKDLAEATKDYMEQNLVDIIESVNPPTANLNPNKTLWRDISGGKPGILKIWTGTAWESVVPDTGPLQKSIKDAENEINTLKETVKDIPDKTWLNQQLEGKADKSGVYMKDYIDQNVVGKQIYETDKQGNIKNFTDLRTDVDRNAQEITNKAEKTVVNQLGNDLASVSQTANTAKQNAEGNTQTITQLDTRFKGMKIGRNNLIENSGNFSDTSKWIANNTGATVEVATEDGFKCLKVKGTAKQSISYKLKPSTEYVFSAEIKLPIDHTMTVSSPLHCWTTIGTNPHTATKAVITPANNSIIQAGIWARVAISIKTLAEGETTFTPFLYSNELTTAMQYSYIKYMQILEGNKLIEDWTPPASELVSTGEFTKKTNEIINTVGENSQTISKVQQDQGTMQSTLNQVKQTTDLNSQNITTLTQTQGQQGPIIQQNTSDITQLNNQIKSKVTDIQMQDYVGGLGSTNVLFNAAFEDRVINATTGIVTSRTPSTTKWSVVGTGSGITIVPESARHHDGYNSVKITATGQTASKWSGIMQRVPAVQNGGDYVFSAWVYVQDKNTLDGGGAIKLQFFNGANAVSTFAQTEIKELLVNNSWTLVSVKITAPNLAITHLQGDIWVRQNGTMWVAQPQLQQGSTRSTFMENPKDYANYDQLVGEVAKKVATSDFNSKVSTIETSINQQSKSIELKAEKTDVYTKTEANGQFGSKAIVDTHTSTLSVMSDEINLRVKSGDVASTINQTAQSVLIQADKIYLNGYIEAKHLKAQTLQGVTIQTAPAGSGANQIRLNAQNMTLHGSGQARGYLGFINRTDSNITSALILGNDYTSAGSLDGSLVIDQTTITGNQWTNSVASIGIATGRNGNDIAKKSYINFYRYNGNMDIRSEGSMELFTSNGDIEIDASSSGSLHGFVNIKASKDIDMFAKRGQYRFFTSDNLSMPAMTLVDRNPTSSGDVDLTLGNLIMFRISRDINYIGDGIQLKSAMGDAFRDMKLRTLRAIENISAQGRMYALEFVPTSTRKIKTNIEDLPFSALEKVNSVSIKCYNLISDVEKYNAGEIDALPVNYGMIAEDTDGVFTTPEKNAVTLYSSVSISMQAIQEVDVKVNQNTINLNSIVESLRNTDTRVDELEKELEVQKLREVDQEKRITDLEELVQKMINGAPITENTTQTEQP
>NZ_CP020750.1|WP_085313725.1|18033_19512_-|phage-tail-family-protein
MPSGSFSFNGIRKDYIFILMGFSRPAWSPVERDILKVPSKAGGYLLQTNTDVRTIEVPVIIKAGSQSEMQKKKEDLADWLVTDQPCELIFDDEPDRTYMAVIDGEAEIEELIFRGKGKITFVCPMPYKLGANQTKTMSIQNQDLKSSFDNKGTVETIPVIDIEVLNPSPFLDVWNKDEYFRLGYPTGVKTRVVKQNERLIWDEMTSLTPWNAVTGQIGIYKSSGTMKVWQGYAFTPDSYGTGTDTEWHGPFMKRTIPNTGGVIQDFRLDVQMNFQSEHWNRMGKTVVMLLDANDNVIVELAMADEYMSHEMTTAQAIIDSGGVRKWIADETGMYRDTFNDFRGHVSLARRGKEWSFYFAKYRKNTEIDDASFVRTWRDESDSNPMTARPVAKVAIGCIAYGANPPADITLIEDVKFWRINTLNIDETPYIFDVGDKVRIDTERSLVTINGKNAIGLKDIFSTFPTVKRGQNDIIVRPSNIGIAQIAYRERYK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP020750_1	1.1\|8550\|38\|NZ_CP020750\|CRISPRCasFinder	8550-8587	38	NZ_CP020750	Bacillus mycoides strain Gnyt1 plasmid unnamed7, complete sequence	8550-8587	0	1.0
NZ_CP020750_1	1.1\|8550\|38\|NZ_CP020750\|CRISPRCasFinder	8550-8587	38	NZ_CP033790	Bacillus sp. FDAARGOS_527 plasmid unnamed3, complete sequence	2836-2873	3	0.921

1. spacer 1.1|8550|38|NZ_CP020750|CRISPRCasFinder matches to NZ_CP020750 (Bacillus mycoides strain Gnyt1 plasmid unnamed7, complete sequence) position: , mismatch: 0, identity: 1.0

tactttttgtacaagcccatgttattatcaattcgaga	CRISPR spacer
tactttttgtacaagcccatgttattatcaattcgaga	Protospacer
**************************************

2. spacer 1.1|8550|38|NZ_CP020750|CRISPRCasFinder matches to NZ_CP033790 (Bacillus sp. FDAARGOS_527 plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.921

tactttttgtacaagcccatgttattatcaattcgaga	CRISPR spacer
tactttttgtacaagcacgtgttattatcaattcgaaa	Protospacer
**************** *.*****************.*

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

115 : 50939

Bacillus_phage(78.33%)

terminase,holin,portal,capsid,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_172805495.1\|115_253_-	hypothetical protein	A0A1B1P8A8	Bacillus_phage	6.8e-11	75.0
WP_172805494.1\|269_494_-	hypothetical protein	NA	NA	NA	NA
WP_085313710.1\|520_1315_-	phage antirepressor KilAC domain-containing protein	A0A0B5A507	Paenibacillus_phage	1.1e-68	52.3
WP_085313711.1\|1380_1578_-	helix-turn-helix transcriptional regulator	A0A1B1P8C7	Bacillus_phage	8.9e-28	95.4
WP_085313712.1\|1791_2139_+	helix-turn-helix transcriptional regulator	A0A1B1P8C2	Bacillus_phage	5.4e-52	94.8
WP_170972591.1\|2144_2282_-	hypothetical protein	A0A0S2MVE3	Bacillus_phage	3.0e-14	88.9
WP_170972590.1\|2428_2584_-	hypothetical protein	A0A1B1P8B4	Bacillus_phage	1.8e-12	73.1
WP_085313713.1\|2580_3807_-	hypothetical protein	A0A1B1P895	Bacillus_phage	2.1e-207	90.0
WP_085313714.1\|4366_4684_+	helix-turn-helix transcriptional regulator	A0A0A7AQV8	Bacillus_phage	4.0e-46	91.9
WP_085313715.1\|4999_6133_+	excalibur calcium-binding domain-containing protein	A0A0A7AR49	Bacillus_phage	5.3e-40	46.6
WP_085313716.1\|6394_7066_-	hypothetical protein	A0A0A7AR45	Bacillus_phage	9.1e-40	43.7
WP_085313717.1\|8656_9604_+	AAA family ATPase	F0PIG8	Enterococcus_phage	2.9e-31	35.4
WP_085313778.1\|9587_9839_+	hypothetical protein	NA	NA	NA	NA
WP_085313718.1\|9871_10156_+	hypothetical protein	NA	NA	NA	NA
WP_085313719.1\|10309_10900_-	DUF3967 domain-containing protein	A0A1Z1LZN4	Bacillus_phage	2.3e-10	35.7
WP_085313720.1\|10991_11246_-	DNA-binding protein	A0A2H4JDR0	uncultured_Caudovirales_phage	9.7e-11	43.2
WP_085313721.1\|11727_12792_-	N-acetylmuramoyl-L-alanine amidase	A0A1B1P878	Bacillus_phage	2.3e-194	93.5
WP_085313722.1\|12788_13028_-\|holin	holin	A0A0A7AR38	Bacillus_phage	6.1e-23	73.4
WP_085313723.1\|13029_13263_-	hemolysin XhlA family protein	A0A1B1P887	Bacillus_phage	1.3e-25	84.4
WP_085313724.1\|13300_18034_-\|tail	phage tail protein	D2XR28	Bacillus_phage	0.0e+00	51.5
WP_085313725.1\|18033_19512_-\|tail	phage tail family protein	A0A1B1P894	Bacillus_phage	8.5e-264	88.6
WP_085313726.1\|22621_23269_-	hypothetical protein	D2XPZ3	Bacillus_virus	2.9e-59	56.9
WP_085313727.1\|23268_23670_-	DUF1892 domain-containing protein	A0A1B1P876	Bacillus_phage	1.1e-40	66.9
WP_085313779.1\|23765_24203_-\|capsid	capsid protein	I1TLE8	Bacillus_phage	2.6e-43	60.8
WP_085313728.1\|24228_24651_-\|capsid	minor capsid protein	A0A1B1P879	Bacillus_phage	4.2e-59	80.0
WP_085313729.1\|24661_25012_-\|capsid	minor capsid protein	A0A1B1P872	Bacillus_phage	1.8e-47	75.0
WP_085313730.1\|25008_25344_-\|capsid	minor capsid protein	A0A1B1P893	Bacillus_phage	4.7e-21	46.4
WP_085313731.1\|25336_25738_-	hypothetical protein	A0A1B1P889	Bacillus_phage	1.5e-29	52.3
WP_085313732.1\|25746_26025_-	hypothetical protein	A0A1B1P891	Bacillus_phage	9.6e-20	88.9
WP_085313733.1\|26077_26980_-\|capsid	capsid protein	A0A1B1P885	Bacillus_phage	1.0e-163	96.0
WP_085313734.1\|27006_27639_-	hypothetical protein	A0A1B1P865	Bacillus_phage	3.4e-81	88.6
WP_085313735.1\|27650_28772_-\|capsid	phage minor capsid protein	B5LPR2	Bacillus_virus	3.8e-192	94.6
WP_085313736.1\|28771_30274_-\|portal	phage portal protein	A0A1B1P863	Bacillus_phage	5.2e-245	87.2
WP_085313737.1\|30286_31564_-\|terminase	PBSX family phage terminase large subunit	D2XPX9	Bacillus_virus	2.4e-222	84.7
WP_085313738.1\|31544_32333_-	hypothetical protein	D2XPX8	Bacillus_virus	6.6e-114	86.8
WP_085313739.1\|32383_32614_-	hypothetical protein	A0A1B1P862	Bacillus_phage	6.5e-22	78.6
WP_085313740.1\|32600_32972_-	hypothetical protein	A0A0A7AQ61	Bacillus_phage	6.4e-27	68.8
WP_085313741.1\|33011_33260_-	hypothetical protein	NA	NA	NA	NA
WP_085313742.1\|33859_34084_-	hypothetical protein	A0A0A7AR10	Bacillus_phage	3.7e-06	62.2
WP_085313743.1\|34176_34560_-	hypothetical protein	A0A1B1P874	Bacillus_phage	4.1e-53	85.8
WP_085313780.1\|34587_34797_-	hypothetical protein	NA	NA	NA	NA
WP_157404967.1\|34918_35134_-	hypothetical protein	NA	NA	NA	NA
WP_085313746.1\|36152_36350_-	hypothetical protein	NA	NA	NA	NA
WP_085313747.1\|36388_36772_-	ArpU family transcriptional regulator	A0A1B1P853	Bacillus_phage	4.4e-23	44.1
WP_085313748.1\|36911_37100_-	hypothetical protein	B5LPP9	Bacillus_virus	3.9e-17	65.6
WP_085313749.1\|37113_37536_-	DUF1064 domain-containing protein	A0A1B1P859	Bacillus_phage	4.1e-70	90.7
WP_172805496.1\|37552_37726_-	hypothetical protein	A0A1B1P875	Bacillus_phage	6.4e-22	87.7
WP_085313751.1\|37755_38178_-	hypothetical protein	NA	NA	NA	NA
WP_085313752.1\|38280_38514_-	hypothetical protein	NA	NA	NA	NA
WP_085313781.1\|38550_38757_-	hypothetical protein	NA	NA	NA	NA
WP_085313753.1\|39002_39401_-	hypothetical protein	A0A2H4J3B9	uncultured_Caudovirales_phage	5.8e-18	61.1
WP_085313755.1\|39846_40257_-	hypothetical protein	W8CYU3	Bacillus_phage	1.2e-34	55.1
WP_085313756.1\|40285_40690_-	hypothetical protein	H0USU9	Bacillus_phage	1.0e-49	73.1
WP_085313757.1\|40726_40969_-	hypothetical protein	A0A1B1P7A3	Bacillus_phage	6.4e-36	82.1
WP_085313758.1\|40989_41358_-	spore protein H	NA	NA	NA	NA
WP_085309233.1\|41528_41894_-	hypothetical protein	A0A0A7AR03	Bacillus_phage	4.1e-34	61.2
WP_085313759.1\|41933_42437_-	deoxyuridine 5'-triphosphate nucleotidohydrolase	A0A0U3SLD3	Bacillus_phage	5.2e-48	62.9
WP_085313760.1\|42414_42624_-	hypothetical protein	A0A1B1P8E4	Bacillus_phage	3.6e-27	93.7
WP_085313761.1\|42636_42888_-	glutaredoxin family protein	A0A0U3TI10	Bacillus_phage	2.8e-18	53.0
WP_085313762.1\|42972_43206_-	hypothetical protein	NA	NA	NA	NA
WP_085313763.1\|43273_43468_-	hypothetical protein	A0A1B1P7U9	Bacillus_phage	1.3e-18	71.9
WP_085313764.1\|43464_43974_-	hypothetical protein	A0A0A7RWK2	Clostridium_phage	3.1e-08	29.7
WP_085313765.1\|43960_44104_-	Fur-regulated basic protein FbpA	NA	NA	NA	NA
WP_085313766.1\|44740_45190_-	nucleoside permease	A0A1B1P8B9	Bacillus_phage	4.9e-21	39.6
WP_085313767.1\|45201_45471_-	hypothetical protein	A0A0U3SU43	Bacillus_phage	5.3e-23	61.8
WP_085313768.1\|45467_45755_-	helix-turn-helix domain containing protein	A0A1B1P7W1	Bacillus_phage	8.2e-14	42.1
WP_085313769.1\|45723_45933_-	hypothetical protein	A0A1B1P8D7	Bacillus_phage	6.8e-18	70.7
WP_085313770.1\|45947_46706_-	ATP-binding protein	U5PWH5	Bacillus_phage	1.6e-37	40.3
WP_085313771.1\|46689_47559_-	phage replisome organizer N-terminal domain-containing protein	A0A218KCJ2	Bacillus_phage	1.7e-38	32.7
WP_085313772.1\|47559_47802_-	hypothetical protein	NA	NA	NA	NA
WP_172805497.1\|47802_47973_-	hypothetical protein	A0A1B1P897	Bacillus_phage	2.0e-07	42.0
WP_085313773.1\|47969_48935_-	recombinase RecT	A0A0C5AEC1	Paenibacillus_phage	9.4e-54	42.6
WP_046944911.1\|48927_49158_-	hypothetical protein	NA	NA	NA	NA
WP_085313774.1\|49150_50683_-	AAA family ATPase	A0A2I7SC81	Paenibacillus_phage	5.4e-80	38.4
WP_085313775.1\|50666_50939_-	hypothetical protein	A0A2H4J4P5	uncultured_Caudovirales_phage	2.3e-18	53.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP020744

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP020744_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP020744_1

63358-63471

Orphan

Consensus_repeat	Method
TCTCAACCTGCATTTGAAATTGGAGCCCCTGAAAAA	CRISPRCasFinder

1 spacers

csa3

The CRISPR arrays of NZ_CP020744_1

>merge|NZ_CP020744|1|63358-63471|CRISPRCasFinder
TCTCAACCTGCATTTGAAATTGGAGCCCCTGAAAAACCGGAACATGCAAAAACTGTTGAAAGATCAGAAGGTTCAGATTCTCAACCTGCATTTGAAATTGAAGCCCCTGAAAAA

>NZ_CP020744|1|1|63358-63471|CRISPRCasFinder
TCTCAACCTGCATTTGAAATTGGAGCCCCTGAAAAA	CCGGAACATGCAAAAACTGTTGAAAGATCAGAAGGTTCAGAT
TCTCAACCTGCATTTGAAATTGAAGCCCCTGAAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP020744.1\|WP_085313068.1\|60327_60747_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020744.1\|WP_085313072.1\|67379_67862_+\|PH-domain-containing-protein	unknown	unknown	unknown
NZ_CP020744.1\|WP_085313069.1\|61444_62203_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP020744.1\|WP_157404937.1\|57496_57628_-\|Phr-family-secreted-Rap-phosphatase-inhibitor	unknown	unknown	unknown
NZ_CP020744.1\|WP_157404939.1\|64507_64678_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020744.1\|WP_172805460.1\|57624_58719_-\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|376220
NZ_CP020744.1\|WP_085313079.1\|74365_74653_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020744.1\|WP_085313074.1\|68757_69120_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020744.1\|WP_085313070.1\|62536_62725_+\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|212463
NZ_CP020744.1\|WP_157404940.1\|69674_69785_+\|YjcZ-family-sporulation-protein	unknown	unknown	unknown
NZ_CP020744.1\|WP_085313067.1\|59415_59982_+\|plasmid-pRiA4b-ORF-3-family-protein	unknown	unknown	gnl\|CDD\|377943
NZ_CP020744.1\|WP_162862851.1\|64932_65094_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020744.1\|WP_085313065.1\|55795_56089_+\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP020744.1\|WP_085313073.1\|67887_68460_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274612
NZ_CP020744.1\|WP_085313063.1\|54944_55238_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020744.1\|WP_085313064.1\|55271_55697_+\|disulfide-bond-formation-protein-B	unknown	unknown	gnl\|CDD\|179540
NZ_CP020744.1\|WP_002105584.1\|64154_64313_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020744.1\|WP_085313326.1\|56894_57164_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020744.1\|WP_085313077.1\|71900_73910_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|283666
NZ_CP020744.1\|WP_085313078.1\|74000_74270_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP020744.1\|WP_085313065.1\|55795_56089_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	8.72107e-12
NZ_CP020744.1\|WP_085313073.1\|67887_68460_+\|hypothetical-protein	gnl\|CDD\|274612	TIGR03502, lipase_Pla1_cef, extracellular lipase, Pla-1/cef family. Members of this protein family are bacterial lipoproteins largely from the Gammaproteobacteria. Characterized members are expressed extracellularly and have esterase activity. Members include the lipase Pla-1 from Aeromonas hydrophila (AF092033) and CHO cell elongation factor (cef) from Vibrio hollisae.	0.00915825
NZ_CP020744.1\|WP_085313070.1\|62536_62725_+\|RNA-chaperone-Hfq	gnl\|CDD\|212463	cd01716, Hfq, bacterial Hfq-like. Hfq, an abundant, ubiquitous RNA-binding protein, functions as a pleiotropic regulator of RNA metabolism in prokaryotes, required for transcription of some transcripts and degradation of others. Hfq binds small RNA molecules called riboregulators that modulate the stability or translation efficiency of RNA transcripts. Hfq binds preferentially to unstructured A/U-rich RNA sequences and is similar to the eukaryotic Sm proteins in both sequence and structure. Hfq forms a homo-hexameric ring similar to the heptameric ring of the Sm proteins.	2.67244e-23
NZ_CP020744.1\|WP_085313064.1\|55271_55697_+\|disulfide-bond-formation-protein-B	gnl\|CDD\|179540	PRK03113, PRK03113, putative disulfide oxidoreductase; Provisional.	6.42257e-36
NZ_CP020744.1\|WP_172805460.1\|57624_58719_-\|tetratricopeptide-repeat-protein	gnl\|CDD\|376220	pfam18801, RapH_N, response regulator aspartate phosphatase H, N terminal. Rap proteins consist of a N-terminal 3-helix bundle and a tetratricopeptide domain. This entry represents the conserved region of the C-terminal bundle.	4.52988e-20
NZ_CP020744.1\|WP_085313069.1\|61444_62203_+\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	2.08227e-17
NZ_CP020744.1\|WP_085313067.1\|59415_59982_+\|plasmid-pRiA4b-ORF-3-family-protein	gnl\|CDD\|377943	pfam07929, PRiA4_ORF3, Plasmid pRiA4b ORF-3-like protein. Members of this family are similar to the protein product of ORF-3 found on plasmid pRiA4 in the bacterium Agrobacterium rhizogenes. This plasmid is responsible for tumorigenesis at wound sites of plants infected by this bacterium, but the ORF-3 product does not seem to be involved in the pathogenetic process. Other proteins found in this family are annotated as being putative TnpR resolvases, but no further evidence was found to back this. Moreover, another member of this family is described as a probable lexA repressor and in fact carries a LexA DNA binding domain (pfam01726), but no references were found to expand on this.	4.8605e-55
NZ_CP020744.1\|WP_085313077.1\|71900_73910_+\|hypothetical-protein	gnl\|CDD\|283666	pfam06054, CoiA, Competence protein CoiA-like family. Many of the members of this family are described as transcription factors. CoiA falls within a competence-specific operon in Streptococcus. CoiA is an uncharacterized protein.	0.00013155

>NZ_CP020744.1|WP_085313070.1|62536_62725_+|RNA-chaperone-Hfq
MFNLQEDMYEQLKEKKGKVTVFLKNGVPVRGQILATDKFTVLMMVDGKQQLIYKQAISTLAT
>NZ_CP020744.1|WP_085313069.1|61444_62203_+|alpha/beta-hydrolase
MTIQNKKIIDICDDRRLFNKYSRNSIPNVIFIAGLGDSYETWKKVQDRISQKTSTFSYNRSGIGRSQVASVPTTCYDLVEELNELLLALEVEKPYILVGHSFGGLVARLYASLYPLNICGMVLVDAAPEYKELAYEKVLPENLLAGNREYYENPMLNSEKIDKIQSYKQIVDHSKQSNLPLAIITRGLPDNGEEGWPSQEILEIDQRLQAEFQGLSTSSKYRIASRSGHYIHHDEPEIVIEEIMLMLKEMGK
>NZ_CP020744.1|WP_085313068.1|60327_60747_+|hypothetical-protein
MTGCGNDAELDAKNEGIKSLKAEINELQTQRQGANVGMSINSGEKITPISIHREDTNLPSCIDLDGFSDLRKGMTIEETYRTVQREASSGRTNSIDNQRTIEYEFRSGTGSKSIKINYKDSKMVRADYVDNEGNYKSIY
>NZ_CP020744.1|WP_085313067.1|59415_59982_+|plasmid-pRiA4b-ORF-3-family-protein
MKCYQLHLELVGCPFPIWRKVILPAKLTFDDLHDVIQCLFQWEHQHLFEFTVGKYVISAPPDPSISFSTLGMTTPSPMLHANKTMLFEHIKKKDQIFQYVYDFGDHWLLQIQVENILDQSSDEVTCIGGKNAAPLEDIGGIPGYLEFLEAIKNTSHPQHKLYSEWDLLDFDSSFFDIQEVNKGLAYCD
>NZ_CP020744.1|WP_172805460.1|57624_58719_-|tetratricopeptide-repeat-protein
MIVSEKGNNEITKILNEWYIEIRSRRIGNAHRLKEIIDSKIHNVEEDQNLLLYYSLLDFRYQFVIDNLSVSKSSFDKVETFAMPTDNFLAYYYHFFKGIHASTIGEYKIAKANYEKAETLLACIPDELEKAEFYYKVGAFHYDIYQGLLSYKRVTEARDIFAQHAGYEINVAFCDNLIGLACTHLREWELAEEYFTKAMDMFQKINEEQFILMVRQNLGLMYATQNLSSLAIRYLSEVNQKMPNNYKALFIEAREHMKEENYSVAKDLIAKGYSICEEVDNIEYLHHFKILDTMNADFPAEALERTVLEGVSYFTEQELFEYIKEYEENLATAFYKENNHVKASHYFYSSSQAGKKAFEKEALK
>NZ_CP020744.1|WP_157404937.1|57496_57628_-|Phr-family-secreted-Rap-phosphatase-inhibitor
MKKTFFGLVGVITIFTLMFGAQSPTETQKAIDVVQYAHGNHGG
>NZ_CP020744.1|WP_085313326.1|56894_57164_+|hypothetical-protein
MLIWQIVMYFFFPVTLLATFILTTKLPQRPSIKFIPAIVSLLFAVFSYSMFLYNNGMGEFMIALLSGCIALANLLLVIFVKLFARFLSS
>NZ_CP020744.1|WP_085313065.1|55795_56089_+|winged-helix-turn-helix-transcriptional-regulator
MTTVQNKKEMNQIPEADVELLKIMAHPVRLQIVKELNHHKICNVTQLTDLLKIPQSTVSQHLSKMRGKILRSERRGLEMYYHIENFKACQIVSVLGL
>NZ_CP020744.1|WP_085313064.1|55271_55697_+|disulfide-bond-formation-protein-B
MALIRKYHIAIAWMIATSAMLISLVFSEWMKLLPCDLCWYQRMAMYPLVLILGVGMYRKDPLVSTYAFPFALCGLLLAVYQITIQTFPASEMKICSVGVSCTENYLNLFGFITIPMLSFVGFLAIIILLYIKPVRETKNNK
>NZ_CP020744.1|WP_085313063.1|54944_55238_+|hypothetical-protein
MSQVAGFLKFVLAKEKRYVYLAVSEKRNKRVNTHILYKFGPMEKALESMYEMRDDFENSFPVELKEKGYDWEDVNDWILSIETGFSKHGNKLITYRR
>NZ_CP020744.1|WP_002105584.1|64154_64313_+|hypothetical-protein
MHKIIYGILILIYTLYSFFVSDGSEVRFIMVLTIVLIFSVVLEKGNANKTTD
>NZ_CP020744.1|WP_157404939.1|64507_64678_-|hypothetical-protein
MSNGTRNGIQSEPLPAFLTKEVGISESYLRKWCLELEKHEYTFIKVRDPKSNCRKT
>NZ_CP020744.1|WP_162862851.1|64932_65094_+|hypothetical-protein
MNIIHIETKNQYKSEKVNEMETIPIIKRVYYENGEIKFEISGEKKVPMAWLDK
>NZ_CP020744.1|WP_085313072.1|67379_67862_+|PH-domain-containing-protein
MATPKYTKIDERFGVIEYPVTLAEMVEISKELPKTERKYYQYAFDALKKVTKAKENIHYFEVADPKLTKTGFIVVGEHNLYLVMMKGGLFGGAEAELVKYKDIKEVDFDIIEGMFGISLMNTGIIYLEMKKMFGTKKRTIRNIPDYNVDGVLKAIRNKLK
>NZ_CP020744.1|WP_085313073.1|67887_68460_+|hypothetical-protein
MKRKLLTALACSALLMGMAACSSNEKTTTESKSSEPAYKKEETKPKEKLAFQDMTTDQYLQNYNKIKDELAGQNIQVLPFNLELEESTKTHRFYYTKAEDTTSEAKWVSVNLRRDGKTIDSMLYNGAPDLNTIKAMIKATGVTWSDKLDKMVEGKESNKDSENIVVDGVRISIYGSPTDINVSIDAPPSI
>NZ_CP020744.1|WP_085313074.1|68757_69120_+|hypothetical-protein
MVKTACVSIITGILLICSTGCATQTDSIAAKTQSIDGTYTTKDITDTFPVGTPITTYIQKEEKLNVKHLTSITLTDVGVGRVLEATDGFVVICGNEKGVFDVLIFKTMEDVKKYEQSLAL
>NZ_CP020744.1|WP_157404940.1|69674_69785_+|YjcZ-family-sporulation-protein
MGFGGSCGEGRGFAGGFALLVVLFILLIIIGCSCFC
>NZ_CP020744.1|WP_085313077.1|71900_73910_+|hypothetical-protein
MQYSYIECFDGWEKIFPSGNLIGFQKKRYIELDSMVIDNDKEAKYIRGRKSLYQAKCPICQDIMSFNKGSKIVNKNPYFFHLDKEQCFSFESLAHARTKKYLYELFNQAGYIVKEEKRHKDISRADVAVLQTVIGKEELKLAIEVQASNIRISNIVRRTNIYFEENVPTAWVLILDSFFPPKETEVNGEKVYTDSYSGTRISNFNPETNSYEYTYISPLKEEYFFVTGANNNAFNYLMDVYNVIVTVDHNGHVFLIRRTPESSKLRADALLENREHSTQDDIFLVNRIAESDIVPVLLETELLRATYRENDMKMNKHTQLNEEFKGQIHKSESHPTNVVDAAIEFDKARQIEEALNSIELARKTREEIKIAYTNKLLEIEQQKAEERRRQEETLGEQMAKDYMSNLYNQYEKAFSMLVERLETEKVQFHLSSIGNWYSWLNYLKEEKHKWYIVVKTLFKGFPTSFYSDNNDFEMYFNKEQNRYKNWIESRSLIEFVAELQQHYEQVTKNTTQKVFYKELLDKYGQKLDKVQKKEKIQREQEELRIRQEKIKKEEEERKHIRLQKEQLYKKQELLNKDYYEIPHLTENEIDDFRNQFWEEYICIPKKERTAYEKKYFPTFTAGLPKWFMSRKLRHEEKEIEAVNKQKSKKREHKENLKDNEDGFIQLKLL
>NZ_CP020744.1|WP_085313078.1|74000_74270_+|hypothetical-protein
MRLNKGERSLPVLLVYERDESGNLAVWCPYGATWHLHGQGDGHRSAHCQNMRSPFIETGYIIKKGSKKDYAFGRTYYDSYGNLDLKYRY
>NZ_CP020744.1|WP_085313079.1|74365_74653_+|hypothetical-protein
MGYSTLSIDFKNKVVVDKTKWKEIWDDCMEPDSFAEYVYIVIENAARRYKFKHDFEPEIYMFNLNSPYKVNLRLGNKKYILIMNPFDESQLVNAE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP020744_1	1.1\|63394\|42\|NZ_CP020744\|CRISPRCasFinder	63394-63435	42	NZ_CP020744	Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence	63394-63435	0	1.0
NZ_CP020744_1	1.1\|63394\|42\|NZ_CP020744\|CRISPRCasFinder	63394-63435	42	NZ_CP020744	Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence	63472-63513	4	0.905
NZ_CP020744_1	1.1\|63394\|42\|NZ_CP020744\|CRISPRCasFinder	63394-63435	42	AP022644	Bacillus wiedmannii PL1 plasmid pBwiPL1-1 DNA, complete sequence	210122-210163	7	0.833
NZ_CP020744_1	1.1\|63394\|42\|NZ_CP020744\|CRISPRCasFinder	63394-63435	42	NZ_CP016590	Bacillus thuringiensis strain KNU-07 plasmid pBTKNU07-02, complete sequence	189881-189922	7	0.833
NZ_CP020744_1	1.1\|63394\|42\|NZ_CP020744\|CRISPRCasFinder	63394-63435	42	NZ_CP020005	Bacillus thuringiensis strain Bacillus thuringiensis L-7601 plasmid unnamed3, complete sequence	57926-57967	7	0.833
NZ_CP020744_1	1.1\|63394\|42\|NZ_CP020744\|CRISPRCasFinder	63394-63435	42	NZ_CP020005	Bacillus thuringiensis strain Bacillus thuringiensis L-7601 plasmid unnamed3, complete sequence	58025-58066	7	0.833
NZ_CP020744_1	1.1\|63394\|42\|NZ_CP020744\|CRISPRCasFinder	63394-63435	42	NZ_CP029455	Bacillus cereus strain FORC087 plasmid pFORC087.1, complete sequence	1054-1095	7	0.833
NZ_CP020744_1	1.1\|63394\|42\|NZ_CP020744\|CRISPRCasFinder	63394-63435	42	NZ_CP029455	Bacillus cereus strain FORC087 plasmid pFORC087.1, complete sequence	1153-1194	7	0.833
NZ_CP020744_1	1.1\|63394\|42\|NZ_CP020744\|CRISPRCasFinder	63394-63435	42	CP024686	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-2-313K, complete sequence	233777-233818	7	0.833
NZ_CP020744_1	1.1\|63394\|42\|NZ_CP020744\|CRISPRCasFinder	63394-63435	42	CP024686	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-2-313K, complete sequence	233876-233917	7	0.833
NZ_CP020744_1	1.1\|63394\|42\|NZ_CP020744\|CRISPRCasFinder	63394-63435	42	CP046512	Bacillus cereus strain JHU plasmid p1, complete sequence	413194-413235	7	0.833
NZ_CP020744_1	1.1\|63394\|42\|NZ_CP020744\|CRISPRCasFinder	63394-63435	42	CP046512	Bacillus cereus strain JHU plasmid p1, complete sequence	413293-413334	7	0.833
NZ_CP020744_1	1.1\|63394\|42\|NZ_CP020744\|CRISPRCasFinder	63394-63435	42	NZ_CP045608	Bacillus cereus strain SB1 plasmid p2, complete sequence	274620-274661	8	0.81
NZ_CP020744_1	1.1\|63394\|42\|NZ_CP020744\|CRISPRCasFinder	63394-63435	42	NZ_CP013276	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-1-360K, complete sequence	320143-320184	8	0.81
NZ_CP020744_1	1.1\|63394\|42\|NZ_CP020744\|CRISPRCasFinder	63394-63435	42	NZ_CP039722	Bacillus thuringiensis strain BT-59 plasmid p1, complete sequence	97932-97973	8	0.81
NZ_CP020744_1	1.1\|63394\|42\|NZ_CP020744\|CRISPRCasFinder	63394-63435	42	NZ_CP009349	Bacillus thuringiensis HD1002 plasmid 1, complete sequence	36673-36714	8	0.81
NZ_CP020744_1	1.1\|63394\|42\|NZ_CP020744\|CRISPRCasFinder	63394-63435	42	NZ_CP045023	Bacillus thuringiensis strain JW-1 plasmid p1, complete sequence	320144-320185	8	0.81

1. spacer 1.1|63394|42|NZ_CP020744|CRISPRCasFinder matches to NZ_CP020744 (Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ccggaacatgcaaaaactgttgaaagatcagaaggttcagat	CRISPR spacer
ccggaacatgcaaaaactgttgaaagatcagaaggttcagat	Protospacer
******************************************

2. spacer 1.1|63394|42|NZ_CP020744|CRISPRCasFinder matches to NZ_CP020744 (Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.905

ccggaacatgcaaaaactgttgaaagatcagaaggttcagat	CRISPR spacer
tcggaacatgtaaaaactgttgaaagatcagaaggtacagac	Protospacer
.*********.************************* ****.

3. spacer 1.1|63394|42|NZ_CP020744|CRISPRCasFinder matches to AP022644 (Bacillus wiedmannii PL1 plasmid pBwiPL1-1 DNA, complete sequence) position: , mismatch: 7, identity: 0.833

ccggaacatgcaaaaactgttgaaagatcagaaggttcagat	CRISPR spacer
cctgagtttgcaaaaactgttgaaagaacagaaggtacagac	Protospacer
** **.. ******************* ******** ****.

4. spacer 1.1|63394|42|NZ_CP020744|CRISPRCasFinder matches to NZ_CP016590 (Bacillus thuringiensis strain KNU-07 plasmid pBTKNU07-02, complete sequence) position: , mismatch: 7, identity: 0.833

ccggaacatgcaaaaactgttgaaagatcagaaggttcagat	CRISPR spacer
cctgagtttgcaaaaactgttgaaagaacagaaggtacagac	Protospacer
** **.. ******************* ******** ****.

5. spacer 1.1|63394|42|NZ_CP020744|CRISPRCasFinder matches to NZ_CP020005 (Bacillus thuringiensis strain Bacillus thuringiensis L-7601 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.833

ccggaacatgcaaaaactgttgaaagatcagaaggttcagat	CRISPR spacer
ggaaaacatgcaaaaactgttgaaaaatcagaaggtacaggt	Protospacer
  ..*********************.********** ***.*

6. spacer 1.1|63394|42|NZ_CP020744|CRISPRCasFinder matches to NZ_CP020005 (Bacillus thuringiensis strain Bacillus thuringiensis L-7601 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.833

ccggaacatgcaaaaactgttgaaagatcagaaggttcagat	CRISPR spacer
ggaaaacatgcaaaaactgttgaaagaacagaaggtacaggt	Protospacer
  ..*********************** ******** ***.*

7. spacer 1.1|63394|42|NZ_CP020744|CRISPRCasFinder matches to NZ_CP029455 (Bacillus cereus strain FORC087 plasmid pFORC087.1, complete sequence) position: , mismatch: 7, identity: 0.833

ccggaacatgcaaaaactgttgaaagatcagaaggttcagat	CRISPR spacer
ggaaaacatgcaaaaactgttgaaaaatcagaaggtacaggt	Protospacer
  ..*********************.********** ***.*

8. spacer 1.1|63394|42|NZ_CP020744|CRISPRCasFinder matches to NZ_CP029455 (Bacillus cereus strain FORC087 plasmid pFORC087.1, complete sequence) position: , mismatch: 7, identity: 0.833

ccggaacatgcaaaaactgttgaaagatcagaaggttcagat	CRISPR spacer
ggaaaacatgcaaaaactgttgaaagaacagaaggtacaggt	Protospacer
  ..*********************** ******** ***.*

9. spacer 1.1|63394|42|NZ_CP020744|CRISPRCasFinder matches to CP024686 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-2-313K, complete sequence) position: , mismatch: 7, identity: 0.833

ccggaacatgcaaaaactgttgaaagatcagaaggttcagat	CRISPR spacer
ggaaaacatgcaaaaactgttgaaaaatcagaaggtacaggt	Protospacer
  ..*********************.********** ***.*

10. spacer 1.1|63394|42|NZ_CP020744|CRISPRCasFinder matches to CP024686 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-2-313K, complete sequence) position: , mismatch: 7, identity: 0.833

ccggaacatgcaaaaactgttgaaagatcagaaggttcagat	CRISPR spacer
ggaaaacatgcaaaaactgttgaaagaacagaaggtacaggt	Protospacer
  ..*********************** ******** ***.*

11. spacer 1.1|63394|42|NZ_CP020744|CRISPRCasFinder matches to CP046512 (Bacillus cereus strain JHU plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.833

ccggaacatgcaaaaactgttgaaagatcagaaggttcagat	CRISPR spacer
ggaaaacatgcaaaaactgttgaaagaacagaaggtacaggt	Protospacer
  ..*********************** ******** ***.*

12. spacer 1.1|63394|42|NZ_CP020744|CRISPRCasFinder matches to CP046512 (Bacillus cereus strain JHU plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.833

ccggaacatgcaaaaactgttgaaagatcagaaggttcagat	CRISPR spacer
ggaaaacatgcaaaaactgttgaaaaatcagaaggtacaggt	Protospacer
  ..*********************.********** ***.*

13. spacer 1.1|63394|42|NZ_CP020744|CRISPRCasFinder matches to NZ_CP045608 (Bacillus cereus strain SB1 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.81

ccggaacatgcaaaaactgttgaaagatcagaaggttcagat	CRISPR spacer
aaaggagatgcaaaaactgttgaaagaacagaaggtacaggt	Protospacer
  .*.* ******************** ******** ***.*

14. spacer 1.1|63394|42|NZ_CP020744|CRISPRCasFinder matches to NZ_CP013276 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-1-360K, complete sequence) position: , mismatch: 8, identity: 0.81

ccggaacatgcaaaaactgttgaaagatcagaaggttcagat	CRISPR spacer
aaaggagatgcaaaaactgttgaaagaacagaaggtacaggt	Protospacer
  .*.* ******************** ******** ***.*

15. spacer 1.1|63394|42|NZ_CP020744|CRISPRCasFinder matches to NZ_CP039722 (Bacillus thuringiensis strain BT-59 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.81

ccggaacatgcaaaaactgttgaaagatcagaaggttcagat	CRISPR spacer
aaaggagatgcaaaaactgttgaaagaacagaaggtacaggt	Protospacer
  .*.* ******************** ******** ***.*

16. spacer 1.1|63394|42|NZ_CP020744|CRISPRCasFinder matches to NZ_CP009349 (Bacillus thuringiensis HD1002 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.81

ccggaacatgcaaaaactgttgaaagatcagaaggttcagat	CRISPR spacer
aaaggagatgcaaaaactgttgaaagaacagaaggtacaggt	Protospacer
  .*.* ******************** ******** ***.*

17. spacer 1.1|63394|42|NZ_CP020744|CRISPRCasFinder matches to NZ_CP045023 (Bacillus thuringiensis strain JW-1 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.81

ccggaacatgcaaaaactgttgaaagatcagaaggttcagat	CRISPR spacer
aaaggagatgcaaaaactgttgaaagaacagaaggtacaggt	Protospacer
  .*.* ******************** ******** ***.*

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

152510 : 214491

Bacillus_phage(25.0%)

integrase,transposase,tRNA

attL 154734:154762|attR 216634:216662

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085313123.1\|152510_153230_-\|tRNA	tRNA-dependent cyclodipeptide synthase	NA	NA	NA	NA
WP_085313124.1\|154243_154438_+	hypothetical protein	NA	NA	NA	NA
154734:154762	attL	NA	NA	NA	NA
WP_085313125.1\|154900_155089_+	RNA chaperone Hfq	NA	NA	NA	NA
WP_085313126.1\|155133_155298_-	aspartyl-phosphate phosphatase Spo0E family protein	NA	NA	NA	NA
WP_172805461.1\|156002_156110_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_157404945.1\|156093_156906_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	4.7e-30	37.6
WP_085313127.1\|157310_159041_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.0e-10	40.5
WP_085313128.1\|159461_160283_-	polysaccharide deacetylase	NA	NA	NA	NA
WP_085313129.1\|160356_160863_-	DUF3902 family protein	NA	NA	NA	NA
WP_172805456.1\|161397_161559_-	hypothetical protein	NA	NA	NA	NA
WP_085313130.1\|161789_162344_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_085313131.1\|162490_163918_-	S-layer homology domain-containing protein	G3MAW8	Bacillus_virus	3.8e-27	43.6
WP_085313132.1\|164555_166205_+	S-layer homology domain-containing protein	NA	NA	NA	NA
WP_085312016.1\|167942_169247_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.2e-27	30.1
WP_085313133.1\|171005_172436_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_085313134.1\|172755_173208_-	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_085313135.1\|173212_173533_-	hypothetical protein	NA	NA	NA	NA
WP_016119277.1\|173692_174628_-	EamA family transporter	NA	NA	NA	NA
WP_085313136.1\|174724_175471_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_085313137.1\|175467_176208_-	2OG-Fe dioxygenase family protein	NA	NA	NA	NA
WP_085313138.1\|177579_178185_+	cupin domain-containing protein	Q2I8C5	Bacillus_phage	7.2e-52	66.9
WP_085313139.1\|178738_179749_-	sensor histidine kinase	NA	NA	NA	NA
WP_085313140.1\|179745_180417_-	response regulator transcription factor	NA	NA	NA	NA
WP_085313141.1\|180498_182484_-	ABC transporter permease	NA	NA	NA	NA
WP_001244401.1\|182473_183241_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.5e-33	38.4
WP_085313142.1\|183524_184007_-	PRK06770 family protein	G3MB13	Bacillus_virus	2.4e-10	38.4
WP_085313143.1\|184185_184413_-	hypothetical protein	NA	NA	NA	NA
WP_085313144.1\|184597_185008_-	DUF1878 family protein	NA	NA	NA	NA
WP_085313145.1\|185639_186959_-	septum formation initiator	NA	NA	NA	NA
WP_085313146.1\|187269_188145_-	L-serine ammonia-lyase, iron-sulfur-dependent, subunit alpha	NA	NA	NA	NA
WP_085313147.1\|188166_188865_-	L-serine ammonia-lyase, iron-sulfur-dependent, subunit beta	NA	NA	NA	NA
WP_085313148.1\|190029_190248_-	alpha/beta-type small acid-soluble spore protein	A0A1P8CX76	Bacillus_phage	2.3e-13	54.5
WP_085313149.1\|190589_190886_-	hypothetical protein	NA	NA	NA	NA
WP_085313150.1\|191106_192279_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_085313151.1\|192682_193684_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_085313152.1\|195656_195986_+	Lrp/AsnC ligand binding domain-containing protein	NA	NA	NA	NA
WP_085313153.1\|196240_196639_+\|transposase	IS200/IS605 family transposase	A0A286QN76	Streptococcus_phage	2.8e-52	69.7
WP_085313154.1\|196650_197763_+	helix-turn-helix domain-containing protein	A0A286QQB7	Streptococcus_phage	1.1e-79	46.3
WP_002191540.1\|198690_199908_-	MFS transporter	NA	NA	NA	NA
WP_085313155.1\|200052_200508_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_085313156.1\|200522_201551_-	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_085313157.1\|201561_202470_-	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_085313158.1\|202536_204552_-\|tRNA	class I tRNA ligase family protein	NA	NA	NA	NA
WP_002191545.1\|204568_205858_-	lysine N(6)-hydroxylase/L-ornithine N(5)-oxygenase family protein	NA	NA	NA	NA
WP_016102640.1\|205940_206849_-	arginase	A0A1V0SJM8	Klosneuvirus	7.3e-32	34.5
WP_085313159.1\|206991_208266_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_078205060.1\|208661_209009_-	cupin domain-containing protein	NA	NA	NA	NA
WP_085313160.1\|209817_210402_+	SCO family protein	NA	NA	NA	NA
WP_085313161.1\|211021_213385_-	DUF3472 domain-containing protein	NA	NA	NA	NA
WP_085313162.1\|214089_214491_-\|transposase	IS200/IS605 family transposase	Q332K6	Clostridium_botulinum_C_phage	1.3e-49	70.5
216634:216662	attR	NA	NA	NA	NA

DBSCAN-SWA_2

222638 : 273882

Bacillus_phage(33.33%)

integrase,transposase

attL 266087:266104|attR 279425:279442

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085313166.1\|222638_223346_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	3.9e-41	42.5
WP_085313167.1\|223564_223750_+	hypothetical protein	NA	NA	NA	NA
WP_002170592.1\|223922_224219_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_157404946.1\|224227_225109_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.5e-42	41.0
WP_085313168.1\|225179_225587_-	hypothetical protein	NA	NA	NA	NA
WP_172805463.1\|225858_226515_-	GAP family protein	NA	NA	NA	NA
WP_085313170.1\|226528_227287_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_002090702.1\|227398_227542_-	hypothetical protein	NA	NA	NA	NA
WP_085313171.1\|228116_228665_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_060749739.1\|228957_229146_-	RNA chaperone Hfq	NA	NA	NA	NA
WP_085313172.1\|229173_229509_-\|transposase	transposase	NA	NA	NA	NA
WP_085313173.1\|230145_230346_+	hypothetical protein	NA	NA	NA	NA
WP_085313174.1\|230387_231068_+	autotransporter	NA	NA	NA	NA
WP_085313175.1\|231088_231361_+	hypothetical protein	NA	NA	NA	NA
WP_085313176.1\|231741_233988_-	chitin-binding protein	NA	NA	NA	NA
WP_085313177.1\|234071_236312_-	hypothetical protein	G1FGA4	Mycobacterium_phage	1.7e-10	44.0
WP_085313178.1\|236917_237577_+\|transposase	IS6 family transposase	A0A1X9I6E7	Streptococcus_phage	4.2e-37	41.5
WP_085313179.1\|238561_239998_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_085312175.1\|240385_241663_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_085313180.1\|243263_245075_-	HBL/NHE enterotoxin family protein	Q38196	Clostridium_botulinum_phage	1.0e-05	37.6
WP_085313181.1\|245180_246383_-	alpha-helical pore-forming toxin family protein	NA	NA	NA	NA
WP_085313182.1\|246437_247598_-	HBL/NHE enterotoxin family protein	NA	NA	NA	NA
WP_085313183.1\|248297_248624_-	hypothetical protein	NA	NA	NA	NA
WP_002204018.1\|248650_248848_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_085313184.1\|249258_250686_+	serine hydrolase	A0A2P1JR59	Mycobacterium_phage	3.3e-07	22.2
WP_085313185.1\|251369_251558_-	RNA chaperone Hfq	NA	NA	NA	NA
WP_085313186.1\|252281_253325_-	Fic family protein	NA	NA	NA	NA
WP_085313187.1\|253991_255230_-	YcaO-like family protein	NA	NA	NA	NA
WP_085313188.1\|256495_256711_-	hypothetical protein	NA	NA	NA	NA
WP_000959445.1\|257406_257766_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	G3MBF1	Bacillus_virus	9.5e-36	60.5
WP_002201236.1\|258245_258563_-	hypothetical protein	NA	NA	NA	NA
WP_002149609.1\|258588_258783_-	hypothetical protein	NA	NA	NA	NA
WP_172805464.1\|260020_260389_+	hypothetical protein	NA	NA	NA	NA
WP_063218277.1\|260566_260815_-	hypothetical protein	NA	NA	NA	NA
WP_063218278.1\|260811_262062_-	radical SAM protein	NA	NA	NA	NA
WP_085313190.1\|262102_263374_-	MFS transporter	NA	NA	NA	NA
WP_063218280.1\|263445_264426_-	radical SAM protein	NA	NA	NA	NA
WP_085313191.1\|265186_265984_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
266087:266104	attL	NA	NA	NA	NA
WP_085313192.1\|266412_266985_-\|integrase	tyrosine-type recombinase/integrase	D2XR58	Bacillus_phage	1.6e-32	42.4
WP_085313193.1\|267899_268061_+	hypothetical protein	NA	NA	NA	NA
WP_085313194.1\|268083_268521_+	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_085313195.1\|268967_269960_-	multidrug resistance efflux transporter family protein	NA	NA	NA	NA
WP_085313196.1\|269946_270606_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_085313197.1\|270855_273882_+\|transposase	Tn3 family transposase	A0A125RQ78	Bacillus_phage	7.5e-65	22.3
279425:279442	attR	NA	NA	NA	NA

DBSCAN-SWA_3

290106 : 295191

Bacillus_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085313211.1\|290106_290619_-	deoxyuridine 5'-triphosphate nucleotidohydrolase	D2XR49	Bacillus_phage	9.9e-71	81.3
WP_078205591.1\|291873_292062_-	hypothetical protein	A0A1B1P7L7	Bacillus_phage	9.7e-08	57.1
WP_078205590.1\|292551_292770_+	hypothetical protein	NA	NA	NA	NA
WP_085313212.1\|293095_293866_-	phage antirepressor KilAC domain-containing protein	Q6J1W3	Lactobacillus_phage	1.4e-47	44.8
WP_085313213.1\|293867_294053_-	transcriptional regulator	A0A0M3ULF9	Bacillus_phage	1.6e-10	60.7
WP_085313214.1\|294327_294753_+	helix-turn-helix transcriptional regulator	A0A0M4QX29	Bacillus_phage	2.8e-50	72.9
WP_085313215.1\|294768_295191_+	ImmA/IrrE family metallo-endopeptidase	A0A0M4RD70	Bacillus_phage	1.5e-51	70.2

DBSCAN-SWA_4

299858 : 382680

Bacillus_phage(39.13%)

integrase,transposase

attL 308087:308106|attR 372595:372614

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085313220.1\|299858_300566_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	3.5e-42	42.7
WP_085313221.1\|302018_303326_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	7.8e-27	30.5
WP_002166777.1\|304995_305160_-	aspartyl-phosphate phosphatase Spo0E family protein	NA	NA	NA	NA
WP_085313222.1\|305729_306212_+	thioredoxin family protein	NA	NA	NA	NA
WP_085313223.1\|306251_307361_+	DUF418 domain-containing protein	NA	NA	NA	NA
WP_085313225.1\|307697_308093_-	DUF4320 family protein	NA	NA	NA	NA
308087:308106	attL	NA	NA	NA	NA
WP_085313226.1\|308118_308568_-	hypothetical protein	NA	NA	NA	NA
WP_085313227.1\|308584_310078_-	hypothetical protein	NA	NA	NA	NA
WP_085313228.1\|310097_311051_-	hypothetical protein	NA	NA	NA	NA
WP_002069459.1\|313203_313944_+	hypothetical protein	NA	NA	NA	NA
WP_002069458.1\|313978_315433_-	hypothetical protein	NA	NA	NA	NA
WP_078205620.1\|315447_315861_-	hypothetical protein	NA	NA	NA	NA
WP_085313229.1\|317412_318696_+	replication-relaxation family protein	NA	NA	NA	NA
WP_085313230.1\|318885_319278_+	hypothetical protein	NA	NA	NA	NA
WP_085313231.1\|319295_320807_+	conjugal transfer protein TraG	NA	NA	NA	NA
WP_085313232.1\|321392_323210_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	4.5e-25	35.5
WP_076775021.1\|324188_326063_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.5e-36	27.4
WP_002166831.1\|328475_328676_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002166832.1\|328681_328975_+	hypothetical protein	NA	NA	NA	NA
WP_085313235.1\|330258_331185_+	hypothetical protein	NA	NA	NA	NA
WP_002069440.1\|331654_332602_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_157404949.1\|332779_333811_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_085313238.1\|333807_334863_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_085313239.1\|334863_335832_+	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
WP_085312175.1\|336185_337463_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_016096929.1\|337847_338135_+	hypothetical protein	NA	NA	NA	NA
WP_078205634.1\|339326_339611_+	hypothetical protein	NA	NA	NA	NA
WP_085313241.1\|339678_339870_+	hypothetical protein	NA	NA	NA	NA
WP_085313242.1\|340617_341004_+	nucleotidyltransferase domain-containing protein	NA	NA	NA	NA
WP_085313243.1\|340990_341404_+	HEPN domain-containing protein	NA	NA	NA	NA
WP_172805467.1\|343273_343432_-	hypothetical protein	NA	NA	NA	NA
WP_085313244.1\|343765_344719_-\|integrase	site-specific integrase	A0A1B1P793	Bacillus_phage	2.2e-39	33.0
WP_172805468.1\|344859_345003_-	hypothetical protein	NA	NA	NA	NA
WP_085313245.1\|345943_347653_-	hypothetical protein	NA	NA	NA	NA
WP_085313246.1\|349089_350787_+	hypothetical protein	NA	NA	NA	NA
WP_085313247.1\|351011_351662_+	RpiB/LacA/LacB family sugar-phosphate isomerase	NA	NA	NA	NA
WP_085313248.1\|352498_353611_-	helix-turn-helix domain-containing protein	A0A286QQB7	Streptococcus_phage	1.5e-79	46.3
WP_085313153.1\|353622_354021_-\|transposase	IS200/IS605 family transposase	A0A286QN76	Streptococcus_phage	2.8e-52	69.7
WP_085313249.1\|356841_357693_+	chemotaxis protein	NA	NA	NA	NA
WP_085313250.1\|360016_360295_+	hypothetical protein	NA	NA	NA	NA
WP_002134894.1\|361568_361889_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_172805416.1\|361912_362764_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	6.4e-38	37.5
WP_085313251.1\|362955_363297_-	YolD-like family protein	NA	NA	NA	NA
WP_085313252.1\|363293_364559_-	Y-family DNA polymerase	O64031	Bacillus_phage	8.7e-108	48.8
WP_157404950.1\|364658_364829_+	hypothetical protein	NA	NA	NA	NA
WP_085313253.1\|364880_365102_-	helix-turn-helix transcriptional regulator	A0A0S2GLH4	Bacillus_phage	1.0e-08	43.8
WP_085313254.1\|365367_365688_+	hypothetical protein	A0A0S2GLK1	Bacillus_phage	3.7e-31	66.0
WP_085313255.1\|365703_366870_+	DNA translocase FtsK	W8CYG2	Bacillus_phage	2.5e-186	82.7
WP_085313332.1\|366892_367468_+	replication-relaxation family protein	W8CZ47	Bacillus_phage	3.3e-83	76.2
WP_085313256.1\|367805_368162_+	YxeA family protein	NA	NA	NA	NA
WP_085313257.1\|368571_369219_+	lysozyme family protein	A0A223LKM8	Bacillus_phage	1.2e-15	32.6
WP_085313258.1\|369693_371118_+	ABC transporter permease	NA	NA	NA	NA
WP_060751035.1\|371129_371816_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.7e-25	35.1
WP_085313259.1\|372607_372823_+	alpha/beta-type small acid-soluble spore protein	A0A1P8CX76	Bacillus_phage	3.7e-19	68.7
372595:372614	attR	NA	NA	NA	NA
WP_085313333.1\|372953_373196_+	5'-nucleotidase	NA	NA	NA	NA
WP_085313260.1\|373904_374756_+	hypothetical protein	NA	NA	NA	NA
WP_085313153.1\|374843_375242_+\|transposase	IS200/IS605 family transposase	A0A286QN76	Streptococcus_phage	2.8e-52	69.7
WP_085313261.1\|375253_376366_+	helix-turn-helix domain-containing protein	A0A286QQB7	Streptococcus_phage	2.3e-80	46.6
WP_085313262.1\|376844_377321_+	GNAT family N-acetyltransferase	E9LUK4	Lactobacillus_phage	1.6e-30	45.3
WP_085313263.1\|378039_379368_+	nucleotide sugar dehydrogenase	M1H5A7	Paramecium_bursaria_Chlorella_virus	5.3e-39	29.6
WP_085313264.1\|379376_380534_+	DegT/DnrJ/EryC1/StrS family aminotransferase	A0A2P1ELT3	Moumouvirus	1.5e-42	33.1
WP_085313265.1\|380540_381464_+	NAD-dependent epimerase/dehydratase family protein	A0A0E3FNQ3	Synechococcus_phage	7.9e-26	32.0
WP_085313266.1\|381438_382680_+	DegT/DnrJ/EryC1/StrS aminotransferase family protein	A0A2P1ELT3	Moumouvirus	4.5e-16	34.4

DBSCAN-SWA_5

392899 : 433183

Bacillus_phage(33.33%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001011319.1\|392899_393427_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_085313275.1\|393563_394337_+	hypothetical protein	NA	NA	NA	NA
WP_002090450.1\|395192_395540_+	YxeA family protein	A0A0K2CYS5	Paenibacillus_phage	2.5e-09	35.3
WP_085313276.1\|395773_396181_+	nucleotidyltransferase domain-containing protein	NA	NA	NA	NA
WP_000787545.1\|396170_396584_+	DUF86 domain-containing protein	NA	NA	NA	NA
WP_085313277.1\|397096_398833_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	5.9e-14	28.6
WP_085313278.1\|398992_399208_+	alpha/beta-type small acid-soluble spore protein	A0A1P8CX76	Bacillus_phage	2.2e-16	64.2
WP_085313279.1\|399354_399747_-	hypothetical protein	NA	NA	NA	NA
WP_170972676.1\|399860_399971_-	HU family DNA-binding protein	NA	NA	NA	NA
WP_085313280.1\|400313_401393_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0A8WI33	Clostridium_phage	4.9e-19	31.8
WP_085313281.1\|401398_401800_-\|transposase	IS200/IS605 family transposase	Q332K6	Clostridium_botulinum_C_phage	3.1e-51	72.7
WP_157404954.1\|402060_403062_+	serine hydrolase	G1DB24	Mycobacterium_phage	4.4e-22	27.0
WP_085313283.1\|403651_403903_+	hypothetical protein	NA	NA	NA	NA
WP_085313284.1\|403972_405139_+	serine hydrolase	A0A1D8EXR7	Mycobacterium_phage	6.1e-23	28.5
WP_085313285.1\|405232_407317_+	serine hydrolase	NA	NA	NA	NA
WP_085313335.1\|407557_407680_+	hypothetical protein	NA	NA	NA	NA
WP_172805469.1\|408021_409221_+	trypsin-like peptidase domain-containing protein	A0A1B1IT49	uncultured_Mediterranean_phage	8.7e-25	30.5
WP_085313287.1\|409571_410996_-	sensor histidine kinase	W8CYF6	Bacillus_phage	2.1e-25	30.1
WP_085313288.1\|410988_411654_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.4e-35	36.1
WP_172805470.1\|411822_411978_+	hypothetical protein	NA	NA	NA	NA
WP_085313289.1\|413514_415878_+	S8 family serine peptidase	G1FGA4	Mycobacterium_phage	5.7e-12	47.8
WP_085313290.1\|416900_417263_+	cell division protein SepF	D2XR47	Bacillus_phage	3.0e-53	87.5
WP_085313292.1\|417727_418327_-	undecaprenyl-diphosphatase	NA	NA	NA	NA
WP_085313293.1\|418519_418768_-	hypothetical protein	A0A288WFY7	Bacillus_phage	1.7e-36	93.9
WP_085313294.1\|419485_419779_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_085313295.1\|420500_421871_+	lytic polysaccharide monooxygenase	G1FGA4	Mycobacterium_phage	6.5e-08	36.1
WP_085313153.1\|422216_422615_+\|transposase	IS200/IS605 family transposase	A0A286QN76	Streptococcus_phage	2.8e-52	69.7
WP_085313296.1\|422626_423739_+	helix-turn-helix domain-containing protein	A0A286QQB7	Streptococcus_phage	6.3e-78	45.0
WP_085313297.1\|424331_425078_+	zeta toxin family protein	A0A2H4J4U1	uncultured_Caudovirales_phage	3.7e-34	38.1
WP_085313298.1\|425645_426569_+	HNH endonuclease	NA	NA	NA	NA
WP_033707385.1\|426643_427006_+	hypothetical protein	NA	NA	NA	NA
WP_002069055.1\|427207_427699_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_085313299.1\|427781_427982_-	hypothetical protein	NA	NA	NA	NA
WP_085313300.1\|430358_431672_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_087943055.1\|431853_433183_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	2.6e-30	35.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. NZ_CP020743

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP020743_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP020743_1

649747-649827

Orphan

Consensus_repeat	Method
TATACGTTTTTTGAAATTTGTCC	CRISPRCasFinder

1 spacers

csa3

The CRISPR arrays of NZ_CP020743_1

>merge|NZ_CP020743|1|649747-649827|CRISPRCasFinder
TATACGTTTTTTGAAATTTGTCCGTTTGATATTATCTCATTGTTTTGGGGCACTTTTATATACGCTTTTTGAAATTTGTCC

>NZ_CP020743|1|1|649747-649827|CRISPRCasFinder
TATACGTTTTTTGAAATTTGTCC	GTTTGATATTATCTCATTGTTTTGGGGCACTTTTA
TATACGCTTTTTGAAATTTGTCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP020743.1\|WP_002010492.1\|660442_660622_+\|acid-soluble-spore-protein-H	unknown	unknown	gnl\|CDD\|179311
NZ_CP020743.1\|WP_016093357.1\|654246_655545_+\|HlyC/CorC-family-transporter	unknown	unknown	gnl\|CDD\|224173
NZ_CP020743.1\|WP_085309045.1\|640387_642742_+\|cadmium-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319847
NZ_CP020743.1\|WP_085312928.1\|639078_639639_+\|SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|226975
NZ_CP020743.1\|WP_085309057.1\|651279_652296_-\|LCP-family-protein	unknown	unknown	gnl\|CDD\|181811
NZ_CP020743.1\|WP_000733136.1\|645903_646032_+\|NprX-family-peptide-pheromone	unknown	unknown	unknown
NZ_CP020743.1\|WP_001075217.1\|659947_660235_+\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP020743.1\|WP_085309053.1\|647961_648522_-\|TVP38/TMEM64-family-protein	unknown	unknown	gnl\|CDD\|223475
NZ_CP020743.1\|WP_001017670.1\|653752_654139_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319940
NZ_CP020743.1\|WP_002029742.1\|655726_657160_+\|aspartate-ammonia-lyase	unknown	unknown	gnl\|CDD\|237031
NZ_CP020743.1\|WP_002091009.1\|652482_653661_-\|pyrimidine-nucleoside-transporter-NupC	unknown	unknown	gnl\|CDD\|224883
NZ_CP020743.1\|WP_002125157.1\|648922_649441_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375857
NZ_CP020743.1\|WP_085309061.1\|660664_662014_-\|peptide-MFS-transporter	unknown	unknown	gnl\|CDD\|340904
NZ_CP020743.1\|WP_085309051.1\|646198_647899_+\|peptidase-M4-family-protein	unknown	unknown	gnl\|CDD\|225768
NZ_CP020743.1\|WP_085309047.1\|642966_644430_-\|nicotinate-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|236426
NZ_CP020743.1\|WP_002010461.1\|639989_640367_+\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP020743.1\|WP_002029741.1\|657197_658817_-\|lactate-permease-LctP-family-transporter	unknown	unknown	gnl\|CDD\|182445
NZ_CP020743.1\|WP_085309055.1\|649455_649728_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020743.1\|WP_085309049.1\|644629_645889_+\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|238045
NZ_CP020743.1\|WP_085309059.1\|659020_659449_-\|TlpA-family-protein-disulfide-reductase	unknown	unknown	gnl\|CDD\|239264

Protein	Function_ID	Function_description	E-value
NZ_CP020743.1\|WP_002010492.1\|660442_660622_+\|acid-soluble-spore-protein-H	gnl\|CDD\|179311	PRK01625, sspH, acid-soluble spore protein H; Provisional.	2.53045e-30
NZ_CP020743.1\|WP_016093357.1\|654246_655545_+\|HlyC/CorC-family-transporter	gnl\|CDD\|224173	COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only].	2.33412e-148
NZ_CP020743.1\|WP_085309045.1\|640387_642742_+\|cadmium-translocating-P-type-ATPase	gnl\|CDD\|319847	cd07548, P-type_ATPase-Cd_Zn_Co_like, P-type heavy metal-transporting ATPase, similar to Bacillus subtilis CadA which appears to transport cadmium, zinc and cobalt but not copper out of the cell. Bacillus subtilis CadA/YvgW appears to transport cadmium, zinc and cobalt but not copper, out of the cell. Functions in metal ion resistance and cellular metal ion homeostasis. CadA/YvgW is also important for sporulation in B. subtilis, the significant specific expression of the cadA/yvgW gene during the late stage of sporulation, is controlled by forespore-specific sigma factor, sigma G, and mother cell-specific sigma factor, sigma E. This subfamily also includes Helicobacter pylori CadA an essential resistance pump with ion specificity towards Cd(2+), Zn(2+) and Co(2+), and Zn-transporting ATPase, ZiaA(N) in Synechocystis PCC 6803. Transcription of ziaA is induced by Zn under the control of the Zn responsive repressor ZiaR. This subclass of P-type ATPase is also referred to as CPx-type ATPases because their amino acid sequences contain a characteristic CPC or CPH motif associated with a stretch of hydrophobic amino acids and N-terminal ion-binding sequences. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP020743.1\|WP_085309047.1\|642966_644430_-\|nicotinate-phosphoribosyltransferase	gnl\|CDD\|236426	PRK09243, PRK09243, nicotinate phosphoribosyltransferase; Validated.	0
NZ_CP020743.1\|WP_085309057.1\|651279_652296_-\|LCP-family-protein	gnl\|CDD\|181811	PRK09379, PRK09379, LytR family transcriptional regulator.	5.061e-88
NZ_CP020743.1\|WP_085312928.1\|639078_639639_+\|SAM-dependent-methyltransferase	gnl\|CDD\|226975	COG4627, COG4627, Uncharacterized protein conserved in bacteria [Function unknown].	2.60713e-71
NZ_CP020743.1\|WP_001075217.1\|659947_660235_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	7.9582e-15
NZ_CP020743.1\|WP_001017670.1\|653752_654139_+\|VOC-family-protein	gnl\|CDD\|319940	cd08352, VOC_Bs_YwkD_like, vicinal oxygen chelate (VOC) family protein Bacillus subtilis YwkD and similar proteins. uncharacterized subfamily of vicinal oxygen chelate (VOC) family contains Bacillus subtilis YwkD and similar proteins. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	1.26178e-69
NZ_CP020743.1\|WP_085309053.1\|647961_648522_-\|TVP38/TMEM64-family-protein	gnl\|CDD\|223475	COG0398, COG0398, Uncharacterized conserved protein [Function unknown].	5.65579e-20
NZ_CP020743.1\|WP_002029742.1\|655726_657160_+\|aspartate-ammonia-lyase	gnl\|CDD\|237031	PRK12273, aspA, aspartate ammonia-lyase; Provisional.	0
NZ_CP020743.1\|WP_002029741.1\|657197_658817_-\|lactate-permease-LctP-family-transporter	gnl\|CDD\|182445	PRK10420, PRK10420, L-lactate permease; Provisional.	0
NZ_CP020743.1\|WP_002125157.1\|648922_649441_+\|hypothetical-protein	gnl\|CDD\|375857	pfam18431, RNAse_A_bac, Bacterial CdiA-CT RNAse A domain. Contact-dependent growth inhibition (CDI) is an important mechanism of inter-bacterial competition found in many Gram-negative pathogens. CDI+ cells express cell-surface CdiA proteins that bind neighboring bacteria and deliver C-terminal toxin domains (CdiA-CT) to inhibit target-cell growth. Structure analysis of CdiA-CT shows that it adopts the same fold (with two beta-sheets forming an overall kidney shape) as angiogenin and other RNase A paralogs, but the toxin does not share sequence similarity with these nucleases and lacks the characteristic disulfide bonds of the superfamily. Furthermore, structural comparison analysis identified human angiogenin, Rana pipiens protein P-30 (onconase) and mouse pancreatic ribonuclease (RNase 1) as the closest structural homologs of CdiA-CT.	6.02948e-38
NZ_CP020743.1\|WP_085309061.1\|660664_662014_-\|peptide-MFS-transporter	gnl\|CDD\|340904	cd17346, MFS_DtpA_like, Dipeptide and tripeptide permease A (DtpA)-like subfamily of the Major Facilitator Superfamily of transporters. The DtpA-like subfamily includes four Escherichia coli proteins: dipeptide and tripeptide permeases A (DtpA, TppB or YdgR), B (DtpB or YhiP), C (DtpC or YjdL), and D (DtpD or YbgH). They are proton-dependent permeases that transport di- and tripeptides. DtpA and DtpB display a preference for di- and tripeptides composed of L-amino acids. DtpC shows higher specificity for dipeptides compared to tripeptides, and prefers dipeptides containing a C-terminal lysine residue. The DtpA-like subfamily belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.28105e-147
NZ_CP020743.1\|WP_085309051.1\|646198_647899_+\|peptidase-M4-family-protein	gnl\|CDD\|225768	COG3227, LasB, Zinc metalloprotease (elastase) [Amino acid transport and metabolism].	1.41022e-165
NZ_CP020743.1\|WP_002091009.1\|652482_653661_-\|pyrimidine-nucleoside-transporter-NupC	gnl\|CDD\|224883	COG1972, NupC, Nucleoside permease [Nucleotide transport and metabolism].	4.4523e-142
NZ_CP020743.1\|WP_002010461.1\|639989_640367_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	2.55875e-21
NZ_CP020743.1\|WP_085309049.1\|644629_645889_+\|tetratricopeptide-repeat-protein	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.23523e-06
NZ_CP020743.1\|WP_085309059.1\|659020_659449_-\|TlpA-family-protein-disulfide-reductase	gnl\|CDD\|239264	cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins. TlpA, ResA and DsbE are bacterial protein disulfide reductases with important roles in cytochrome maturation. They are membrane-anchored proteins with a soluble TRX domain containing a CXXC motif located in the periplasm. The TRX domains of this family contain an insert, approximately 25 residues in length, which correspond to an extra alpha helix and a beta strand when compared with TRX. TlpA catalyzes an essential reaction in the biogenesis of cytochrome aa3, while ResA and DsbE are essential proteins in cytochrome c maturation. Also included in this family are proteins containing a TlpA-like TRX domain with domain architectures similar to E. coli DipZ protein, and the N-terminal TRX domain of PilB protein from Neisseria which acts as a disulfide reductase that can recylce methionine sulfoxide reductases.	1.67738e-51

>NZ_CP020743.1|WP_085309055.1|649455_649728_+|hypothetical-protein
MYPTLQYFLKSYCTLSIHEDEIVSVMEEFIEQEDEEIVLKLRDELVNMKKKNAWEEACVLAAKQGNRVWSLEATKDHLKNFLLLLQKKKA
>NZ_CP020743.1|WP_002125157.1|648922_649441_+|hypothetical-protein
MKRLSSLFLSSLLALMLILSGCAGKEQKTEKPKEDHSTSVEKISDNILDEMEGPPKNGHTIERHVGKSEEDLKNRLKTDKVSAASTYYDKETATKAVKDSLKQHDKEIQDWLKNSKEARLVLNTTHSFPVGKTVIKKNMNVKDKLVKTVTVLARDKSGNLGFKIITSYPSDK
>NZ_CP020743.1|WP_085309053.1|647961_648522_-|TVP38/TMEM64-family-protein
MAETIQNFLTDYYSIAIPLSILINIIISLLGFIPSIFLTAINIQLFGVTNGTIISIAGEALGAIISFYIYRIGLQKFTHDKVNKYPKVERLLYVEGREAFLLVLSFRFIPFIPSSIVTLFAALGKMSLLSFSIASTIGKIPALLIEVYSAYHVINGTNEAKWIITIAGCVGLFYLWKKWRQNKEGA
>NZ_CP020743.1|WP_085309051.1|646198_647899_+|peptidase-M4-family-protein
MKRKSLALVLATGMAVTTFGGTGSAFADSKNVLSTKKYNETVQSPEFISGDLTGATGKKAESVVFDYLNAAKGDYKLGEKSAQDSFKVKQVKKDAVTDSTVVRMQQVYEGVPVWGSTQVAHVSKDGSLKVLSGTVAPDLDKKEKLKNKNKIEGAKAIEIAQQDLGVTPKYEVDPKADLYVYQNGEETTYAYVVNLNFLEPNPGNYYYFIEAESGKVLNKYNKLDHVTNDDKSSVKQDAPKQEAKAVVKPVTGTNKVGTGKGVLGDTKSLNTTLSGSSYYLQDNTRGATIFTYDAKNRSTLPGTLWVDADNVFNVAYDAAAVDAHYYAGKTYDYYKATFNRNSINDAGAPLKSTVHYGSKYNNAFWNGSQMVYGDGDGVTFTSLSGGIDVIGHELTHAVTENSSDLIYQNESGALNEAISDIFGTLVEFYDNRNPDWEIGEDIYTPGQAGDALRSMSDPAKYGDPDHYSKRYTGSSDNGGVHTNSGIINKQAYLLANGGTHSGVTVTGIGKDKLGAIYYRANTQYFTQSTTFSQARAGAVQAAADLYGASSAEVTAVKQSFSAVGVN
>NZ_CP020743.1|WP_000733136.1|645903_646032_+|NprX-family-peptide-pheromone
MKKLIAGTFVVMAIAAVVLDIQYAWKPDTLGQEAKTVEQINL
>NZ_CP020743.1|WP_085309049.1|644629_645889_+|tetratricopeptide-repeat-protein
MQQTLEKIGKQVFYKRLQQKMTQEELCQGICSVSYLSKIENGKIEASEEILQLLCTRLEIAVTDLRDVEEDVKVKLDEWLNALVHLDKQQVERIYEELQGEMKHVLDFEIINYYKLLYTRYLMMKRDLPAVEEELDGLKKVYKKYSPFQKMLYTYNKALLYSVQYKYTQALEYLLKTESMAKELGYYETGIYYNLALTYSQMEIDHMTLYFANVALEGFKSEYKFRNIINCKFLIAFSYTRKKQYNEAMEIYNHIIREATSFADKDNILSIALNNIGYLYYRQKNYAKAKEYYIECLKYKKEEDMNYIDAMYELSLQCIQLGELEEAAEWIEKGILAARKDDRYKGMLYLLLNLRYKYFEERDLYKKFLETEVVPFFKIEENIKDLKKVYLELAEYLEECSDFKESNRYYKLAITLLEE
>NZ_CP020743.1|WP_085309047.1|642966_644430_-|nicotinate-phosphoribosyltransferase
MNHYKDDSYALHTDLYQINMAYTYWKDGIHTRRSVFDLYFRKLPFENGYAVFAGLEKIVEYIENFSFTESDIAYLAELQFEEDFLHYLQNMKFTGTIRSMQEGEVVFNNEPLLRVDAPLGEAQIIETALLNIVNYQTLIATKAARMKHAANNDELLEFGTRRAHEFDAALWGTRAAFIGGFSSTSNVRAGKRFGIPVAGTHAHSFVQAYRDEYVAFKKYAETHKKCVFLVDTYDTLKSGVPNAIRVAKEFGDRIDFYGIRLDSGDMAYLSKEARKQLDAAGFTNTKIIASSDLDEYTIMHLKSQGAKIDVWGVGTRLITSFEQPALGAVYKLVAIEDTDGKLNDTIKISSNPEKITTPGLKRIYRIINRVNDHAEGDYIALESEDPGKEERLKMFHPVHTYISKFVTSFEARELHQDIFINGKRAYELPNILDIQKYNERSLSLFWEEYMRTLNPEEYPVDLSQECWDHKMNYIQTVREQVEKNIQK
>NZ_CP020743.1|WP_085309045.1|640387_642742_+|cadmium-translocating-P-type-ATPase
MAEALVKKKLMLEGLDCANCAMKIEKGVGNIEGVTSCSVNFATKTMLLETPQNKENQVVTEAKQLVTKLEPHIKVQEEQKTKSVKEVFVLEGLDCANCAMKIENKVKEMPTISEATVDFVSKKLRVEVANKRELESTVQNIKNVVQKLEPDVKVVREEEKGHDHDHGDGNVKKMIGRLVVGGILTGIAALAGLPQMITIPLFVLAYLLIGGDIVWRAVRNITRGQVFDENFLMAIATLGAFAIQQYPEAVAVMLFYQVGELFQSIAVNRSRKSITSLMDIRPDYANVKVGNETKQVSPEDVQIGEYIIVKPGEKVPLDGKVVEGTSMMDTSALTGESVPREVEVGNDVLSGFVNQNGVLIVEVTKEFGESTVSKILDLVQNASSKKAPTENFITKFARYYTPVVVITAAIMAFIPPLILEGATFSDWIYRALVFLVISCPCALVVSIPLGFFGGIGGASKSGILVKGSNYLEALNDVKYIVFDKTGTLTKGVFKVTKMEPSEGITAEELLEYAAFAEVYSNHPIAQSIRNAYGKSIDENAIEDYSEISGHGTVVKVQGKEIFAGNAKLMSKENITFKQQNTVGTLVHVAVDGKYAGYIVISDEVKEDSKQAIQKLKELGIKKTVMLTGDAKSVGEAVGKELGLDEVHAELLPHQKVEEIEKIDAAKRGKEKIAFVGDGINDTPVLARADVGIAMGGLGSDAAIEAADIVIMTDEPSKIATAVKIAKRTRSIVWQNIIFALGVKGLVLLLGAFGIATMWEAVFSDVGVTLLAVLNAMRVLQVKDL
>NZ_CP020743.1|WP_002010461.1|639989_640367_+|winged-helix-turn-helix-transcriptional-regulator
MAENKVETQQEACSQTVIHEEIVDQVKQTIPTDESLSKVAELFKVLGDRTRTRILHALFEAEMCVCDLAYLLGMTQSSISHQLRVLKQAKLVKNRKEGKVVYYSLADQHVIHIFEQAFEHVNEEE
>NZ_CP020743.1|WP_085312928.1|639078_639639_+|SAM-dependent-methyltransferase
METKVVVGAEGYNNNPGWLHTNEEELNLLKRETWINKFPSNSLSVILAEHVWEHLSYEEGIEAAKVCYEFLEDSGYIRCAVPDAFFPNEEYQRGVQVGGPGPLDHPAASHKIVHNYKTIISMFEAVGFQVKLLEYCDENRQFHYSDWEENGGFIYRSKRFDHRNQDGKLGFASLIVDAVKVNKVKI
>NZ_CP020743.1|WP_085309057.1|651279_652296_-|LCP-family-protein
MMKSDINNETRAKKGRSKKKRLLWFILIPLLIVAMGAGGYSFHIYSKAKSVLSNAYSELGRGDKSSKREKAVKPMTDNISVLIMGVDESDIREKGYGKATRTDALLLATINKNDKSVKLVSIPRDSRVFIKSRDKYDKITHAHVFGGVDSTIDTVEKFLDVPVDYYVKFNFKSFIKIVDSLGGITVDVPVEFTEQNSSDEAGAIHLKKGRQHLNGEEALALARTRHIDSDYMRGQRQQLVLEAIAEKALSLNSINKIGSLLDAVDTDLKTNLTFDDMMTIAKNSMDSNLKMDKLQVEGTDKYIGGIYYYVPNEKSVNDISTTLQEHLGVTNKNEHKKL
>NZ_CP020743.1|WP_002091009.1|652482_653661_-|pyrimidine-nucleoside-transporter-NupC
MKFITFFVGLIVVFFLAYIASNNKKHIKFKPIFIMLIIQLILTYLLLNTEIGLILITVISSLFTRLLEYAASGINFVFGGLANKGEMPFFLNVLLPIVFISVLIGILQHFKILPFFIRWIGFFLSKINGLGKLESYNAIASAIVGQSEVFITVKKQLAQIPKHRLYTLCASAMSTVSMSIVGAYMTMIEPKYVVTALVLNLFSGFIIVLIINPYDVNDDEDILVIKGGKQSFFEMLGEYILDGFRVAIVVGAMLIGFVALMSCINDLFLIIFGITFQQLIGYVFAPIAFLIGVPSSEIVTAGSIMATKLVTNEFVAMMDLSKISSTLSIRTVGIISVFLVSFANFSSIGIISGAVKGLNEEQGNVVARFGLKLLYGATLVSILSAIIVSIML
>NZ_CP020743.1|WP_001017670.1|653752_654139_+|VOC-family-protein
MNICRVHHVAIICSNYELSKDFYTRILGFKAINEVYRKERDSYKLDLCVGEEYQIELFSFPSPPERPSFPEAAGLRHLAFAVTNIEEAVNHLKQCGVETEAIRMDEITDKKFVFFQDPDGLPLELYEA
>NZ_CP020743.1|WP_016093357.1|654246_655545_+|HlyC/CorC-family-transporter
MDILKLLMVAILIALTAFFVAVEFAIIKVRSSRIDQLVSEKRRGALAAKKVTSNLDEYLSACQLGITITALGLGWLGEPTIKHILEPLFLKLHLSPAIASTVSFIIAFAVITFLHVVIGELAPKTLAIQRAEQVSLLLSKPIIYFYRVMYPFIWALNGSARLVTGLFGLHPASEHEVAHSEEELRLILSESYESGEINQREFKYVNNIFEFDNRVAKEIMVPRTEVVGLYEDEPFETHIKIIAQEKYTRYPVFGEDKDEIIGMVNVKDLFIRYMDGNRDEGCSITPYTRPVIEVLENIPIHDLLLQMQRKRIPLAVLYDEYGGTAGIVTLEDILEEIVGEIRDEYDEDEHPPIEHISEGCKIVEGKVLISEVNDLFGIHLIADDVDTIGGWIMVQKQIVAEGDIIEKHGFSFKVLEKDMHQIKRVEIKKVEE
>NZ_CP020743.1|WP_002029742.1|655726_657160_+|aspartate-ammonia-lyase
MIATKDIRIEKDFLGEKEVPSVAYYGVQTLRAVENFPITGYRIHPSLITAMAIVKKAAALANIDTGYLAKDIGQEIAEAAQEIVDGKFHDQFIVDPIQGGAGTSINMNTNEVIANRALERMGYEKGEYAKISPNTHVNMAQSTNDAFPTGIHIATLMMLEELLVTMEELHSAFHDKAKEFDHVIKMGRTHLQDAVPIRLGQEFEAYSRVLERDIKRIKQSRQHLYEVNMGATAVGTGLNANPTYIEQVVKHLRTFSGFPLVGAEHLVDATQNTDAYTEVSAALKVCMMNMSKIANDLRIMASGPRVGLAEIQLPARQPGSSIMPGKVNPVMAEVINQVAFQVIGNDHTICLASEAGQLELNVMEPVLVFNLIQSISIMNNGFRVFREYCIKGITANEELLKQYVEKSVGVITAVNPHIGYEAASRIAREAIATGKSVRELCLEHGVLTAEELDIILDPYEMTHPEIAGASLLKTKKM
>NZ_CP020743.1|WP_002029741.1|657197_658817_-|lactate-permease-LctP-family-transporter
MSTWTQIYDPLNNIWLSALIAALPIFCFIICLVGFKMKGYMAGLYSVIVAIILAIFVYKMPATVAVASAGFGVLSGFYPICTIVIAAIFLYKLTVKTEQFNVIRDSISSITNDQRLQVLLIAYSFGAFLEGAAGFGVPVAITAALLVGMGFNPLKAAGICLVANIAGGAMGAMGIPVTVPAQLTGLDALTVGRQAVYILPFISIVLPFLLVSMVDGFKGIKETWQGILVSGVSFAITQFLVTYFLGAELTNIFAAVVSMVALTLFLRVWQPKSSAKEEKQEEKESHTFNQILYAWSPFVFLTAFVTIFNLKPIKALFAPDGPLANLVFNIQFPGLHNAVMKTAPITKADTPFAAIFKLDVFSSTTTAIVLAIIVSLIVYRVNGKMIKELMIETIKELKVPVYTICSVIALAYVENYSGMSSTLGLAFSSTGNAFPVLSPILGWIGVFITGSVVSSGSLFAPLQAVTADQLNIVPSTLVSLNVVGGTIAKMVSPQSVAVACAAVGLVGQESALFKIVMKYSLIFLAIISLLQLNSVFNIF
>NZ_CP020743.1|WP_085309059.1|659020_659449_-|TlpA-family-protein-disulfide-reductase
MGTEVGTVARNFLLETTTGQEVRLTDYKGKKVILNFWASWCGPCKIEMPDMEKFYHDTKDMGIEIVAVNATATEKDPNNVKQFLEENKYTFPVLLDQKGQASAAYQIISIPTSFVIDSNGVIQYKHVGPMTYEKMKEYVNNL
>NZ_CP020743.1|WP_001075217.1|659947_660235_+|winged-helix-turn-helix-transcriptional-regulator
MNQNQFDCRISEEDVQMLRALAHPLRLRLVMELMQRGTCNVTQLQEVLEIPQSTVSQHLTKLKQNKVVRFERRGLEVYYQIHNDKVSEVVKTLFS
>NZ_CP020743.1|WP_002010492.1|660442_660622_+|acid-soluble-spore-protein-H
MDVKRVKQILSSSSRIDVTYEGVPVWIESCDEQKGSAQVYDVSNPGESVHVDVTALEEM
>NZ_CP020743.1|WP_085309061.1|660664_662014_-|peptide-MFS-transporter
MDAALKLDKAGEQQSPKKHPPGLYLLFFTEAWERFSYYGMRGLLVLYLTTSLVSGGLGFDKAVAVQIYGIFTMLVYFTPIIGGWLTDHFITKRHAITIGGIIMAIGNFVLFSMNTKTGLFLGLGLLVIGNGFFKPNISTLLGQLYSDNDSRRDSAFTIFYMGINLGALIAPFICGYFTDYRYGFLTACIGMIIGQIAFNLLAPRYLGSAGTTVVGKKSKEQNAKPIEKKPLTTQEKKRTTAILILTCFVVFFWAGFEQAGSSLTLYTDKFVDRTIGGFTIPTPWFQSVNPLFIILLALPVSALWIKLSKTKNGDLKIPTKMAFGMILLGIGYLVLTLAVLKTGSDEGNITMKANLLFIVFTYMFHTIGELFLSPIGLSMVSAIAPLKLASLLMGVWLAGTGFANLLAGQLAAFTQSLGYLEVFASIGVIVIVLGLVLLMFSKKIAHMME

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP020743_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP020743_2

2059045-2059248

Orphan

Consensus_repeat	Method
TTTTTTAAGCGAGTACATTTTGTAACGAAAGTACATTTTTTCACGCGAGTACAT	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP020743_2

>merge|NZ_CP020743|2|2059045-2059248|PILER-CR
TTTTCAAAGCGAACGCATTTTGTAACGAAAGTACATTTTTTCACGCGAGTACGTTTTGTAACTATAACGCATTCTTTTCTGCGAGTAACCTTTGTAACGAAAGTCCATTTTTGAACGCGTACACGAGTACATTTTGTAACAAAAGTCCATTTTTTTACATGAGTACATTTTGTAACGAAAGTACAATGTTTCACGCGAGTACAT

>NZ_CP020743|2|1|2059045-2059248|PILER-CR
TTTTCAAAGCGAACGCATTTTGTAACGAAAGTACATTTTTTCACGCGAGTACGT	TTTGTAACTATAACGCAT
TCTTTTCTGCGAGTAACCTTTGTAACGAAAGTCCATTTTTGAACGCGTACACGA	GTACATTTTGTAACAAAAGTCCATTTTTTTA
CATGAGTACATTTTGTAACGAAAGTACAATGTTTCACGCGAGTACAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP020743.1\|WP_085310597.1\|2055466_2057128_+\|peptide-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173869
NZ_CP020743.1\|WP_002031481.1\|2061527_2062130_+\|DedA-family-protein	unknown	unknown	gnl\|CDD\|223659
NZ_CP020743.1\|WP_085310591.1\|2052058_2052718_+\|oxidoreductase	unknown	unknown	gnl\|CDD\|187560
NZ_CP020743.1\|WP_000418719.1\|2064933_2065830_+\|permease	unknown	unknown	gnl\|CDD\|223773
NZ_CP020743.1\|WP_085310599.1\|2059623_2060700_+\|spore-coat-protein-CotH	unknown	unknown	gnl\|CDD\|378045
NZ_CP020743.1\|WP_085310595.1\|2054396_2055395_+\|DUF2628-domain-containing-protein	unknown	unknown	gnl\|CDD\|313994
NZ_CP020743.1\|WP_002012448.1\|2066822_2067329_+\|acyl-CoA-thioesterase	unknown	unknown	gnl\|CDD\|224523
NZ_CP020743.1\|WP_002012438.1\|2058175_2058787_+\|phosphoserine-phosphatase-1	unknown	unknown	gnl\|CDD\|172065
NZ_CP020743.1\|WP_000505094.1\|2067458_2067545_-\|YjcZ-family-sporulation-protein	unknown	unknown	unknown
NZ_CP020743.1\|WP_002148565.1\|2057187_2057604_+\|FosB/FosD-family-fosfomycin-resistance-bacillithiol-transferase	unknown	unknown	gnl\|CDD\|179740
NZ_CP020743.1\|WP_000932386.1\|2063792_2064734_+\|magnesium-transporter-CorA-family-protein	unknown	unknown	gnl\|CDD\|213361
NZ_CP020743.1\|WP_002031473.1\|2057616_2058162_+\|short-chain-dehydrogenase	unknown	unknown	gnl\|CDD\|236232
NZ_CP020743.1\|WP_002168580.1\|2060805_2061423_+\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|240029
NZ_CP020743.1\|WP_085310602.1\|2067704_2068889_+\|cardiolipin-synthase	unknown	unknown	gnl\|CDD\|234967
NZ_CP020743.1\|WP_085310601.1\|2062226_2063606_+\|polysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|240529
NZ_CP020743.1\|WP_002012447.1\|2065833_2066703_+\|TIGR03943-family-protein	unknown	unknown	gnl\|CDD\|226214
NZ_CP020743.1\|WP_002031467.1\|2053918_2054371_+\|methylated-DNA--[protein]-cysteine-S-methyltransferase	unknown	unknown	gnl\|CDD\|234860
NZ_CP020743.1\|WP_002012427.1\|2051717_2051942_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020743.1\|WP_085310593.1\|2052747_2053785_-\|NADPH-dehydrogenase-NamA	unknown	unknown	gnl\|CDD\|184110
NZ_CP020743.1\|WP_085310589.1\|2050569_2051520_-\|zinc-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238499

Protein	Function_ID	Function_description	E-value
NZ_CP020743.1\|WP_085310597.1\|2055466_2057128_+\|peptide-ABC-transporter-substrate-binding-protein	gnl\|CDD\|173869	cd08504, PBP2_OppA, The substrate-binding component of an ABC-type oligopetide import system contains the type 2 periplasmic binding fold. This family represents the periplasmic substrate-binding component of an ATP-binding cassette (ABC)-type oligopeptide transport system comprised of 5 subunits. The transport system OppABCDEF contains two homologous integral membrane proteins OppB and OppF that form the translocation pore; two homologous nucleotide-binding domains OppD and OppF that drive the transport process through binding and hydrolysis of ATP; and the substrate-binding protein or receptor OppA that determines the substrate specificity of the transport system. The dipeptide (DppA) and oligopeptide (OppA) binding proteins differ in several ways. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP020743.1\|WP_002031481.1\|2061527_2062130_+\|DedA-family-protein	gnl\|CDD\|223659	COG0586, DedA, Uncharacterized membrane-associated protein [Function unknown].	3.37901e-42
NZ_CP020743.1\|WP_085310591.1\|2052058_2052718_+\|oxidoreductase	gnl\|CDD\|187560	cd05250, CC3_like_SDR_a, CC3(TIP30)-like, atypical (a) SDRs. Atypical SDRs in this subgroup include CC3 (also known as TIP30) which is implicated in tumor suppression. Atypical SDRs are distinct from classical SDRs. Members of this subgroup have a glycine rich NAD(P)-binding motif that resembles the extended SDRs, and have an active site triad of the SDRs (YXXXK and upstream Ser), although the upstream Asn of the usual SDR active site is substituted with Asp. For CC3, the Tyr of the triad is displaced compared to the usual SDRs and the protein is monomeric, both these observations suggest that the usual SDR catalytic activity is not present. NADP appears to serve an important role as a ligand, and may be important in the interaction with other macromolecules. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.47217e-92
NZ_CP020743.1\|WP_000418719.1\|2064933_2065830_+\|permease	gnl\|CDD\|223773	COG0701, COG0701, Predicted permeases [General function prediction only].	8.25121e-74
NZ_CP020743.1\|WP_085310599.1\|2059623_2060700_+\|spore-coat-protein-CotH	gnl\|CDD\|378045	pfam08757, CotH, CotH kinase protein. Members of this family include the spore coat protein H (cotH). This protein is an atypical protein kinase that phosphorylates CotB and CotG.	1.79033e-114
NZ_CP020743.1\|WP_002012448.1\|2066822_2067329_+\|acyl-CoA-thioesterase	gnl\|CDD\|224523	COG1607, COG1607, Acyl-CoA hydrolase [Lipid metabolism].	3.21637e-50
NZ_CP020743.1\|WP_002012438.1\|2058175_2058787_+\|phosphoserine-phosphatase-1	gnl\|CDD\|172065	PRK13463, PRK13463, phosphoserine phosphatase 1.	7.22714e-140
NZ_CP020743.1\|WP_085310602.1\|2067704_2068889_+\|cardiolipin-synthase	gnl\|CDD\|234967	PRK01642, cls, cardiolipin synthetase; Reviewed.	2.49395e-94
NZ_CP020743.1\|WP_002148565.1\|2057187_2057604_+\|FosB/FosD-family-fosfomycin-resistance-bacillithiol-transferase	gnl\|CDD\|179740	PRK04101, PRK04101, metallothiol transferase FosB.	3.84209e-99
NZ_CP020743.1\|WP_000932386.1\|2063792_2064734_+\|magnesium-transporter-CorA-family-protein	gnl\|CDD\|213361	cd12827, EcCorA_ZntB-like_u2, uncharacterized bacterial subfamily of the Escherichia coli CorA-Salmonella typhimurium ZntB family. A uncharacterized subfamily of the Escherichia coli CorA-Salmonella typhimurium ZntB (EcCorA-ZntB_like) family of the MIT superfamily of essential membrane proteins involved in transporting divalent cations (uptake or efflux) across membranes.The EcCorA-ZntB-like family includes the Mg2+ transporters Escherichia coli and Salmonella typhimurium CorAs, which can also transport Co2+, and Ni2+. Structures of the intracellular domain of EcCorA-ZntB-like family members, Vibrio parahaemolyticus and Salmonella typhimurium ZntB, form funnel-shaped homopentamers, the tip of the funnel is formed from two C-terminal transmembrane (TM) helices from each monomer, and the large opening of the funnel from the N-terminal cytoplasmic domains. The GMN signature motif of the MIT superfamily occurs just after TM1, mutation within this motif is known to abolish Mg2+ transport through Salmonella typhimurium CorA. Natural variants such as GVN and GIN, such as occur in some ZntB family proteins, may be associated with the transport of different divalent cations, such as zinc and cadmium. The functional diversity of MIT transporters may also be due to minor structural differences regulating gating, substrate selection, and transport.	6.43395e-137
NZ_CP020743.1\|WP_002031473.1\|2057616_2058162_+\|short-chain-dehydrogenase	gnl\|CDD\|236232	PRK08309, PRK08309, short chain dehydrogenase; Provisional.	3.60116e-109
NZ_CP020743.1\|WP_002168580.1\|2060805_2061423_+\|NUDIX-hydrolase	gnl\|CDD\|240029	cd04672, Nudix_Hydrolase_14, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	4.61035e-65
NZ_CP020743.1\|WP_085310601.1\|2062226_2063606_+\|polysaccharide-biosynthesis-protein	gnl\|CDD\|240529	cd13124, MATE_SpoVB_like, Stage V sporulation protein B, also known as Stage III sporulation protein F, and related proteins. The integral membrane protein SpoVB has been implicated in the biosynthesis of the peptidoglycan component of the spore cortex in Bacillus subtilis. This model represents a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	3.49979e-126
NZ_CP020743.1\|WP_002012447.1\|2065833_2066703_+\|TIGR03943-family-protein	gnl\|CDD\|226214	COG3689, COG3689, Predicted membrane protein [Function unknown].	2.92469e-92
NZ_CP020743.1\|WP_002031467.1\|2053918_2054371_+\|methylated-DNA--[protein]-cysteine-S-methyltransferase	gnl\|CDD\|234860	PRK00901, PRK00901, methylated-DNA--protein-cysteine methyltransferase; Provisional.	6.88974e-60
NZ_CP020743.1\|WP_085310595.1\|2054396_2055395_+\|DUF2628-domain-containing-protein	gnl\|CDD\|313994	pfam10947, DUF2628, Protein of unknown function (DUF2628). Some members in this family of proteins are annotated as yigF however currently no function is known.	7.4634e-17
NZ_CP020743.1\|WP_085310593.1\|2052747_2053785_-\|NADPH-dehydrogenase-NamA	gnl\|CDD\|184110	PRK13523, PRK13523, NADPH dehydrogenase NamA; Provisional.	0
NZ_CP020743.1\|WP_085310589.1\|2050569_2051520_-\|zinc-ABC-transporter-substrate-binding-protein	gnl\|CDD\|238499	cd01017, AdcA, Metal binding protein AdcA. These proteins have been shown to function in the ABC uptake of Zn2+ and Mn2+ and in competence for genetic transformation and adhesion. The AdcA proteins belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism. They are comprised of two globular subdomains connected by a long alpha helix and they bind their ligand in the cleft between these domains. In addition, many of these proteins have a low complexity region containing metal binding histidine-rich motif (repetitive HDH sequence).	1.35776e-130

>NZ_CP020743.1|WP_002012438.1|2058175_2058787_+|phosphoserine-phosphatase-1
MKTTVYVTRHGETEWNVAGRMQGRKNSALTENGMIQAKQLGERMKDLPLHAIYSSPSERTLHTAELIKGERDLPIIEDERFYEINMGIWEGQTIADLEMQYPEEVHLFWNEPHLFQSTSGENFAAVHKRVIEGIHFLLEKHKGENILIVTHAAAAKLLVGHFAGFEIEHVWEEPFMHSASLSVIEFDENRGKVKQFADISHFQ
>NZ_CP020743.1|WP_002031473.1|2057616_2058162_+|short-chain-dehydrogenase
MHALVIGGTGMLKKVSMWLCDQGFRVSVIGRDEVKLENVKQASSAPENITCLPLDYQNDDGLKRSITNTIEQNGPITLVVAWVHSSAKHALRLICNEVELSSEKYSLFHILGSSASRTKSQKIGGTLCSYYRIILGFILEDTYARWLTHEEIADGVIKGIESKCTEWIVGRVEPWESRPKW
>NZ_CP020743.1|WP_002148565.1|2057187_2057604_+|FosB/FosD-family-fosfomycin-resistance-bacillithiol-transferase
MLKGINHLCFSVSNLENAIMFYERVLEGELLVKGRKLAYFNICGVWIALNEEAHIPRKEIHQSYTHLAFSVEQEDFERLLQRLEENKVHILQGRERDVRDCESIYFVDPDGHKFEFHSGTLQDRLNYYREEKPHMTFY
>NZ_CP020743.1|WP_085310597.1|2055466_2057128_+|peptide-ABC-transporter-substrate-binding-protein
MKRKVTTIAAVALSASVLVAGCGNGEKASTTKKESSKGMADKQVLNLLETAEIPSMDTSKSTDSVSFRVFVNAMEGLYRLDKDNKPTPGMAKDVKISEDKKTYTFELRDAKWSNGDPVRAQDFVYAWQRTLDKAIAAEYAFILFDVKNAQKVNKGEVPSDQLGVKAKDDKTLVVELEQPAPYFLELTSFPTFFPLNEKYVKGQGDKYGLEADKLLYNGPFTMSEWKHEQSYQLKKNPNYWDKDAVKLQEINVGIVKETSTGVNLYDSDQADRVILSSEFVDKYKKNKPDEFKTKLDPRMYFLRFNQKNATFKNQKVREAIDLAYDKKGIADVILNDGSLPAYFLVPEKFTTGPDGKDFRTVNKNFRDSKDNATKAKKLWEEAKKELGQDTITVELLNDDNGSRKKVGDFIKEELEKNLPGIKVNLKQQPYKQKLDLEKKFEYEFSLSAWSPDYPDPMTYIDMFVTGSSFNEMDYSNPKYDDLVTKSKGELLKDDAARWKALAEAEKILIGQDAAISPTYQQSTAYLEKTYVNGIANHTFGGDFSYKWAYITKK
>NZ_CP020743.1|WP_085310595.1|2054396_2055395_+|DUF2628-domain-containing-protein
MKCINCGRPCINDQLNCANCQRNLHNKQGEESSLIDKELEVYVGRQYPYYKRKWELENKRIARWSWNGLAAIFNVGWLGYRKYYLPAALFILLLVACDAFSYYMGFNVALPIINMVPLTFLLLIFILFGMGIFANGLYYQFAERRIYRIKARGIKDESVENYLIRDSGGTSKMGATIVTILAVASIFFSHFFFPTDRDIIQKVRTSSLYEYPFFSIGESFESYFQNSGWIYYRGSEGMELVEFQGYSPGMPRQKVTIRFIVDYKLSEIEPYSLTINGESKNEEEFLKMMEEIFKVQNPFEIEDGLQVNAIQQSGGKAISDRFFSFYENKYLK
>NZ_CP020743.1|WP_002031467.1|2053918_2054371_+|methylated-DNA--[protein]-cysteine-S-methyltransferase
MYQAYYESELGLLEITANTKGITSVIFVEERKEEHKNELVEQCINELDEYFEGKRKEFTVPLSAEGTPFQKNVWEALYTVPYGVSASYLDIADKVGNTKAVRAIGGANSRNPISIIVPCHRVIGKSGKLVGYAGGLWRKEWLLKHEGILK
>NZ_CP020743.1|WP_085310593.1|2052747_2053785_-|NADPH-dehydrogenase-NamA
MELQLFSPYTIKDVTLKNRIVMSPMCMYSSENEDGRVTNFHLIHYGTRAAGQVGLVMIEATAVLPEGRISNKDLGIWDDNLIEGLHKTTAFIHDNGAKAAIQLAHAGRKAELETDALAPSAIPFNDGMKIPVEMSKQQIKDTVLAFQKAALRSKQAGFDVIELHGAHGYLINEFLSPLSNKRTDEYGGSPENRYRFLREIIDSVNEVWNGPLFVRISANDYHPDGLTVQDYVQYTGWMKEQGVDLIDCSSGAVVPAHIDVYPGYQVQYAKHIKGHVDIATGAVGLITTGSQAEQILNNNEADLIFIGRELLRNPYFPRIAANELGFELKEPYQYRRAPGKIKTNK
>NZ_CP020743.1|WP_085310591.1|2052058_2052718_+|oxidoreductase
MNKRTALVLGASGLVGQEITRLLLDSDYYDSVTIFVREPLQLQHEKLQQKQVDFSVLEEYKEFFAVDDVFSCLGTTIKKAKSKSNFKKVDYEYTLRAACLAEKQGVQNFLVISSMGAKPKSFFFYSQVKGKMEEELKKLVIGGIHIFRPSLLVGNRQEYRFGERMAEKLSRILPFVFKGAFKKYKPISAKDVAKGMYITALREESGIHIYSSNDIIEIK
>NZ_CP020743.1|WP_002012427.1|2051717_2051942_+|hypothetical-protein
MIGAYVTMLLSYIGREQKKGDERLGYFMEAILLILAVVLPLSFVLIFLRRLISNLGDATTITKLPAEEKEEKKE
>NZ_CP020743.1|WP_085310589.1|2050569_2051520_-|zinc-ABC-transporter-substrate-binding-protein
MPKKLALFSFILIFTLIFAGCSNNKDSAAKKDGKLSVYTTIFPLADFAKKIGGDYVNVETIYPPGADSHTFEPSQKQTVQVAKADLFVYNGAELEPFAEKMEKSLKKENVKIVNASKDIELRASSEEEQHDHGDGHKEDEHHHDKDPHVWIDPTLAMKQAEKIKNALVELQPEHKKEFEKNFAALQTKFTDLDDQFKAVVANAKTKEILVSHAAYGYWEQRYGLKQIPIAGISASDEPSQKQLADITKTVKEHGLKYILFETFSTPKVASVIQQETGTKILRLNHLATISEDDAKNNKDYFTLMEENVNTLKEATN
>NZ_CP020743.1|WP_085310599.1|2059623_2060700_+|spore-coat-protein-CotH
MLPSYEFFIHPMYLVEMKKDIWSDSPVPAKLTYGKKKYDIDIVYRGAHIREFEKKSYHVMFYKPKKFQGAKEFHLNSEFMDPSLIRNKLSLDFFHDIGVISPKSQHVFIKINGQIQGVYLQLESVDENFLKNRGLPSGSIYYAIDDDANFSLMSERDKDVKTELFAGYEFKYSNKNSEEQLSEFVFQANTLSREDYEKEIGKFLHVDKYLRWLAGVIFTQNFDGFVHNYALYHNDETNLFEVIPWDYDATWGRDVQGRPLNHEYIRIQGYNTLSARLLDIPVFRKQYRSILEEILEEQFTVSFMMPKVEGLCESIRPYLLQDPYMKGKLETFDQEADMIDEYINKRRKYIQDHLHELD
>NZ_CP020743.1|WP_002168580.1|2060805_2061423_+|NUDIX-hydrolase
MTVKWIDWVKQIQSIAQAGLTYSKDVYDIERFQQLRDISVSMMSHYTKTDWEVVENLFASETGYQTPKVDIRAVIFQNEKLLFVKEKSDRKWALPGGWADVGYTPTEVAAKEVLEETGYEVDDFKLLAIFDKEKHQPSPSATHVYKIFIGCKIIGGEKKTSIETEDVEFFDENELPNLSIARNTEEQIKEMFAYMKEPQKETLID
>NZ_CP020743.1|WP_002031481.1|2061527_2062130_+|DedA-family-protein
MLANIIDQLLQFFASLGYFGVALALMIEIIPSEIVLSYAGFLVADGKISFVGAVIAGTIGGTLAQIFLYWLGYYGGRPVVEKYGKYLLINKHHLDIAENWFKRYGAGVIFSARFIPIVRHAISIPAGLAKMPLKLFTLYTVVAIIPWSILFIYLGEKLGGNWRHIKEYASDYTHYIIIGAVLFVALYFGLKYLKKKKAAR
>NZ_CP020743.1|WP_085310601.1|2062226_2063606_+|polysaccharide-biosynthesis-protein
MKGSPFLRGTIFLTMATMISKMLGFIYVIPFTAMVGTSGYVLYTYAYRPYTIMLSIATMGLPLAVSKMVSKYDQLNDYHTVKRVLKSGIVFMVIMGVISCLALYMLAPHLAKLVIDGNDQSGNSVVAVTHNIQIVSFALILVPVMSLLRGFFQGFQSMGPSALSVVVEQFFRVLTILIGSFVVLYVIKASVSLAVGISTFGAFMGALGGLSVLSAYYIRRRKHLKKKEIASIPQTTKTFFSLYRELFTYSIPFVVVGLAIPLYQTIDTFTINKLLIQVGYMQGEAEKINAIIGLVQMVVLIPVSVATAFSMSLVPEMTKAYTAGNEKLLYKHFTRTNLLVVGITVPATIGMMILAKPVYTLLFGAGNDPEMGSIILQYYAPACILFSLFTVTAAMLQGINQQQKTVLGLVIGITVKIVLNIVLLPYFDYVSFIISTYAGYTISVGFNLWMLSKYVIKAT
>NZ_CP020743.1|WP_000932386.1|2063792_2064734_+|magnesium-transporter-CorA-family-protein
MLNIYLTDRNGKLQEIEEMQKGCWINVLHPTEEEIQYLVQTLNVDLDFIKDPLDDEERSRIEKEDNNTLIIVDIPTVRHDEEGNSIYDTIPIGMIVMPDCFVTICLEENPIFERFINQRIKEFYTFKKTRFALQLLYTISTYYLRYLKQINRKTIDLEHQLNKSMKNKEIFTLLGLEKSLVYFTTSLKANKIVIQKLMRNSTFLKMYEDDQDLLEDVLIENKQAIEMAEIYSHILSGMMNTFSSVISNNLNSVMKLLTSITIILSLPTMVSSFFGMNVKVPFEGEAHGFVIVLIICVTLSFTLAFVFWKKRYF
>NZ_CP020743.1|WP_000418719.1|2064933_2065830_+|permease
MELFQLPKAFLQMNTIFISILIEALPFVLIGVFISGFIQMFVTEDMVAKWMPKNRFLSVLLATFLGMMFPGCECGIVPIVRRLIGKGVPPYAGIAFMLTGPIINPVVLFATYVAFGSSMHMVWYRSIVAIIVAIIVGIILSFMFKEHQLRDDHFPEVNHKRPLRTKMWDVCTHAVEEFFSMGKYLVLGALIAAAVQTFVQTSTLLAIGQGPFSSSAVMMGLAFILSLCSEADAFIASSFQSTFSTASLVAFLVYGPMVDIKNMFMMLATFKTKFVIVVTVTVTLVVYASSLLIYAMGW
>NZ_CP020743.1|WP_002012447.1|2065833_2066703_+|TIGR03943-family-protein
MFRAYILLGFTILIGQLHISGNITKYINMKYAYLSKTAAIILGFLTIVQIIIVFQKEHQKEKEKHDCSCDHSHCGHDHSKDENTWWKKVFSYTLFCFPIITGLFFPIATLDSDIVKAKGFHFPVAQAESKDPFMTRQFLRPDTSIYYGKEGYRGVMEKGKKEFVTKDNITLKDEDFLKGMETIYNYPGEFTGKTLSYKGFVFRDDSSKKEQYFLFRFGIIHCVADSGVYGMLVKKPEGVEWKNDDWIQIEGEISTEFYQPFHANIPVLEVTKWNKVEQPKEQYVFRGAD
>NZ_CP020743.1|WP_002012448.1|2066822_2067329_+|acyl-CoA-thioesterase
MTEVKGKTANESRVFKTSRVFPTDLNDHNTLFGGKILAEMDMVASISATRHSRMECVTASMDWVDFLHPVRSSDCVSYESFVIWTGRTSMEIFVKVVAEDLISGKKRVAATSFVTFVALSKENNPVPVPRVIPETEEEKELHRIAVLRAEQRHIRKAESKKVATLLTF
>NZ_CP020743.1|WP_000505094.1|2067458_2067545_-|YjcZ-family-sporulation-protein
MGFAHGNGFALLVVLFILLIIVGAACFC
>NZ_CP020743.1|WP_085310602.1|2067704_2068889_+|cardiolipin-synthase
MKRFLIVIICFIGVFIWMNVDVEMGKKMASGYELEKIRSGDFQLYTNGDELYKSLFEDINRAERNVYIHFYIVGKDEVSQKFLKLLEKKASSGVDVKLSVDRIGGYKLKKKIINQLKEKGVKFTFSKKPKLKNLFYSLHQRNHRRIVTIDGKVSYIGGFNIGKEYLGQDPKFGPWRDYHVRIKGNGATDMERKFAEDWQEDTGEKFPIHQELPVQGNVKYQYVFSNGKGLWKEYGAFLKKAKHSLIIATPYFVPSKEMVKGLKDALNRGVHVKILVPFKSDAVLLKQAAYPYLKDMLDAGAEIYQYRNGFFHGKVTIIDEEMVDIGTANFDNRSFYLNSESNCFIYDKTVVADVWSRLKEDFHKSKRFSEEDFEKISRWDWFLARISNVIASYL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP020743_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP020743_3

3041208-3041367

Orphan

Consensus_repeat	Method
ATTTAGGAATGAATGTTCATTCCTAT	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP020743_3

>merge|NZ_CP020743|3|3041208-3041367|PILER-CR
ATTTAGGAATGAACGTTCATTCCTATTATCCTATTAAATTATTTTTCAATTCTATTAAATCACTCCCTGCGGAATGAATATTCATTCCTTTAATTGTACAGATATATCATCTCCTGTAATCGTTTTTTATATTTATTTAGGAATGAATGTTCATTCCTGT

>NZ_CP020743|3|2|3041208-3041367|PILER-CR
ATTTAGGAATGAACGTTCATTCCTAT	TATCCTATTAAATTATTTTTCAATTCTATTAAATCACTCCCTGC
GGAATGAATATTCATTCCTTTAATTG	TACAGATATATCATCTCCTGTAATCGTTTTTTATATTTATTTA
GGAATGAATGTTCATTCCTGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP020743.1\|WP_085311727.1\|3030939_3031485_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP020743.1\|WP_085311731.1\|3042138_3043302_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|226925
NZ_CP020743.1\|WP_085311734.1\|3050994_3054507_-\|DUF4020-domain-containing-protein	unknown	unknown	gnl\|CDD\|372518
NZ_CP020743.1\|WP_002066031.1\|3046515_3047616_-\|histidinol-phosphate-transaminase	unknown	unknown	gnl\|CDD\|134568
NZ_CP020743.1\|WP_002013434.1\|3047634_3048807_-\|chorismate-synthase	unknown	unknown	gnl\|CDD\|171518
NZ_CP020743.1\|WP_002013433.1\|3049089_3050166_-\|bifunctional-3-deoxy-7-phosphoheptulonate-synthase/chorismate-mutase	unknown	unknown	gnl\|CDD\|183614
NZ_CP020743.1\|WP_085311722.1\|3024399_3024708_-\|gamma-type-small-acid-soluble-spore-protein	unknown	unknown	unknown
NZ_CP020743.1\|WP_085311732.1\|3043592_3044099_-\|STAS/SEC14-domain-containing-protein	unknown	unknown	unknown
NZ_CP020743.1\|WP_002013443.1\|3041385_3041952_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|292911
NZ_CP020743.1\|WP_085311725.1\|3027393_3027609_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020743.1\|WP_085311726.1\|3030395_3030821_-\|PadR-family-transcriptional-regulator	unknown	unknown	unknown
NZ_CP020743.1\|WP_002131144.1\|3045422_3046523_-\|prephenate-dehydrogenase	unknown	unknown	gnl\|CDD\|235824
NZ_CP020743.1\|WP_060750470.1\|3029525_3030353_+\|polysaccharide-deacetylase	unknown	unknown	gnl\|CDD\|200569
NZ_CP020743.1\|WP_085311728.1\|3031658_3033107_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP020743.1\|WP_002032778.1\|3036078_3037704_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|237894
NZ_CP020743.1\|WP_085311733.1\|3044116_3045406_-\|3-phosphoshikimate-1-carboxyvinyltransferase	unknown	unknown	gnl\|CDD\|235037
NZ_CP020743.1\|WP_002032800.1\|3054658_3055096_+\|YndM-family-protein	unknown	unknown	gnl\|CDD\|371204
NZ_CP020743.1\|WP_085311723.1\|3024982_3025603_-\|replication-relaxation-family-protein	unknown	unknown	gnl\|CDD\|379384
NZ_CP020743.1\|WP_085311729.1\|3033154_3035128_-\|LTA-synthase-family-protein	unknown	unknown	gnl\|CDD\|224287
NZ_CP020743.1\|WP_085311730.1\|3038016_3041133_-\|MMPL-family-transporter	unknown	unknown	gnl\|CDD\|225272

Protein	Function_ID	Function_description	E-value
NZ_CP020743.1\|WP_085311727.1\|3030939_3031485_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	2.5889e-07
NZ_CP020743.1\|WP_085311731.1\|3042138_3043302_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|226925	COG4552, Eis, Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only].	6.89764e-72
NZ_CP020743.1\|WP_002066031.1\|3046515_3047616_-\|histidinol-phosphate-transaminase	gnl\|CDD\|134568	PRK01533, PRK01533, histidinol-phosphate aminotransferase; Validated.	0
NZ_CP020743.1\|WP_085311734.1\|3050994_3054507_-\|DUF4020-domain-containing-protein	gnl\|CDD\|372518	pfam13212, DUF4020, Domain of unknown function (DUF4020). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, and is typically between 176 and 195 amino acids in length.	1.6569e-57
NZ_CP020743.1\|WP_002013433.1\|3049089_3050166_-\|bifunctional-3-deoxy-7-phosphoheptulonate-synthase/chorismate-mutase	gnl\|CDD\|183614	PRK12595, PRK12595, bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed.	0
NZ_CP020743.1\|WP_002013434.1\|3047634_3048807_-\|chorismate-synthase	gnl\|CDD\|171518	PRK12463, PRK12463, chorismate synthase; Reviewed.	0
NZ_CP020743.1\|WP_002013443.1\|3041385_3041952_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|292911	pfam16295, TetR_C_10, Tetracycline repressor, C-terminal all-alpha domain.	1.26401e-63
NZ_CP020743.1\|WP_085311723.1\|3024982_3025603_-\|replication-relaxation-family-protein	gnl\|CDD\|379384	pfam13814, Replic_Relax, Replication-relaxation. This family includes proteins which are essential for plasmid replication and plasmid DNA relaxation.	1.11908e-17
NZ_CP020743.1\|WP_002131144.1\|3045422_3046523_-\|prephenate-dehydrogenase	gnl\|CDD\|235824	PRK06545, PRK06545, prephenate dehydrogenase; Validated.	2.54353e-162
NZ_CP020743.1\|WP_060750470.1\|3029525_3030353_+\|polysaccharide-deacetylase	gnl\|CDD\|200569	cd10944, CE4_SmPgdA_like, Catalytic NodB homology domain of Streptococcus mutans polysaccharide deacetylase PgdA, Bacillus subtilis YheN, and similar proteins. This family is represented by a putative polysaccharide deacetylase PgdA from the oral pathogen Streptococcus mutans (SmPgdA) and Bacillus subtilis YheN (BsYheN), which are members of the carbohydrate esterase 4 (CE4) superfamily. SmPgdA is an extracellular metal-dependent polysaccharide deacetylase with a typical CE4 fold, with metal bound to a His-His-Asp triad. It possesses de-N-acetylase activity toward a hexamer of chitooligosaccharide N-acetylglucosamine, but not shorter chitooligosaccharides or a synthetic peptidoglycan tetrasaccharide. SmPgdA plays a role in tuning cell surface properties and in interactions with (salivary) agglutinin, an essential component of the innate immune system, most likely through deacetylation of an as-yet-unidentified polysaccharide. SmPgdA shows significant homology to the catalytic domains of peptidoglycan deacetylases from Streptococcus pneumoniae (SpPgdA) and Listeria monocytogenes (LmPgdA), both of which are involved in the bacterial defense mechanism against human mucosal lysozyme. The Bacillus subtilis genome contains six polysaccharide deacetylase gene homologs: pdaA, pdaB (previously known as ybaN), yheN, yjeA, yxkH and ylxY. The biological function of BsYheN is still unknown. This family also includes many uncharacterized polysaccharide deacetylases mainly found in bacteria.	4.94935e-82
NZ_CP020743.1\|WP_085311728.1\|3031658_3033107_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.99217e-102
NZ_CP020743.1\|WP_002032778.1\|3036078_3037704_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|237894	PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional.	0
NZ_CP020743.1\|WP_085311733.1\|3044116_3045406_-\|3-phosphoshikimate-1-carboxyvinyltransferase	gnl\|CDD\|235037	PRK02427, PRK02427, 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional.	0
NZ_CP020743.1\|WP_002032800.1\|3054658_3055096_+\|YndM-family-protein	gnl\|CDD\|371204	pfam10710, DUF2512, Protein of unknown function (DUF2512). Proteins in this family are predicted to be integral membrane proteins, and many of them are annotated as being YndM protein. They are all found in Firmicutes. The true function is not known.	1.25914e-43
NZ_CP020743.1\|WP_085311729.1\|3033154_3035128_-\|LTA-synthase-family-protein	gnl\|CDD\|224287	COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane].	0
NZ_CP020743.1\|WP_085311730.1\|3038016_3041133_-\|MMPL-family-transporter	gnl\|CDD\|225272	COG2409, COG2409, Predicted drug exporters of the RND superfamily [General function prediction only].	4.07678e-141

>NZ_CP020743.1|WP_085311730.1|3038016_3041133_-|MMPL-family-transporter
MSKLKSWRSLSFLLWIVITIAMIVMMPNMDQLVKEKGQITIPNTEQSSIADKMIKEMDKEGAEKYEIIAVFNSGSKKALTNEQKEEITKTINALQNEKEQLGIKEVVSHLDNKELQKQLVSKDNTTILTQISVDKKHGKISKIANNLHKKVQTKGVTTYLTGSDLIAGDFLTSSQEGVKKTEVISIIFILVVLIIVFRSPVVPIISLLTVGVSYLISMGIIAHLVDQFNFPFSNFTQVFVVVVLFGVGTDYNILLYTRFKEELSKQENAYLATKETFKSAGKTVLYSGIAVLIGFASLALASFKLYQSTSAVAIGVAVLLLVLTTLNPFFMVLLGKGMFYPVKTFKGHEDSRLWGFFAKNSVARPFIALIIVFVISIPFVLKYSNTLNYNDLFEVDNKYESKMGINVIEEHFPPGFSSPSTLVIQSDKKLDEANSLQTLDELTDKISKVKGVSEVYSPTRPTGDKIKELYINKQAGELNTGLGDANGGIKEINEGLTDAKDKMDSNDSNSLANVQKLIDGTNEAKNGVSALGTALNQLSNGINNGAQGAKQIEDGLAALNGNINALSNATSQLHAGYAQLEKGLSSYDQYFGSISQAIDGAKKGYEQIETLMNNFIQTKPELANDPNVQQTLGIAKEAQKQLSVLSNELNQLATQHKAAMSSFKEANQSLLKVDNGLKEMNNGVTQLQKGAAELKNGLNEGATGSKQISNKSADLQSGLTKINDGQGQLLTGLKDLQEKMGQLQSGLSKSTEGLGKVSNGLGDAQKYLGELNESKSSEKFYIPKEVLEGEDFQKALNTYMSHDRKTAKMTIILDVNPYSKEAMPIIQEINKTIDGTLKGTELNDAKKAIGGTTARNVDLKEVTGQDFLRTATIMLLGISLVLIVITRSFLNSIFIIGSLILAYFASLGISEQISAHVLNVESLSWNVPFFSFIMIVALGVDYSIFVMMRYNELEGDSVTKIVNASRHIGGVVLSAALILGGTFAALIPSGVLTLIQVASVVGVALLLLALIVMPILLPALIGLTSKLKSYKEKIINTK
>NZ_CP020743.1|WP_002032778.1|3036078_3037704_-|ATP-binding-cassette-domain-containing-protein
MITVSNVSLRFADRKLFEDVNIKFTPGNCYGLIGANGAGKSTFLKILSGEIDQSTGDIHITPGERLAVLKQNHFEYEEFPALETVMMGHTRLYKVMQEKNAIYMKEDFSDEDGMRAAELEGEFAELNGWEAESEAAILLKGLGIGEDIHDKKMSELTGAEKVKVLLAQALFGQPDILLLDEPTNHLDLKAIQWLENFLMNFENTVIVVSHDRHFLNKVCTHMADLDFGKIQLYVGNYDFWYESSQLALKLTQDSNKKKEEKVKELQNFIARFSSNASKAKQATSRKKLLDKITLDDIRPSSRRYPFVGFTPEREVGNDLLTVEGISKTIDGEKILDNVNFTLNKGDKVAFIGRNDIAMTTLFKILMGEMEPDSGSFKWGVTTSQAHFPRDNSEYFENSDYTLIDWLRQFSPQDESESFLRGFLGRMLFSGEEVKKNVSVLSGGEKVRCMLSKMMLSGANVLTLDDPTNHLDLESITALNNGLITFKGTLLFTSHDHQFVQTIANRIIEVTPNGVVDKVATYDEFLESQELQKQVDAMYKGQ
>NZ_CP020743.1|WP_085311729.1|3033154_3035128_-|LTA-synthase-family-protein
MQQFLLKSKRVLSNHFGFFVFAVILLWLKTYAAYVTEFNLGISNTIQKFLLFFNPLSSAVLFLGLALFAKGKRAYIWLIIINLLMSILLYANVVYYRFFSDFITFPTLTQTNNFGDLGGSIFALLHLYDPLYFLDTIILIVLVATKFVNPKPIRVAKHKLSLVFVAGILLFSVNLGLAESDRPELLTRTFDRNYIVKYLGAYNFTIYDGIQSAKASTERALADGDNMTEVRNYLTSTYASPNPEYFGKGKGMNVIYIHLESFQNFLIDYKLNGQEVTPFLNSFTKDANTLYFDNFFHQTGQGKTSDAEFMLENSMFGLPQGSVFTNKAHNTYQSAPAILGQQGYTSAVFHGNYKTFWNRDDIYKSFGFNKFFDASYYDMNEKDVVNYGLKDKPFFNESIPLLQTLKQPFYTKFITLSNHFPYPIDKAEATIEPAKTGDSSVDTYFQTARYLDESVKGFIDYLKQSGLYDNSIIVMYGDHYGISDNHSAAMSQIMGKEMNAFENAQLQRVPLIIRVPGMEGGVQHQYGGEIDVLPTLLHLLGTDTKNYVQFGSDLLSPEHKQVVPFRNGNYVSPTVTALNGKYYDTATGKPVEFTDEIKQNEQMVQKSLKYSDQVVNGDLLRFYTPEGFTPVEPSKYNYNNRDKDKTKVKTTEDGETK
>NZ_CP020743.1|WP_085311728.1|3031658_3033107_+|DHA2-family-efflux-MFS-transporter-permease-subunit
MQKEISERNKKIILVVLISGCFLSTLNQTLLNVAMSNLMEVFDVTAATVQWLSTGFMLINGVLVPITAFLMKRFTTRQLFISSMLSLFIGTVLCACAMNFGTLLTGRMIQAVGAGIIMPLMMTVILYLYPSEKRGSIMGTIGFAIIFAPAIAPTLSGFIIEYVSWRWLFIGFAPFVLIVIILALKYLMNVAETTKAKLDIVSVILSTIGFGCIIFGFSSAGSKGWDHPVIVTIIIIGIIVTSLFCLRQIKSNDPLLNLSVFKYKVFTLTSVINVLITMIMYADLIILPIYLQNGRGFTAFESGLLLLPGAVINAFLSPITGKMFDKYGAKPLFITGLICIIISMWGVIDLTESTTYMYLMVRTIILRIGLSFISMPLNTAGLNALPRELGSHGSAVNNTIRQLAGAIGTAVIITVYTIQSTSHTSQLSSENGSISAMQVTKLASIFSSSDAYVFMLVLSFVALIIACFMPKKVALQKSESKS
>NZ_CP020743.1|WP_085311727.1|3030939_3031485_-|TetR/AcrR-family-transcriptional-regulator
MSTPKKEDPRTVRSREMFKNAVFSLLCENPSISSLTVQKVATKAGLNRTTFYLHYQDIQDLLDQITNEISNELSNKIADLIHAKDLSEKQKLTQLLDYLYNHRNYLFILFKMNQFEEQLFLFLKELIETRRENTKKDLPDNYVAVDIKTASLVGIIMWWIRHGLHFSSDYIANQIYFMYKG
>NZ_CP020743.1|WP_085311726.1|3030395_3030821_-|PadR-family-transcriptional-regulator
MNFQNEKISLHLEVVNYQYKDAKDECDRNWLRVKAKLSEENKVFETMDPFLQTSDLQYMIKWFQALPNPTYNELAFMEPNLEFEFMGEKEEEFHLVIRLSLELKPEWCKEEEYEFSISITQEDRENMIRSIEDQQRKFPKR
>NZ_CP020743.1|WP_060750470.1|3029525_3030353_+|polysaccharide-deacetylase
MHNGIRMTTLVKRALLICAGVLFTYEAAYGSTHIALASTEDEAKSVQLVSEIQTSLAPKEAPKHYNGQVRKVAYLTFDDGPGKYTAELLDMLKSENAKATFFLIGSNVKAFPDLVKREDAEGHYVGMHSMTHNYKKLYTEGHYVDEMKEDQGLIAGVLGKSPVLTRPSYGSMPGLNEALRNKVVENGLKVWDWTIDSLDWKYNKMPVDAASAKIVENVLHGATNPTEVILMHDIHPQSVKAVPGIIKGLKERGYELEAYNENEHFPLNFWHDNRM
>NZ_CP020743.1|WP_085311725.1|3027393_3027609_-|hypothetical-protein
MCMTCSNTGVVHTEIYPGMVTVKACTCEIAKQQEATQQERWEAWLQRFAEWEKGCSVSNIVRGYPKGKYAV
>NZ_CP020743.1|WP_085311723.1|3024982_3025603_-|replication-relaxation-family-protein
MNIQSHMKINRQMAILATIRKLQFATRRHVMSVHDMGGIRNANRIMSDLKPYVSKTMQGKEYVYYLNKEGHAMFGDDEKVVSRGKLAHALLRNEAWLHLFCPDDWQIETDIRYKKNEEKKKIVPDVKFRDEEGILHAVEVDRSQKMKVNEEKLKNYEEFTKIYKQKYNGKMPIIHFFTITKYREKKLEELVAKYDVFVKVYVIEEI
>NZ_CP020743.1|WP_085311722.1|3024399_3024708_-|gamma-type-small-acid-soluble-spore-protein
MDKNQQGHNKTISGASIQSAKQQNAGYGTEFATETNVNQVKQQNAQSAAKKSQAASAGVQNANAGYGTEFATETNVNQVKQQNAQSAAKKSQAFGKNQGTDQ
>NZ_CP020743.1|WP_002013443.1|3041385_3041952_-|TetR/AcrR-family-transcriptional-regulator
MAKNKQEDIFDAAIKLFAERGYDGTTIPMIAEKANVGAGTIYRYFENKEALVNSLFSKSMLQLSETIKTDFPVEANIREQFSHTYNRLFEFARNNVDAFLFTNSHCDSYFLDEQSKKIFDDFIGFFMNIIEDGIEKGFLRPLPIIALIIIVYQPLEKLIKVMATGQLEYSKELVKELEESSWNAIRII
>NZ_CP020743.1|WP_085311731.1|3042138_3043302_-|GNAT-family-N-acetyltransferase
MNVIQLKEDKFREALRLSEYAFQYKANEEWIEQKIARMKESHQIYGIMEGEELAAKLHLIPFHIYIGKEKFKMGGVAGVATYPEHRRSGYVKELLQHSLQTMKRDGYSVSMLHPFAVSFYRKYGWELCANRIVCQMTKSDLIIKKQVNGTVKRFSKDNHPEEVENLYETFAERFSGMLVRGRKWWLQAVYHNLTLAVYYDENKTAAGYILYKIENSKMKVEEFVPLHNEARIGLWNFICQHDSMIKDLEMILSETEPLLYTLQEPRVKAEVTPYFMGRIVDVEQFFKQYDWNWNNEEQEVILHITDSFAPWNNVTVQLKNNEITIVKEETAKENGIQIDINALSTIMFGYKRPLELNEIDLISGSEEEIRAFENVVPVRKPFIYDFF
>NZ_CP020743.1|WP_085311732.1|3043592_3044099_-|STAS/SEC14-domain-containing-protein
MQCICFFMLAFFVNNVALLCKNFILIDFMRFLRIIVTKGDGSKLSKQNISTTVSGDLIVTHLIGKINTADVYEWFNGFEQVCQQFISEGRKYKLLVDRKGYTPGHFSVQKAWKDKFFNETILNHSKAIAFLLEEGEIMNYLQQSNTKESVEFFDDYEQALIWLNEYPI
>NZ_CP020743.1|WP_085311733.1|3044116_3045406_-|3-phosphoshikimate-1-carboxyvinyltransferase
MKEKTVQTVNNGLNGTITIPGDKSISHRAVMFGAIAEGKTTIKGFLPGADCLSTISCFKEMGVEITQNRDEVTVIGKGLEGLQEPKAVLDVGNSGTTIRLMSGILVNTPFFSCVQGDASIAKRPMQRVTNPLKQMGAKIDGRKEGTFTPLTIRGGNLKAIEYTSPVASAQVKSAILLAGLRAEGVTAVTEPHISRDHTERMLEAFGVTVTRVGKTVKLAGGQKLKGTDVQVPGDVSSAAFFLVAGAIIPNSKLLLQNVGMNPTRTGIIDVLEKMGATFTVEQINEGASEPAANITIETSPLKGIEIGGDIIPRLIDEIPIIALAATQADGITVIKDAHELKVKETNRIDTVVAELTKLGARIEATDDGMIIYGKCKLKGNTVHSHGDHRIGMMLAIAGCIAEGETTIEDAEAVGVSYPTFFEELQTLAK
>NZ_CP020743.1|WP_002131144.1|3045422_3046523_-|prephenate-dehydrogenase
MCKKVVLIGTGLIGGSLALAIKKEHDVTIIGYDIFKEQVERAKELHVVDEVAVDLQRACEEANLIVFASPVEETKKLLHKLASFHLREDVIVTDVGSTKGTIMNEAEALLTKQVSFIGGHPMAGSHKTGVESAKAHLFENAFYILTPMNHVLDERVEELKEWLKGTGSHFLVLNTKEHDYITGIVSHFPHLIAAGLVKQVEKHAGDNPLIHQLAAGGFKDITRIASSSPKMWSDIVKQNRGHLLELLEEWISEMEELYKTVSKGDAGEIQSYFADAKEYRDSLPVRKRGAIPAYHDLYVDVLDKVGALAHITSILAEEEISITNLQILEAREGLLGVLRISFQREEDRTQAKIALGKEEYQTYETI
>NZ_CP020743.1|WP_002066031.1|3046515_3047616_-|histidinol-phosphate-transaminase
MRVKDQLSSLQPYKPGKSPEQMKEVYGNHSFVKLASNENPFGCSPRVLGELQKSWQEHALYPDGGAEVLRQTIAEKLQVQMEQVLCGSGLDEVIQIISRAVLCKGDNIVTAGATFPQYRHHAIIEGCEVKEIALKNGVYDLDEISSAVDEHTKIVWICNPNNPTGTYVNERKLTQFIESISENTLIVIDEAYYEYVTAKDFPETLPLLEKHNNILVLRTFSKAYGLASFRVGYAIGQEELIEKLNVVRLPFNVSSLAQKAATIAFNDEAFIEEIVRVNTEGLQQYESFCTENEIPFYPSQTNFIFLPVDDAGEIYEACAHAGFIIRPFPNGVRITIGTREQNEGVISVLKQHFENKKGKSRDEANV
>NZ_CP020743.1|WP_002013434.1|3047634_3048807_-|chorismate-synthase
MRYITAGESHGPQLTVILEGVPAGLTLTAEHINKELLRRQKGHGRGRRMQIETDTVEIASGVRHGMTLGSPITLIVKNDDFKHWTKVMGAEPISEQESKEMKRTITKPRPGHADLNGAIKYGHRDIRNVLERSSARETTVRVAAGAVAKQILKELGVEIAGHVLEIGGVQAKRISNLPIEEIQTITENSPVRCLDKEVEQEMMNAIDDAKSSGDSIGGIVEVIAEGMPIGVGSYVHYDRKLDAKLAGAIMSVNAFKGAEIGIGFEAARQPGSKVHDEILWDEEKGYTRNTNNAGGLEGGMTTGMPIVVRGVMKPIPTLYKPLASVDIDTKEAFQASIERSDSCAVPAAGVVAEAVVAWELAGALVEQFGKDRMELLKQNISQHNKYAKEF
>NZ_CP020743.1|WP_002013433.1|3049089_3050166_-|bifunctional-3-deoxy-7-phosphoheptulonate-synthase/chorismate-mutase
MANHELDQLRKQVDEINLQLLHLLNKRGEIVQKIGEQKQVQGTKRFDPVREREVLDMLAEHNEGPFETSTIQHIFKTIFKASLELQEDDNRKALLVSRKKKKENTIVNVKGELIGNGTQTFIMGPCAVESLEQVRQVGQAMKDQGLKLMRGGAFKPRTSPYDFQGLGVEGLQILRQVADEFDLAIISEILNPNDVEMALEYVDVIQVGARNMQNFDLLRAVGKVNKPVLLKRGLAATIDEFINAAEYIIAQGNDQIILCERGIRTYERATRNTLDISAVPILKKETHLPVIVDVTHSTGRRDLLLPTAKAALAIGADAVMAEVHPDPAVALSDSAQQMDIPEFHRFMDELKGFKNKLS
>NZ_CP020743.1|WP_085311734.1|3050994_3054507_-|DUF4020-domain-containing-protein
MTFLGKGESGMWITSEVEIPDELIDHLEQGKLVLFVGAGVSMKGKSNLPNFDDLVDEISKALYVERREMTEPHDYYLGKIAKTKDVHQVARDLVNIEKSKPNPLHYAIPRLFPLDTDVRIVTTNFDQHFTSVITEMNRELNIYYAPALPTGRAFKGLAYIHGNVEQEKEALILTDGDFGRAYLTEGWARRFLVDLFSNYTVLFVGYSHNDPVMKYLATGLPPSTRRYAFVAQGDNTYHWEHLGIRPIVYPNKANNHQALVKAVKRWAELMGDNYITKRMRIRDIVTVPPSVEQEQLSYIKQSIKKIETVRYFVEFARDYEWVEWLEAEGKLRNLFLLTANYDEVDELLAEWLVEQFLFSHQKELFQLIFKNHSKISPLWWRTICTYLNETKETMDPLLFARWTLLLLETAEKDSSSIEMITYLLQKCSFPEHKEIGLLLLTFILDGKLKLKRVRRWGNDTQESIELEESSRIPMPIFSHVERIWKEKMRPHITYYANPIMVTGLEKIQLLSLRQNALKRRDREISEQELQQNDFTFLIQIVKECLTYLCENNEKKANHYITEMIETDSVLQKRIAIEAMINNVFVTADDKLKWLLHVDVLLDFTCKHEVFQLLKNYYADALEETKEEVIQHVLEYLAEERAFDACLVLDLLFTCDSNSKCTAEGYELMKQKHPHFSSDLYSVPKKEANEQRITCNVTADGLLQLKDDEIMEQVRQFSRDGVFEQRHFLEMLSKACKLNVEWSISFAYQLVGVHEISNEVWFVCIREWRNNRNLTNEQIQKIIPLLQKFIRNTAFHWLISSFSYEISNRLEELDENSIRIVKRFAFSVLPQVMRGESDFKIGKQEFYNESIQHPVGKMTAVLLKLLAYDHLYDRNVYEYLFLFEEQVRVTSERTNFMFARLTADITFLYHIEKQWCRKNVLPYLDLKKESELTKYAWAGLCYTQINLPLFTEIRRYIKYAVEHLDALHPYTREAFLKWLSFVFIKCVLYWEQKTDWLYPLLMQENEENKIKFMQYLCYYVKTLSGKEQQKFWTAWLSVFLRERPKMGVITTREYMMLLRIVLCMDEVLEKGLNIISSKFQGVEGQSNQEEMKQLFIEILEKKERMKAYKELYANVFFTLLQTCQEADLLESEIIQIKELLTRYEVERHVLNLIENEIIRIGIVTENLQEES
>NZ_CP020743.1|WP_002032800.1|3054658_3055096_+|YndM-family-protein
MSDITVILIKFISCIIAFSIGLALFFPATLVQIISFSLFVTIVSYMFVDKIILNRIGNSAAIMTDFLLTYLSVWIFGNILLDNYMQIAWGSILSAIVFTLSEVIVHRFSNSHTRHSNDNIRINRRFAYGTEFAEEQNVLDKDKKK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP020743_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP020743_4

3059532-3060209

Orphan

Consensus_repeat	Method
TNCTTTNGCTTCTTCNTT	CRT

11 spacers

The CRISPR arrays of NZ_CP020743_4

>merge|NZ_CP020743|4|3059532-3060209|CRT
TGCTTTCGCTTCTTCTTTCGCTTTTTCTATTTCTCGTGCTTTCGCTTCTTCCTTAGCCTTTGCTATTTCTTGTGCTTTTGTTTCTTCCTTTTCTTTTTCCTTAGCTTTTGCTATTTCTTGTGCTCTTGCTTCTTCCTTTGCTTTTTCCATTTCTCGTACTTTTGCTTCTTCCTTAGCCCTTGCTATTTCTTGTGCTTTCGCTTCTTCTTTTACTTTTTCTATTTCTCGTACTTTTGCTTCTTCCTTAGCTTTTGCTATTTCTTGTGCTTTCGCTTCTTCTTTTACTTTTTCTTCTTCCTTGGTCTTTACTATTTCTTCTGCTTTCATTTCTTCCTTAACTTTTACTCTCTCTGTTACTTTCGCTTCTTCTTTAGGCTTTACTATTTCTTCTGCTTTCATTTCTTCCTTAACTTTTACTCTCTCTGTTACTTTTGCTTCTTCCTTGGTCTTTGCTATTTCTTCTGCTTTCATTTCTTCCTTAACTTTTACTCTCTCTGTTACTTTCGCTTCTTCTTTAGGCTTTACTATTTCTTCTGCTTTCGTTTCTTCCTTAACTTTTACTCTCTCTGTTACTTTCGCTTCTTCTTTAGGCTTTGCTATTTCTTGTACTTTTGCTTCTTTCTGCGTTTTTACTTCTTCCTTTGCTTTAACTGCTTTTTGTACTTTCGCTACTCGCTT

>NZ_CP020743|4|1|3059532-3060209|CRT
TGCTTTCGCTTCTTCTTT	CGCTTTTTCTATTTCTCG
TGCTTTCGCTTCTTCCTT	AGCCTTTGCTATTTCTTG
TGCTTTTGTTTCTTCCTT	TTCTTTTTCCTTAGCTTTTGCTATTTCTTG
TGCTCTTGCTTCTTCCTT	TGCTTTTTCCATTTCTCG
TACTTTTGCTTCTTCCTT	AGCCCTTGCTATTTCTTGTGCTTTCGCTTCTTCTTTTACTTTTTCTATTTCTCG
TACTTTTGCTTCTTCCTT	AGCTTTTGCTATTTCTTGTGCTTTCGCTTCTTCTTT
TACTTTTTCTTCTTCCTT	GGTCTTTACTATTTCTTCTGCTTTCATTTCTTCCTTAACTTTTACTCTCTCTGT
TACTTTCGCTTCTTCTTT	AGGCTTTACTATTTCTTCTGCTTTCATTTCTTCCTTAACTTTTACTCTCTCTGT
TACTTTTGCTTCTTCCTT	GGTCTTTGCTATTTCTTCTGCTTTCATTTCTTCCTTAACTTTTACTCTCTCTGT
TACTTTCGCTTCTTCTTT	AGGCTTTACTATTTCTTCTGCTTTCGTTTCTTCCTTAACTTTTACTCTCTCTGT
TACTTTCGCTTCTTCTTT	AGGCTTTGCTATTTCTTGTACTTTTGCTTCTTTCTGCGTTTTTACTTCTTCCTTTGCTTTAACTGCTTTTTG
TACTTTCGCTACTCGCTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP020743.1\|WP_085311737.1\|3058009_3058684_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020743.1\|WP_085311741.1\|3063568_3064051_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020743.1\|WP_061674140.1\|3056937_3057357_+\|SgcJ/EcaC-family-oxidoreductase	unknown	unknown	gnl\|CDD\|274053
NZ_CP020743.1\|WP_085311742.1\|3064423_3064960_-\|DinB-family-protein	unknown	unknown	gnl\|CDD\|378981
NZ_CP020743.1\|WP_085311735.1\|3055300_3055825_-\|cysteine-hydrolase	unknown	unknown	gnl\|CDD\|238496
NZ_CP020743.1\|WP_002127892.1\|3066538_3068041_+\|malate:quinone-oxidoreductase	unknown	unknown	gnl\|CDD\|377591
NZ_CP020743.1\|WP_085311740.1\|3062662_3063208_-\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|223508
NZ_CP020743.1\|WP_085311734.1\|3050994_3054507_-\|DUF4020-domain-containing-protein	unknown	unknown	gnl\|CDD\|372518
NZ_CP020743.1\|WP_002013433.1\|3049089_3050166_-\|bifunctional-3-deoxy-7-phosphoheptulonate-synthase/chorismate-mutase	unknown	unknown	gnl\|CDD\|183614
NZ_CP020743.1\|WP_002013434.1\|3047634_3048807_-\|chorismate-synthase	unknown	unknown	gnl\|CDD\|171518
NZ_CP020743.1\|WP_002127880.1\|3061643_3062024_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319905
NZ_CP020743.1\|WP_085311743.1\|3065070_3066117_-\|DUF2332-domain-containing-protein	unknown	unknown	gnl\|CDD\|378386
NZ_CP020743.1\|WP_085311739.1\|3062076_3062562_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379112
NZ_CP020743.1\|WP_085311736.1\|3055867_3056407_-\|acetyltransferase	unknown	unknown	gnl\|CDD\|379237
NZ_CP020743.1\|WP_157404905.1\|3056476_3056677_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|290824
NZ_CP020743.1\|WP_085311738.1\|3060890_3061382_-\|nitroreductase	unknown	unknown	unknown
NZ_CP020743.1\|WP_002032800.1\|3054658_3055096_+\|YndM-family-protein	unknown	unknown	gnl\|CDD\|371204
NZ_CP020743.1\|WP_085311744.1\|3068104_3069148_-\|autoinducer-2-ABC-transporter-substrate-binding-protein-LsrB	unknown	unknown	gnl\|CDD\|237961
NZ_CP020743.1\|WP_085311745.1\|3069144_3070143_-\|autoinducer-2-import-system-permease-LsrD	unknown	unknown	gnl\|CDD\|184998
NZ_CP020743.1\|WP_078176514.1\|3057477_3057981_+\|kinase	unknown	unknown	gnl\|CDD\|235858

Protein	Function_ID	Function_description	E-value
NZ_CP020743.1\|WP_002127880.1\|3061643_3062024_+\|VOC-family-protein	gnl\|CDD\|319905	cd07241, VOC_BsYyaH, vicinal oxygen chelate (VOC) family protein similar to Bacillus subtilis YyaH. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	1.00179e-62
NZ_CP020743.1\|WP_085311742.1\|3064423_3064960_-\|DinB-family-protein	gnl\|CDD\|378981	pfam12867, DinB_2, DinB superfamily. The DinB family are an uncharacterized family of potential enzymes. The structure of these proteins is composed of a four helix bundle.	3.3029e-20
NZ_CP020743.1\|WP_085311735.1\|3055300_3055825_-\|cysteine-hydrolase	gnl\|CDD\|238496	cd01014, nicotinamidase_related, Nicotinamidase_ related amidohydrolases. Cysteine hydrolases of unknown function that share the catalytic triad with other amidohydrolases, like nicotinamidase, which converts nicotinamide to nicotinic acid and ammonia.	4.39073e-67
NZ_CP020743.1\|WP_085311740.1\|3062662_3063208_-\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|223508	COG0431, COG0431, Predicted flavoprotein [General function prediction only].	1.48126e-34
NZ_CP020743.1\|WP_085311734.1\|3050994_3054507_-\|DUF4020-domain-containing-protein	gnl\|CDD\|372518	pfam13212, DUF4020, Domain of unknown function (DUF4020). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, and is typically between 176 and 195 amino acids in length.	1.6569e-57
NZ_CP020743.1\|WP_002013433.1\|3049089_3050166_-\|bifunctional-3-deoxy-7-phosphoheptulonate-synthase/chorismate-mutase	gnl\|CDD\|183614	PRK12595, PRK12595, bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed.	0
NZ_CP020743.1\|WP_002013434.1\|3047634_3048807_-\|chorismate-synthase	gnl\|CDD\|171518	PRK12463, PRK12463, chorismate synthase; Reviewed.	0
NZ_CP020743.1\|WP_061674140.1\|3056937_3057357_+\|SgcJ/EcaC-family-oxidoreductase	gnl\|CDD\|274053	TIGR02246, hypothetical_protein, conserved hypothetical protein. This family consists of uncharacterized proteins found in a number of genera and species, including Streptomyces, Xanthomonas, Oceanobacillus iheyensis, Caulobacter crescentus CB15, and Xylella fastidiosa. The function is unknown.	2.20875e-15
NZ_CP020743.1\|WP_085311743.1\|3065070_3066117_-\|DUF2332-domain-containing-protein	gnl\|CDD\|378386	pfam10094, DUF2332, Uncharacterized protein conserved in bacteria (DUF2332). Members of this family of hypothetical bacterial proteins have no known function.	1.03957e-144
NZ_CP020743.1\|WP_085311739.1\|3062076_3062562_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379112	pfam13302, Acetyltransf_3, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	2.68913e-24
NZ_CP020743.1\|WP_085311736.1\|3055867_3056407_-\|acetyltransferase	gnl\|CDD\|379237	pfam13523, Acetyltransf_8, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	5.59876e-28
NZ_CP020743.1\|WP_157404905.1\|3056476_3056677_-\|hypothetical-protein	gnl\|CDD\|290824	pfam14118, YfzA, YfzA-like protein. The YfzA-like protein family includes the B. subtilis YfzA protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 100 amino acids in length.	3.60405e-17
NZ_CP020743.1\|WP_002127892.1\|3066538_3068041_+\|malate:quinone-oxidoreductase	gnl\|CDD\|377591	pfam06039, Mqo, Malate:quinone oxidoreductase (Mqo). This family consists of several bacterial Malate:quinone oxidoreductase (Mqo) proteins (EC:1.1.99.16). Mqo takes part in the citric acid cycle. It oxidizes L-malate to oxaloacetate and donates electrons to ubiquinone-1 and other artificial acceptors or, via the electron transfer chain, to oxygen. NAD is not an acceptor and the natural direct acceptor for the enzyme is most likely a quinone. The enzyme is therefore called malate:quinone oxidoreductase, abbreviated to Mqo. Mqo is a peripheral membrane protein and can be released from the membrane by addition of chelators.	0
NZ_CP020743.1\|WP_002032800.1\|3054658_3055096_+\|YndM-family-protein	gnl\|CDD\|371204	pfam10710, DUF2512, Protein of unknown function (DUF2512). Proteins in this family are predicted to be integral membrane proteins, and many of them are annotated as being YndM protein. They are all found in Firmicutes. The true function is not known.	1.25914e-43
NZ_CP020743.1\|WP_085311744.1\|3068104_3069148_-\|autoinducer-2-ABC-transporter-substrate-binding-protein-LsrB	gnl\|CDD\|237961	PRK15408, PRK15408, autoinducer 2 ABC transporter substrate-binding protein LsrB.	0
NZ_CP020743.1\|WP_085311745.1\|3069144_3070143_-\|autoinducer-2-import-system-permease-LsrD	gnl\|CDD\|184998	PRK15038, PRK15038, autoinducer 2 ABC transporter permease LsrD.	2.3373e-79
NZ_CP020743.1\|WP_078176514.1\|3057477_3057981_+\|kinase	gnl\|CDD\|235858	PRK06762, PRK06762, hypothetical protein; Provisional.	8.76253e-98

>NZ_CP020743.1|WP_085311737.1|3058009_3058684_-|hypothetical-protein
MTTELYGTHYNEIKGYRVIEGKDSYNHYFGGQDCDLPLCKLCNEKMHQIFSLDLKDDRLVELKNDEMNVLPFVSCLNCSMVWEPQYFQLSNGGKTVQIIKQDNTEDWIMENEDKLPVDLPKTNVKLTNMKNEDIPTDEDRYWEAFDLFGSEYVCRLLGAPLYDDVPEDLGCPTCSKKMKYVATITQDLEEREFISVVDFQFGEMNIYYYLCKDCSVMKTEIQGT
>NZ_CP020743.1|WP_078176514.1|3057477_3057981_+|kinase
MKSTLIILRGNSASGKTTIAKELQEHFGQGTLLVSQDVVRRDMLKVHDTIGNLSHDLLFEITKYGKGKCEFVILEGILSSRRYGDMLKELIHFFDENTFTYYFDLSLEETIRRHNTRGKRHEFGEDALRKWYNPHDTIEVARETVFTDDFTQKDVFHTILNDVTQQK
>NZ_CP020743.1|WP_061674140.1|3056937_3057357_+|SgcJ/EcaC-family-oxidoreductase
MTKYYNSKEELQLGIKHIEQTIHEVEAAFNKHDADELDRHFTLHASWVNVLGIRLSGWKQINEAHKILLAGPLHNSYAQYEIEDIHFIRSDVAIVHIKQYPTTSEGTIIENEQSSLAMYVMVKEKDTWKIASGQNTFVQ
>NZ_CP020743.1|WP_157404905.1|3056476_3056677_-|hypothetical-protein
MAFLVMQFILFFCELNSWWSPKFSEGGLFERIMNSQFFTETFAPYKTSQFNLYTAFFIIALLIYAH
>NZ_CP020743.1|WP_085311736.1|3055867_3056407_-|acetyltransferase
MLFQKENLSVRYVIKNDAPIISKWLTDPEILQYYEGRDNPQSVEEVLAHFIHNPNSNEKRCLVEFDEMPIGYIQMYPVDSEWKALYGYEESQNVWGMDQFIGEPIFWGKGIGTKLVQAAITYIMEKLGAEAIAMDPRVNNERAIKCYEKCGFKKVKILKEQELHEGKLEDCWMVEYKQL
>NZ_CP020743.1|WP_085311735.1|3055300_3055825_-|cysteine-hydrolase
MKKALLVIDVQAGMYTAGIPVHNGEKFLETLQELIGECRSNGIPVIYVQHNGPKDHPLEKGTDGWKVHAAIAPREGELVVEKTTPDSFHKTNLNEVLLGKGIEHVIISGMQTEYCVDTTTRRAFSEGYKVTLVSDAHSTFDTDVLRAEDIVKHHNVVFGSFTDVITLKDLKVKA
>NZ_CP020743.1|WP_002032800.1|3054658_3055096_+|YndM-family-protein
MSDITVILIKFISCIIAFSIGLALFFPATLVQIISFSLFVTIVSYMFVDKIILNRIGNSAAIMTDFLLTYLSVWIFGNILLDNYMQIAWGSILSAIVFTLSEVIVHRFSNSHTRHSNDNIRINRRFAYGTEFAEEQNVLDKDKKK
>NZ_CP020743.1|WP_085311734.1|3050994_3054507_-|DUF4020-domain-containing-protein
MTFLGKGESGMWITSEVEIPDELIDHLEQGKLVLFVGAGVSMKGKSNLPNFDDLVDEISKALYVERREMTEPHDYYLGKIAKTKDVHQVARDLVNIEKSKPNPLHYAIPRLFPLDTDVRIVTTNFDQHFTSVITEMNRELNIYYAPALPTGRAFKGLAYIHGNVEQEKEALILTDGDFGRAYLTEGWARRFLVDLFSNYTVLFVGYSHNDPVMKYLATGLPPSTRRYAFVAQGDNTYHWEHLGIRPIVYPNKANNHQALVKAVKRWAELMGDNYITKRMRIRDIVTVPPSVEQEQLSYIKQSIKKIETVRYFVEFARDYEWVEWLEAEGKLRNLFLLTANYDEVDELLAEWLVEQFLFSHQKELFQLIFKNHSKISPLWWRTICTYLNETKETMDPLLFARWTLLLLETAEKDSSSIEMITYLLQKCSFPEHKEIGLLLLTFILDGKLKLKRVRRWGNDTQESIELEESSRIPMPIFSHVERIWKEKMRPHITYYANPIMVTGLEKIQLLSLRQNALKRRDREISEQELQQNDFTFLIQIVKECLTYLCENNEKKANHYITEMIETDSVLQKRIAIEAMINNVFVTADDKLKWLLHVDVLLDFTCKHEVFQLLKNYYADALEETKEEVIQHVLEYLAEERAFDACLVLDLLFTCDSNSKCTAEGYELMKQKHPHFSSDLYSVPKKEANEQRITCNVTADGLLQLKDDEIMEQVRQFSRDGVFEQRHFLEMLSKACKLNVEWSISFAYQLVGVHEISNEVWFVCIREWRNNRNLTNEQIQKIIPLLQKFIRNTAFHWLISSFSYEISNRLEELDENSIRIVKRFAFSVLPQVMRGESDFKIGKQEFYNESIQHPVGKMTAVLLKLLAYDHLYDRNVYEYLFLFEEQVRVTSERTNFMFARLTADITFLYHIEKQWCRKNVLPYLDLKKESELTKYAWAGLCYTQINLPLFTEIRRYIKYAVEHLDALHPYTREAFLKWLSFVFIKCVLYWEQKTDWLYPLLMQENEENKIKFMQYLCYYVKTLSGKEQQKFWTAWLSVFLRERPKMGVITTREYMMLLRIVLCMDEVLEKGLNIISSKFQGVEGQSNQEEMKQLFIEILEKKERMKAYKELYANVFFTLLQTCQEADLLESEIIQIKELLTRYEVERHVLNLIENEIIRIGIVTENLQEES
>NZ_CP020743.1|WP_002013433.1|3049089_3050166_-|bifunctional-3-deoxy-7-phosphoheptulonate-synthase/chorismate-mutase
MANHELDQLRKQVDEINLQLLHLLNKRGEIVQKIGEQKQVQGTKRFDPVREREVLDMLAEHNEGPFETSTIQHIFKTIFKASLELQEDDNRKALLVSRKKKKENTIVNVKGELIGNGTQTFIMGPCAVESLEQVRQVGQAMKDQGLKLMRGGAFKPRTSPYDFQGLGVEGLQILRQVADEFDLAIISEILNPNDVEMALEYVDVIQVGARNMQNFDLLRAVGKVNKPVLLKRGLAATIDEFINAAEYIIAQGNDQIILCERGIRTYERATRNTLDISAVPILKKETHLPVIVDVTHSTGRRDLLLPTAKAALAIGADAVMAEVHPDPAVALSDSAQQMDIPEFHRFMDELKGFKNKLS
>NZ_CP020743.1|WP_002013434.1|3047634_3048807_-|chorismate-synthase
MRYITAGESHGPQLTVILEGVPAGLTLTAEHINKELLRRQKGHGRGRRMQIETDTVEIASGVRHGMTLGSPITLIVKNDDFKHWTKVMGAEPISEQESKEMKRTITKPRPGHADLNGAIKYGHRDIRNVLERSSARETTVRVAAGAVAKQILKELGVEIAGHVLEIGGVQAKRISNLPIEEIQTITENSPVRCLDKEVEQEMMNAIDDAKSSGDSIGGIVEVIAEGMPIGVGSYVHYDRKLDAKLAGAIMSVNAFKGAEIGIGFEAARQPGSKVHDEILWDEEKGYTRNTNNAGGLEGGMTTGMPIVVRGVMKPIPTLYKPLASVDIDTKEAFQASIERSDSCAVPAAGVVAEAVVAWELAGALVEQFGKDRMELLKQNISQHNKYAKEF
>NZ_CP020743.1|WP_085311738.1|3060890_3061382_-|nitroreductase
MGQFEQMVIVGISMSFILSIMILGSTYYNPRLWLNDYPKDIQKVVLPKSINEKKQTFYFGIIYNIILFGTPLVSTYILHHHGKILYIEAYLHTFGIVMIFNLVDLLIIDWLIFCWITPRFVVIPSTEGMKGYKDYKFHLRGAIAGTPFLAIVSLFLAGIATTI
>NZ_CP020743.1|WP_002127880.1|3061643_3062024_+|VOC-family-protein
MKIEHIAIWVNDLELMRTFYTKYFNGKANSLYHNEAKHFESYFITFESGARLEIMRKKGIENEPNLNITGYAHMAFSVGSEERVNELTKTLKEAGSPLLNGPRFTGDGYYESVISDPEGNQIEITI
>NZ_CP020743.1|WP_085311739.1|3062076_3062562_+|GNAT-family-N-acetyltransferase
MHKLHFKKFEATDFSPYFQLVSNERVMAQITEHAIPLEEAQNDYEKLLRRNEKHKLFGSYKVYDSATNEFIGLGHVTVNEDNVKEAEIGYMILPEHWGKRYGSYIARELIEIAKQTDVSVLKAIIDPSNTPSRKILLNVGFTSEKVCEIDGLPGEILSTYI
>NZ_CP020743.1|WP_085311740.1|3062662_3063208_-|NAD(P)H-dependent-oxidoreductase
MSIHKKIIAISGSIREGSSSTNILKTLAAFIPEGIDYTIYNGIEELPHFNPDVDRVGAPVVVEEFRKTLSEAHALIICTPEYAKSIPGVLKNALEWLVSSAELYKKPVAIITASPSIAGGDKAHESLLLTLGMLDTIVVQNGSLLIPSVRTKFSDDAKVTDEDTKKALISLVQRVVDEIKK
>NZ_CP020743.1|WP_085311741.1|3063568_3064051_+|hypothetical-protein
MNKEDKLYAENVLKHLFIGAQVDGLQFGISPATIKIHFTNFEAAVDYDGQLYVNIESKWCLFNNPPEKYPSNEEEFDDYTEEEEYKRIFEVRRKKVTNIQLANESPHLFITFENGQIMFVNGFHDHYECWQAGVQFEDWLVVAAPGNEIATWTPDEFTNK
>NZ_CP020743.1|WP_085311742.1|3064423_3064960_-|DinB-family-protein
MQKRPEANEYNPYYSTYINLIPDGDIIHILEQQMKETNLLLKDISDSEGHFRYAPNKWSIKEVIGHIADTERIMAYRLLSIARGETAELPGYNDDMYVLRATFDKQSMQDLLENLIVVRQSTMHLLKSLDKEAWLQRGIANNSEVTVLALANIIAGHELHHRQLVKERYLGSKAYPAC
>NZ_CP020743.1|WP_085311743.1|3065070_3066117_-|DUF2332-domain-containing-protein
MLTKEQVANLFRNFSVNECKGSSVLYEYLSIKISEDEEVLTLASYAQPGQPVPNLLLGAVHYLLLKGKEHSLKNYYQSLVENADINFENAFYQFKDFCHVYREEVISLLQTKLVQTNEVRRCAYLYPSFCYIFNKVNKPLALIEIGTSAGLQLFWDQYRYSYGTEEMYGNRQSNVHLQSEIKGEKKPSFLKQSPHVMERIGLDLHVNNLNDEEDYLWLRALIWPEHKERLELFDQAATLVKEKSVQLIEGDGVALLPAIANQIREDAVICIFHTHVANQIPENVKHTLEKQIKEIGAKRDVFHLYNNMWDRDLHIDYYINGNEYCETVGETEGHGRWFSWGLGDKPLC
>NZ_CP020743.1|WP_002127892.1|3066538_3068041_+|malate:quinone-oxidoreductase
MSNMQQKTDVILIGAGIMSATLGSLLKELAPEWEIKVFEKLANAGEESSNEWNNAGTGHSALCELNYTSEKSDGSIDIGKAVKVNEQFQLSRQFWAYLVKRNLIRNPQDFIMPLPHMSLVQGEKNVEFLKKRFEALSKNALFQGMEFSDAPDTLKKWLPLIMEGRNSNEPMAATKIDSGTDVNFGALTRMLFDYLKTKNVELNYKHSVENIKRTKNGLWEVKVHDMNSGKIEHHTAKFVFIGGGGGSLPLLQKTGIPESKHIGGFPVSGLFMVCKNPKVVEQHHAKVYGKAKVGAPPMSVPHLDTRYIDNKKALLFGPFAGFSPKFLKTGSNLDLIGSVKPNNVLTMLAAGVKEMGLTKYLIQQVMLSHEKRMEELREFIPNAKSEDWDTVVAGQRVQVIKDTDAGGKGTLQFGTEVVSANDGSIAALLGASPGASTAVHVMLEVLEKCFPERILEWEPKIKEMVPSYGVSLTENPRLFQELHASTGRTLGLNEKEAVHN
>NZ_CP020743.1|WP_085311744.1|3068104_3069148_-|autoinducer-2-ABC-transporter-substrate-binding-protein-LsrB
MKRKLRIVIIMCICLIGLIACSSQTADKKKADDVKFAFIPKLTGVGFFTSGGEGAKEMGDKLGVQVKYDGPSEASVSGQVKYINNFINQNYDAIMVSSTSVDGLSQSLQRAKKKGMTVLTWDSDVNPKDRSFYISQGTPDQLANLLIEMTSKQIGDKGKVAFFYSSPTVTDQNQWVTKAKEIIKKKYPNWEIVTTQYGENNAQKSLSVGENILKTYPDINAVICPDATALPAMAQAAENLKMDKKVVVTGFSTPNVMRDYVKRGTVKQFGLWDVKQQGALATYVANEIVVKGKKLKVGDSFEVKGIGKVKVEPNSIQGYDYEAEGNGIIVLPERVVFTKDNIDKYNF
>NZ_CP020743.1|WP_085311745.1|3069144_3070143_-|autoinducer-2-import-system-permease-LsrD
MRGIRSLYRWEGVLLILLLVELILFSFINSDFLNISNLLFSMNDFLIISIAAIPMTFVIVTGGIDVSVGSIMGLTSILIGALWMNGMPILLAVIIALVISCIAGGLNGLIIKMTDVEPLVVTLGTMFLYAGIALVISGGSGAAGYEGISGLPDSYVQMANGSFIGIPNLLWLLVILTIVFTILFHRTTYGRYAKLTGANESTARYSGIRTKKVVIIAYVLSGLGGGLGGAFLTAYFGSARADIGSETILPVITAVVLGGTLITGGKGSIIGTVLASIFIGLMQYGLQMTGLTNEQSNVVIGIILIVSVIMRHFKLQRFTTRKRRDLHKGEMS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP020743_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP020743_5

3212207-3212338

Orphan

Consensus_repeat	Method
GTTGTTCCTATTACTAAGGAAACTTCTTGTTGTAGT	CRISPRCasFinder

1 spacers

csa3

The CRISPR arrays of NZ_CP020743_5

>merge|NZ_CP020743|5|3212207-3212338|CRISPRCasFinder
GTTGTTCCTATTACTAAGGAAACTTCTTGTTGTAGTGCTGAAAAAGAAATAGTAAGAGAAAATTCGTCATGTTGCTCCTCTAAAAAAGAGATTCCGGTTGTTCCTATCACTAAGGAAACTTCTTGTTGTAGT

>NZ_CP020743|5|2|3212207-3212338|CRISPRCasFinder
GTTGTTCCTATTACTAAGGAAACTTCTTGTTGTAGT	GCTGAAAAAGAAATAGTAAGAGAAAATTCGTCATGTTGCTCCTCTAAAAAAGAGATTCCG
GTTGTTCCTATCACTAAGGAAACTTCTTGTTGTAGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP020743.1\|WP_085311846.1\|3210718_3211468_-\|metal-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224046
NZ_CP020743.1\|WP_085311852.1\|3216418_3216937_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372729
NZ_CP020743.1\|WP_085311851.1\|3215941_3216373_+\|disulfide-bond-formation-protein-B	unknown	unknown	gnl\|CDD\|179540
NZ_CP020743.1\|WP_085311845.1\|3208902_3209838_-\|manganese-ABC-transporter-substrate-binding-protein/adhesin-MntA	unknown	unknown	gnl\|CDD\|238557
NZ_CP020743.1\|WP_085311854.1\|3217356_3218358_-\|phosphotransferase	unknown	unknown	gnl\|CDD\|270702
NZ_CP020743.1\|WP_085311855.1\|3218651_3219056_-\|arsenate-reductase-(thioredoxin)	unknown	unknown	gnl\|CDD\|237415
NZ_CP020743.1\|WP_085311850.1\|3215264_3215945_+\|DsbA-family-protein	unknown	unknown	gnl\|CDD\|372611
NZ_CP020743.1\|WP_085311841.1\|3203911_3204754_-\|polysaccharide-deacetylase	unknown	unknown	gnl\|CDD\|200569
NZ_CP020743.1\|WP_085311853.1\|3217079_3217268_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020743.1\|WP_085311849.1\|3214626_3215211_+\|SCO-family-protein	unknown	unknown	gnl\|CDD\|239266
NZ_CP020743.1\|WP_085311842.1\|3204937_3206722_-\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|274368
NZ_CP020743.1\|WP_085311840.1\|3203138_3203819_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|238879
NZ_CP020743.1\|WP_085311857.1\|3220140_3220578_-\|glyoxalase/bleomycin-resistance/dioxygenase-family-protein	unknown	unknown	gnl\|CDD\|319917
NZ_CP020743.1\|WP_085311847.1\|3211791_3212151_+\|helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP020743.1\|WP_085311844.1\|3208160_3208721_+\|streptothricin-N-acetyltransferase-SatA	unknown	unknown	gnl\|CDD\|366181
NZ_CP020743.1\|WP_043937143.1\|3209855_3210722_-\|metal-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224033
NZ_CP020743.1\|WP_085311858.1\|3220638_3220944_-\|arsenical-resistance-operon-transcriptional-regulator-ArsR	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP020743.1\|WP_085311843.1\|3206718_3207405_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NZ_CP020743.1\|WP_085311839.1\|3202022_3202712_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|238879
NZ_CP020743.1\|WP_157404909.1\|3219081_3220122_-\|ACR3-family-arsenite-efflux-transporter	unknown	unknown	gnl\|CDD\|213563

Protein	Function_ID	Function_description	E-value
NZ_CP020743.1\|WP_085311846.1\|3210718_3211468_-\|metal-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224046	COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism].	8.57584e-110
NZ_CP020743.1\|WP_085311852.1\|3216418_3216937_+\|hypothetical-protein	gnl\|CDD\|372729	pfam13798, PCYCGC, Protein of unknown function with PCYCGC motif. This domain contains a PCYCGC motif and four other conserved cysteines. Its function is unknown.	1.37475e-53
NZ_CP020743.1\|WP_085311851.1\|3215941_3216373_+\|disulfide-bond-formation-protein-B	gnl\|CDD\|179540	PRK03113, PRK03113, putative disulfide oxidoreductase; Provisional.	5.21567e-52
NZ_CP020743.1\|WP_085311845.1\|3208902_3209838_-\|manganese-ABC-transporter-substrate-binding-protein/adhesin-MntA	gnl\|CDD\|238557	cd01137, PsaA, Metal binding protein PsaA. These proteins have been shown to function as initial receptors in ABC transport of Mn2+ and as surface adhesins in some eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains. In addition, these proteins sometimes have a low complexity region containing a metal-binding histidine-rich motif (repetitive HDH sequence).	1.10339e-134
NZ_CP020743.1\|WP_085311854.1\|3217356_3218358_-\|phosphotransferase	gnl\|CDD\|270702	cd05153, HomoserineK_II, Type II Homoserine Kinase. This subfamily is composed of unusual homoserine kinases, from a subset of bacteria, which have a Protein Kinase fold. These proteins do not bear any similarity to the GHMP family homoserine kinases present in most bacteria and eukaryotes. Homoserine kinase catalyzes the transfer of the gamma-phosphoryl group from ATP to L-homoserine producing L-homoserine phosphate, an intermediate in the production of the amino acids threonine, methionine, and isoleucine. The Type II homoserine kinase subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).	8.85961e-08
NZ_CP020743.1\|WP_085311855.1\|3218651_3219056_-\|arsenate-reductase-(thioredoxin)	gnl\|CDD\|237415	PRK13530, PRK13530, arsenate reductase (thioredoxin).	2.15935e-100
NZ_CP020743.1\|WP_085311850.1\|3215264_3215945_+\|DsbA-family-protein	gnl\|CDD\|372611	pfam13462, Thioredoxin_4, Thioredoxin.	9.47076e-39
NZ_CP020743.1\|WP_085311841.1\|3203911_3204754_-\|polysaccharide-deacetylase	gnl\|CDD\|200569	cd10944, CE4_SmPgdA_like, Catalytic NodB homology domain of Streptococcus mutans polysaccharide deacetylase PgdA, Bacillus subtilis YheN, and similar proteins. This family is represented by a putative polysaccharide deacetylase PgdA from the oral pathogen Streptococcus mutans (SmPgdA) and Bacillus subtilis YheN (BsYheN), which are members of the carbohydrate esterase 4 (CE4) superfamily. SmPgdA is an extracellular metal-dependent polysaccharide deacetylase with a typical CE4 fold, with metal bound to a His-His-Asp triad. It possesses de-N-acetylase activity toward a hexamer of chitooligosaccharide N-acetylglucosamine, but not shorter chitooligosaccharides or a synthetic peptidoglycan tetrasaccharide. SmPgdA plays a role in tuning cell surface properties and in interactions with (salivary) agglutinin, an essential component of the innate immune system, most likely through deacetylation of an as-yet-unidentified polysaccharide. SmPgdA shows significant homology to the catalytic domains of peptidoglycan deacetylases from Streptococcus pneumoniae (SpPgdA) and Listeria monocytogenes (LmPgdA), both of which are involved in the bacterial defense mechanism against human mucosal lysozyme. The Bacillus subtilis genome contains six polysaccharide deacetylase gene homologs: pdaA, pdaB (previously known as ybaN), yheN, yjeA, yxkH and ylxY. The biological function of BsYheN is still unknown. This family also includes many uncharacterized polysaccharide deacetylases mainly found in bacteria.	4.7377e-85
NZ_CP020743.1\|WP_085311849.1\|3214626_3215211_+\|SCO-family-protein	gnl\|CDD\|239266	cd02968, SCO, SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold. Members of this family are required for the proper assembly of cytochrome c oxidase (COX). They contain a metal binding motif, typically CXXXC, which is located in a flexible loop. COX, the terminal enzyme in the respiratory chain, is imbedded in the inner mitochondrial membrane of all eukaryotes and in the plasma membrane of some prokaryotes. It is composed of two subunits, COX I and COX II. It has been proposed that Sco1 specifically delivers copper to the CuA site, a dinuclear copper center, of the COX II subunit. Mutations in human Sco1 and Sco2 cause fatal infantile hepatoencephalomyopathy and cardioencephalomyopathy, respectively. Both disorders are associated with severe COX deficiency in affected tissues. More recently, it has been argued that the redox sensitivity of the copper binding properties of Sco1 implies that it participates in signaling events rather than functioning as a chaperone that transfers copper to COX II.	2.38361e-44
NZ_CP020743.1\|WP_085311842.1\|3204937_3206722_-\|sensor-histidine-kinase	gnl\|CDD\|274368	TIGR02966, Phosphate_regulon_sensor_protein_PhoR, phosphate regulon sensor kinase PhoR. Members of this protein family are the regulatory histidine kinase PhoR associated with the phosphate ABC transporter in most Proteobacteria. Related proteins from Gram-positive organisms are not included in this model. The phoR gene usually is adjacent to the response regulator phoB gene (TIGR02154). [Signal transduction, Two-component systems].	3.77579e-54
NZ_CP020743.1\|WP_085311840.1\|3203138_3203819_-\|hypothetical-protein	gnl\|CDD\|238879	cd01841, NnaC_like, NnaC (CMP-NeuNAc synthetase) _like subfamily of SGNH_hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases. E. coli NnaC appears to be involved in polysaccharide synthesis.	1.30898e-34
NZ_CP020743.1\|WP_085311857.1\|3220140_3220578_-\|glyoxalase/bleomycin-resistance/dioxygenase-family-protein	gnl\|CDD\|319917	cd07254, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	8.30216e-63
NZ_CP020743.1\|WP_085311847.1\|3211791_3212151_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	1.56539e-18
NZ_CP020743.1\|WP_085311844.1\|3208160_3208721_+\|streptothricin-N-acetyltransferase-SatA	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	2.37099e-20
NZ_CP020743.1\|WP_043937143.1\|3209855_3210722_-\|metal-ABC-transporter-permease	gnl\|CDD\|224033	COG1108, ZnuB, ABC-type Mn2+/Zn2+ transport systems, permease components [Inorganic ion transport and metabolism].	4.68659e-79
NZ_CP020743.1\|WP_085311858.1\|3220638_3220944_-\|arsenical-resistance-operon-transcriptional-regulator-ArsR	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	2.19253e-20
NZ_CP020743.1\|WP_085311843.1\|3206718_3207405_-\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	1.28307e-82
NZ_CP020743.1\|WP_085311839.1\|3202022_3202712_-\|hypothetical-protein	gnl\|CDD\|238879	cd01841, NnaC_like, NnaC (CMP-NeuNAc synthetase) _like subfamily of SGNH_hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases. E. coli NnaC appears to be involved in polysaccharide synthesis.	1.21761e-33
NZ_CP020743.1\|WP_157404909.1\|3219081_3220122_-\|ACR3-family-arsenite-efflux-transporter	gnl\|CDD\|213563	TIGR00832, Uncharacterized_transporter_slr0944, arsenical-resistance protein. The Arsenical Resistance-3 (ACR3) Family (TC 2.A.59) The first protein of the ACR3 family functionally characterized was the ACR3 protein of Saccharomyces cerevisiae. It is present in the yeast plasma membrane and pumps arsenite out of the cell in response to the pmf. Similar proteins are found in bacteria, often as part of a four gene operon with an regulatory protein ArsR, a protein of unknown function ArsH, and an arsenate reductase that converts arsenate to arsenite to facilitate transport. [Cellular processes, Detoxification, Transport and binding proteins, Anions].	1.7025e-153

>NZ_CP020743.1|WP_085311847.1|3211791_3212151_+|helix-turn-helix-transcriptional-regulator
MCNSNDSDVKAKFIRGFADKTRLQILQCMMDGEKTVSEIVEITQGNQSNVSQHLNCLKGCGIILGRQEGKYVHYSLRNKQIEQLLTMFDVVFHEVQNEVASCDKNDACLSQKGENCHDR
>NZ_CP020743.1|WP_085311846.1|3210718_3211468_-|metal-ABC-transporter-ATP-binding-protein
MDEAIIVKDLFVSYQGNQVVQNVSFDIEKGKLVGIIGPNGAGKSTLMKAVLDLIPKDKGYVQVLGEDIRSSRKHVAYVPQRSDIDWDFPITVIDVVLIGTYPSLGMMKRPKKEHRDWAFECLKKVGMEEFKNRQIGELSGGQQQRVFLARALAQKAEIFFLDEPFVGIDVTSEETIIKILRELRIEGKTIVVVHHDLSKAESYFDKLLLLNKSLIHYGEVRQVLEPTVMSKAYVNHGILFNNAAEVHSS
>NZ_CP020743.1|WP_043937143.1|3209855_3210722_-|metal-ABC-transporter-permease
MKIVEFIDALMQYGFLQKALLTSVMVGVICGVIGCFIILRGMALMGDAISHAVLPGVALSYMIGMNYFIGAVLTGVITAVGIGFVSQNSRIKHDMAIGIMFTSVFAIGIILITFMKSSSDLYHILFGNVLSVRSSDMWMTLIIGVVIISLVILFYKELLVSTFDPTMAQSYGLPNKWIHYGLMILLTMVTVASLQTVGIILVVAMLITPAATAYLLTNRLWVMIYLAAGIGALSSVVGLYFSFSYNLASGATIVLVATFLFALAFFFSPSQGLFWRAIKIRKNRAELS
>NZ_CP020743.1|WP_085311845.1|3208902_3209838_-|manganese-ABC-transporter-substrate-binding-protein/adhesin-MntA
MKFKNILLSVICMFVFALTACSSNTNGKEEKSGKLKVVTTYSIIYDMVKQIGGDKVEIHSLVPIGANPHEYDPLPKDVMKMTDADMVFYNGLNLEEGGAWFNKLLKTANKSEKDAPVYKVSEGVEAIYLETKGLEKEPDPHAWMNIKNGIIYAENVKKALIKEDPKNKEFYTKNADKYVAELQKLHDETVNRIHQIPEEKRFLISSEGAFKYFGKAYGINTGYIWEINSENQGTPDQIRDVVSLIQTNKVPALFVETSVDRRSMETVSKETNVPIAGTIFTDSLGKSGEDGDTYLKMMKWNTDTIINGLQK
>NZ_CP020743.1|WP_085311844.1|3208160_3208721_+|streptothricin-N-acetyltransferase-SatA
MNLLIRELEVNDLDNLPEIDDSFVVNARLILSLSKVNKRIEYIVEDAPSYDKSYLQNQYDDDDEIAYNEYINKPNQVIYIALLHNQIIGVMVLKKNWNRYAYIEDIKVDKEFRALGVGRRLIEQAKQWAKEGNMPGIMLETQNNNVTACQFYEKCGFVIGGFDFLVYKGLHAESDEVAIYWYFHFK
>NZ_CP020743.1|WP_085311843.1|3206718_3207405_-|response-regulator-transcription-factor
MKKTILIVEDEDILREIMKDYLLNEGYKVLEAIDGKEALSIFEEHEVHLIILDIMLPELDGWAVCRRIRKKSNVPIIMLTARVDEDDTLLGFEMGADDYVTKPYSPPILLARAKRLIESRYSSTINVSTADTLTSSGIHVHFPSRTVTVDGEDISMTHTEFEILTYFMQNQGIVISREQLITKIWGYEFTGDDRTVNSHIRNLRHKLGEKATCIVTVVRTGYKFEGQV
>NZ_CP020743.1|WP_085311842.1|3204937_3206722_-|sensor-histidine-kinase
MKKGIVLKLFILTTALCTLILVTIFIGQTIFFKQYYSNRKVNDIKTNIQSFEKAYIKAGDDAKRIQELEQNFYQDNATWITTLDRVGNIKYASDFSLEIQLDPNGNKTFSERLIQIPLYSFVNLEDIQRIKDSLEQGSHIIIDGVQEGDAVVPAMLTIKEKNIGLENKQLSEKLYGPKVASSKENSQLYLAGSIKNVQLPEGTVGTNSIYGNRVLIDRIKQFQVDLILNQKPNNITSTEIVDYEENDIKYKLLIKPTIDADGKVNYIFAMTSLQPVDEAVQMIKDYYVYLIIFVLILIVLISFYYSNKIAKPLLQINDTTKKIAGLDFSEMIPITTKDEIGDLSKNINTLSKALHSYINQLQQDIEKEKQLENTRKEFIAGVSHELKTPLSIMKSCISILEDGVASNKKDYYFKAMSKEVDKMDMLIIDMLELAKFESGTYKMEMDVFHIDEMIDYICEQLTSDITAKQLHVHKQLSKIEVVANLHRIEQVVTNFITNAIRYTPEQENIIISTIEENERVKVCVENKGAHIELEHLEKIWDRFYRGDTSRQRSKGGTGLGLAISKNILELHGAEYGVSNTEDGVLFFFYLNKNV
>NZ_CP020743.1|WP_085311841.1|3203911_3204754_-|polysaccharide-deacetylase
MKESQSKKKTSRLTKVIISLGVVLATTFFTFFLIGKWHSIPAKGVANESMKQVNTQQQEKKKETSPAKQKRPDGKPVGKVVYLTFDDGPSELTGKFLDVLKEQNVASTFFMQGSNLQNTGFQENVKRAVKEGHYIGAHSMTHNSDKLYKKGQFVPEMKETLDLIHNITGTTPKLVRPPYGSAPGLKGEEIRNQIVEAAIKVWDWTVDSNDWKLKDNPTQIIENVKKQTTEEVEVVLMHEKAQTLQALPEIIKFYKENGYEFGVYNDVDHFRLNFQKDQRL
>NZ_CP020743.1|WP_085311840.1|3203138_3203819_-|hypothetical-protein
MIKKIITIPLIGIIALSACGNPDSQRDITSPVSKIDSSSTTFEKEHISSSNIDTSTFKSIFKSSVFLGDSITDGLHDIDILDEENIVSGIGKSIGDAQKNIEQVVNQKPKNIFILLGLCNLSETKESAITQYSQLIQKIKEKLPDTKINILSITPVTPERTQKEERYKNINDFNEGFKVLAKKEQVNFIDLSPIFKDNPDLYDKDGIHFKSEFYPIWLEYLKNQLK
>NZ_CP020743.1|WP_085311839.1|3202022_3202712_-|hypothetical-protein
MLKKVCVCLLTGAVALTSAACVNNETEKPSNKVTQNATHEKAPKDSAYKPIFKNSLFFGDSITEGMIDQELIEDKNIIADKGKVTAMAIEEDVNKVVEKKPEHIFMSFGTNDLLMPMDLEGKPIENPVKFSIDNYSKLIQKIKEKLPNVSIHLLSVTPVTDSVLQEYPQYKHIDEYNVKLKELAKTEKVEYIDLSPIFEKNKDVHDSDGVHFKADYYKILLEQLKGSVK
>NZ_CP020743.1|WP_085311849.1|3214626_3215211_+|SCO-family-protein
MKKMRVITLLMLISIITILGACSDNKLRDSLNWDVEKFTFTDQNKNKFGSSELKDKVWVADFIFTSCETVCPPMTANMAKLQNMLQKEGIKDVEFVSFSVDPEVDTPEKITEFMKVYEMDAKRTHFLTGYTRPDIEKFAKDNFQTLVTKPENNTQVIHGTSFYLVDRDGKVVKKYSGLQNTPYEDMIHDIKRIR
>NZ_CP020743.1|WP_085311850.1|3215264_3215945_+|DsbA-family-protein
MKKKQSSHIKLLFVATLIIFAAVTAFVVLNKEDKVATNKVIKDLPPIGKQPTLGKEDAPVSIIEFGDFKCPACKAWGEHIFPKLQKDYIDTGKVKFSYVNVLFHGTESKLSALAAESVYKQDPQAYWSFHKELFNAQPENHDDPWITPEKLLEIAKTYTPSINAIQLEEDLKKQTTQEEVNKDEKLTQDYGVEQTPSIVINGTMLSDPYDYEQIKNLVEKALKDKK
>NZ_CP020743.1|WP_085311851.1|3215941_3216373_+|disulfide-bond-formation-protein-B
MMSTTKKHFEWRNYTLYFAWIVSMIATLGSLFFSEILGFIPCELCWYQRIMMYPLCIILGIATFYNEKNMKKYVLPISIIGGSISLYHYAIQKFPSVSEINPCVQGVPCNVDYINWFGFITIPFLALIAFSFITLFMMLTRSN
>NZ_CP020743.1|WP_085311852.1|3216418_3216937_+|hypothetical-protein
MSKIVPIFLLVSLLIGCSSINDSSPTKNDSTQNQLQETKNNDKHFKGDTLETTATVEALPSFLSATKNGQVSQIYGMVGKDIELLQWIPCYCGCDENSGHKSNKDCFIREMKENGQVTWNSHAMNHAECVDIAFQAVLMKQNGASPLKIREYIDKQYKKDGVKATPTPMPSA
>NZ_CP020743.1|WP_085311853.1|3217079_3217268_-|hypothetical-protein
MTKLSYSGLKYGKSDVEVKLLVDIKNDSFEITHTKEVSLVMNKSKGEYIVVNRNTLKFEVVA
>NZ_CP020743.1|WP_085311854.1|3217356_3218358_-|phosphotransferase
MKHIIKDILMNYFKEIHTLIVEEELHKNSWHTDLHYKIMVNGDRYSARFINSDRTINPAFGTLSNEQLKEQVRFTYYLREHGIPFMQIKENRAGDYFTLLTWNEEQYRFVLSTWIEGEHITYCTETMAESFGKEARKIHDISSTFQSSIFQKKSHLDGYGEFIKLLENKGSTCKELRGYIDLAKYHIECAHASDLEFIVQTDLNPLNVIWNSSQCVKGIVDFESIGYVDRIEGLAFIIKWYSRTKGIQSHEVCSSVASAFLEGYKASNILTLNEYKRLSSLLWLSGSLNWNFVKKTMNVLDDGRGLKEHLKGYKIRGERLSSLLSGERASSFG
>NZ_CP020743.1|WP_085311855.1|3218651_3219056_-|arsenate-reductase-(thioredoxin)
MENKKTIYFLCTGNSCRSQMAEAWGKQYVGDKWNVYSAGIEAHGVNPNAIKAMKEVNIDITDQTSDILDVNILNNADLVVTLCSHADSVCPSTPSHVNRVHWGFDDPAGKEWSEFQRVRDEIGERIKRFSEIGE
>NZ_CP020743.1|WP_157404909.1|3219081_3220122_-|ACR3-family-arsenite-efflux-transporter
MKRLPFLDRYLTLWIFLAMAVGIGLGFVFPSVVDGLNTLQVGTTSIPLAVGLIVMMYPPLAKVRYEEMGRVFKDVKVLVLSLVQNWIIGPVLMFVLAIIFLPDKPEYMVGLIMIGLARCIAMVIVWNDLADGDKEYAAGLVAFNSVFQMLFFSVYAYVFVTVIPEWLGIEGAIVDITMVEVAKSVFIYLGIPFIAGMLTRFVFVKLKGRQWYEKVFIPKISPLTLLALLFTIIIMFSLKGEMIVSVPLDVVRIAIPLLIYFIVMFFVSFFMGRKIGANYPVTTTLAFTAGSNNFELAIAVAVGVFGIHSGAAFAAVIGPLVEVPVMIALVNVAFWFKRKYFNDQPV
>NZ_CP020743.1|WP_085311857.1|3220140_3220578_-|glyoxalase/bleomycin-resistance/dioxygenase-family-protein
MRYVHVGINVTDLEKSIQFYEKVFGVSPVKVKMDYAKFLLENPGLNFTLNVRDEVKGNQVNHFGFQVDAAEEITFHKERLEKEGFFARDEMDTTCCYAVQDKFWVTDPDGNEWEFFYTKAHSDVHKIEDPSCCMTSNVVDKNSCC
>NZ_CP020743.1|WP_085311858.1|3220638_3220944_-|arsenical-resistance-operon-transcriptional-regulator-ArsR
MAQDFQLYEKKFKALADQKRLEIMYELCQRGQTCVCDLTEIFEMTQSKLSYHLKILLDAGLIVKETKGTWSYYDLNDAEVNNLLSEELCCIFRKTGEGSCC

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP020743_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP020743_6

5098115-5098211

Orphan

Consensus_repeat	Method
TTCTAGCCGCTGGAGCTAGATTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP020743_6

>merge|NZ_CP020743|6|5098115-5098211|CRISPRCasFinder
TTCTAGCCGCTGGAGCTAGATTTAGTAAAAAGCGCAAGCGGCTCGTTTAGAATGTGAAGCGAAGCCATCGAACATTCTAGCCGCTGGAGCTGGATTT

>NZ_CP020743|6|3|5098115-5098211|CRISPRCasFinder
TTCTAGCCGCTGGAGCTAGATTT	AGTAAAAAGCGCAAGCGGCTCGTTTAGAATGTGAAGCGAAGCCATCGAACA
TTCTAGCCGCTGGAGCTGGATTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP020743.1\|WP_002015928.1\|5089057_5090455_-\|Fe-S-cluster-assembly-protein-SufB	unknown	unknown	gnl\|CDD\|131035
NZ_CP020743.1\|WP_085312712.1\|5098613_5098958_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020743.1\|WP_002089394.1\|5102998_5104012_-\|PTS-sugar-transporter-subunit-IIC	unknown	unknown	gnl\|CDD\|379113
NZ_CP020743.1\|WP_002129756.1\|5100609_5100975_-\|arsenate-reductase-family-protein	unknown	unknown	gnl\|CDD\|239334
NZ_CP020743.1\|WP_000026895.1\|5100184_5100568_-\|glycine-cleavage-system-protein-GcvH	unknown	unknown	gnl\|CDD\|234918
NZ_CP020743.1\|WP_002015930.1\|5090924_5092145_-\|cysteine-desulfurase-SufS	unknown	unknown	gnl\|CDD\|131034
NZ_CP020743.1\|WP_002034622.1\|5102296_5102944_+\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239481
NZ_CP020743.1\|WP_002089369.1\|5090503_5090935_-\|iron-sulfur-cluster-assembly-scaffold-protein-SufU	unknown	unknown	gnl\|CDD\|273918
NZ_CP020743.1\|WP_001180550.1\|5105493_5105679_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020743.1\|WP_002034620.1\|5105231_5105480_-\|spore-coat-protein	unknown	unknown	gnl\|CDD\|377935
NZ_CP020743.1\|WP_002089372.1\|5092144_5093437_-\|Fe-S-cluster-assembly-protein-SufD	unknown	unknown	gnl\|CDD\|223791
NZ_CP020743.1\|WP_002015935.1\|5095355_5096168_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224381
NZ_CP020743.1\|WP_085312709.1\|5094475_5095282_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224381
NZ_CP020743.1\|WP_000640865.1\|5099422_5099767_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224572
NZ_CP020743.1\|WP_002034576.1\|5093452_5094238_-\|Fe-S-cluster-assembly-ATPase-SufC	unknown	unknown	gnl\|CDD\|223473
NZ_CP020743.1\|WP_085312708.1\|5086969_5088361_-\|bifunctional-metallophosphatase/5'-nucleotidase	unknown	unknown	gnl\|CDD\|223808
NZ_CP020743.1\|WP_085312710.1\|5096190_5096856_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224922
NZ_CP020743.1\|WP_172805444.1\|5099110_5099419_-\|thioredoxin-family-protein	unknown	unknown	gnl\|CDD\|239245
NZ_CP020743.1\|WP_085312711.1\|5096848_5097874_-\|methionine-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224058
NZ_CP020743.1\|WP_085312714.1\|5101624_5102152_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP020743.1\|WP_002015928.1\|5089057_5090455_-\|Fe-S-cluster-assembly-protein-SufB	gnl\|CDD\|131035	TIGR01980, UPF0051_protein_slr0074, FeS assembly protein SufB. This protein, SufB, forms a cytosolic complex SufBCD. This complex enhances the cysteine desulfurase of SufSE. The system, together with SufA, is believed to act in iron-sulfur cluster formation during oxidative stress. Note that SufC belongs to the family of ABC transporter ATP binding proteins, so this protein, encoded by an adjacent gene, has often been annotated as a transporter component. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	0
NZ_CP020743.1\|WP_002089394.1\|5102998_5104012_-\|PTS-sugar-transporter-subunit-IIC	gnl\|CDD\|379113	pfam13303, PTS_EIIC_2, Phosphotransferase system, EIIC. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. The sugar-specific permease of the PTS consists of three domains (IIA, IIB and IIC). The IIC domain catalyzes the transfer of a phosphoryl group from IIB to the sugar substrate.	6.66779e-86
NZ_CP020743.1\|WP_002129756.1\|5100609_5100975_-\|arsenate-reductase-family-protein	gnl\|CDD\|239334	cd03036, ArsC_like, Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC. Proteins containing a redox active CXXC motif like TRX and glutaredoxin (GRX) function as protein disulfide oxidoreductases, altering the redox state of target proteins via the reversible oxidation of the active site dithiol. ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], using reducing equivalents derived from glutathione via GRX, through a single catalytic cysteine.	7.36059e-61
NZ_CP020743.1\|WP_000026895.1\|5100184_5100568_-\|glycine-cleavage-system-protein-GcvH	gnl\|CDD\|234918	PRK01202, PRK01202, glycine cleavage system protein GcvH.	1.83528e-70
NZ_CP020743.1\|WP_002015930.1\|5090924_5092145_-\|cysteine-desulfurase-SufS	gnl\|CDD\|131034	TIGR01979, Probable_cysteine_desulfurase, cysteine desulfurases, SufSfamily. This model represents a subfamily of NifS-related cysteine desulfurases involved in FeS cluster formation needed for nitrogen fixation among other vital functions. Many cysteine desulfurases are also active as selenocysteine lyase and/or cysteine sulfinate desulfinase. This subfamily is associated with the six-gene SUF system described in E. coli and Erwinia as an FeS cluster formation system during oxidative stress. The active site Cys is this subfamily resembles GHHC with one or both His conserved. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	0
NZ_CP020743.1\|WP_002034622.1\|5102296_5102944_+\|phosphatase-PAP2-family-protein	gnl\|CDD\|239481	cd03386, PAP2_Aur1_like, PAP2_like proteins, Aur1_like subfamily. Yeast Aur1p or Ipc1p is necessary for the addition of inositol phosphate to ceramide, an essential step in yeast sphingolipid synthesis, and is the target of several antifungal compounds such as aureobasidin.	1.14057e-15
NZ_CP020743.1\|WP_002089369.1\|5090503_5090935_-\|iron-sulfur-cluster-assembly-scaffold-protein-SufU	gnl\|CDD\|273918	TIGR01994, Iron-sulfur_cluster_assembly_scaffold_protein_IscU, SUF system FeS assembly protein, NifU family. Three iron-sulfur cluster assembly systems are known so far. ISC is broadly distributed while NIF tends to be associated with nitrogenase in nitrogen-fixing bacteria. The most recently described is SUF, believed to be important to maintain the function during aerobic stress of enzymes with labile Fe-S clusters. It is fairly widely distributed. This family represents one of two different proteins proposed to act as a scaffold on which the Fe-S cluster is built and from which it is transferred. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	8.52571e-74
NZ_CP020743.1\|WP_002034620.1\|5105231_5105480_-\|spore-coat-protein	gnl\|CDD\|377935	pfam07875, Coat_F, Coat F domain. The Coat F proteins, which contribute to the Bacillales spore coat. It occurs multiple times in the genomes it is found in.	3.12709e-15
NZ_CP020743.1\|WP_002089372.1\|5092144_5093437_-\|Fe-S-cluster-assembly-protein-SufD	gnl\|CDD\|223791	COG0719, SufB, Cysteine desulfurase activator SufB [Posttranslational modification, protein turnover, chaperones].	8.76133e-131
NZ_CP020743.1\|WP_002015935.1\|5095355_5096168_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224381	COG1464, NlpA, ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism].	2.04435e-111
NZ_CP020743.1\|WP_085312709.1\|5094475_5095282_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224381	COG1464, NlpA, ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism].	6.24765e-111
NZ_CP020743.1\|WP_000640865.1\|5099422_5099767_-\|hypothetical-protein	gnl\|CDD\|224572	COG1658, COG1658, Small primase-like proteins (Toprim domain) [DNA replication, recombination, and repair].	2.52725e-22
NZ_CP020743.1\|WP_002034576.1\|5093452_5094238_-\|Fe-S-cluster-assembly-ATPase-SufC	gnl\|CDD\|223473	COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones].	1.56656e-149
NZ_CP020743.1\|WP_085312708.1\|5086969_5088361_-\|bifunctional-metallophosphatase/5'-nucleotidase	gnl\|CDD\|223808	COG0737, UshA, 5'-nucleotidase/2',3'-cyclic phosphodiesterase and related esterases [Nucleotide transport and metabolism].	1.63127e-64
NZ_CP020743.1\|WP_085312710.1\|5096190_5096856_-\|ABC-transporter-permease	gnl\|CDD\|224922	COG2011, AbcD, ABC-type metal ion transport system, permease component [Inorganic ion transport and metabolism].	1.9668e-98
NZ_CP020743.1\|WP_172805444.1\|5099110_5099419_-\|thioredoxin-family-protein	gnl\|CDD\|239245	cd02947, TRX_family, TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains. Group I TRX is a small ancient protein that alter the redox state of target proteins via the reversible oxidation of an active site dithiol, present in a CXXC motif, partially exposed at the protein's surface. TRX reduces protein disulfide bonds, resulting in a disulfide bond at its active site. Oxidized TRX is converted to the active form by TRX reductase, using reducing equivalents derived from either NADPH or ferredoxins. By altering their redox state, TRX regulates the functions of at least 30 target proteins, some of which are enzymes and transcription factors. It also plays an important role in the defense against oxidative stress by directly reducing hydrogen peroxide and certain radicals, and by serving as a reductant for peroxiredoxins. At least two major types of functional TRXs have been reported in most organisms; in eukaryotes, they are located in the cytoplasm and the mitochondria. Higher plants contain more types (at least 20 TRX genes have been detected in the genome of Arabidopsis thaliana), two of which (types f amd m) are located in the same compartment, the chloroplast. Also included in the alignment are TRX-like domains which show sequence homology to TRX but do not contain the redox active CXXC motif. Group II proteins, in addition to either a redox active TRX or a TRX-like domain, also contain additional domains, which may or may not possess homology to known proteins.	4.27535e-18
NZ_CP020743.1\|WP_085312711.1\|5096848_5097874_-\|methionine-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224058	COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism].	8.82369e-178

>NZ_CP020743.1|WP_085312711.1|5096848_5097874_-|methionine-ABC-transporter-ATP-binding-protein
MILLENVKKIYKAKSGDVTAVDNANLQIEKGEIFGVIGYSGAGKSSLIRLFNQLEKPTSGQITIANRVISAITGSELRKARQEIGMIFQHFNLLWSRTVRENIAFPLEIAGVDKAERRKRVDELIHLVGLEGRGDAYPSQLSGGQKQRVGIARALANNPQVLLCDEATSALDPETTDQILDLLLDINKRLGLTIVLITHEMHVIRKICNRVAVMEKGKIVETGPVLDVFRNPQQDITKRFVQQLTDSEDTNETIESLIEKYPDGKVIRLQFVGEAVERPVLQRLMQRGDIEVSILQGNIAQTNNGSYGSLVVHLNGEETAIQQAIEGIHQDQVELEVIAHG
>NZ_CP020743.1|WP_085312710.1|5096190_5096856_-|ABC-transporter-permease
MDKLIANVDWNQMLEATGETLYMTAIAALATFVLGLILGLLLFMTAKDNLWENKAINTVIGAFVNIFRSIPFIILIILLIPFTKILLGTILGASAALPALIIGAAPFYARMVEIALREIDKGVIEASKAMGAKTSTIILKVLIPESLPALVSGITVTTIALVGYTAMAGVVGAGGLGTLAYLEGFQRGNNDVTIVATICVLLVVFLIQWIGDSLTTRIDKR
>NZ_CP020743.1|WP_002015935.1|5095355_5096168_-|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein
MKKLLLTALISTSIFGLAACGGKDKDEKKLVVGASNVPHAEILEKAKPLLEKKGIELEIKKFQDYVLPNKSLADKELDANYFQHIPYLEKEIKDKKYDFEIAGKIHLEPIGVYSQKYKSLKELPNGATIIMSNSVTDHGRGLAILQKEGILKIKDGVEPVKATPKDIADNPKNLKFKTDIEPGLLPQVYNNKEGDAVLINSNYAIDAKLNPEKDAIAIEGNDSPYANVVAVRKGDKDKKEIKALIEVLHSKEIEDFITKEYKGAVVPVKE
>NZ_CP020743.1|WP_085312709.1|5094475_5095282_-|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein
MKKIILSVVTALSVFTLAACGGKDENKLVVGASNIPHAVILEKAQPILEKKGIKLEIKKFQDYVLPNKALADKEIDANYFQHIPYLDKEIQEKGYKIVNAGKIHLEPMGIYSKKYKSLKELPDGGTVIMSNNVAERGRMLALLQKGGVIKLKDGVDVVKATVKDVVENPKNLKFKTDVEPGLSPKLYENNEGDALFINSNYAIDAKLNPTKDAIAIEGSDSPYANIIAVRKGDEKKKEIKELVEVLHSKEIQDFINKEYKGAVLPVNE
>NZ_CP020743.1|WP_002034576.1|5093452_5094238_-|Fe-S-cluster-assembly-ATPase-SufC
MAGSTLTVKDLHVSIDGKEILKGVNLEVKGGEIHAIMGPNGTGKSTLSSAIMGHPKYEVTEGSIIIDGEDVLEMEVDERALAGLFLAMQYPSEISGVTNADFLRSAINARREEGDEISLMKFIRTLDKNMEFLEMDPEMAQRYLNEGFSGGEKKRNEILQLMMIEPKIAILDEIDSGLDIDALKVVSKGINQMRGEEFGCLMITHYQRLLNYITPDFVHVMMNGRIVKSGGPELAQRLEAEGYDWIKKELGIEDETAEQEA
>NZ_CP020743.1|WP_002089372.1|5092144_5093437_-|Fe-S-cluster-assembly-protein-SufD
MTIGTLPFDQETIRQRASEVNEAAWLTEFRLQALAQATELPMPTPDKTKIEKWDFIGKGDAAKQEPVSSLTELPEAVKNLIDENNSVLVQRTGTTAFVSLADEAKEKGVIFTDIVTAATEHAELVQKYLMKDGVKVDEHRLTALHAALINGGAFVYVPKNVVLETPLQAVFLVDGEEANVYNHVLFVADANSTATYVENYVANENAKGIANIVAEVIVEQGAQVKFGAVDLLAKDVTTYVNRRGIVGRDGRIDWALGLMNDGNTISENVTNLMGDGSYADTKTVTIGRGNQTQNFTTKVVHFGKHSEGWILKHGVQKDSATSIFNGIGKIEHGASKSNAQQSSRVLMLDEKARGDANPILLIDEDDVMAGHAASVGRVDPYQLYYLMSRGIPKREAERLVIHGFLAPVVNELPIEGVKAQLVEVIERKVR
>NZ_CP020743.1|WP_002015930.1|5090924_5092145_-|cysteine-desulfurase-SufS
MNIHEIRKQFPILDQKVNGKQLVYFDSAATSQKPIQVIETLERYYKEYNSNVHRGVHTLGTKATDAYEGAREKVRKFINAKSMEEIIFTRGTTTALNTVAASYGLDNVKEGDEIVISYMEHHSNIIPWQQVAKKTGATLKYLPLQLDGTISLEDVRQTVTPNTKIVSIMHVSNVLGTINPVKEIGAIAHENGAIMIVDGAQSAPHMKVDVQDLNCDFYALSAHKMCGPTGVGVLYGKKELLNNMEPIEFGGEMIDFVDLQESTWKELPWKFEAGTPIIGNAIGLGAAIDFLEEIGLHNIEKHEHELAQYALERLSEVDGVTIYGPKHRAGLVTFNIEDVHPHDVATVLDVEGIAVRAGHHCAQPLMKWLKASSTARASFYLYNTKEEIDTFVESLIKTKEYFTNVI
>NZ_CP020743.1|WP_002089369.1|5090503_5090935_-|iron-sulfur-cluster-assembly-scaffold-protein-SufU
MSFNNLDTLYRQVIMDHYKNPRNHGVLEDSVTVNLNNPTCGDRIQLTMKVEEGIVQEAKFEGEGCSISMSSASMMTQAVKGKKIEEALKLSKIFSDMMLGKEYDDSIDLGDIEALQGVCKFPARIKCATLAWKALEKGLNEDK
>NZ_CP020743.1|WP_002015928.1|5089057_5090455_-|Fe-S-cluster-assembly-protein-SufB
MAKQLPDIGDYKYGFKDKDVSIFRAGRGLTKEIVEEISRMKEEPQWMLDFRLKSLDKFYEMPMPQWGGDLNDLDFDEITYYVKPSEKSEKSWDEVPEEIKATFDKLGIPEAEQKYLAGVSAQYESEVVYHNMKEDLEDLGVVFKDTDSALKENEDIFREHFGKVIPPTDNKFSALNSAVWSGGSFIYVPKGIKVDTPLQAYFRINSENMGQFERTLIIVDEGAHVHYVEGCTAPVYTTNSLHSAVVEIIIKKDAYCRYTTIQNWANNVYNLVTKRAVCEENATMEWIDGNIGSKLTMKYPAVILKGEGARGLTLSIAIAGKGQHQDAGAKMIHLAPNTSSTIVSKSIAKHGGKVTYRGIVQFGPKAKNSRSNIECDTLIMDNQSTSDTIPYNEIKNDYVSLEHEAKVSKVSEEQLFYLMSRGISEQEATEMIVMGFIEPFTRELPMEYAVEMNRLIKFEMEGSIG
>NZ_CP020743.1|WP_085312708.1|5086969_5088361_-|bifunctional-metallophosphatase/5'-nucleotidase
MHLYHTNDIHSHFENWPQISRFVRGEKKRRQEAGETVLTVDIGDHVDRFHSISEATNGIGNTKLLNEALYDYVTIGNNEGITLAKEHLNRLYDDAGFEVLVANLFEKEGVRPAWAQPYKLHTTTDGITIAFIGLTVAYPEFYHMLDWHIEDPIIHLESILEEVKDTAHITVVLSHLGKSMDEYMAEHYDIDVILGAHTHHLFERGVLVDNTLLCCCEKWGHYVGHVQLTVDKETKRLLKKDGRAIKTERLGAYSEPLSTIEMLKEESKQIMAEPVVHLKESLPVDWFKETTFSHMLASALKEWCNADVGMVNAGVLLEGLNEGVVTRGDIHRICPHPINPCLLKVPGKTLREVILKARRPNMENLEVKGFGFRGKVMGKMIYDGLEVIPDTIPGNKILLEDVLINGESLELDRIYTVGTIDMFTFGYLYPELSTLSDKQYYMPELLRDVLTDMLITYKSSVKL
>NZ_CP020743.1|WP_085312712.1|5098613_5098958_-|hypothetical-protein
MKLYSLLQSFVHYANGQYHLEPLLRQGERTVNFRFGDECCSLQISRDYIELLKEARGTEQIVCLEEEDVQKLVTGNMRLQKLMSDGRVQYSGTYRTMLLVESMFHICKPMSVGA
>NZ_CP020743.1|WP_172805444.1|5099110_5099419_-|thioredoxin-family-protein
MIEVIDWTGAEATALIGNEEKTVLYVYTPMCGTCQLAKKMLTVVEMTIEDLQIGMLDLNYAPHLAKEYGIESVPCLLIFENGTLMKKIYAFHSVEYLYTELK
>NZ_CP020743.1|WP_000640865.1|5099422_5099767_-|hypothetical-protein
MIYVEKVIIVEGKSDRRKIESIIREPVEIVCTNGTIGLSKMDELIDQFFDKDVYVLVDADDAGEKLRKQFRKEFPQAEHIYIDRSYREVATAPSSHLANVLWGADIDVYTEYLR
>NZ_CP020743.1|WP_000026895.1|5100184_5100568_-|glycine-cleavage-system-protein-GcvH
MSIPNNLRYSEEHEWVKTEGNAVVIGITHFAQGELGDIVFVELPEVGATIQADEPFGSVESVKTVSELYAPVSGKVVAVNEELSDQPELVNESPYEGAWMVKVELSDASQVEKLLTAEKYAEMTNQD
>NZ_CP020743.1|WP_002129756.1|5100609_5100975_-|arsenate-reductase-family-protein
MTVTFYSYPKCGTCQKAKKWFEANDVAYEMIHIVENPPSKEDLRNLHEKSELPLKKFFNTSGMRYRELGLKDKLKDASEDEMYELLASDGMLIKRPIVTDGTSVTLGFNEEQFESVWKKYQ
>NZ_CP020743.1|WP_085312714.1|5101624_5102152_-|hypothetical-protein
MKRSLYFLVFILLCLVSTGCAKDKEGENLEYNGRALVIGVVGEKPKDTFRNIKFEKVKLEELKKESGAVDGFLIMKEHFQEASKEQYKDVFSSLKKPVFFIGLQDKSYSTFITKGIEYNSARKDVNAMYAQGFANIGSGEGQQWGVGLSNGGNTEESIHNMYIVVFQTISDYLSR
>NZ_CP020743.1|WP_002034622.1|5102296_5102944_+|phosphatase-PAP2-family-protein
MKKFKLSSLLPLSYILLLVLVSPLYDVLNKSTVHAVDVTTVVDDWIPFVKAFIIPYLLWFPYLYGALIYYCFADRKQYYVTLSSVILGKLACFSIYFFWQTTVPRPTVVGTDVFSELVRYIYSIDQPVNCFPSIHVLTTFVIMLAAFKRREQHTLEYYILTFFGTLIILSTLFTKQHAFVDAISGMTLASVLYFGVQLLLAKETVRVPVKQNHKM
>NZ_CP020743.1|WP_002089394.1|5102998_5104012_-|PTS-sugar-transporter-subunit-IIC
MKEYIMSRVFKASAGIAQGIFVSLGIGLLIENIGRIVDIPLLITIGVVAKSLMAPAIGAGIAFMLGANGLVIFSAMVAGAIGAGSISITEAGLIIKTGEPIGALLTATLAVYIGKRLSGKTALDMMLVPFAAILGSGLVGIWLAQNISPVLNTVGAFIKDSSAGSPFIASIVIAVVWGLLLISPASSAALAIALSLDGVAGGAALAGCVAQFIGFSVISAKENNLGGILAQALCTPKVQLPNITKNPMILVPTVVASAIVGPVSALIFQLEAGKEIAGLGLSSLIAPINLISSQGWEVVPAMVITYIIIPVAVSYILYIALKKAGRIHSGDMTVPQS
>NZ_CP020743.1|WP_002034620.1|5105231_5105480_-|spore-coat-protein
MNEKDMVNDYLAGLNSSLTSYANYISQSDNEQLHQTLIQIRNQDESRQRNMYEYAKQKSYYKPAAPANPMIVQQLKSQLSAE
>NZ_CP020743.1|WP_001180550.1|5105493_5105679_-|hypothetical-protein
MQNLTELEVENLRHLIGGHATIINKLDQYAQACTDPQLKQMLQKDAQDARNTKQQLMTFLG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP020743_4	4.3\|3059622\|30\|NZ_CP020743\|CRT	3059622-3059651	30	NC_025124	Arcobacter butzleri strain AC1166 plasmid AB-1166-LD, complete sequence	2791-2820	6	0.8
NZ_CP020743_4	4.3\|3059622\|30\|NZ_CP020743\|CRT	3059622-3059651	30	NC_025125	Arcobacter butzleri strain AC1163 plasmid AB-1163-LD, complete sequence	3116-3145	6	0.8
NZ_CP020743_4	4.3\|3059622\|30\|NZ_CP020743\|CRT	3059622-3059651	30	MH648920	Microviridae sp. isolate cthi004, complete genome	2921-2950	6	0.8
NZ_CP020743_4	4.3\|3059622\|30\|NZ_CP020743\|CRT	3059622-3059651	30	AJ312240	Bacteriophage PSA complete genome	26931-26960	6	0.8
NZ_CP020743_4	4.3\|3059622\|30\|NZ_CP020743\|CRT	3059622-3059651	30	NZ_CP017949	Tenericutes bacterium MO-XQ plasmid unnamed, complete sequence	10453-10482	7	0.767
NZ_CP020743_4	4.3\|3059622\|30\|NZ_CP020743\|CRT	3059622-3059651	30	NZ_CP035461	Photobacterium damselae subsp. damselae strain KC-Na-NB1 plasmid pFPPDNB1-3, complete sequence	46871-46900	7	0.767
NZ_CP020743_4	4.3\|3059622\|30\|NZ_CP020743\|CRT	3059622-3059651	30	NZ_CP021155	Photobacterium damselae subsp. damselae strain KC-Na-1 plasmid pPDD-Na-1-3, complete sequence	39361-39390	7	0.767
NZ_CP020743_4	4.3\|3059622\|30\|NZ_CP020743\|CRT	3059622-3059651	30	MN694072	Marine virus AFVG_250M222, complete genome	29757-29786	7	0.767
NZ_CP020743_4	4.3\|3059622\|30\|NZ_CP020743\|CRT	3059622-3059651	30	MT648819	Acinetobacter phage C001, partial genome	24047-24076	7	0.767
NZ_CP020743_4	4.3\|3059622\|30\|NZ_CP020743\|CRT	3059622-3059651	30	NZ_MG973074	Clostridioides difficile strain HSJD-312 plasmid pHSJD-312, complete sequence	16730-16759	7	0.767
NZ_CP020743_2	2.2\|2059171\|31\|NZ_CP020743\|PILER-CR	2059171-2059201	31	NZ_CP015305	Chlamydia trachomatis strain E-DK-20 plasmid pCtrEDK20, complete sequence	98-128	8	0.742
NZ_CP020743_2	2.2\|2059171\|31\|NZ_CP020743\|PILER-CR	2059171-2059201	31	NC_001372	Chlamydia trachomatis plasmid pCHL1, complete sequence	6955-6985	8	0.742
NZ_CP020743_4	4.3\|3059622\|30\|NZ_CP020743\|CRT	3059622-3059651	30	KX119195	Helicobacter phage FrGC43A, complete genome	18243-18272	8	0.733
NZ_CP020743_4	4.3\|3059622\|30\|NZ_CP020743\|CRT	3059622-3059651	30	KX119194	Helicobacter phage FrG12G, complete genome	15808-15837	8	0.733
NZ_CP020743_4	4.3\|3059622\|30\|NZ_CP020743\|CRT	3059622-3059651	30	MN693954	Marine virus AFVG_250M569, complete genome	42782-42811	8	0.733
NZ_CP020743_4	4.3\|3059622\|30\|NZ_CP020743\|CRT	3059622-3059651	30	NC_002579	Aggregatibacter actinomycetemcomitans plasmid pVT745, complete sequence	17703-17732	8	0.733

1. spacer 4.3|3059622|30|NZ_CP020743|CRT matches to NC_025124 (Arcobacter butzleri strain AC1166 plasmid AB-1166-LD, complete sequence) position: , mismatch: 6, identity: 0.8

ttctttttccttagcttttgctatttcttg	CRISPR spacer
ttgcaagtccttagcttttgctagttcttg	Protospacer
** .   **************** ******

2. spacer 4.3|3059622|30|NZ_CP020743|CRT matches to NC_025125 (Arcobacter butzleri strain AC1163 plasmid AB-1163-LD, complete sequence) position: , mismatch: 6, identity: 0.8

ttctttttccttagcttttgctatttcttg	CRISPR spacer
ttgcaagtccttagcttttgctagttcttg	Protospacer
** .   **************** ******

3. spacer 4.3|3059622|30|NZ_CP020743|CRT matches to MH648920 (Microviridae sp. isolate cthi004, complete genome) position: , mismatch: 6, identity: 0.8

ttctttttccttagcttttgctatttcttg	CRISPR spacer
agctaattccttagcttttgctgattcttg	Protospacer
  **  ****************. ******

4. spacer 4.3|3059622|30|NZ_CP020743|CRT matches to AJ312240 (Bacteriophage PSA complete genome) position: , mismatch: 6, identity: 0.8

ttctttttccttagcttttgctatttcttg	CRISPR spacer
taccatttcctttgcttctgctatttcttc	Protospacer
* *. ******* ****.***********

5. spacer 4.3|3059622|30|NZ_CP020743|CRT matches to NZ_CP017949 (Tenericutes bacterium MO-XQ plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ttctttttccttagcttttgctatttcttg	CRISPR spacer
ttctttttccttagctttagctggtttcac	Protospacer
****************** ***. **..

6. spacer 4.3|3059622|30|NZ_CP020743|CRT matches to NZ_CP035461 (Photobacterium damselae subsp. damselae strain KC-Na-NB1 plasmid pFPPDNB1-3, complete sequence) position: , mismatch: 7, identity: 0.767

ttctttttccttagcttttgctatttcttg	CRISPR spacer
caccctttccttagcctttgctttttcttt	Protospacer
. *..**********.****** ******

7. spacer 4.3|3059622|30|NZ_CP020743|CRT matches to NZ_CP021155 (Photobacterium damselae subsp. damselae strain KC-Na-1 plasmid pPDD-Na-1-3, complete sequence) position: , mismatch: 7, identity: 0.767

ttctttttccttagcttttgctatttcttg	CRISPR spacer
caccctttccttagcctttgctttttcttt	Protospacer
. *..**********.****** ******

8. spacer 4.3|3059622|30|NZ_CP020743|CRT matches to MN694072 (Marine virus AFVG_250M222, complete genome) position: , mismatch: 7, identity: 0.767

ttctttttccttagcttttgctatttcttg	CRISPR spacer
tctttttttcttagcttttgctatggttgg	Protospacer
*..*****.***************  .* *

9. spacer 4.3|3059622|30|NZ_CP020743|CRT matches to MT648819 (Acinetobacter phage C001, partial genome) position: , mismatch: 7, identity: 0.767

ttctttttccttagcttttgctatttcttg	CRISPR spacer
agatgtttccttagcttttgcaatttatag	Protospacer
   * **************** **** * *

10. spacer 4.3|3059622|30|NZ_CP020743|CRT matches to NZ_MG973074 (Clostridioides difficile strain HSJD-312 plasmid pHSJD-312, complete sequence) position: , mismatch: 7, identity: 0.767

ttctttttccttagcttttgctatttcttg	CRISPR spacer
atatttttcattagattttgctattttatt	Protospacer
 * ****** **** ***********. *

11. spacer 2.2|2059171|31|NZ_CP020743|PILER-CR matches to NZ_CP015305 (Chlamydia trachomatis strain E-DK-20 plasmid pCtrEDK20, complete sequence) position: , mismatch: 8, identity: 0.742

tacacgagtacattttgtaacaaaagtccat	CRISPR spacer
gattttaataaattttttaacaaaagtccat	Protospacer
 *. . *.** ***** **************

12. spacer 2.2|2059171|31|NZ_CP020743|PILER-CR matches to NC_001372 (Chlamydia trachomatis plasmid pCHL1, complete sequence) position: , mismatch: 8, identity: 0.742

tacacgagtacattttgtaacaaaagtccat	CRISPR spacer
gattttaataaattttttaacaaaagtccat	Protospacer
 *. . *.** ***** **************

13. spacer 4.3|3059622|30|NZ_CP020743|CRT matches to KX119195 (Helicobacter phage FrGC43A, complete genome) position: , mismatch: 8, identity: 0.733

ttctttttccttagcttttgctatttcttg	CRISPR spacer
aaactccgccttagctttttctatttcttg	Protospacer
   .*.. *********** **********

14. spacer 4.3|3059622|30|NZ_CP020743|CRT matches to KX119194 (Helicobacter phage FrG12G, complete genome) position: , mismatch: 8, identity: 0.733

ttctttttccttagcttttgctatttcttg	CRISPR spacer
aaactccgccttagctttttctatttcttg	Protospacer
   .*.. *********** **********

15. spacer 4.3|3059622|30|NZ_CP020743|CRT matches to MN693954 (Marine virus AFVG_250M569, complete genome) position: , mismatch: 8, identity: 0.733

ttctttttccttagcttttgctatttcttg	CRISPR spacer
acctctttccatagcttttgctattttaga	Protospacer
 .**.***** ***************.  .

16. spacer 4.3|3059622|30|NZ_CP020743|CRT matches to NC_002579 (Aggregatibacter actinomycetemcomitans plasmid pVT745, complete sequence) position: , mismatch: 8, identity: 0.733

ttctttttccttagcttttgctatttcttg	CRISPR spacer
ttctttttccttagcttgtgccggttgcgt	Protospacer
***************** ***.. ** .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

259850 : 267798

uncultured_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002009985.1\|259850_260135_+	co-chaperone GroES	A0A221S3C8	uncultured_virus	4.4e-20	53.8
WP_002029451.1\|260172_261807_+	chaperonin GroEL	A0A219YK78	uncultured_virus	2.2e-156	57.8
WP_164081472.1\|262210_263752_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	2.0e-21	31.2
WP_002091603.1\|264136_265462_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	2.4e-44	30.2
WP_085308686.1\|265607_266309_+	response regulator transcription factor	W8CYM9	Bacillus_phage	5.6e-40	36.9
WP_085308688.1\|266292_267798_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	2.1e-31	30.3

DBSCAN-SWA_2

339011 : 402712

Bacillus_phage(88.68%)

transposase,terminase,capsid,tail,head,integrase,portal,protease,tRNA

attL 338939:338960|attR 383845:383866

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
338939:338960	attL	NA	NA	NA	NA
WP_085308735.1\|339011_340073_-\|integrase	site-specific integrase	H0UST3	Bacillus_phage	2.0e-158	78.8
WP_085312926.1\|340672_341923_+	hypothetical protein	W8CYT9	Bacillus_phage	4.1e-187	80.1
WP_085308737.1\|342301_342649_-	helix-turn-helix transcriptional regulator	I7J6V3	Bacillus_phage	8.8e-55	95.6
WP_085308739.1\|342794_343031_+	helix-turn-helix transcriptional regulator	A0A0S2GLE0	Bacillus_phage	4.0e-35	93.6
WP_085308741.1\|343063_343252_+	helix-turn-helix transcriptional regulator	W8CYN7	Bacillus_phage	2.5e-24	91.9
WP_172805393.1\|343273_343429_+	hypothetical protein	I7J4K2	Bacillus_phage	7.5e-22	96.0
WP_085308743.1\|343466_344261_+	ORF6C domain-containing protein	A0A0S2GLP8	Bacillus_phage	1.2e-134	94.3
WP_085308745.1\|344420_344729_+	hypothetical protein	W8CYU1	Bacillus_phage	6.9e-43	86.1
WP_085308747.1\|344906_345803_+	conserved phage C-terminal domain-containing protein	A0A0U3TZZ4	Bacillus_phage	4.7e-76	61.9
WP_085308750.1\|345738_346611_+	ATP-binding protein	A0A1B0T6C3	Bacillus_phage	1.7e-102	72.1
WP_085308752.1\|346644_347004_+	cell division protein SepF	A0A1B1P7A1	Bacillus_phage	9.2e-31	51.7
WP_085308754.1\|346981_347188_+	DUF3954 domain-containing protein	A0A1B1P7U5	Bacillus_phage	2.2e-13	67.9
WP_085308756.1\|347218_347791_+	hypothetical protein	A0A1C8E9B1	Bacillus_phage	5.1e-92	86.3
WP_085308758.1\|347970_348378_-	DUF4870 domain-containing protein	NA	NA	NA	NA
WP_085308762.1\|348944_350174_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	1.7e-84	49.1
WP_085308763.1\|350542_351238_+	hypothetical protein	A0A1I9S6E4	Bacillus_phage	8.7e-110	79.3
WP_085308765.1\|351282_351633_+	hypothetical protein	NA	NA	NA	NA
WP_085308767.1\|351669_352038_+	spore protein H	NA	NA	NA	NA
WP_085308769.1\|352082_352382_+	hypothetical protein	D2XR51	Bacillus_phage	9.9e-47	90.9
WP_085308771.1\|352417_352645_+	hypothetical protein	A0A288WFX6	Bacillus_phage	1.6e-36	100.0
WP_085308773.1\|352678_352990_+	hypothetical protein	A0A0A7AR06	Bacillus_phage	1.1e-43	90.3
WP_085308775.1\|353025_353271_+	hypothetical protein	A0A0S2MV78	Bacillus_phage	1.8e-25	64.2
WP_085308777.1\|353436_353634_+	hypothetical protein	NA	NA	NA	NA
WP_085308779.1\|354051_354408_+	hypothetical protein	NA	NA	NA	NA
WP_157404927.1\|354515_354677_+	DUF3983 domain-containing protein	NA	NA	NA	NA
WP_172805394.1\|354790_354961_+	hypothetical protein	A0A1B1P735	Bacillus_phage	2.2e-06	82.1
WP_085308781.1\|354988_355471_+	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	5.0e-72	83.8
WP_085308782.1\|355470_356013_+\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	3.3e-88	90.6
WP_085308785.1\|356227_356452_+	hypothetical protein	H0USV5	Bacillus_phage	7.5e-31	91.9
WP_085308787.1\|356837_357053_+	hypothetical protein	NA	NA	NA	NA
WP_085308789.1\|357105_357327_+	hypothetical protein	H0USV7	Bacillus_phage	2.6e-20	75.3
WP_085308790.1\|357319_357574_+	hypothetical protein	NA	NA	NA	NA
WP_172805395.1\|357613_357787_+	hypothetical protein	NA	NA	NA	NA
WP_085308794.1\|357833_358046_+	hypothetical protein	A0A1B1P8F3	Bacillus_phage	2.4e-26	87.1
WP_085308798.1\|358398_358650_+	hydrolase	NA	NA	NA	NA
WP_085308800.1\|358662_358917_+	hypothetical protein	H0USW0	Bacillus_phage	3.8e-39	93.8
WP_085308802.1\|358932_359118_+	hypothetical protein	NA	NA	NA	NA
WP_085308804.1\|359107_359506_+	HNH endonuclease	A0A0S2GLI5	Bacillus_phage	1.3e-65	94.4
WP_063607610.1\|359614_360118_+\|terminase	phage terminase small subunit P27 family	A0A2H4J8E3	uncultured_Caudovirales_phage	2.4e-85	95.8
WP_085308806.1\|360119_361814_+\|terminase	terminase large subunit	A0A0S2GLF0	Bacillus_phage	0.0e+00	93.3
WP_085308808.1\|362002_363250_+\|portal	phage portal protein	A0A0S2GLJ4	Bacillus_phage	2.2e-225	93.3
WP_050000543.1\|363236_363947_+\|protease	Clp protease ClpP	W8CYT5	Bacillus_phage	1.1e-123	95.3
WP_085308810.1\|363984_365163_+\|capsid	phage major capsid protein	W8CYN2	Bacillus_phage	1.2e-196	90.7
WP_085308811.1\|365183_365462_+\|head,tail	phage gp6-like head-tail connector protein	A0A0S2GLH6	Bacillus_phage	3.3e-36	84.8
WP_085308813.1\|365458_365782_+\|head	phage head closure protein	H0USW8	Bacillus_phage	8.5e-52	88.8
WP_078206878.1\|365774_366209_+	hypothetical protein	A0A288WGB7	Bacillus_phage	5.1e-68	89.0
WP_085308816.1\|366205_366565_+	DUF3168 domain-containing protein	W8CYY6	Bacillus_phage	5.2e-58	91.6
WP_085308818.1\|366565_367174_+\|tail	phage tail protein	A0A288WG55	Bacillus_phage	1.2e-94	90.6
WP_085308820.1\|367221_367539_+	hypothetical protein	A0A288WFU6	Bacillus_phage	1.8e-46	86.7
WP_170972767.1\|367568_367745_+	hypothetical protein	Q3HL07	Bacillus_phage	1.4e-13	67.2
WP_085308822.1\|367760_371609_+\|tail	phage tail tape measure protein	A0A288WG88	Bacillus_phage	0.0e+00	82.5
WP_085308824.1\|371623_373114_+\|tail	phage tail family protein	A0A2H4JC38	uncultured_Caudovirales_phage	2.2e-267	87.7
WP_085308826.1\|373110_377187_+\|tail	phage tail protein	H0USX5	Bacillus_phage	0.0e+00	62.7
WP_085308828.1\|377287_378247_+\|integrase	site-specific integrase	A0A0S2GLC8	Bacillus_phage	6.4e-172	94.0
WP_085308830.1\|378260_378542_+	hypothetical protein	A0A0S2GM64	Bacillus_phage	1.4e-34	83.9
WP_085308832.1\|378544_378757_+	hypothetical protein	A0A0S2GM50	Bacillus_phage	4.6e-30	89.7
WP_085308834.1\|378756_379542_+	N-acetylmuramoyl-L-alanine amidase	A0A1B1P7T9	Bacillus_phage	4.6e-35	83.1
WP_085308836.1\|379849_380080_-	helix-turn-helix domain-containing protein	S5MBY6	Brevibacillus_phage	2.3e-11	45.7
WP_085308838.1\|380524_380845_+	hypothetical protein	A0A0S2GLK1	Bacillus_phage	5.6e-48	93.4
WP_085308840.1\|380855_382022_+	DNA translocase FtsK	A0A0S2GLG9	Bacillus_phage	3.3e-202	89.7
WP_085308842.1\|382011_382620_+	replication-relaxation family protein	A0A0S2GLL8	Bacillus_phage	6.6e-106	92.5
WP_085308845.1\|382622_383504_-	helix-turn-helix domain-containing protein	I7ILW0	Bacillus_phage	1.5e-127	84.9
WP_000086999.1\|384184_384475_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
383845:383866	attR	NA	NA	NA	NA
WP_002010048.1\|384489_385947_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_002010050.1\|385961_387389_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_002010051.1\|387948_388854_+	diacylglycerol kinase	A0A1V0SBJ0	Catovirus	5.4e-27	30.1
WP_085308847.1\|389048_389795_+	HAD family hydrolase	NA	NA	NA	NA
WP_172805396.1\|389950_391315_+	4-aminobutyrate--2-oxoglutarate transaminase	NA	NA	NA	NA
WP_002029493.1\|391622_392990_+	sigma 54-interacting transcriptional regulator	NA	NA	NA	NA
WP_002124905.1\|392982_394434_+	NADP-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_000263259.1\|394481_394805_+	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_085308851.1\|394845_396075_-	aminopeptidase	NA	NA	NA	NA
WP_085308853.1\|396191_397274_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_085308855.1\|397777_398482_+	hypothetical protein	NA	NA	NA	NA
WP_016093450.1\|398528_399725_-	NupC family nucleoside transporter	NA	NA	NA	NA
WP_085308857.1\|400144_401521_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	1.9e-116	46.4
WP_085308859.1\|401722_402712_+\|tRNA	tRNA-dihydrouridine synthase	NA	NA	NA	NA

DBSCAN-SWA_3

815304 : 855553

Bacillus_phage(93.02%)

transposase,terminase,capsid,tail,head,integrase,portal,protease,holin

attL 809745:809761|attR 838950:838966

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
809745:809761	attL	NA	NA	NA	NA
WP_085309205.1\|815304_816396_-\|integrase	site-specific integrase	A0A0S2GLI2	Bacillus_phage	7.9e-158	77.7
WP_085309207.1\|817010_818273_+	hypothetical protein	A0A288WGM1	Bacillus_phage	8.9e-137	58.1
WP_085309209.1\|818601_818949_-	helix-turn-helix transcriptional regulator	A0A288WGH2	Bacillus_phage	7.3e-33	64.3
WP_085309211.1\|819098_819314_+	helix-turn-helix transcriptional regulator	A0A288WG89	Bacillus_phage	1.8e-18	64.7
WP_085309213.1\|819398_819587_+	helix-turn-helix domain-containing protein	A0A0S2GLE9	Bacillus_phage	6.5e-20	80.6
WP_170924938.1\|819611_819767_+	hypothetical protein	I7J4K2	Bacillus_phage	8.2e-21	92.0
WP_085309215.1\|819804_820620_+	ORF6C domain-containing protein	Q3HL19	Bacillus_phage	4.1e-119	78.2
WP_085309217.1\|820779_821094_+	hypothetical protein	A0A0S2GLB6	Bacillus_phage	1.2e-45	87.5
WP_085309219.1\|821367_822015_+	sigma-70 family RNA polymerase sigma factor	W8CYN8	Bacillus_phage	1.1e-93	80.5
WP_085312931.1\|822260_823163_+	DNA replication protein DnaD	A0A0S2GLI6	Bacillus_phage	2.9e-105	65.3
WP_172805449.1\|823131_823938_+	ATP-binding protein	D2XQ17	Bacillus_virus	6.1e-123	80.9
WP_085309223.1\|824022_824289_+	hypothetical protein	A0A0S2GLK4	Bacillus_phage	2.4e-36	87.5
WP_085309225.1\|824361_824529_+	DUF3954 domain-containing protein	A0A0S2GLF5	Bacillus_phage	6.6e-16	75.9
WP_085309227.1\|824561_824831_+	hypothetical protein	NA	NA	NA	NA
WP_157404885.1\|824925_825093_+	hypothetical protein	NA	NA	NA	NA
WP_085309231.1\|825692_826232_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_085309233.1\|826511_826877_+	hypothetical protein	A0A0A7AR03	Bacillus_phage	4.1e-34	61.2
WP_085308769.1\|827197_827497_+	hypothetical protein	D2XR51	Bacillus_phage	9.9e-47	90.9
WP_172805399.1\|828580_828745_+	hypothetical protein	W8CYP0	Bacillus_phage	7.6e-17	84.9
WP_085309242.1\|828930_829215_+	hypothetical protein	A0A1B1P8C3	Bacillus_phage	2.0e-25	61.7
WP_085312932.1\|829451_829730_+	hypothetical protein	NA	NA	NA	NA
WP_172805400.1\|829726_829888_+	hypothetical protein	NA	NA	NA	NA
WP_085309244.1\|829924_830296_+	hypothetical protein	A0A140HLN4	Bacillus_phage	2.5e-15	41.5
WP_157404886.1\|830314_830449_+	DUF3983 domain-containing protein	NA	NA	NA	NA
WP_172805401.1\|830551_830722_+	hypothetical protein	A0A1B0T6D0	Bacillus_phage	3.9e-08	69.6
WP_050000419.1\|830742_831213_+	ArpU family transcriptional regulator	A0A1B1P744	Bacillus_phage	4.9e-48	61.8
WP_085309246.1\|831209_831752_+\|integrase	tyrosine-type recombinase/integrase	A0A1B1P7Y2	Bacillus_phage	1.1e-88	90.6
WP_085309248.1\|832372_832822_+	hypothetical protein	A0A288WG64	Bacillus_phage	5.2e-31	53.8
WP_157404887.1\|832853_833183_+	hypothetical protein	A0A0S2MVB8	Bacillus_phage	7.7e-16	54.5
WP_085309250.1\|833169_833382_+	hypothetical protein	A0A1B1P8F3	Bacillus_phage	2.1e-19	72.9
WP_085309252.1\|833663_833894_+	hypothetical protein	NA	NA	NA	NA
WP_085309254.1\|833883_834240_+	HNH endonuclease	A0A1B1P8D2	Bacillus_phage	1.6e-30	56.0
WP_085309256.1\|834253_834487_+	hypothetical protein	NA	NA	NA	NA
WP_085309258.1\|834636_835017_+\|terminase	phage terminase small subunit P27 family	A0A1B1P7R2	Bacillus_phage	8.2e-62	93.7
WP_085309260.1\|834997_836770_+\|terminase	terminase large subunit	A0A1B1P7R3	Bacillus_phage	1.6e-311	87.9
WP_085309262.1\|836791_838009_+\|portal	phage portal protein	A0A0U3SQF0	Bacillus_phage	1.0e-150	62.5
WP_085309264.1\|837986_838745_+\|protease	Clp protease ClpP	A0A0U3U021	Bacillus_phage	7.3e-86	64.7
WP_157404928.1\|838768_839953_+\|capsid	phage major capsid protein	A0A0K2CZ99	Paenibacillus_phage	1.0e-150	71.2
838950:838966	attR	NA	NA	NA	NA
WP_085312934.1\|840029_840230_+	hypothetical protein	NA	NA	NA	NA
WP_085309268.1\|840242_840494_+\|head,tail	phage gp6-like head-tail connector protein	H0USW7	Bacillus_phage	4.9e-15	47.1
WP_085309270.1\|840500_840848_+\|head	phage head closure protein	A0A1B1P7T4	Bacillus_phage	1.7e-58	93.9
WP_085309272.1\|840835_841273_+	HK97 gp10 family phage protein	A0A1B1P7R6	Bacillus_phage	5.9e-72	91.7
WP_085309274.1\|841269_841629_+	structural protein	A0A1B1P7S7	Bacillus_phage	2.5e-60	93.3
WP_085309276.1\|841642_842224_+\|tail	phage tail protein	A0A1B1P7S4	Bacillus_phage	7.5e-99	91.7
WP_085309278.1\|842699_842840_+	LysR family transcriptional regulator	A0A1B1P7R9	Bacillus_phage	2.5e-16	89.1
WP_085309279.1\|842854_847864_+\|tail	phage tail tape measure protein	A0A1B1P7S6	Bacillus_phage	0.0e+00	73.5
WP_085309280.1\|847904_849392_+\|tail	phage tail family protein	A0A1B1P7W7	Bacillus_phage	2.8e-238	78.8
WP_085309282.1\|849388_853402_+\|tail	tail fiber domain-containing protein	A0A1B1P7S3	Bacillus_phage	0.0e+00	81.2
WP_085309284.1\|853424_853865_+	hypothetical protein	A0A2H4J6F8	uncultured_Caudovirales_phage	1.5e-75	95.3
WP_085309286.1\|854125_854350_+	hemolysin XhlA family protein	A0A1B1P780	Bacillus_phage	5.4e-29	95.9
WP_085309288.1\|854426_854852_+\|holin	phage holin family protein	H0USX7	Bacillus_phage	3.4e-64	88.7
WP_085309290.1\|854851_855553_+	N-acetylmuramoyl-L-alanine amidase	W8CZ46	Bacillus_phage	7.1e-120	88.1

DBSCAN-SWA_4

1476907 : 1505399

Bacillus_phage(75.86%)

integrase,transposase,tail,holin

attL 1495966:1495981|attR 1512463:1512478

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085309993.1\|1476907_1478794_-	LTA synthase family protein	W6LM83	Streptococcus_phage	1.8e-85	33.7
WP_085309995.1\|1478988_1480098_-\|integrase	site-specific integrase	A0A0U3U8Y8	Bacillus_phage	5.6e-143	76.9
WP_085309997.1\|1480440_1481589_+	hypothetical protein	H0UST6	Bacillus_phage	1.9e-82	40.1
WP_153602161.1\|1481592_1481748_+	hypothetical protein	NA	NA	NA	NA
WP_085309999.1\|1481951_1482296_+	hypothetical protein	NA	NA	NA	NA
WP_006926358.1\|1482332_1482995_+	hypothetical protein	A0A0A7AR45	Bacillus_phage	2.2e-46	43.3
WP_157404891.1\|1483146_1483299_+	DNA polymerase III subunit delta'	A0A0A7AQZ6	Bacillus_phage	7.3e-14	78.0
WP_085310001.1\|1483305_1483653_-	helix-turn-helix transcriptional regulator	A0A0A7AR52	Bacillus_phage	2.5e-49	92.2
WP_033692757.1\|1483829_1484048_+	helix-turn-helix transcriptional regulator	A0A0A7AQV9	Bacillus_phage	5.9e-33	94.4
WP_085310003.1\|1484107_1484902_+	phage antirepressor KilAC domain-containing protein	A0A0B5A507	Paenibacillus_phage	6.3e-72	55.1
WP_085310005.1\|1484916_1485192_+	helix-turn-helix domain-containing protein	A0A0U3ULL9	Bacillus_phage	8.0e-35	84.3
WP_172805407.1\|1485226_1485373_+	hypothetical protein	A0A1B1P8G4	Bacillus_phage	7.5e-08	60.4
WP_172805408.1\|1485420_1485597_+	hypothetical protein	A0A1B1P7U0	Bacillus_phage	7.2e-21	77.6
WP_078204460.1\|1485602_1486466_+	phage replisome organizer N-terminal domain-containing protein	V5UQV4	Oenococcus_phage	5.3e-40	43.1
WP_078204461.1\|1486407_1487271_+	ATP-binding protein	A0A1B0T6C3	Bacillus_phage	9.8e-103	72.3
WP_078204462.1\|1487273_1487468_+	hypothetical protein	A0A1B1P7U7	Bacillus_phage	4.3e-27	90.6
WP_085310007.1\|1487484_1487763_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	4.6e-14	62.7
WP_085310009.1\|1487755_1488115_+	cell division protein SepF	A0A1B1P7A1	Bacillus_phage	3.5e-30	53.3
WP_042596972.1\|1488134_1488302_+	DUF3954 domain-containing protein	A0A1B0T6B8	Bacillus_phage	1.4e-13	62.3
WP_000109496.1\|1488327_1488579_+	hypothetical protein	A0A0K2CNP4	Brevibacillus_phage	6.5e-07	42.2
WP_085310011.1\|1488598_1489054_+	nucleoside triphosphate pyrophosphohydrolase family protein	A0A0U4IBD0	Bacillus_phage	1.1e-20	48.6
WP_085310013.1\|1489091_1489361_+	hypothetical protein	NA	NA	NA	NA
WP_085310015.1\|1489347_1489647_-	hypothetical protein	NA	NA	NA	NA
WP_085312947.1\|1489748_1489943_+	hypothetical protein	NA	NA	NA	NA
WP_085308762.1\|1490246_1491476_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	1.7e-84	49.1
WP_085310017.1\|1491845_1492163_+	hypothetical protein	A0A288WFU6	Bacillus_phage	4.0e-46	86.7
WP_157404892.1\|1492192_1492369_+	hypothetical protein	W8CYG0	Bacillus_phage	2.0e-15	70.7
WP_085310019.1\|1492384_1496230_+\|tail	phage tail tape measure protein	Q2I8F0	Bacillus_phage	0.0e+00	83.1
1495966:1495981	attL	NA	NA	NA	NA
WP_085310022.1\|1496244_1497735_+\|tail	phage tail family protein	A0A2H4JC38	uncultured_Caudovirales_phage	4.8e-267	87.7
WP_085310024.1\|1497731_1502165_+\|tail	tail fiber domain-containing protein	H0USX5	Bacillus_phage	0.0e+00	72.3
WP_085310026.1\|1502289_1502985_+	hypothetical protein	D2XR29	Bacillus_phage	6.4e-113	91.8
WP_085310028.1\|1503192_1504152_+\|integrase	site-specific integrase	A0A0S2GLC8	Bacillus_phage	2.9e-172	94.4
WP_085310030.1\|1504167_1504593_+\|holin	phage holin family protein	Q2I8E7	Bacillus_phage	9.1e-62	85.8
WP_085310032.1\|1504592_1505399_+	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	4.8e-152	91.0
1512463:1512478	attR	NA	NA	NA	NA

DBSCAN-SWA_5

1983836 : 1992650

Bacillus_phage(85.71%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085310514.1\|1983836_1985114_+	C40 family peptidase	A0A217EQL1	Bacillus_phage	2.5e-14	33.1
WP_002135756.1\|1985294_1986059_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_085310516.1\|1986334_1988095_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.2e-264	94.3
WP_085310518.1\|1988181_1988859_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.1e-117	92.0
WP_085310521.1\|1988855_1989929_+	HAMP domain-containing sensor histidine kinase	W8CYF6	Bacillus_phage	2.7e-171	87.4
WP_000818985.1\|1990097_1990817_+	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
WP_085312954.1\|1990966_1991638_+	O-methyltransferase	W8CYT3	Bacillus_phage	5.9e-63	89.1
WP_085310523.1\|1991771_1992650_+	aminoglycoside 6-adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	1.2e-63	44.0

DBSCAN-SWA_6

2068921 : 2132873

Bacillus_phage(93.18%)

transposase,terminase,tail,integrase,portal,coat

attL 2087922:2087938|attR 2133218:2133234

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085310605.1\|2068921_2069380_+\|coat	spore coat protein	NA	NA	NA	NA
WP_016120072.1\|2069567_2069747_+	hypothetical protein	NA	NA	NA	NA
WP_085310607.1\|2069985_2070606_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_000217328.1\|2070630_2071113_-	DUF456 family protein	NA	NA	NA	NA
WP_002086044.1\|2071114_2072422_-	HlyC/CorC family transporter	NA	NA	NA	NA
WP_002012455.1\|2072631_2073519_-	hypothetical protein	NA	NA	NA	NA
WP_085310609.1\|2073906_2074554_+	CBS domain-containing protein	NA	NA	NA	NA
WP_172805410.1\|2074980_2076333_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_085310613.1\|2076399_2076729_+	chaperone CsaA	NA	NA	NA	NA
WP_085310615.1\|2076709_2077276_+	DUF1572 family protein	NA	NA	NA	NA
WP_002012463.1\|2077557_2077854_-	hypothetical protein	NA	NA	NA	NA
WP_002135865.1\|2077943_2079098_+	stage II sporulation protein SpoIIP	NA	NA	NA	NA
WP_085310617.1\|2079384_2079882_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_085310619.1\|2079893_2080634_+	M15 family metallopeptidase	NA	NA	NA	NA
WP_002127013.1\|2080657_2081104_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_085310621.1\|2081291_2082773_+	amidase	NA	NA	NA	NA
WP_085310623.1\|2082822_2084040_-	MFS transporter	NA	NA	NA	NA
WP_002012470.1\|2084315_2084744_+	NfeD family protein	NA	NA	NA	NA
WP_002012471.1\|2084746_2085718_+	SPFH/Band 7/PHB domain protein	NA	NA	NA	NA
WP_085312957.1\|2085791_2086946_+	stage II sporulation protein P	NA	NA	NA	NA
WP_002065036.1\|2087036_2087627_+	histidine phosphatase family protein	NA	NA	NA	NA
2087922:2087938	attL	NA	NA	NA	NA
WP_085310625.1\|2087958_2089050_-\|integrase	site-specific integrase	A0A0S2GLI2	Bacillus_phage	1.8e-162	79.6
WP_085310627.1\|2089782_2091003_+	hypothetical protein	A0A0U3TNF6	Bacillus_phage	3.7e-108	49.2
WP_001033792.1\|2091260_2091407_+	hypothetical protein	NA	NA	NA	NA
WP_085310629.1\|2091403_2091748_-	helix-turn-helix domain-containing protein	H0UST7	Bacillus_phage	1.2e-14	40.6
WP_000714354.1\|2091922_2092129_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_016109799.1\|2092204_2092393_+	helix-turn-helix transcriptional regulator	W8CYN7	Bacillus_phage	9.4e-27	98.4
WP_172805411.1\|2092417_2092573_+	hypothetical protein	I7J4K2	Bacillus_phage	4.1e-20	90.0
WP_085310631.1\|2092610_2093426_+	ORF6C domain-containing protein	Q3HL19	Bacillus_phage	1.1e-119	78.2
WP_085309217.1\|2093585_2093900_+	hypothetical protein	A0A0S2GLB6	Bacillus_phage	1.2e-45	87.5
WP_085309219.1\|2094173_2094821_+	sigma-70 family RNA polymerase sigma factor	W8CYN8	Bacillus_phage	1.1e-93	80.5
WP_085312931.1\|2095066_2095969_+	DNA replication protein DnaD	A0A0S2GLI6	Bacillus_phage	2.9e-105	65.3
WP_172805449.1\|2095937_2096744_+	ATP-binding protein	D2XQ17	Bacillus_virus	6.1e-123	80.9
WP_085309223.1\|2096828_2097095_+	hypothetical protein	A0A0S2GLK4	Bacillus_phage	2.4e-36	87.5
WP_085309225.1\|2097167_2097335_+	DUF3954 domain-containing protein	A0A0S2GLF5	Bacillus_phage	6.6e-16	75.9
WP_085309227.1\|2097367_2097637_+	hypothetical protein	NA	NA	NA	NA
WP_157404885.1\|2097731_2097899_+	hypothetical protein	NA	NA	NA	NA
WP_085308667.1\|2097972_2098500_+	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_157404881.1\|2098475_2099039_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_085309233.1\|2099318_2099684_+	hypothetical protein	A0A0A7AR03	Bacillus_phage	4.1e-34	61.2
WP_085308769.1\|2100004_2100304_+	hypothetical protein	D2XR51	Bacillus_phage	9.9e-47	90.9
WP_172805399.1\|2101387_2101552_+	hypothetical protein	W8CYP0	Bacillus_phage	7.6e-17	84.9
WP_085309242.1\|2101737_2102022_+	hypothetical protein	A0A1B1P8C3	Bacillus_phage	2.0e-25	61.7
WP_085312932.1\|2102258_2102537_+	hypothetical protein	NA	NA	NA	NA
WP_172805400.1\|2102533_2102695_+	hypothetical protein	NA	NA	NA	NA
WP_085309244.1\|2102731_2103103_+	hypothetical protein	A0A140HLN4	Bacillus_phage	2.5e-15	41.5
WP_157404886.1\|2103121_2103256_+	DUF3983 domain-containing protein	NA	NA	NA	NA
WP_172805401.1\|2103358_2103529_+	hypothetical protein	A0A1B0T6D0	Bacillus_phage	3.9e-08	69.6
WP_050000419.1\|2103549_2104020_+	ArpU family transcriptional regulator	A0A1B1P744	Bacillus_phage	4.9e-48	61.8
WP_085309246.1\|2104016_2104559_+\|integrase	tyrosine-type recombinase/integrase	A0A1B1P7Y2	Bacillus_phage	1.1e-88	90.6
WP_085309248.1\|2105179_2105629_+	hypothetical protein	A0A288WG64	Bacillus_phage	5.2e-31	53.8
WP_157404887.1\|2105660_2105990_+	hypothetical protein	A0A0S2MVB8	Bacillus_phage	7.7e-16	54.5
WP_085309250.1\|2105976_2106189_+	hypothetical protein	A0A1B1P8F3	Bacillus_phage	2.1e-19	72.9
WP_085309252.1\|2106470_2106701_+	hypothetical protein	NA	NA	NA	NA
WP_085309254.1\|2106690_2107047_+	HNH endonuclease	A0A1B1P8D2	Bacillus_phage	1.6e-30	56.0
WP_085309256.1\|2107060_2107294_+	hypothetical protein	NA	NA	NA	NA
WP_085309258.1\|2107443_2107824_+\|terminase	phage terminase small subunit P27 family	A0A1B1P7R2	Bacillus_phage	8.2e-62	93.7
WP_085310633.1\|2107804_2109577_+\|terminase	terminase large subunit	A0A1B1P7R3	Bacillus_phage	0.0e+00	88.1
WP_085310635.1\|2109598_2110816_+\|portal	phage portal protein	A0A0U3SQF0	Bacillus_phage	5.2e-150	62.5
WP_157404897.1\|2112780_2112984_+	fibronectin type III domain-containing protein	NA	NA	NA	NA
WP_085309276.1\|2114407_2114989_+\|tail	phage tail protein	A0A1B1P7S4	Bacillus_phage	7.5e-99	91.7
WP_157404898.1\|2115056_2115461_+	hypothetical protein	A0A1B1P7S9	Bacillus_phage	2.9e-49	88.4
WP_085309278.1\|2115462_2115603_+	LysR family transcriptional regulator	A0A1B1P7R9	Bacillus_phage	2.5e-16	89.1
WP_085310637.1\|2115617_2120627_+\|tail	phage tail tape measure protein	A0A1B1P7S6	Bacillus_phage	0.0e+00	74.3
WP_085310639.1\|2120667_2122155_+\|tail	phage tail family protein	A0A1B1P7W7	Bacillus_phage	6.1e-238	78.8
WP_085310641.1\|2122151_2126165_+\|tail	tail fiber domain-containing protein	H0USX5	Bacillus_phage	0.0e+00	82.0
WP_085310643.1\|2126187_2126637_+	hypothetical protein	A0A2H4J6F8	uncultured_Caudovirales_phage	1.8e-79	97.3
WP_085308828.1\|2126871_2127831_+\|integrase	site-specific integrase	A0A0S2GLC8	Bacillus_phage	6.4e-172	94.0
WP_085308830.1\|2127844_2128126_+	hypothetical protein	A0A0S2GM64	Bacillus_phage	1.4e-34	83.9
WP_085308832.1\|2128128_2128341_+	hypothetical protein	A0A0S2GM50	Bacillus_phage	4.6e-30	89.7
WP_085308834.1\|2128340_2129126_+	N-acetylmuramoyl-L-alanine amidase	A0A1B1P7T9	Bacillus_phage	4.6e-35	83.1
WP_085310645.1\|2129306_2129510_-	helix-turn-helix transcriptional regulator	A0A288WG80	Bacillus_phage	1.4e-07	48.4
WP_085310647.1\|2129683_2130001_+	hypothetical protein	H0USY0	Bacillus_phage	8.3e-52	99.0
WP_085310649.1\|2129997_2130180_+	hypothetical protein	Q2I8E2	Bacillus_phage	9.7e-21	83.3
WP_085310651.1\|2130295_2131477_+	cell division protein FtsK	H0USY1	Bacillus_phage	7.6e-215	94.4
WP_085310653.1\|2131418_2132039_+	replication-relaxation family protein	H0USY2	Bacillus_phage	2.2e-109	93.7
WP_085310655.1\|2132048_2132873_-	helix-turn-helix domain-containing protein	A0A2H4J969	uncultured_Caudovirales_phage	2.8e-107	71.3
2133218:2133234	attR	NA	NA	NA	NA

DBSCAN-SWA_7

2227372 : 2231495

Caldibacillus_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085310777.1\|2227372_2227759_-	helix-turn-helix transcriptional regulator	A0A290GJU0	Caldibacillus_phage	4.3e-18	45.5
WP_085310779.1\|2227931_2228150_+	helix-turn-helix transcriptional regulator	A0A290G4F8	Caldibacillus_phage	5.2e-13	52.2
WP_085310781.1\|2228163_2228463_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_085310784.1\|2228530_2229046_+	helix-turn-helix transcriptional regulator	A0A290FZK9	Caldibacillus_phage	1.2e-10	24.0
WP_002141496.1\|2229076_2229298_+	hypothetical protein	NA	NA	NA	NA
WP_085310786.1\|2229479_2229764_+	hypothetical protein	D2XR42	Bacillus_phage	3.2e-26	56.4
WP_085310788.1\|2229881_2230859_+	DnaD domain protein	A6M985	Geobacillus_virus	1.0e-52	45.0
WP_085310791.1\|2230869_2231232_+	cell division protein SepF	D2XR47	Bacillus_phage	5.4e-47	74.2
WP_085310793.1\|2231303_2231495_+	DUF3954 domain-containing protein	D2XR48	Bacillus_phage	1.7e-15	66.7

DBSCAN-SWA_8

3450384 : 3498153

Bacillus_phage(43.48%)

terminase,transposase,capsid,portal,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_172805416.1\|3450384_3451236_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.9e-27	30.4
WP_085311986.1\|3451519_3452566_-	N-acetylmuramoyl-L-alanine amidase	A0A2H4JEZ1	uncultured_Caudovirales_phage	1.2e-176	87.6
WP_000439592.1\|3452658_3453147_-\|holin	phage holin family protein	NA	NA	NA	NA
WP_085311987.1\|3453327_3454626_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	8.5e-42	32.8
WP_085311988.1\|3455179_3455638_-	hypothetical protein	NA	NA	NA	NA
WP_085311989.1\|3455647_3456631_-	hypothetical protein	NA	NA	NA	NA
WP_085311990.1\|3456642_3457557_-	hypothetical protein	NA	NA	NA	NA
WP_085311991.1\|3457569_3457959_-	hypothetical protein	G3MAB0	Bacillus_virus	3.9e-11	34.8
WP_085311992.1\|3457973_3464621_-	hypothetical protein	A0A0K2CPP1	Brevibacillus_phage	2.3e-50	34.0
WP_085311993.1\|3464914_3468748_-	hypothetical protein	NA	NA	NA	NA
WP_085311994.1\|3468778_3470515_-	hypothetical protein	A0A0K2CNY7	Brevibacillus_phage	1.3e-125	42.6
WP_085311995.1\|3470530_3471862_-	hypothetical protein	A0A0K2CP42	Brevibacillus_phage	9.8e-70	33.3
WP_085311996.1\|3471874_3472252_-	Low copy number virion structural protein	NA	NA	NA	NA
WP_000464270.1\|3472265_3472640_-	hypothetical protein	A0A0K2CPN7	Brevibacillus_phage	2.2e-19	39.2
WP_085311997.1\|3472684_3473068_-	hypothetical protein	NA	NA	NA	NA
WP_085311998.1\|3473078_3474623_-	hypothetical protein	NA	NA	NA	NA
WP_085311999.1\|3474619_3475303_-	hypothetical protein	NA	NA	NA	NA
WP_085312000.1\|3475299_3477684_-	hypothetical protein	NA	NA	NA	NA
WP_002169534.1\|3477714_3478119_-	hypothetical protein	NA	NA	NA	NA
WP_000210326.1\|3478097_3478595_-	hypothetical protein	NA	NA	NA	NA
WP_000118567.1\|3478637_3479234_-	hypothetical protein	A0A0U4IS63	Bacillus_phage	3.4e-14	29.1
WP_000208341.1\|3479247_3479664_-	hypothetical protein	NA	NA	NA	NA
WP_002169535.1\|3479660_3480077_-	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_002169536.1\|3480078_3480405_-	hypothetical protein	NA	NA	NA	NA
WP_002169537.1\|3480433_3480967_-	hypothetical protein	NA	NA	NA	NA
WP_000691127.1\|3480980_3481145_-	hypothetical protein	NA	NA	NA	NA
WP_002169538.1\|3481161_3482142_-\|capsid	phage major capsid protein	H7BVA6	unidentified_phage	8.0e-69	41.4
WP_085312001.1\|3482162_3483353_-	hypothetical protein	A0A1B1P7E4	Bacillus_phage	6.0e-34	33.7
WP_085312002.1\|3483381_3484722_-\|portal	phage portal protein	NA	NA	NA	NA
WP_002169541.1\|3484815_3486072_-\|terminase	phage terminase large subunit	A0A2H4J7G6	uncultured_Caudovirales_phage	1.0e-116	52.8
WP_085312003.1\|3486252_3486744_-	hypothetical protein	NA	NA	NA	NA
WP_002169544.1\|3486761_3486947_-	hypothetical protein	NA	NA	NA	NA
WP_085312005.1\|3487473_3487974_-	sigma-70 family RNA polymerase sigma factor	A0A0S2MVE1	Bacillus_phage	4.4e-47	59.8
WP_085312006.1\|3488244_3488625_-	ArpU family transcriptional regulator	A0A0M4R397	Bacillus_phage	1.4e-16	41.4
WP_085312007.1\|3488688_3488865_-	Fur-regulated basic protein FbpA	NA	NA	NA	NA
WP_085312008.1\|3488869_3489484_-	hypothetical protein	A0A0M4RU33	Bacillus_phage	2.0e-09	30.7
WP_172805453.1\|3489720_3490503_-	ATP-binding protein	U5PWH5	Bacillus_phage	9.6e-33	35.6
WP_000096620.1\|3490486_3491251_-	conserved phage C-terminal domain-containing protein	A0A1W6JNI1	Staphylococcus_phage	7.9e-56	49.2
WP_085312010.1\|3491328_3491607_-	hypothetical protein	NA	NA	NA	NA
WP_085312011.1\|3491676_3491922_-	hypothetical protein	A0A1B1P7U4	Bacillus_phage	2.0e-24	62.2
WP_000549412.1\|3492118_3492325_-	transcriptional regulator	W8CYN7	Bacillus_phage	1.8e-10	51.7
WP_002169552.1\|3492463_3493108_+	helix-turn-helix domain-containing protein	A0A2H4J245	uncultured_Caudovirales_phage	1.2e-28	33.8
WP_157404914.1\|3493531_3494473_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	2.9e-39	38.4
WP_078175295.1\|3494394_3494703_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_157404915.1\|3494770_3496074_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	7.0e-28	35.5
WP_172805391.1\|3496148_3496310_-	hypothetical protein	NA	NA	NA	NA
WP_149282397.1\|3497302_3497437_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_172805433.1\|3497433_3498153_-\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	3.7e-07	44.2

DBSCAN-SWA_9

3610077 : 3618071

Bacillus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033709367.1\|3610077_3610923_-	exonuclease	G3MBN3	Bacillus_virus	1.8e-13	27.7
WP_001179147.1\|3611112_3611313_-	cold shock-like protein CspB	Q9AZD3	Lactococcus_phage	2.6e-19	69.2
WP_002087724.1\|3611531_3612431_-	hypothetical protein	NA	NA	NA	NA
WP_001062757.1\|3612447_3612891_-	flavodoxin	A7KUZ7	Bacillus_phage	1.7e-10	35.0
WP_157404883.1\|3613064_3614418_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	7.6e-126	84.4
WP_000070943.1\|3614482_3615103_-	hypothetical protein	NA	NA	NA	NA
WP_060749166.1\|3615189_3615585_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_012261378.1\|3615581_3615923_-	ASCH domain-containing protein	NA	NA	NA	NA
WP_002128459.1\|3616062_3616620_+	CatB-related O-acetyltransferase	M1HKK6	Paramecium_bursaria_Chlorella_virus	7.6e-40	51.4
WP_002137449.1\|3616772_3618071_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	8.5e-42	32.8

DBSCAN-SWA_10

4302809 : 4345832

Bacillus_phage(89.36%)

terminase,tail,capsid,head,integrase,portal,protease

attL 4304293:4304308|attR 4350526:4350541

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002131210.1\|4302809_4303460_-	2OG-Fe(II) oxygenase	A0A1V0SIE1	Klosneuvirus	4.7e-17	30.4
WP_002167676.1\|4303634_4304006_-	competence protein ComG	NA	NA	NA	NA
WP_085312339.1\|4304002_4304335_-	ComGF family competence protein	NA	NA	NA	NA
4304293:4304308	attL	NA	NA	NA	NA
WP_085312340.1\|4305252_4306059_-	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	1.1e-148	89.6
WP_085312341.1\|4306058_4306271_-	hypothetical protein	A0A0S2GM50	Bacillus_phage	1.3e-32	94.3
WP_085312342.1\|4306273_4306555_-	hypothetical protein	A0A0S2GM64	Bacillus_phage	5.9e-33	81.7
WP_085312343.1\|4306568_4307528_-\|integrase	site-specific integrase	A0A0S2GLC8	Bacillus_phage	2.1e-175	95.9
WP_085310643.1\|4307760_4308210_-	hypothetical protein	A0A2H4J6F8	uncultured_Caudovirales_phage	1.8e-79	97.3
WP_085310639.1\|4312242_4313730_-\|tail	phage tail family protein	A0A1B1P7W7	Bacillus_phage	6.1e-238	78.8
WP_085310637.1\|4313770_4318780_-\|tail	phage tail tape measure protein	A0A1B1P7S6	Bacillus_phage	0.0e+00	74.3
WP_085309278.1\|4318794_4318935_-	LysR family transcriptional regulator	A0A1B1P7R9	Bacillus_phage	2.5e-16	89.1
WP_085312344.1\|4318952_4319342_-	hypothetical protein	A0A1B1P7S9	Bacillus_phage	1.2e-47	80.3
WP_085309276.1\|4319409_4319991_-\|tail	phage tail protein	A0A1B1P7S4	Bacillus_phage	7.5e-99	91.7
WP_085309274.1\|4320004_4320364_-	structural protein	A0A1B1P7S7	Bacillus_phage	2.5e-60	93.3
WP_085312345.1\|4320360_4320795_-	HK97 gp10 family phage protein	A0A1B1P7R6	Bacillus_phage	3.5e-69	91.0
WP_085309270.1\|4320782_4321130_-\|head	phage head closure protein	A0A1B1P7T4	Bacillus_phage	1.7e-58	93.9
WP_085309268.1\|4321136_4321388_-\|head,tail	phage gp6-like head-tail connector protein	H0USW7	Bacillus_phage	4.9e-15	47.1
WP_157404921.1\|4321400_4321652_-	fibronectin type III domain-containing protein	NA	NA	NA	NA
WP_085313001.1\|4321680_4322865_-\|capsid	phage major capsid protein	A0A0K2CZ99	Paenibacillus_phage	5.2e-163	78.0
WP_085312346.1\|4322888_4323647_-\|protease	Clp protease ClpP	A0A0U3U021	Bacillus_phage	8.1e-85	63.9
WP_085312347.1\|4323624_4324842_-\|portal	phage portal protein	A0A0U3SQF0	Bacillus_phage	8.8e-150	62.2
WP_085310633.1\|4324863_4326636_-\|terminase	terminase large subunit	A0A1B1P7R3	Bacillus_phage	0.0e+00	88.1
WP_085309258.1\|4326616_4326997_-\|terminase	phage terminase small subunit P27 family	A0A1B1P7R2	Bacillus_phage	8.2e-62	93.7
WP_085312348.1\|4327146_4327380_-	hypothetical protein	NA	NA	NA	NA
WP_170972832.1\|4327393_4327759_-	HNH endonuclease	A0A1B1P8D2	Bacillus_phage	9.4e-31	56.0
WP_085309252.1\|4327739_4327970_-	hypothetical protein	NA	NA	NA	NA
WP_085312350.1\|4328252_4328465_-	hypothetical protein	A0A1B1P8F3	Bacillus_phage	2.0e-25	82.9
WP_085312351.1\|4328451_4328787_-	hypothetical protein	A0A0S2MVB8	Bacillus_phage	6.0e-16	47.7
WP_085312353.1\|4329407_4329950_-\|integrase	site-specific integrase	A0A1B1P746	Bacillus_phage	3.8e-89	90.0
WP_085312354.1\|4329946_4330417_-	ArpU family transcriptional regulator	A0A1B1P744	Bacillus_phage	1.7e-48	61.8
WP_172805435.1\|4330437_4330608_-	hypothetical protein	A0A1B0T6D0	Bacillus_phage	7.9e-09	73.2
WP_085312356.1\|4330736_4331033_-	hypothetical protein	NA	NA	NA	NA
WP_085312357.1\|4331112_4331409_-	hypothetical protein	NA	NA	NA	NA
WP_172805399.1\|4332066_4332231_-	hypothetical protein	W8CYP0	Bacillus_phage	7.6e-17	84.9
WP_085312358.1\|4332389_4333085_-	hypothetical protein	A0A1I9S6E4	Bacillus_phage	7.3e-109	79.3
WP_085312359.1\|4333122_4333521_-	hypothetical protein	W8CYU3	Bacillus_phage	2.1e-52	74.2
WP_085313003.1\|4333541_4334075_-	hypothetical protein	A0A1Z1DA37	Bacillus_phage	6.1e-47	54.5
WP_085312360.1\|4334110_4334365_-	hypothetical protein	A0A1B1P779	Bacillus_phage	1.4e-38	86.9
WP_085310015.1\|4334467_4334767_+	hypothetical protein	NA	NA	NA	NA
WP_085310013.1\|4334753_4335023_-	hypothetical protein	NA	NA	NA	NA
WP_085310011.1\|4335060_4335516_-	nucleoside triphosphate pyrophosphohydrolase family protein	A0A0U4IBD0	Bacillus_phage	1.1e-20	48.6
WP_042596972.1\|4335605_4335773_-	DUF3954 domain-containing protein	A0A1B0T6B8	Bacillus_phage	1.4e-13	62.3
WP_085312361.1\|4335791_4336151_-	cell division protein SepF	A0A1B1P7A1	Bacillus_phage	1.2e-30	50.8
WP_085312362.1\|4336143_4336422_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	7.9e-14	62.7
WP_085312363.1\|4336438_4336633_-	hypothetical protein	A0A1B1P7U7	Bacillus_phage	4.5e-24	85.9
WP_085313004.1\|4336648_4337512_-	ATP-binding protein	Q2I8C8	Bacillus_phage	5.2e-64	45.8
WP_085312364.1\|4337462_4338257_-	DnaD domain protein	A0A0S2MVA0	Bacillus_phage	1.5e-65	55.5
WP_085312365.1\|4338258_4338438_-	hypothetical protein	A0A1B1P7U0	Bacillus_phage	1.1e-13	59.6
WP_172805436.1\|4338467_4338632_-	hypothetical protein	A0A0U3B230	Bacillus_phage	3.2e-15	72.2
WP_061529637.1\|4338644_4338905_-	group-specific protein	A0A1B1P7U4	Bacillus_phage	1.4e-41	94.1
WP_172805437.1\|4338925_4339078_-	hypothetical protein	I7J4K2	Bacillus_phage	1.1e-14	70.0
WP_085312366.1\|4339119_4339851_-	ORF6C domain-containing protein	A0A1B1P7T7	Bacillus_phage	1.7e-124	90.9
WP_085312367.1\|4339813_4340086_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_016099708.1\|4340249_4340597_+	helix-turn-helix transcriptional regulator	S5MUA5	Brevibacillus_phage	6.6e-10	38.3
WP_085313005.1\|4340607_4340790_-	hypothetical protein	NA	NA	NA	NA
WP_172805438.1\|4340936_4341086_-	hypothetical protein	NA	NA	NA	NA
WP_085313006.1\|4341082_4342222_-	hypothetical protein	H0UST6	Bacillus_phage	8.0e-137	64.5
WP_085313007.1\|4342720_4343074_+	helix-turn-helix transcriptional regulator	A0A1B1P888	Bacillus_phage	5.9e-22	46.4
WP_085312368.1\|4343262_4343871_+	hypothetical protein	NA	NA	NA	NA
WP_088068512.1\|4344209_4344362_-	hypothetical protein	NA	NA	NA	NA
WP_085312369.1\|4344662_4345832_+\|integrase	site-specific integrase	A0A0M5M609	Bacillus_phage	5.4e-64	37.5
4350526:4350541	attR	NA	NA	NA	NA

DBSCAN-SWA_11

4513265 : 4576674

Bacillus_phage(22.22%)

integrase,tRNA,coat,protease

attL 4508733:4508750|attR 4560126:4560143

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4508733:4508750	attL	NA	NA	NA	NA
WP_002015319.1\|4513265_4514405_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	3.3e-82	41.8
WP_002088783.1\|4514417_4515470_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_085312424.1\|4515489_4515690_-	DUF2905 domain-containing protein	NA	NA	NA	NA
WP_000344470.1\|4515686_4516688_-	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	4.0e-07	26.3
WP_016096077.1\|4516693_4517311_-	Holliday junction DNA helicase RuvA	NA	NA	NA	NA
WP_002190759.1\|4517500_4518445_+	iron-hydroxamate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002167631.1\|4518455_4518971_-	BofC C-terminal domain-containing protein	NA	NA	NA	NA
WP_085313009.1\|4519559_4519994_+	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_016100589.1\|4520026_4520671_-	YhcN/YlaJ family sporulation lipoprotein	NA	NA	NA	NA
WP_085312425.1\|4520850_4522797_-\|coat	spore coat assembly protein ExsA	NA	NA	NA	NA
WP_002088797.1\|4523021_4524128_-	quinolinate synthase NadA	NA	NA	NA	NA
WP_002184918.1\|4524158_4524992_-	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
WP_085312426.1\|4525011_4526541_-	L-aspartate oxidase	NA	NA	NA	NA
WP_002034158.1\|4526694_4527837_+	IscS subfamily cysteine desulfurase	A0A1X7QGF3	Faustovirus	1.7e-33	30.4
WP_002034157.1\|4527836_4528379_+	transcription repressor NadR	NA	NA	NA	NA
WP_085312427.1\|4528463_4529111_+	MOSC domain-containing protein	NA	NA	NA	NA
WP_085312428.1\|4529213_4530065_-	prephenate dehydratase	NA	NA	NA	NA
WP_085312429.1\|4530162_4532076_-	ABC transporter permease	NA	NA	NA	NA
WP_085312430.1\|4532125_4534048_-	ABC transporter permease	NA	NA	NA	NA
WP_002015381.1\|4534022_4534799_-	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	4.6e-19	31.0
WP_085312431.1\|4534892_4535975_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_061689570.1\|4535964_4536672_-	response regulator transcription factor	W8CYM9	Bacillus_phage	5.7e-24	34.8
WP_002015378.1\|4536843_4538127_-	GTPase ObgE	NA	NA	NA	NA
WP_044442397.1\|4538126_4538675_-	Spo0B domain-containing protein	NA	NA	NA	NA
WP_000944957.1\|4538738_4539029_-	50S ribosomal protein L27	NA	NA	NA	NA
WP_002138477.1\|4539032_4539377_-\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_000270907.1\|4539388_4539697_-	50S ribosomal protein L21	NA	NA	NA	NA
WP_085312432.1\|4539867_4541277_-	Rne/Rng family ribonuclease	NA	NA	NA	NA
WP_002088816.1\|4541319_4542180_-\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_002034147.1\|4542172_4542919_-	M23 family metallopeptidase	NA	NA	NA	NA
WP_000503308.1\|4543052_4543850_-	septum site-determining protein MinD	NA	NA	NA	NA
WP_002015372.1\|4543852_4544539_-	septum site-determining protein MinC	NA	NA	NA	NA
WP_002015371.1\|4544574_4545120_-	rod shape-determining protein MreD	NA	NA	NA	NA
WP_085312433.1\|4545134_4545986_-	rod shape-determining protein MreC	NA	NA	NA	NA
WP_002015369.1\|4546027_4547047_-	rod shape-determining protein MreB	NA	NA	NA	NA
WP_002169579.1\|4547659_4549108_-	serine hydrolase	NA	NA	NA	NA
WP_085312434.1\|4549484_4550144_-	DUF2290 domain-containing protein	NA	NA	NA	NA
WP_085312435.1\|4550133_4552245_-	ATP-binding domain-containing protein	NA	NA	NA	NA
WP_085312436.1\|4552407_4553760_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_085312437.1\|4553772_4554087_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_085312438.1\|4555202_4555787_-	DNA repair protein RadC	NA	NA	NA	NA
WP_012261761.1\|4555837_4556413_-	septum formation inhibitor Maf	NA	NA	NA	NA
WP_085312439.1\|4556632_4557595_-	stage II sporulation protein B	NA	NA	NA	NA
WP_085312440.1\|4557759_4559061_-	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_002129263.1\|4559155_4561801_-\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	2.8e-164	43.0
4560126:4560143	attR	NA	NA	NA	NA
WP_085312441.1\|4562205_4563231_-\|coat	spore coat protein YsxE	NA	NA	NA	NA
WP_170972587.1\|4563303_4564311_-	stage VI sporulation protein D	NA	NA	NA	NA
WP_002034163.1\|4564390_4565680_-	glutamate-1-semialdehyde 2,1-aminomutase	A0A1V0SKB7	Klosneuvirus	1.3e-05	35.2
WP_002015358.1\|4565679_4566669_-	porphobilinogen synthase	NA	NA	NA	NA
WP_085312443.1\|4566689_4567442_-	uroporphyrinogen-III synthase	NA	NA	NA	NA
WP_002034194.1\|4567444_4568374_-	hydroxymethylbilane synthase	NA	NA	NA	NA
WP_002015354.1\|4568389_4569223_-	cytochrome c biogenesis protein CcsA	NA	NA	NA	NA
WP_002015353.1\|4569240_4570572_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_002015350.1\|4570989_4571442_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_002015349.1\|4571444_4571861_+	organic hydroperoxide resistance protein	NA	NA	NA	NA
WP_002088829.1\|4571894_4572491_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_002192456.1\|4572487_4574818_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	1.5e-177	43.4
WP_002015346.1\|4575003_4576674_-\|protease	ATP-dependent protease LonB	E3T4F6	Cafeteria_roenbergensis_virus	6.7e-15	33.5

DBSCAN-SWA_12

4620157 : 4627798

Staphylococcus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085312467.1\|4620157_4621081_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	9.0e-46	43.5
WP_085312468.1\|4621206_4622142_-	HAMP domain-containing histidine kinase	Q8QNA2	Ectocarpus_siliculosus_virus	1.7e-12	26.4
WP_085312469.1\|4622143_4622836_-	response regulator transcription factor	B5LWA6	Feldmannia_species_virus	1.8e-06	28.8
WP_002015431.1\|4623006_4623180_+	hypothetical protein	NA	NA	NA	NA
WP_001014315.1\|4623180_4623375_+	YwbE family protein	NA	NA	NA	NA
WP_085312470.1\|4623418_4624618_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	4.3e-72	41.0
WP_002015426.1\|4624865_4625189_+	heme oxygenase	NA	NA	NA	NA
WP_085312471.1\|4625258_4626023_-	class B sortase	NA	NA	NA	NA
WP_002088890.1\|4626054_4626825_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.4e-14	26.6
WP_085312472.1\|4626814_4627798_-	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	1.1e-17	27.1

DBSCAN-SWA_13

4878237 : 4926125

Bacillus_phage(89.36%)

transposase,tail,capsid,terminase,head,integrase,portal,protease,holin,plate

attL 4883772:4883787|attR 4926180:4926195

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157404883.1\|4878237_4879592_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	7.6e-126	84.4
WP_002129581.1\|4879660_4879975_-	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_085312586.1\|4879976_4880672_-	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_085312587.1\|4880668_4881433_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_001141371.1\|4881615_4882089_-	S-ribosylhomocysteine lyase LuxS	NA	NA	NA	NA
WP_085312588.1\|4882217_4882454_+	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	1.3e-25	68.5
WP_002089163.1\|4882450_4883014_-	carbonic anhydrase	NA	NA	NA	NA
4883772:4883787	attL	NA	NA	NA	NA
WP_085312589.1\|4884100_4885168_+	cytosolic protein	NA	NA	NA	NA
WP_085309294.1\|4885411_4885612_+	hypothetical protein	NA	NA	NA	NA
WP_085312935.1\|4885618_4885885_+	hypothetical protein	NA	NA	NA	NA
WP_085309292.1\|4885952_4886486_+	hypothetical protein	NA	NA	NA	NA
WP_085312590.1\|4887635_4888337_-	N-acetylmuramoyl-L-alanine amidase	W8CZ46	Bacillus_phage	2.7e-119	87.7
WP_085309288.1\|4888336_4888762_-\|holin	phage holin family protein	H0USX7	Bacillus_phage	3.4e-64	88.7
WP_085309286.1\|4888839_4889064_-	hemolysin XhlA family protein	A0A1B1P780	Bacillus_phage	5.4e-29	95.9
WP_085312591.1\|4889326_4890625_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.5e-41	32.6
WP_085312592.1\|4891185_4892373_-\|plate	BppU family phage baseplate upper protein	A0A1B1P768	Bacillus_phage	1.1e-152	72.4
WP_085312593.1\|4892375_4894793_-\|tail	phage tail protein	A0A1B1P770	Bacillus_phage	0.0e+00	88.5
WP_085312594.1\|4894792_4895476_-\|tail	phage tail family protein	A0A1C8EA72	Bacillus_phage	5.3e-112	85.5
WP_085312595.1\|4895477_4900142_-	hypothetical protein	A0A1B1P764	Bacillus_phage	7.9e-215	86.9
WP_085312596.1\|4900320_4900782_-	hypothetical protein	A0A1B1P772	Bacillus_phage	7.3e-73	90.2
WP_085312597.1\|4900853_4901438_-\|tail	phage tail protein	A0A1B1P778	Bacillus_phage	9.2e-97	89.7
WP_085312598.1\|4901439_4901868_-	hypothetical protein	A0A1B1P769	Bacillus_phage	4.1e-62	83.8
WP_085313016.1\|4901854_4902232_-	hypothetical protein	A0A1B1P759	Bacillus_phage	1.1e-53	87.2
WP_085312599.1\|4902248_4902605_-\|head	phage head closure protein	A0A1B1P760	Bacillus_phage	2.6e-54	89.0
WP_085312600.1\|4902585_4902882_-	hypothetical protein	A0A1B1P751	Bacillus_phage	2.8e-41	86.7
WP_085313017.1\|4902874_4902970_-	hypothetical protein	NA	NA	NA	NA
WP_085312601.1\|4903022_4904186_-\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	1.4e-83	42.7
WP_085312602.1\|4904228_4904942_-\|protease	Clp protease ClpP	A0A2H4JC91	uncultured_Caudovirales_phage	2.6e-53	51.5
WP_085312603.1\|4904928_4906095_-\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	4.3e-186	82.9
WP_085312604.1\|4906109_4907765_-\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	4.7e-271	80.9
WP_085312605.1\|4907757_4908072_-	hypothetical protein	A0A1B1P762	Bacillus_phage	1.7e-20	57.7
WP_085312606.1\|4908178_4908487_-	hypothetical protein	A0A1B1P767	Bacillus_phage	8.1e-44	88.5
WP_085312607.1\|4908489_4908837_-	HNH endonuclease	A0A1B1P757	Bacillus_phage	1.8e-23	52.2
WP_085312608.1\|4908839_4909046_-	hypothetical protein	NA	NA	NA	NA
WP_085312609.1\|4909053_4909278_-	hypothetical protein	A0A1B1P745	Bacillus_phage	1.7e-19	68.5
WP_172805439.1\|4909289_4909583_-	hypothetical protein	A0A1C8E9B7	Bacillus_phage	3.3e-26	61.0
WP_085312611.1\|4909682_4909919_-	hypothetical protein	Q2I8B4	Bacillus_phage	1.1e-16	71.0
WP_085312612.1\|4909972_4910188_-	hypothetical protein	NA	NA	NA	NA
WP_050000420.1\|4910801_4911344_-\|integrase	tyrosine-type recombinase/integrase	A0A1B1P7Y2	Bacillus_phage	2.5e-88	90.0
WP_050000419.1\|4911340_4911811_-	ArpU family transcriptional regulator	A0A1B1P744	Bacillus_phage	4.9e-48	61.8
WP_172805440.1\|4911831_4912002_-	hypothetical protein	A0A1B1P735	Bacillus_phage	6.3e-06	82.1
WP_002010097.1\|4912115_4912238_-	DUF3983 domain-containing protein	NA	NA	NA	NA
WP_085312613.1\|4912908_4913307_+	CHRD domain-containing protein	A0A2K9L200	Tupanvirus	4.2e-16	38.8
WP_078179947.1\|4913769_4914027_-	hypothetical protein	NA	NA	NA	NA
WP_085312614.1\|4914500_4915004_-	hypothetical protein	A0A0M4RU27	Bacillus_phage	4.5e-68	72.0
WP_172805454.1\|4915043_4915418_-	hypothetical protein	H0USU9	Bacillus_phage	2.7e-41	85.6
WP_085312616.1\|4915496_4915742_-	hypothetical protein	NA	NA	NA	NA
WP_172805441.1\|4915773_4915950_-	hypothetical protein	I7ILW5	Bacillus_phage	1.2e-20	89.7
WP_085312617.1\|4916028_4916298_-	hypothetical protein	NA	NA	NA	NA
WP_085312618.1\|4916330_4916498_-	DUF3954 domain-containing protein	A0A0S2GLF5	Bacillus_phage	2.0e-20	85.2
WP_085312619.1\|4916570_4916837_-	hypothetical protein	A0A0S2GLK4	Bacillus_phage	2.9e-37	87.5
WP_085312620.1\|4916833_4917109_-	helix-turn-helix domain containing protein	A0A1B1P7W1	Bacillus_phage	1.2e-17	51.1
WP_088024771.1\|4917139_4917946_-	ATP-binding protein	D2XQ17	Bacillus_virus	4.6e-123	81.3
WP_085312622.1\|4917914_4918739_-	replication protein	W8CYG5	Bacillus_phage	9.5e-31	31.7
WP_085312623.1\|4918739_4918928_-	hypothetical protein	A0A1B1P897	Bacillus_phage	4.8e-07	48.1
WP_085312624.1\|4919213_4919861_-	sigma-70 family RNA polymerase sigma factor	H0USU1	Bacillus_phage	9.5e-103	84.7
WP_085312625.1\|4919886_4920195_-	hypothetical protein	W8CYU1	Bacillus_phage	1.3e-41	91.6
WP_085310631.1\|4920354_4921170_-	ORF6C domain-containing protein	Q3HL19	Bacillus_phage	1.1e-119	78.2
WP_170924938.1\|4921207_4921363_-	hypothetical protein	I7J4K2	Bacillus_phage	8.2e-21	92.0
WP_085313018.1\|4921387_4921576_-	helix-turn-helix domain-containing protein	A0A0S2GLE9	Bacillus_phage	2.5e-19	79.0
WP_085312626.1\|4921589_4921811_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_085312627.1\|4921995_4922349_+	helix-turn-helix transcriptional regulator	A0A1B0T6A7	Bacillus_phage	1.0e-18	46.5
WP_157404922.1\|4922399_4922558_-	hypothetical protein	NA	NA	NA	NA
WP_172805442.1\|4922697_4922847_-	hypothetical protein	NA	NA	NA	NA
WP_085312628.1\|4922846_4924094_-	hypothetical protein	H0UST6	Bacillus_phage	1.2e-165	77.6
WP_085312629.1\|4925063_4926125_+\|integrase	site-specific integrase	H0UST3	Bacillus_phage	4.8e-168	81.9
4926180:4926195	attR	NA	NA	NA	NA

DBSCAN-SWA_14

5352933 : 5359823

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085312828.1\|5352933_5353926_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	2.1e-53	39.3
WP_085312829.1\|5354018_5354837_-	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_085312830.1\|5354935_5355850_-	LytR family transcriptional regulator	NA	NA	NA	NA
WP_085312831.1\|5355949_5356342_-	glycerol-3-phosphate cytidylyltransferase	A0A1V0SGE7	Hokovirus	6.3e-17	40.0
WP_085312832.1\|5356476_5357508_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	4.0e-79	47.1
WP_085312833.1\|5357509_5358364_-	dTDP-4-dehydrorhamnose reductase	I7HXC9	Enterobacteria_phage	1.1e-37	39.1
WP_085312834.1\|5358368_5358929_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A218MN57	uncultured_virus	1.1e-41	47.9
WP_085312835.1\|5358944_5359823_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	1.7e-107	66.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage