CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP016746	Lactococcus lactis subsp. cremoris strain JM1 plasmid pMPJM1, complete sequence	0 crisprs	DEDDh	2
NZ_CP016750	Lactococcus lactis subsp. cremoris strain JM1 plasmid pJM1D, complete sequence	0 crisprs	NA	0
NZ_CP015899	Lactococcus lactis subsp. cremoris strain JM1 chromosome, complete genome	1 crisprs	DEDDh,csa3,WYL,DinG,cas3	17
NZ_CP016748	Lactococcus lactis subsp. cremoris strain JM1 plasmid pJM1B, complete sequence	0 crisprs	RT	0
NZ_CP016747	Lactococcus lactis subsp. cremoris strain JM1 plasmid pJM1A, complete sequence	0 crisprs	NA	0
NZ_CP016749	Lactococcus lactis subsp. cremoris strain JM1 plasmid pJM1C, complete sequence	0 crisprs	NA	0
NZ_CP016752	Lactococcus lactis subsp. cremoris strain JM1 plasmid pJM1F, complete sequence	0 crisprs	NA	0
NZ_CP016751	Lactococcus lactis subsp. cremoris strain JM1 plasmid pJM1E, complete sequence	0 crisprs	NA	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

82008 : 86097

Lactococcus_phage(85.71%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_063280735.1\|82008_82680_+	N-6 DNA methylase	L0P368	Streptococcus_phage	5.7e-50	45.8
WP_063280734.1\|82715_82952_+	hypothetical protein	A0A1P8BLV4	Lactococcus_phage	1.7e-09	48.2
WP_063280733.1\|83016_83352_+	hypothetical protein	Q8LTM4	Lactococcus_phage	2.0e-24	53.4
WP_063280732.1\|83348_83543_+	hypothetical protein	NA	NA	NA	NA
WP_063280731.1\|83539_83935_+	hypothetical protein	NA	NA	NA	NA
WP_063280730.1\|84007_84427_+	dUTP diphosphatase	A0A1P8BLJ0	Lactococcus_phage	6.5e-52	72.7
WP_155724498.1\|84447_84606_+	hypothetical protein	NA	NA	NA	NA
WP_063280729.1\|84617_85016_+	hypothetical protein	A0A1P8BM10	Lactococcus_phage	1.1e-19	63.4
WP_063280728.1\|85041_85305_+	hypothetical protein	NA	NA	NA	NA
WP_063280727.1\|85325_85823_+	hypothetical protein	A0A1W6JJX6	Lactococcus_phage	2.6e-07	46.0
WP_153041305.1\|85854_86097_+	hypothetical protein	A0A1W6JIL6	Lactococcus_phage	3.0e-09	42.0

DBSCAN-SWA_2

147580 : 186657

Streptococcus_phage(38.46%)

transposase,integrase

attL 147508:147567|attR 178555:179362

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
147508:147567	attL	NA	NA	NA	NA
WP_010890648.1\|147580_148261_+\|transposase	IS6-like element ISS1S family transposase	A0A1X9I6C6	Streptococcus_phage	8.5e-110	84.5
WP_042748179.1\|148442_150491_-	S8 family serine peptidase	A0A2H4PQH1	Staphylococcus_phage	5.0e-65	36.7
WP_063280706.1\|150492_151230_-	NisI/SpaI family lantibiotic immunity lipoprotein	NA	NA	NA	NA
WP_011834934.1\|151966_152647_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	7.6e-127	98.7
WP_021212881.1\|152909_153080_-	hypothetical protein	NA	NA	NA	NA
WP_021215689.1\|153594_153855_+	hypothetical protein	NA	NA	NA	NA
WP_080683478.1\|154011_154593_+	hypothetical protein	A0A1S5SBP9	Streptococcus_phage	9.4e-25	35.0
WP_080683477.1\|154609_154930_+	hypothetical protein	NA	NA	NA	NA
WP_081196202.1\|155058_161121_-	S8 family serine peptidase	NA	NA	NA	NA
WP_011669080.1\|161440_162340_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_081196203.1\|162489_163170_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.7e-105	81.9
WP_081196204.1\|163835_165638_+	N-6 DNA methylase	J7I0U9	Acinetobacter_phage	2.3e-13	24.2
WP_021722469.1\|165659_167171_+	type I restriction-modification system subunit M	A0A220A2U4	Liberibacter_phage	9.5e-53	30.3
WP_081196205.1\|167115_167667_+	restriction endonuclease subunit S	A0A240FAT6	Liberibacter_phage	1.7e-23	37.1
WP_153041310.1\|167596_168265_-	type I restriction endonuclease	E3T4D5	Cafeteria_roenbergensis_virus	2.0e-10	35.5
WP_081196211.1\|168370_169363_+\|integrase	tyrosine-type recombinase/integrase	A0A2H4JAA2	uncultured_Caudovirales_phage	7.7e-35	29.2
WP_081196206.1\|169375_170551_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_081196207.1\|170591_172088_+	DUF3800 domain-containing protein	NA	NA	NA	NA
WP_081196208.1\|172120_175138_+	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	4.7e-67	27.4
WP_081196209.1\|175197_175464_+	hypothetical protein	NA	NA	NA	NA
WP_031286803.1\|176177_177983_-	oligoendopeptidase F	NA	NA	NA	NA
WP_010890648.1\|178627_179308_+\|transposase	IS6-like element ISS1S family transposase	A0A1X9I6C6	Streptococcus_phage	8.5e-110	84.5
WP_063280543.1\|179583_180696_+	hypothetical protein	NA	NA	NA	NA
178555:179362	attR	NA	NA	NA	NA
WP_063280544.1\|180714_183180_+	DEAD/DEAH box helicase	NA	NA	NA	NA
WP_063280545.1\|183268_183580_+	hypothetical protein	NA	NA	NA	NA
WP_152023992.1\|183820_184600_-	hypothetical protein	NA	NA	NA	NA
WP_155724481.1\|184821_184983_+	hypothetical protein	NA	NA	NA	NA
WP_153041311.1\|185285_186657_+\|transposase	IS3-like element ISLla3 family transposase	A0A1B1P773	Bacillus_phage	9.2e-55	43.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP015899

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP015899_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015899_1

234243-234328

Orphan

Consensus_repeat	Method
AAGAATTGGGAAAATTGAGGAAGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015899_1

>merge|NZ_CP015899|1|234243-234328|CRISPRCasFinder
AAGAATTGGGAAAATTGAGGAAGAATATTACTAAGTATAACTTGCGTAAATGTTTATTTTAAAAGAATTGGGAAGATTGAGGAAGA

>NZ_CP015899|1|1|234243-234328|CRISPRCasFinder
AAGAATTGGGAAAATTGAGGAAGA	ATATTACTAAGTATAACTTGCGTAAATGTTTATTTTAA
AAGAATTGGGAAGATTGAGGAAGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015899.1\|WP_063280540.1\|227649_229695_-\|MnhB-domain-containing-protein	unknown	unknown	gnl\|CDD\|173412
NZ_CP015899.1\|WP_021165021.1\|244948_246013_+\|ornithine-carbamoyltransferase	unknown	unknown	gnl\|CDD\|179366
NZ_CP015899.1\|WP_011677112.1\|237729_238329_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015899.1\|WP_032951223.1\|225981_226476_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015899.1\|WP_081196049.1\|232353_233244_-\|IS982-family-transposase	unknown	unknown	gnl\|CDD\|376573
NZ_CP015899.1\|WP_032951226.1\|225466_225958_-\|antirestriction-protein-ArdA	unknown	unknown	gnl\|CDD\|377800
NZ_CP015899.1\|WP_032951210.1\|238529_239861_+\|UDP-N-acetylmuramate--L-alanine-ligase	unknown	unknown	gnl\|CDD\|234757
NZ_CP015899.1\|WP_061778324.1\|221190_221580_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|379199
NZ_CP015899.1\|WP_081196048.1\|223819_224716_+\|IS982-family-transposase	unknown	unknown	gnl\|CDD\|372648
NZ_CP015899.1\|WP_050595613.1\|226570_227635_-\|CHAP-domain-containing-protein	unknown	unknown	gnl\|CDD\|380090
NZ_CP015899.1\|WP_032951212.1\|234408_237513_+\|DEAD/DEAH-box-helicase-family-protein	unknown	unknown	gnl\|CDD\|350770
NZ_CP015899.1\|WP_011677109.1\|240546_242241_+\|arginine--tRNA-ligase	unknown	unknown	gnl\|CDD\|183534
NZ_CP015899.1\|WP_003331414.1\|222985_223744_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|366760
NZ_CP015899.1\|WP_021213427.1\|246144_247725_+\|amino-acid-permease	unknown	unknown	gnl\|CDD\|163522
NZ_CP015899.1\|WP_017865109.1\|225196_225406_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015899.1\|WP_081196050.1\|243676_244525_+\|IS982-family-transposase	unknown	unknown	gnl\|CDD\|372648
NZ_CP015899.1\|WP_004254487.1\|240020_240479_-\|arginine-repressor	unknown	unknown	gnl\|CDD\|130592
NZ_CP015899.1\|WP_003331415.1\|221750_222974_+\|IS21-like-element-IS712-family-transposase	unknown	unknown	gnl\|CDD\|226950
NZ_CP015899.1\|WP_021165024.1\|249922_251053_+\|aminotransferase	unknown	unknown	gnl\|CDD\|235989
NZ_CP015899.1\|WP_032951208.1\|248714_249659_+\|carbamate-kinase	unknown	unknown	gnl\|CDD\|223623

Protein	Function_ID	Function_description	E-value
NZ_CP015899.1\|WP_063280540.1\|227649_229695_-\|MnhB-domain-containing-protein	gnl\|CDD\|173412	PTZ00121, PTZ00121, MAEBL; Provisional.	4.90943e-07
NZ_CP015899.1\|WP_021165021.1\|244948_246013_+\|ornithine-carbamoyltransferase	gnl\|CDD\|179366	PRK02102, PRK02102, ornithine carbamoyltransferase; Validated.	0
NZ_CP015899.1\|WP_021165024.1\|249922_251053_+\|aminotransferase	gnl\|CDD\|235989	PRK07324, PRK07324, transaminase; Validated.	0
NZ_CP015899.1\|WP_081196049.1\|232353_233244_-\|IS982-family-transposase	gnl\|CDD\|376573	pfam01609, DDE_Tnp_1, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. This family contains transposases for IS4, IS421, IS5377, IS427, IS402, IS1355, IS5, which was original isolated in bacteriophage lambda.	1.76915e-24
NZ_CP015899.1\|WP_032951226.1\|225466_225958_-\|antirestriction-protein-ArdA	gnl\|CDD\|377800	pfam07275, ArdA, Antirestriction protein (ArdA). This family consists of several bacterial antirestriction (ArdA) proteins. ArdA functions in bacterial conjugation to allow an unmodified plasmid to evade restriction in the recipient bacterium and yet acquire cognate modification.	1.41403e-29
NZ_CP015899.1\|WP_032951210.1\|238529_239861_+\|UDP-N-acetylmuramate--L-alanine-ligase	gnl\|CDD\|234757	PRK00421, murC, UDP-N-acetylmuramate--L-alanine ligase; Provisional.	0
NZ_CP015899.1\|WP_061778324.1\|221190_221580_+\|SDR-family-oxidoreductase	gnl\|CDD\|379199	pfam13460, NAD_binding_10, NAD(P)H-binding.	5.23366e-23
NZ_CP015899.1\|WP_081196048.1\|223819_224716_+\|IS982-family-transposase	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	3.78783e-26
NZ_CP015899.1\|WP_032951212.1\|234408_237513_+\|DEAD/DEAH-box-helicase-family-protein	gnl\|CDD\|350770	cd18012, DEXQc_arch_SWI2_SNF2, DEAQ-box helicase domain of archaeal and bacterial SNF2-related proteins. Proteins belonging to SNF2 family of DNA dependent ATPases are important members of the chromatin remodeling complexes that are implicated in epigenetic control of gene expression. The Snf2 family comprises a large group of ATP-hydrolyzing proteins that are ubiquitous in eukaryotes, but also present in eubacteria and archaea. Archaeal SWI2 and SNF2 are members of the DEAD-like helicase superfamily, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.	6.2346e-94
NZ_CP015899.1\|WP_011677109.1\|240546_242241_+\|arginine--tRNA-ligase	gnl\|CDD\|183534	PRK12451, PRK12451, arginyl-tRNA synthetase; Reviewed.	0
NZ_CP015899.1\|WP_003331414.1\|222985_223744_+\|ATP-binding-protein	gnl\|CDD\|366760	pfam01695, IstB_IS21, IstB-like ATP binding protein. This protein contains an ATP/GTP binding P-loop motif. It is found associated with IS21 family insertion sequences. The function of this protein is unknown, but it may perform a transposase function.	3.89255e-62
NZ_CP015899.1\|WP_021213427.1\|246144_247725_+\|amino-acid-permease	gnl\|CDD\|163522	TIGR03810, arginine-ornithine_antiporter, arginine-ornithine antiporter. Members of this protein family are the arginine/ornithine antiporter, ArcD. This exchanger of ornithine for arginine occurs in a system with arginine deiminase, ornithine carbamoyltransferase, and carbamate kinase, with together turn arginine to ornithine with the generation of ATP and release of CO2. [Transport and binding proteins, Amino acids, peptides and amines].	3.24315e-157
NZ_CP015899.1\|WP_050595613.1\|226570_227635_-\|CHAP-domain-containing-protein	gnl\|CDD\|380090	pfam18013, Phage_lysozyme2, Phage tail lysozyme. This domain has a lysozyme like fold. It is found in the tail protein of various phages probably giving them the ability to degrade the host cell wall peptidoglycan layer.	2.67253e-32
NZ_CP015899.1\|WP_081196050.1\|243676_244525_+\|IS982-family-transposase	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	6.55405e-26
NZ_CP015899.1\|WP_004254487.1\|240020_240479_-\|arginine-repressor	gnl\|CDD\|130592	TIGR01529, Arginine_repressor., arginine repressor. This model includes most members of the arginine-responsive transcriptional regulator family ArgR. This hexameric protein binds DNA at its amino end to repress arginine biosyntheis or activate arginine catabolism. Some species have several ArgR paralogs. In a neighbor-joining tree, some of these paralogous sequences show long branches and differ significantly in an otherwise well-conserved C-terminal region motif GT[VIL][AC]GDDT. These paralogs are excluded from the seed and score in the gray zone of this model, between trusted and noise cutoffs. [Amino acid biosynthesis, Glutamate family, Regulatory functions, DNA interactions].	4.3854e-60
NZ_CP015899.1\|WP_003331415.1\|221750_222974_+\|IS21-like-element-IS712-family-transposase	gnl\|CDD\|226950	COG4584, COG4584, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.63091e-43
NZ_CP015899.1\|WP_032951208.1\|248714_249659_+\|carbamate-kinase	gnl\|CDD\|223623	COG0549, ArcC, Carbamate kinase [Amino acid transport and metabolism].	2.52608e-174

>NZ_CP015899.1|WP_081196049.1|232353_233244_-|IS982-family-transposase
MTYNSTLPKVFVYLLTTIETLYQTRVPLEVQNRKNVHLATSDCLVIACYLWGVLHFSETLKAKHQLAQSLFPNFLEYSRFVRRCNALLPSIQVIRQALVFKEVEGMSVSIIDSFPIPLCQPICNFRSKGLGDYANVGYNATKGQYFYGCKCHALVSESGYVIDYTITPASMADSSMTEEVLSQFGTPTVLGDMGYLGQSLHDRLELKGIDLITPVRKNMKQKKILFPNFSKRRKVIERVFSFLTNLGAERCKSRSPQGFQLKLEMILLAYSLLLKSAKSLEPETLRYSIGYQVMAK
>NZ_CP015899.1|WP_063280540.1|227649_229695_-|MnhB-domain-containing-protein
MKKRTVLILVALFFCFILLSKVGADTSSGSIPGIDLPDQNTLDDLNNSADDAQNAVDDIKDASDDAINKELGDDSTNYELGDDKTPLYVYTSYLDTDNKIKVTVNMGVQGVFYIAKQEYSFTKWIDNMFSKINVVKDYGKVVLASGKTVYDSLLSPSNPSFWLIATFILYSLLRAFLKGHLAKTVIVIFGLLILNSSFFNLGGKVIDTVQTKSADINTSVIEKIKIGGVSNGKPDLLQTMVITPFERMNFDNDKQYGTKSENVNKLINSGGDAGKVADIRKAEKVSHLRFNEIGDKFSVALGAVINNFVLGCGVLLFKLGALIAGIAFLVFLLVAPIVAFLVFLSVFEQAGKNLVVKTGVTLILSVLLGYATTLFLSLNNFLDTIFGGAGANYLFMSIAKVIVYVILFKFRGFFFSVLGNASSAITNNRAFNAMDTAFSRAKQRTLQPILADGTAGIIAGKTFAKDINYKVGTGAINRRRSENRFKKYGESMKNILDPNSDEKKRNKATKQKERFEKRFEKQNKKAEKKQQNTQTSETKKKRASDKVAPYSDMNKAQPKTETGKNLKYLKQKSEQKVEHDKKLEQLRPATERMVKNTQQNYEKKHQSAESRNQAIVKGVKANQEQKASAQRMAQRFEKNKQRFSPNSNKPTKTSVKQSVKSEDIKRENTQINRPTKIKNEL
>NZ_CP015899.1|WP_050595613.1|226570_227635_-|CHAP-domain-containing-protein
MIKKKLKRKIALSFVPLLLPFVFLLTFVFVLFNVVTADDSSNNNVNVNTTQQQVAKTIWDRALKEDGTKEGAAALIGNNQHESDGLIPSAIQSQASYDESKAMNGSIGGYGFGLTQWDSGRRVSLLKYAKSQKKSWTDTNIQVEFMFEHDDSDSTLIKKLVKETNINQATEDIMRKWERAGAVDSLSQRQEYAQYWYTFFTTGGDNGTGDGSGGSGITPGIPSGWTLDKPINTSGYIASSYEYKQCTWFTWNRAKDFGITFGMYMGNGADWQKQAGYSVTTTPVLHSAVSFSGGQTVGGQWNADPVYGHVAFVEEIHSDGSVLISQSGTGFSTVYTFQVLTKAQASQLHYVIGK
>NZ_CP015899.1|WP_032951223.1|225981_226476_-|hypothetical-protein
MSKLEEVRASGKMSERILENNFRIFDHRLREMEGELKLCPYATLSEVIAWAEQLKITIGKIKLIQESNIVKSKKEWESLEEKMLAYLQIDKAFIHVFSDHIIFLVQLEQRYHQRLDIFANNLDNSVRYLKKYADDLEKQGFSISGILAESKNLSDMNWLSILNY
>NZ_CP015899.1|WP_032951226.1|225466_225958_-|antirestriction-protein-ArdA
METPKIYVVNLNSYNNMKTRGRWYDLPVDFRQIQRDLLLDEEHGEEFAIHDFENFYGYKVGEYSSIKELNEYAEKLEEISDLDHIKEFLEVYSIDDIIDNRDDLDFVEAGDAEDLAQELIEQMGGVETLSVETLQRYFNFGSYGRDLAINDYAKTSHGYVRNI
>NZ_CP015899.1|WP_017865109.1|225196_225406_-|hypothetical-protein
MSEKKYGTKQEIAEMFGVKKGTLDNDLTKMRRNPKFSEYVIRKSYKVTLVSVVGYEEFIKYCGRLQEIV
>NZ_CP015899.1|WP_081196048.1|223819_224716_+|IS982-family-transposase
MALDNNSTLPKVFVYLLTTIETLYQTRVPLEVQNRKNVHLATSDCLVIACYLWGVLHFSETLKAKHQLAQSLFPNFLEYYRFVRRCKALLPSIQVIRQALVFKEVEGISVSIIDSFPIPLCQPIRNFRSKVLGDYANVGYNATKGQYFYGCKCHALVSESGYVIDYTITPASMADSSMTEEVLSQFGTPTVLGDMGYLGQSLHDRLELKGIDLITPVRKNMKQKKILFPNFSKRRKVIERVFSFLTNLGAERCKSRSPQGFQLKLEMILLAYSLLLKSAKSLEPETLRYSIGYQVMAK
>NZ_CP015899.1|WP_003331414.1|222985_223744_+|ATP-binding-protein
MTTYHQLLNQLDHLKLDRVRQLLPEFLDEHADISLVEGLHELLSEELREREALLQERRLKKAHLPYEKRVMDFDFQFQPKINKAEILDLHTLRFLDKHENLLFIGNSGVGKTHLAISITLEALEKGYSSYFCMSTELVDRLLRANQKGTLERVLKQYANYDVLVIDEVGYLPFSRDGASLLFQLINMRYEKKSTLITTNIPLSQWSEFLQDKKLTNALLDRLVHHSKVISITGKSYRMKDYSEKKTKTPKSK
>NZ_CP015899.1|WP_003331415.1|221750_222974_+|IS21-like-element-IS712-family-transposase
MRKDILESITEHLMTGIKPNFADIARRYNCDYRTVKRYYDLGKEKTLEEASKRRVPPSLIENYKSIIEDKLKLGCSVRSIYYFIQLKGYQGSYTTVKRYARLIRESCKHKATIRIETTPGLSAQVDWKENLKLISRNGEVFTINIFLYILGYSRMKYLQLTVDRLQPTLFECLNHAFEKFGGVPEEIWFDNMKTVVDHSKSQFSNVVFNERFRQYAKDAGFKPIACRPFRPQTKGKVEALARTVDRLLVFNNEFEDLEELQALVQQLMEDLNHKEISQAIGTSPSERLDQEALNLKAFDLELLKVYSQLSVPLTRKVSKEALVIFEGRKYSVPVKYIGQTVTCEKEQEDLKVYCDQRLIARHPLSDRPFNYRREDYVEILKSDVFKHLEEDELEAYVDENLQAYDLL
>NZ_CP015899.1|WP_061778324.1|221190_221580_+|SDR-family-oxidoreductase
MKIFIVGATGRVATSLIENLVIDGHQIIAGSRHPEKVSENSQVKSVMLDLHKDVNDLARIIGTVDVIYFTAGSRGKDLLQTDAYGAVKVMEVAKMNNISRFIMLSSIFALEPEKWNEEGLKNIPEYPNC
>NZ_CP015899.1|WP_032951212.1|234408_237513_+|DEAD/DEAH-box-helicase-family-protein
MSRMMPARVRSEGIALYAKGFLNDPIETDFKLTAEIDGEEVSYDLDGAQDSCTCSIFQQNHRYCKHIAAIEEYLKNQDKGSLETKDKETKGAERGLYNENIAFLDAVNGETQLNFSTDQYSIEVQIEDNSQLYDYFSMDYFLYFDLKLKSKNLGRSYVIKDIPYFLRALKNYSQYSLGSLHYIDLFFDNFDEASQEFLSFLLKIDGKSDEALTKSLYIKNGRYLNIPFLFLEEAMDLVSALEVYQLKIIGRIVNYFTFIPLDNDSEIFKFKVESQQDYIELSLFSEDYHNFYDYSLLYDNNVFYKLSQEQRRLLLVLDKQFAQKSKIKFSYSEKDKLAQALQQLSTLGKIEAPEHFVVKPFDAKFTFDLLDEKTLSLAMKFDYGTFSIDSFHDLETLEFSRDLRKEQKIFALMERLQFAKAFNSTLEITEHLSENFFLKILPSFQKLGQIELSPTLRNMRMDEVPEIHIDSQGGLLDISFNIPHVEDGEFANVIAKLQENAEFYISESGKFYHFNEKFDRLKAALHELDDQFVIQGSSLHVNINRSFQISKIFEKISGASFSEKFKSLYQHLTHPEEFPYEKPEHIKASLRSYQETGVRWMSMLSHYNLGGILADDMGLGKTVQAITFILSNLKKDESVLITAPASLTYNWASEFEKFTDEIDFVVIDGNKADRTKEIQENHQIYITSYGSFLKDFEDYQDKKLNYLLLDEAQVVKNYSSKTNKSLSALNVEHTFALSGTPLENRIEEIWAIFQVVMPGFLPKREKFNKMEPSVISRLIQPFIMRRKKEDVLEELPEKMEITVYNQLADDQKVIYLAQLELMQKQVLEMDNAALSRSRIEILAGITRLRQICNTPALFMDDYKGSSGKLERLRELLAQIKDSGHRPLIFSQFTKVFPHIEKLMEEQEMTAYKLTGSTPIKDRLSMVQAFNAGSRDAFLVSLKAGGVGLNLTSADVVILVDLWWNPAVEEQAIARAHRMGQKNTVEVIRLITQGTIEEKIMEIQERKKDLIANVLEGDTVDKVLSEAEIREILGV
>NZ_CP015899.1|WP_011677112.1|237729_238329_+|hypothetical-protein
MVERRVVFPVIGDDEVLQKDTRVIFTNQQLLTRNPSLQDEASIETSKSKTDAKRPESFKPYKAKTSFSTQHRPLNSNHAGVSSYDKMPKKTSVDESKERAKRAAATLPKPPKQYVSPLERDKEDLTVRRSTSAILNKRPSTNDNPIRDMKKQGMNVSDAVAKNGSGMKKATPHGGAANDTQKGSYFENKRKNIFDRGIV
>NZ_CP015899.1|WP_032951210.1|238529_239861_+|UDP-N-acetylmuramate--L-alanine-ligase
MEKTYHFTGIKGSGMSALALMLHQMGKNVQGSDSTDYFFTQRGLEQVGVPLLPFDEKNIKPEFELIVGNAFRDDNNVEIAFAHKNGFPFKRYHEFLGHFMEDFTSIGVAGAHGKTSTTGMLAHVMSNIVDTSYLIGDGTGRGNAGSEYFVFESDEYERHFMPYHPEYTIMTNIDFDHPDYFEGIEDVTSAFQDYANNIKKGIFAYGEDVNLRKLSAKAPIYYYGFEANDDYRAENLIRSTRGSSFDAYFRGEKIGHFVVPTYGKHNVLNALSVVAVCHNLGLDMTDVADHLLTFRGVKRRFTEKKVGETVIIDDFAHHPTEIEATLDAARQKYPDREIVAVFQPHTFTRIIAFADEFAEVLDHADTVYLAQIYGSAREVDHHEITAQDLADKVRKPAKVIELNNVSPLLDHDRGIYVFMGAGNIQKYEIAFEKLLSQTSTNLQ
>NZ_CP015899.1|WP_004254487.1|240020_240479_-|arginine-repressor
MKRDKRLEIIKEIVTNNKISTQEELQSLLLERGVEVTQATLSRDIRKLNIIKKRDKGESFYSFLTSGNSKINSDLQLYFYNFVISAKSVGALVVIRTKLGEADVLANALDDERDSRTDILGTIAGADTLLVICASEKAANILTAEIKYILLG
>NZ_CP015899.1|WP_011677109.1|240546_242241_+|arginine--tRNA-ligase
MDEKQLVSQALSAAIDGVLGVEQIAAIIEKPKSSDLGDLAFPAFQLAKTLRKSPQIIAGEIAEKIDTKGFEKVIAVGPYVNFFLDKNATASEVIREVLTEGEHYGDANIGEGGNVPIDMSAPNIAKPFSIGHLRSTVIGDSIAKIYEKLGYQPIKINHLGDWGKQFGLLITAYKKYGDEATITANPIDELLKLYVKINAEAKEDPEVDEEGRQWFLKMEQGDEEALRIWKWFSDVSLIEFNRIYGKLGVTFDHFMGESFYSDKMDAIVEDLENKNLLHESKGALIVDLEKYNLNPALIKKTDGATLYITRDLATAAYRKKTFNFVKSLYVVGGEQTNHFKQLKAVLKEAGYDWSDDMVHVPFGMVTQGGKKFSTRKGHVVKLEMALDEAVDRAEKQIEAKNPNLENKEEVAKQVGVGAVKFYDLKTDRNNGYDFDLDEMVSFEGETGPYVQYAHARIQSILRKANRKVNIDNISLVVSDAEAWEIVKALKEFPNIVKRAADNYEPSIIAKYAISLAQAFNKYYAHVRILEDDAQLDGRLALISATSIVLKEALRLLGVAAPENM
>NZ_CP015899.1|WP_081196050.1|243676_244525_+|IS982-family-transposase
MTYNSTLPKVFVYLLTTIETLYQTSVPLEVQNRKNVHLAISDCLVITCYLWGVLHFSETLKAKHQLAQSLFPNFLEYYRFVRRCKALLPSIQVIRQALVFKEVEGISVSIIDSFPIPLCQPIRNFRSKVLGDYANVGYNATKGQYFYGCKCHALVSESGYVIDYTITPASMADSSMTEEVLSQFGTPTVLGDMGYLGQSLHDRLELKGIDLMTPVRKNMKQKKILFPNFSKRRKVIERVFSFLTNLGAERCKSRSPQGFQLKLEMILLAYSLLLKSAKSLEP
>NZ_CP015899.1|WP_021165021.1|244948_246013_+|ornithine-carbamoyltransferase
MTSPLITKAEVNSVFQGRSLLAEKDFTPAEINYLVDFGLHLKALKQQNIPHHYLEGKNIALLFAKTSTRTRAAFTTAAIDLGAHPEYLGANDIQLGIKESTEDTARVLGSMFDAIERRGFSQKEVEDLAKYSGVPVWNGLTDDWHPTQMIADFMTVKENFGYLKGLTLVYVGDGRNNMANSLIVTGSMLGVNVHIVAPDSLHPSKEVMDIANKFAEKSGAKPLATSNIEEGVKGANIIYSDVWVSMGESNWEERVKLLTPYRITMDMLKMTGNADNGKLIFMDCLPAFHDTETEYGKEIKEKYGLTEMEVTDEVFRSKYARQFEEAENRMHSIKAIMAATLGNLFIPAVPEDFK
>NZ_CP015899.1|WP_021213427.1|246144_247725_+|amino-acid-permease
MDAENKKGIGLAALVAIIVSGAIGGGVFNLSNDLATNASPGGVVISWIVIGFGILMLVLSLNHLVVNKPELSGVSDYARAGFGNMVGFISGWGYWLSAWAGNIAFAVLMMTAVDYFFPGVFQAKNGSLTILSVIVVSIVSWGLTLLVMRGVEGAAAINAIVLVAKLIPLFVFVIAGIVTFKAGVFSAHFWQNFVANTNADGVIKSLTWSNMTGGDLFSQVKGSLMVMIWVFVGIEGAAMMGDRAKRKSDAGKASILGLIALLVIYILLSLLPFGFMSQQELANTGQPGLVHILNAMVGGWGGSLMAIGLVISLLGAWLSWTMLPVEATQQLSEQKLLPSWFGKLNDKGAPKNSLLLTQLIVQIFLIVTYFVADAYNVFVYLCTAVIMICYALVGLYLFKLGIQEKKTSNIIIGFIAAAFQILALYYSGWQFVWLSLILYAVGFILYALGKKEYGTKMSTAELIATFILTVLGILAVFGVYGNWLGLQDALGIDGNTLLVAVVPLIVVTFIVYFVVRSDINKKGIKN
>NZ_CP015899.1|WP_032951208.1|248714_249659_+|carbamate-kinase
MVRRMVVALGGNAILTDDPTAKAQERALETTAEQLIPLIRNNDVEMVVTHGNGPQVGNLLLQQLAADSPKNPAMPIDTAVAMTQGQIGFWMGQAFTRALIKNKMERVPVISVVTRTVVDKDDSAFEKPTKPIGPFYGEKGLAEMKAQYPDWTFVEDSGRGYRRVVPSPKPTRIVEAEAIKPLISSSILVTVSGGGGIPVIETQEGYEGVEAVIDKDFSAAKVAELVEADNLLILTAVDNVFVNFNKPNQKKLETVTMAEMKAYIKEGQFAAGSMLPKVEAAMEFVTRTGRPVTITSLENLEDFLNNDSGTKIIP
>NZ_CP015899.1|WP_021165024.1|249922_251053_+|aminotransferase
MELVQFGCEDWLNVWEKSATIDIAQSTIDSLSLEEVLAFEEDKGEAFMSQMMKEKFSYGWIEGSPAFKSEVAKLYKRVSEDNILSTNGATGANFLTILGLIGQGDHVIAQYPSYQQLYDWPKTLGAQVDYWKIKEENHWLPQIEDLRRLVKPNTKLICLNNAAQPTGAIMSPDFLAEVVEIARSVDAYILCDEVYLPLDEETPYAPIADLYEKGISTNSISKTYSVPGIRVGWVATQDRDLCNEFRKIRDYTLICTGVFDDALASLVLKHKDKVLARARDIVKGNLSILKEWVENEPLVSMVYPNAVSVSFVKFEQLDPMKTEDFAIQLLREKGVLIIPGNRFDLPGYARIGYCTDEKTLRQGLQLLSEFLREYKG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

13207 : 69489

Bacillus_phage(25.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011675087.1\|13207_13774_+\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_063280587.1\|13774_17263_+	transcription-repair coupling factor	NA	NA	NA	NA
WP_011675089.1\|17579_17849_+	RNA-binding S4 domain-containing protein	NA	NA	NA	NA
WP_021165758.1\|17879_18254_+	septum formation initiator family protein	NA	NA	NA	NA
WP_032951484.1\|18253_18577_+	S1 RNA-binding domain protein	NA	NA	NA	NA
WP_021165759.1\|18717_20055_+	hypothetical protein	NA	NA	NA	NA
WP_021165760.1\|20051_21320_+\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_011675094.1\|21300_21852_+	hypoxanthine phosphoribosyltransferase	A0A1V0SEQ1	Hokovirus	1.4e-09	29.7
WP_021165762.1\|22057_24145_+	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	G8DDJ2	Micromonas_pusilla_virus	1.6e-106	49.2
WP_063282465.1\|25211_26996_+	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_003331414.1\|27036_27795_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	5.3e-137	100.0
WP_003331415.1\|27806_29030_-\|transposase	IS21-like element IS712 family transposase	A0A059NT83	Lactococcus_phage	4.9e-233	100.0
WP_032950607.1\|29264_31199_+	transcription antiterminator	NA	NA	NA	NA
WP_032950610.1\|31245_31677_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_032950612.1\|31825_32992_+	mannitol-1-phosphate 5-dehydrogenase	NA	NA	NA	NA
WP_032940659.1\|33651_34389_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003138385.1\|34513_35689_+\|transposase	IS256-like element IS905 family transposase	A0A0N9STL0	Staphylococcus_phage	2.5e-32	32.3
WP_032950618.1\|36445_36811_+	hypothetical protein	NA	NA	NA	NA
WP_011675105.1\|37743_38097_+	DUF1648 domain-containing protein	NA	NA	NA	NA
WP_011675106.1\|38218_38377_+	hypothetical protein	NA	NA	NA	NA
WP_153041275.1\|38436_39548_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.1e-49	41.4
WP_011675108.1\|40030_40483_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_011675109.1\|40567_40810_+	TM2 domain-containing protein	NA	NA	NA	NA
WP_014571770.1\|40903_42526_-	SulP family inorganic anion transporter	NA	NA	NA	NA
WP_011675112.1\|42735_43257_+	N-acetyltransferase	A0A1P8CWJ6	Bacillus_phage	1.0e-30	42.1
WP_015081831.1\|43718_44894_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_011675114.1\|44991_45747_+	DNA repair protein RecO	NA	NA	NA	NA
WP_021165938.1\|45898_47317_-	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	2.3e-40	27.0
WP_032950622.1\|47535_49122_-	dienelactone hydrolase	NA	NA	NA	NA
WP_011834176.1\|49114_50095_-	alpha-ketoacid dehydrogenase subunit beta	NA	NA	NA	NA
WP_011675118.1\|50097_51222_-	thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha	NA	NA	NA	NA
WP_011675119.1\|51310_52312_-	lipoate--protein ligase	NA	NA	NA	NA
WP_011675120.1\|52504_53359_-	glycerophosphodiester phosphodiesterase	A0A0S2MYI4	Enterococcus_phage	7.8e-12	31.4
WP_011675122.1\|54137_54464_-	hypothetical protein	NA	NA	NA	NA
WP_081196043.1\|54520_55411_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_032950628.1\|55562_56588_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_011675125.1\|57086_57524_+	OsmC family protein	NA	NA	NA	NA
WP_032950631.1\|57685_58999_+	APC family permease	NA	NA	NA	NA
WP_011675127.1\|59077_60073_-	phosphate acyltransferase PlsX	NA	NA	NA	NA
WP_032950633.1\|60175_60988_-	HAD family hydrolase	NA	NA	NA	NA
WP_032950637.1\|61513_63151_-	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	4.8e-50	26.1
WP_063280668.1\|63650_63845_+	hypothetical protein	NA	NA	NA	NA
WP_153041276.1\|63826_65198_+\|transposase	IS3-like element ISLla3 family transposase	A0A1B1P773	Bacillus_phage	7.1e-55	43.4
WP_011675132.1\|65258_65840_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_032950651.1\|66696_67866_+	ring-cleaving dioxygenase	NA	NA	NA	NA
WP_011675141.1\|67876_68467_+	flavin reductase family protein	NA	NA	NA	NA
WP_031559015.1\|68553_69489_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5

DBSCAN-SWA_2

86080 : 139729

unidentified_phage(50.0%)

protease,tRNA,bacteriocin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011675157.1\|86080_86536_+\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
WP_014571846.1\|86528_87533_+	DUF1211 domain-containing protein	NA	NA	NA	NA
WP_011675159.1\|87535_88159_+	HAD family phosphatase	NA	NA	NA	NA
WP_011675160.1\|88292_89690_+	amino acid permease	NA	NA	NA	NA
WP_011675161.1\|89859_90501_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_014571848.1\|90531_91050_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_032950669.1\|92026_94624_+	preprotein translocase subunit SecA	NA	NA	NA	NA
WP_011834223.1\|94753_95791_+	3-deoxy-7-phosphoheptulonate synthase	S4W5F1	Pandoravirus	1.2e-46	35.8
WP_031559015.1\|95875_96811_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5
WP_011834224.1\|97114_97381_+	phosphocarrier protein HPr	NA	NA	NA	NA
WP_011675166.1\|97383_99111_+	phosphoenolpyruvate--protein phosphotransferase	NA	NA	NA	NA
WP_032950672.1\|99285_99594_+	hypothetical protein	NA	NA	NA	NA
WP_011675168.1\|99683_99983_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_011675169.1\|100087_100375_+	serine hydroxymethyltransferase	NA	NA	NA	NA
WP_032950700.1\|100654_101590_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_032950701.1\|102357_103140_+	hypothetical protein	NA	NA	NA	NA
WP_032950703.1\|103325_103646_+	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_011675174.1\|103768_104932_+	MFS transporter	NA	NA	NA	NA
WP_101961446.1\|105314_106425_+\|transposase	IS3-like element IS981 family transposase	A0A1P8CWQ3	Bacillus_phage	1.2e-49	41.4
WP_032950708.1\|106869_108306_+	permease	NA	NA	NA	NA
WP_032950711.1\|109261_110455_+	argininosuccinate synthase	NA	NA	NA	NA
WP_021165999.1\|110483_111863_+	argininosuccinate lyase	NA	NA	NA	NA
WP_011675183.1\|111879_113076_-	multidrug efflux MFS transporter	NA	NA	NA	NA
WP_011675184.1\|113268_113844_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_031286668.1\|113985_114354_+	ribonuclease P protein component	NA	NA	NA	NA
WP_011675186.1\|114350_115160_+	membrane protein insertase YidC	NA	NA	NA	NA
WP_081196044.1\|115247_116162_+	protein jag	NA	NA	NA	NA
WP_003131818.1\|116293_116428_+	50S ribosomal protein L34	NA	NA	NA	NA
WP_011675188.1\|116604_117516_+	aldo/keto reductase	NA	NA	NA	NA
WP_031559015.1\|117676_118612_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5
WP_063280608.1\|118705_118975_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011675190.1\|119151_119310_+\|bacteriocin	class IIb bacteriocin, lactobin A/cerein 7B family	NA	NA	NA	NA
WP_032950716.1\|119392_120073_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003131820.1\|120367_120634_+	IreB family regulatory phosphoprotein	NA	NA	NA	NA
WP_011675192.1\|120633_121065_+	Holliday junction resolvase RuvX	NA	NA	NA	NA
WP_003131822.1\|121165_121489_+	DUF1292 domain-containing protein	NA	NA	NA	NA
WP_032950719.1\|121518_122070_-	DUF1211 domain-containing protein	NA	NA	NA	NA
WP_032950722.1\|122159_122945_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_021166007.1\|122964_123276_-	DUF2316 family protein	NA	NA	NA	NA
WP_011675197.1\|123285_124071_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_011675198.1\|124189_124735_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_032950724.1\|124800_126744_-	1,4-alpha-glucan-branching protein	NA	NA	NA	NA
WP_014571867.1\|126863_127184_-	hypothetical protein	NA	NA	NA	NA
WP_011675201.1\|128019_128559_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_063280609.1\|129014_134420_+	collagen binding domain-containing protein	NA	NA	NA	NA
WP_031559015.1\|134512_135448_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5
WP_011677192.1\|136204_136537_+	preprotein translocase subunit YajC	NA	NA	NA	NA
WP_032951303.1\|136886_137621_+	isoprenyl transferase	R9W0U9	Flavobacterium_phage	2.0e-16	37.0
WP_011677190.1\|137620_138424_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_011677189.1\|138442_139729_+\|protease	RIP metalloprotease RseP	NA	NA	NA	NA

DBSCAN-SWA_3

169808 : 295530

132

Lactococcus_phage(52.94%)

protease,transposase,tRNA,terminase,integrase

attL 282498:282521|attR 296087:296110

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031559015.1\|169808_170744_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5
WP_032951276.1\|171048_171357_+	30S ribosomal protein S10	NA	NA	NA	NA
WP_032951274.1\|171375_171999_+	50S ribosomal protein L3	NA	NA	NA	NA
WP_011677162.1\|172024_172651_+	50S ribosomal protein L4	NA	NA	NA	NA
WP_011836026.1\|172650_172944_+	50S ribosomal protein L23	NA	NA	NA	NA
WP_011677160.1\|172959_173790_+	50S ribosomal protein L2	NA	NA	NA	NA
WP_011677159.1\|173949_174228_+	30S ribosomal protein S19	NA	NA	NA	NA
WP_010906302.1\|174243_174591_+	50S ribosomal protein L22	NA	NA	NA	NA
WP_003129960.1\|174603_175257_+	30S ribosomal protein S3	NA	NA	NA	NA
WP_063280538.1\|175260_175674_+	50S ribosomal protein L16	NA	NA	NA	NA
WP_003129957.1\|175673_175883_+	50S ribosomal protein L29	NA	NA	NA	NA
WP_003129955.1\|175903_176164_+	30S ribosomal protein S17	NA	NA	NA	NA
WP_003129953.1\|176186_176555_+	50S ribosomal protein L14	NA	NA	NA	NA
WP_003129951.1\|176688_176994_+	50S ribosomal protein L24	NA	NA	NA	NA
WP_003129948.1\|177013_177556_+	50S ribosomal protein L5	NA	NA	NA	NA
WP_003129946.1\|177574_177760_+	type Z 30S ribosomal protein S14	NA	NA	NA	NA
WP_011677156.1\|177910_178510_+	hypothetical protein	NA	NA	NA	NA
WP_011677155.1\|178714_179113_+	30S ribosomal protein S8	NA	NA	NA	NA
WP_011677154.1\|179329_179866_+	50S ribosomal protein L6	NA	NA	NA	NA
WP_011677153.1\|180134_180482_+	50S ribosomal protein L18	NA	NA	NA	NA
WP_032951271.1\|180500_181007_+	30S ribosomal protein S5	NA	NA	NA	NA
WP_003129921.1\|181017_181197_+	50S ribosomal protein L30	NA	NA	NA	NA
WP_011677151.1\|181492_181936_+	50S ribosomal protein L15	NA	NA	NA	NA
WP_032951269.1\|182013_183333_+	preprotein translocase subunit SecY	NA	NA	NA	NA
WP_011677149.1\|183472_184120_+	adenylate kinase	NA	NA	NA	NA
WP_003130554.1\|184422_184641_+	translation initiation factor IF-1	NA	NA	NA	NA
WP_001808836.1\|184694_184811_+	50S ribosomal protein L36	NA	NA	NA	NA
WP_003130555.1\|184828_185194_+	30S ribosomal protein S13	NA	NA	NA	NA
WP_010906297.1\|185214_185598_+	30S ribosomal protein S11	NA	NA	NA	NA
WP_003130557.1\|185646_186585_+	DNA-directed RNA polymerase subunit alpha	NA	NA	NA	NA
WP_003130558.1\|186603_186984_+	50S ribosomal protein L17	NA	NA	NA	NA
WP_063280539.1\|187695_188886_+	peptidoglycan bridge formation glycyltransferase FemA/FemB family protein	NA	NA	NA	NA
WP_021164992.1\|188892_189873_+	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	2.0e-11	33.3
WP_032951257.1\|190859_191849_+	alpha-1,2-fucosyltransferase	E3SJA0	Synechococcus_phage	1.1e-12	30.2
WP_011677142.1\|194338_194914_+	SIS domain-containing protein	A0A067XQR2	Caulobacter_phage	7.8e-24	32.3
WP_011677141.1\|194910_195456_+	HAD family hydrolase	NA	NA	NA	NA
WP_011677138.1\|196619_197981_+	DNA repair protein RadA	NA	NA	NA	NA
WP_081196046.1\|198081_198972_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_063280748.1\|199028_199712_-	DUF1275 domain-containing protein	NA	NA	NA	NA
WP_003138385.1\|199905_201081_+\|transposase	IS256-like element IS905 family transposase	A0A0N9STL0	Staphylococcus_phage	2.5e-32	32.3
WP_032951248.1\|201299_202385_+	PIN/TRAM domain-containing protein	NA	NA	NA	NA
WP_011677135.1\|202442_203072_+	hypothetical protein	NA	NA	NA	NA
WP_011677134.1\|203193_203550_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011677133.1\|203542_203881_+	DUF1048 domain-containing protein	NA	NA	NA	NA
WP_011677132.1\|203877_204201_+	DUF1048 domain-containing protein	NA	NA	NA	NA
WP_014573309.1\|204291_204786_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_032951246.1\|205938_206823_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_032951245.1\|206931_207474_+	cysteine hydrolase	A0A1V0SL12	Klosneuvirus	9.7e-08	28.6
WP_032951243.1\|207477_207972_+	cysteine hydrolase	NA	NA	NA	NA
WP_032951242.1\|208113_209565_+\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_032951241.1\|209676_210999_+	FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	5.5e-113	48.3
WP_011677124.1\|211087_211930_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_021165010.1\|212793_215085_-	Xaa-Pro dipeptidyl-peptidase	NA	NA	NA	NA
WP_011677122.1\|215256_216126_+	aquaporin family protein	NA	NA	NA	NA
WP_032951238.1\|216161_216944_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_153041277.1\|217575_218687_-\|transposase	IS3-like element IS981 family transposase	A0A1P8CWQ3	Bacillus_phage	2.1e-49	41.4
WP_032951233.1\|218807_219770_-	D-2-hydroxyacid dehydrogenase	A0A1V0SBV6	Catovirus	3.7e-34	32.7
WP_061778365.1\|220029_220992_+	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_061778324.1\|221190_221580_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_003331415.1\|221750_222974_+\|transposase	IS21-like element IS712 family transposase	A0A059NT83	Lactococcus_phage	4.9e-233	100.0
WP_003331414.1\|222985_223744_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	5.3e-137	100.0
WP_081196048.1\|223819_224716_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_017865109.1\|225196_225406_-	hypothetical protein	NA	NA	NA	NA
WP_032951226.1\|225466_225958_-	antirestriction protein ArdA	NA	NA	NA	NA
WP_032951223.1\|225981_226476_-	hypothetical protein	NA	NA	NA	NA
WP_050595613.1\|226570_227635_-	CHAP domain-containing protein	NA	NA	NA	NA
WP_063280540.1\|227649_229695_-	MnhB domain-containing protein	NA	NA	NA	NA
WP_081196049.1\|232353_233244_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_032951212.1\|234408_237513_+	DEAD/DEAH box helicase family protein	A0A2L1IWL4	Gordonia_phage	2.4e-42	30.1
WP_011677112.1\|237729_238329_+	hypothetical protein	NA	NA	NA	NA
WP_032951210.1\|238529_239861_+	UDP-N-acetylmuramate--L-alanine ligase	NA	NA	NA	NA
WP_004254487.1\|240020_240479_-	arginine repressor	NA	NA	NA	NA
WP_011677109.1\|240546_242241_+\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	7.8e-80	34.2
WP_081196050.1\|243676_244525_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_021165021.1\|244948_246013_+	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_021213427.1\|246144_247725_+	amino acid permease	NA	NA	NA	NA
WP_032951208.1\|248714_249659_+	carbamate kinase	NA	NA	NA	NA
WP_021165024.1\|249922_251053_+	aminotransferase	NA	NA	NA	NA
WP_032951207.1\|251242_252736_+	amino acid permease	NA	NA	NA	NA
WP_011677102.1\|252811_253303_+\|tRNA	prolyl-tRNA editing protein	NA	NA	NA	NA
WP_032951206.1\|253378_254473_+	DNA polymerase IV	NA	NA	NA	NA
WP_014573269.1\|254423_255089_-	prepilin peptidase	NA	NA	NA	NA
WP_032951204.1\|255254_255701_+	DNA starvation/stationary phase protection protein	A0A2K9VDB4	Lactobacillus_phage	3.2e-17	33.1
WP_011677097.1\|255816_256203_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_032951202.1\|256205_257177_-	ROK family glucokinase	NA	NA	NA	NA
WP_011677095.1\|257210_257432_-	YqgQ family protein	NA	NA	NA	NA
WP_031286281.1\|257624_258353_+	LytTR family transcriptional regulator	NA	NA	NA	NA
WP_014573264.1\|258692_259307_+	hypothetical protein	NA	NA	NA	NA
WP_021165027.1\|259321_259780_+	hypothetical protein	NA	NA	NA	NA
WP_081196051.1\|259840_260731_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_031286284.1\|261881_263714_+	translational GTPase TypA	A0A1S5SF82	Streptococcus_phage	9.2e-18	35.4
WP_011677086.1\|263814_264066_+	hypothetical protein	NA	NA	NA	NA
WP_032951195.1\|264153_265092_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_011677084.1\|265283_266471_+	acetate kinase	NA	NA	NA	NA
WP_032951192.1\|266629_267817_+	acetate kinase	NA	NA	NA	NA
WP_021165032.1\|267946_268399_+	hypothetical protein	NA	NA	NA	NA
WP_004254608.1\|268483_269200_+	UMP kinase	NA	NA	NA	NA
WP_011677081.1\|269355_269913_+	ribosome recycling factor	NA	NA	NA	NA
WP_011677080.1\|269997_270456_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_032951191.1\|270500_271358_+	S1 RNA-binding domain-containing protein	NA	NA	NA	NA
WP_011677078.1\|271532_272054_+	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_011677077.1\|272087_272297_+	hypothetical protein	NA	NA	NA	NA
WP_032951189.1\|272363_273242_+	ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	2.5e-05	26.4
WP_032951185.1\|273241_274006_+	ABC transporter permease	NA	NA	NA	NA
WP_011677074.1\|274141_274567_+	50S ribosomal protein L11	NA	NA	NA	NA
WP_011677073.1\|274953_275643_+	50S ribosomal protein L1	NA	NA	NA	NA
WP_031559015.1\|275761_276697_+\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5
WP_014573252.1\|276796_277141_+	hypothetical protein	NA	NA	NA	NA
WP_011677071.1\|277152_277374_-	hypothetical protein	NA	NA	NA	NA
WP_011677070.1\|277388_277787_-	HIT family protein	NA	NA	NA	NA
WP_011677068.1\|279876_280647_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.9e-29	32.8
WP_021165037.1\|280639_281659_+	ABC transporter permease	NA	NA	NA	NA
WP_021216177.1\|281691_282318_-	hypothetical protein	NA	NA	NA	NA
282498:282521	attL	NA	NA	NA	NA
WP_011677065.1\|282530_283712_-\|integrase	site-specific integrase	Q9AZK8	Lactococcus_phage	4.9e-89	45.2
WP_032951175.1\|284237_285560_-	deoxyribonuclease	NA	NA	NA	NA
WP_011677061.1\|285688_285883_-	hypothetical protein	Q9AZK1	Lactococcus_phage	3.9e-28	96.9
WP_011834155.1\|285955_286186_-	hypothetical protein	Q9AZK0	Lactococcus_phage	1.2e-15	85.5
WP_032951173.1\|286611_287475_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_032951171.1\|287949_288459_+	Rha family transcriptional regulator	R9QNB1	Lactococcus_phage	7.3e-90	98.2
WP_032951169.1\|288707_288902_+	DUF1655 domain-containing protein	Q9AZF2	Lactococcus_phage	4.3e-27	93.8
WP_032951168.1\|288905_289427_+	hypothetical protein	Q9AZJ3	Lactococcus_phage	2.4e-72	77.5
WP_021212079.1\|289423_289642_+	hypothetical protein	NA	NA	NA	NA
WP_032951167.1\|289638_289920_+	hypothetical protein	Q9AZJ1	Lactococcus_phage	1.1e-44	94.6
WP_032951166.1\|289962_290202_+	hypothetical protein	Q9AZJ0	Lactococcus_phage	6.1e-39	97.5
WP_025017252.1\|290449_290644_+	hypothetical protein	Q9AZE8	Lactococcus_phage	8.7e-28	98.4
WP_032951164.1\|290630_290966_+	hypothetical protein	Q9AZI7	Lactococcus_phage	4.0e-52	93.5
WP_032951161.1\|290962_291757_+	hypothetical protein	Q9AZI6	Lactococcus_phage	4.0e-143	90.9
WP_032951159.1\|291767_293396_+	DNA primase	Q9AZI5	Lactococcus_phage	5.4e-304	95.0
WP_032951156.1\|293631_294213_+	hypothetical protein	Q9AZI4	Lactococcus_phage	2.2e-90	90.7
WP_032951179.1\|294333_294774_+\|terminase	terminase small subunit	Q9AZI3	Lactococcus_phage	1.6e-56	87.7
WP_032951154.1\|294773_295106_+	hypothetical protein	Q9AZE0	Lactococcus_phage	6.9e-49	88.9
WP_032951152.1\|295206_295530_+	sigma-70 family RNA polymerase sigma factor	Q9AZI1	Lactococcus_phage	1.0e-44	86.0
296087:296110	attR	NA	NA	NA	NA

DBSCAN-SWA_4

416632 : 483410

unidentified_phage(21.05%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003130410.1\|416632_417580_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	3.4e-32	33.0
WP_014573100.1\|418685_419342_+	DUF2140 family protein	NA	NA	NA	NA
WP_010905402.1\|419446_419722_+	HU family DNA-binding protein	A7KV42	Bacillus_phage	1.6e-22	67.4
WP_081196057.1\|419831_420329_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_021165946.1\|420511_421021_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	5.1e-27	44.5
WP_021165947.1\|421035_421584_+	methylphosphotriester-DNA--protein-cysteine methyltransferase family protein	NA	NA	NA	NA
WP_011675543.1\|422545_423355_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	5.3e-18	34.0
WP_015082100.1\|423351_424077_+	ABC transporter permease	NA	NA	NA	NA
WP_014573095.1\|424138_424597_+	LytTR family transcriptional regulator	NA	NA	NA	NA
WP_011675546.1\|424593_424971_+	DUF3021 family protein	NA	NA	NA	NA
WP_021165952.1\|425079_426225_+	cysteine desulfurase	NA	NA	NA	NA
WP_032951420.1\|426374_427253_+	gamma-glutamyl-diamino acid-endopeptidase	NA	NA	NA	NA
WP_021165954.1\|427309_428959_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_063280768.1\|429150_430083_-	cysteine synthase A	A0A1X9I5K7	Streptococcus_phage	1.8e-118	71.1
WP_031559015.1\|430214_431150_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5
WP_032951424.1\|431376_432462_+	LysM peptidoglycan-binding domain-containing protein	A0A223LD43	Bacillus_phage	2.1e-09	34.1
WP_032951425.1\|432497_433130_-	MBL fold metallo-hydrolase	A0A1X9I5D3	Streptococcus_phage	2.7e-49	45.8
WP_161940334.1\|433130_435212_-	penicillin-binding protein	NA	NA	NA	NA
WP_021165958.1\|435198_435840_-	Holliday junction resolvase RecU	NA	NA	NA	NA
WP_014573088.1\|435920_436445_+	DUF1273 domain-containing protein	NA	NA	NA	NA
WP_063280739.1\|436604_436991_+	Spx/MgsR family RNA polymerase-binding regulatory protein	NA	NA	NA	NA
WP_011675557.1\|437215_437497_+	UPF0223 family protein	NA	NA	NA	NA
WP_011834553.1\|437480_438242_+	inositol monophosphatase family protein	NA	NA	NA	NA
WP_081196058.1\|438336_439617_+	UDP-N-acetylglucosamine 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_011675560.1\|439616_439808_+	DNA-directed RNA polymerase subunit beta	NA	NA	NA	NA
WP_011675561.1\|439983_441267_+	trigger factor	NA	NA	NA	NA
WP_032951358.1\|448126_450040_+	DNA primase	A0A1S5REW9	Helicobacter_phage	3.9e-43	33.5
WP_080683464.1\|450116_451460_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	3.2e-36	32.9
WP_031559015.1\|452398_453334_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5
WP_015082114.1\|453543_454923_+	MFS transporter	NA	NA	NA	NA
WP_014573078.1\|455078_455948_+	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_032951356.1\|455957_457223_+	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_011834562.1\|457451_457796_+	hypothetical protein	NA	NA	NA	NA
WP_011675568.1\|457841_460088_+\|protease	ATP-dependent Clp protease ATP-binding subunit	K4FB40	Cronobacter_phage	3.3e-126	39.9
WP_032951355.1\|460213_460684_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_021166306.1\|461285_461921_-	peptide deformylase	Q6VSW0	Vibrio_phage	3.8e-11	36.4
WP_011675572.1\|462075_462480_+	RNA pyrophosphohydrolase	NA	NA	NA	NA
WP_032951352.1\|462541_464620_+	excinuclease ABC subunit UvrB	NA	NA	NA	NA
WP_011675574.1\|464801_465623_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_011675575.1\|466808_467264_-	3-hydroxyacyl-ACP dehydratase FabZ	NA	NA	NA	NA
WP_011675576.1\|467539_468292_+	enoyl-ACP reductase FabI	NA	NA	NA	NA
WP_011675577.1\|468477_469440_-	membrane protein insertase YidC	NA	NA	NA	NA
WP_011675578.1\|469614_470373_-	HAD-IIB family hydrolase	A0A2P1EM96	Moumouvirus	6.1e-08	25.9
WP_011675579.1\|470467_471058_-	ECF transporter S component	NA	NA	NA	NA
WP_014573068.1\|471074_471611_-	phosphopantothenoylcysteine decarboxylase	Q9J5A8	Fowlpox_virus	6.8e-22	34.9
WP_011675580.1\|471603_472299_-	phosphopantothenate--cysteine ligase	Q9HH70	Methanothermobacter_phage	1.7e-17	31.7
WP_011675581.1\|472445_472631_-	4-oxalocrotonate tautomerase	NA	NA	NA	NA
WP_032951347.1\|472816_475144_+	cation-translocating P-type ATPase	M1HBF8	Paramecium_bursaria_Chlorella_virus	3.3e-44	26.0
WP_011675583.1\|475176_475620_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_032951345.1\|475846_476443_+	hypothetical protein	NA	NA	NA	NA
WP_153041279.1\|476504_477616_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	6.1e-49	41.1
WP_011675590.1\|477946_478990_+	hypothetical protein	NA	NA	NA	NA
WP_014573057.1\|478995_479205_+	hypothetical protein	NA	NA	NA	NA
WP_063280755.1\|480827_481598_+	hypothetical protein	NA	NA	NA	NA
WP_063280754.1\|481863_482238_-	hypothetical protein	NA	NA	NA	NA
WP_031559015.1\|482474_483410_+\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5

DBSCAN-SWA_5

513387 : 587072

Bacillus_phage(19.05%)

protease,tRNA,integrase,transposase

attL 554261:554320|attR 589696:589804

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096824164.1\|513387_514308_+	threonylcarbamoyl-AMP synthase	A0A291ATS8	Pandoravirus	1.7e-20	32.8
WP_021166332.1\|514540_515788_+	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	8.0e-98	53.0
WP_003138385.1\|515934_517110_+\|transposase	IS256-like element IS905 family transposase	A0A0N9STL0	Staphylococcus_phage	2.5e-32	32.3
WP_032951334.1\|517237_517840_+	lysozyme family protein	A0A223LKM8	Bacillus_phage	2.0e-22	38.2
WP_011675604.1\|517966_519064_+	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	1.9e-127	61.4
WP_032951332.1\|519060_520257_+	phosphoglycerate dehydrogenase	M1NSB9	Streptococcus_phage	6.9e-115	51.5
WP_011675606.1\|520302_520965_+	phosphoserine phosphatase SerB	NA	NA	NA	NA
WP_011675742.1\|521001_521295_-	acylphosphatase	NA	NA	NA	NA
WP_015082133.1\|521406_522165_+	RNA methyltransferase	NA	NA	NA	NA
WP_032951330.1\|522376_522766_-	cupin domain-containing protein	NA	NA	NA	NA
WP_011675746.1\|523071_523419_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_014573050.1\|523432_523759_+	inorganic pyrophosphatase	NA	NA	NA	NA
WP_011675748.1\|523934_524378_-	flavodoxin	A7KUZ7	Bacillus_phage	3.2e-09	32.5
WP_011675750.1\|526242_526872_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_015082136.1\|527151_528006_+	methionyl aminopeptidase	NA	NA	NA	NA
WP_011675752.1\|528028_528934_+	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_011675753.1\|529036_529483_-	GtrA family protein	NA	NA	NA	NA
WP_021211719.1\|529628_530360_+	TIM44-like domain-containing protein	NA	NA	NA	NA
WP_032951327.1\|530391_530667_+	DUF1294 domain-containing protein	NA	NA	NA	NA
WP_011675756.1\|530769_530946_+	DUF3272 family protein	NA	NA	NA	NA
WP_011834603.1\|531078_532011_+	HPr kinase/phosphorylase	NA	NA	NA	NA
WP_081196069.1\|532072_532858_+	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_011675759.1\|533024_533444_+	DUF948 domain-containing protein	NA	NA	NA	NA
WP_011675760.1\|533473_534034_+	YtxH domain-containing protein	NA	NA	NA	NA
WP_014573039.1\|534167_535586_+	NADP-dependent phosphogluconate dehydrogenase	E3SJC4	Synechococcus_phage	8.4e-35	33.0
WP_032951324.1\|535767_537789_+	potassium transporter Kup	A7K9V6	Acanthocystis_turfacea_chlorella_virus	1.4e-64	34.1
WP_011675763.1\|538003_540019_+	potassium transporter Kup	M1IBC2	Acanthocystis_turfacea_Chlorella_virus	2.6e-58	31.8
WP_080683462.1\|540071_540242_-	DUF3042 family protein	NA	NA	NA	NA
WP_011675765.1\|540436_541102_+	YitT family protein	M1Q1P6	Streptococcus_phage	2.3e-19	29.8
WP_011675766.1\|541233_542118_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_011675767.1\|542263_542932_+	hypothetical protein	NA	NA	NA	NA
WP_011675768.1\|543096_543999_+	SPFH domain-containing protein	A0A1V0SL90	Klosneuvirus	1.8e-35	35.2
WP_011675770.1\|545372_545720_-	XRE family transcriptional regulator	A0A182BQC8	Lactococcus_phage	1.6e-43	75.4
WP_015082147.1\|546484_547408_+	ribonuclease Z	NA	NA	NA	NA
WP_011675772.1\|547400_548102_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_032951320.1\|548274_550503_+	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	6.7e-79	31.1
WP_011834623.1\|550626_551139_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	5.3e-32	44.0
WP_021166354.1\|551354_551918_+	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
WP_032951319.1\|552053_553694_+	endolytic transglycosylase MltG	NA	NA	NA	NA
WP_014573028.1\|553754_554225_+	transcription elongation factor GreA	NA	NA	NA	NA
554261:554320	attL	NA	NA	NA	NA
WP_011834627.1\|555904_556360_+	CtsR family transcriptional regulator	NA	NA	NA	NA
WP_011675609.1\|556349_558800_+\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A223W0B1	Agrobacterium_phage	1.3e-123	34.0
WP_011834629.1\|558934_559492_+	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
WP_010905473.1\|559679_560981_+	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	4.0e-217	87.6
WP_032951316.1\|561069_562005_+\|integrase	tyrosine-type recombinase/integrase	A0A142F1N9	Bacillus_phage	8.0e-26	28.1
WP_011675617.1\|563553_563730_+	hypothetical protein	NA	NA	NA	NA
WP_031559015.1\|563976_564912_+\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5
WP_063280860.1\|564986_565850_+	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_021036847.1\|566110_568474_+	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	3.6e-107	31.8
WP_011675632.1\|568602_569262_+	dephospho-CoA kinase	NA	NA	NA	NA
WP_032951433.1\|569264_570482_+	multidrug efflux MFS transporter	NA	NA	NA	NA
WP_003129585.1\|570478_570625_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_032951434.1\|571002_572265_+	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_021166367.1\|572369_575783_+	pyruvate carboxylase	NA	NA	NA	NA
WP_032951436.1\|579796_581035_+	NADP-dependent isocitrate dehydrogenase	NA	NA	NA	NA
WP_011834647.1\|581074_581674_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	7.1e-52	52.6
WP_032951437.1\|581869_582400_+	hypothetical protein	NA	NA	NA	NA
WP_003129597.1\|582569_582968_+	transcriptional regulator Spx	NA	NA	NA	NA
WP_063280878.1\|583349_584513_-	hypothetical protein	NA	NA	NA	NA
WP_153041280.1\|586217_587072_+\|transposase	IS982 family transposase	NA	NA	NA	NA
589696:589804	attR	NA	NA	NA	NA

DBSCAN-SWA_6

599493 : 656515

Lactococcus_phage(33.33%)

integrase,bacteriocin,transposase

attL 599394:599426|attR 659502:659534

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
599394:599426	attL	NA	NA	NA	NA
WP_031559015.1\|599493_600429_+\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5
WP_063280649.1\|600447_601896_+	4-alpha-glucanotransferase	NA	NA	NA	NA
WP_021213515.1\|601996_603139_+	glucose-1-phosphate adenylyltransferase	NA	NA	NA	NA
WP_063280648.1\|603128_604268_+	glucose-1-phosphate adenylyltransferase subunit GlgD	NA	NA	NA	NA
WP_032951444.1\|604351_605794_+	glycogen synthase GlgA	NA	NA	NA	NA
WP_042748819.1\|605877_608280_+	glycogen/starch/alpha-glucan phosphorylase	Q8B3H5	Iris_mild_mosaic_virus	1.9e-10	40.2
WP_032951447.1\|608510_610313_+	glycoside hydrolase family 13 protein	NA	NA	NA	NA
WP_011675661.1\|610388_610646_+	helix-turn-helix transcriptional regulator	S5MAC0	Brevibacillus_phage	1.6e-05	42.4
WP_011675662.1\|610745_610895_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_032951448.1\|611775_613269_+	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	1.3e-73	35.0
WP_032951450.1\|613989_615465_+	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_011675669.1\|615464_616460_+	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_050595621.1\|616682_618434_+	thiol reductant ABC exporter subunit CydD	W8CYL7	Bacillus_phage	1.5e-20	23.7
WP_011675671.1\|618433_620155_+	thiol reductant ABC exporter subunit CydC	W8CYL7	Bacillus_phage	2.3e-18	24.7
WP_015082174.1\|620488_621376_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_003331415.1\|621522_622746_+\|transposase	IS21-like element IS712 family transposase	A0A059NT83	Lactococcus_phage	4.9e-233	100.0
WP_063280872.1\|623583_624060_+	flavodoxin	NA	NA	NA	NA
WP_021166169.1\|624075_624750_+	lysophospholipase	NA	NA	NA	NA
WP_011675676.1\|626587_627244_-	DUF1211 domain-containing protein	NA	NA	NA	NA
WP_081196072.1\|627317_627962_-	DedA family protein	NA	NA	NA	NA
WP_014572963.1\|628236_630231_-	ABC transporter ATP-binding protein/permease	G9BWD6	Planktothrix_phage	1.1e-32	37.2
WP_032949716.1\|630297_630516_-	DNA-binding protein	NA	NA	NA	NA
WP_015082180.1\|630726_631389_+	DUF1275 domain-containing protein	NA	NA	NA	NA
WP_021166165.1\|631417_632404_-	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_032949719.1\|634020_634221_+	hypothetical protein	Q9AZK6	Lactococcus_phage	2.6e-06	55.8
WP_011675684.1\|634343_634544_+	cold-shock protein	A0A1X9IGI9	Lactococcus_phage	3.0e-15	60.9
WP_011675685.1\|634812_635013_+	cold-shock protein	Q9AZD3	Lactococcus_phage	2.3e-23	78.8
WP_011675686.1\|635339_636092_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_011675688.1\|636929_637397_+	nucleoside deaminase	NA	NA	NA	NA
WP_032949721.1\|637737_637941_+	hypothetical protein	NA	NA	NA	NA
WP_032949723.1\|637960_639127_-\|integrase	site-specific integrase	A0A2H4J5L5	uncultured_Caudovirales_phage	2.8e-20	28.6
WP_050595582.1\|639123_640320_-	hypothetical protein	NA	NA	NA	NA
WP_032949725.1\|640706_641531_-	hypothetical protein	NA	NA	NA	NA
WP_139949727.1\|641546_642047_-	hypothetical protein	NA	NA	NA	NA
WP_063282460.1\|642236_643586_-	hypothetical protein	NA	NA	NA	NA
WP_032949727.1\|643586_643838_-	hypothetical protein	NA	NA	NA	NA
WP_032949728.1\|643858_644236_-	hypothetical protein	NA	NA	NA	NA
WP_011676499.1\|644553_644754_+	hypothetical protein	NA	NA	NA	NA
WP_081196073.1\|644735_645626_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_032950344.1\|645840_646065_+\|bacteriocin	garvicin Q family class II bacteriocin	NA	NA	NA	NA
WP_011834820.1\|646069_646375_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_032950343.1\|646733_648164_+	MFS transporter	NA	NA	NA	NA
WP_011676494.1\|648228_648909_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_032950341.1\|651082_652159_+	mannonate dehydratase	NA	NA	NA	NA
WP_032950339.1\|652344_653871_+	MFS transporter	NA	NA	NA	NA
WP_031288657.1\|653930_654812_+	aldose 1-epimerase family protein	NA	NA	NA	NA
WP_081196074.1\|655624_656515_-\|transposase	IS982 family transposase	NA	NA	NA	NA
659502:659534	attR	NA	NA	NA	NA

DBSCAN-SWA_7

714756 : 782166

unidentified_phage(10.0%)

integrase,tRNA,bacteriocin,transposase

attL 707959:707976|attR 780532:780549

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
707959:707976	attL	NA	NA	NA	NA
WP_021212493.1\|714756_715800_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_011676611.1\|715935_717054_-\|integrase	site-specific integrase	A0A1S5S8R9	Streptococcus_phage	7.1e-37	30.2
WP_032950295.1\|717171_717510_-	hypothetical protein	NA	NA	NA	NA
WP_032950287.1\|718800_718983_+	hypothetical protein	NA	NA	NA	NA
WP_032950285.1\|719329_719512_+	hypothetical protein	NA	NA	NA	NA
WP_015082636.1\|721058_721766_+	glucosamine-6-phosphate deaminase	NA	NA	NA	NA
WP_063280606.1\|721826_722981_-	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
WP_031286480.1\|723285_724425_+	thiolase family protein	NA	NA	NA	NA
WP_021165514.1\|724472_725705_+	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
WP_011834878.1\|725789_726062_+	30S ribosomal protein S16	NA	NA	NA	NA
WP_011676598.1\|726157_726397_+	KH domain-containing protein	NA	NA	NA	NA
WP_015082632.1\|726596_727553_+	ferrochelatase	NA	NA	NA	NA
WP_015082631.1\|727578_728424_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_011676595.1\|728608_729124_+	ribosome maturation factor RimM	NA	NA	NA	NA
WP_081196164.1\|729128_729872_+\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_011834883.1\|729997_730390_+	DUF1149 family protein	NA	NA	NA	NA
WP_015082629.1\|730406_731252_+	DegV family protein	NA	NA	NA	NA
WP_021165512.1\|731381_732164_+	4-hydroxy-tetrahydrodipicolinate reductase	NA	NA	NA	NA
WP_021165511.1\|732229_732772_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_011834887.1\|732971_734180_+\|tRNA	CCA tRNA nucleotidyltransferase	H7BUW3	unidentified_phage	1.8e-41	48.8
WP_161631173.1\|734309_735728_+	C69 family dipeptidase	NA	NA	NA	NA
WP_021165509.1\|735837_736356_+	hypothetical protein	NA	NA	NA	NA
WP_021165508.1\|736460_737540_+	iron-containing alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_011834890.1\|737623_738577_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_032950272.1\|738724_740596_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	1.9e-55	30.7
WP_032950270.1\|740602_740785_+	hypothetical protein	NA	NA	NA	NA
WP_161631172.1\|740842_741628_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_032950268.1\|741638_742190_-	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_011676580.1\|742330_743266_+	dihydroorotate oxidase	A0A1V0SH91	Hokovirus	1.5e-64	45.7
WP_021165504.1\|743390_744098_+	hypothetical protein	NA	NA	NA	NA
WP_011676578.1\|744157_744427_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_032950264.1\|744539_745586_+	zinc-dependent alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_032950262.1\|745678_746677_-	LacI family transcriptional regulator	NA	NA	NA	NA
WP_032950261.1\|747537_747990_+	ribose 5-phosphate isomerase B	NA	NA	NA	NA
WP_032950259.1\|748038_749403_+	glycoside hydrolase family 1 protein	A0A0B5JD41	Pandoravirus	9.6e-28	25.7
WP_081196077.1\|749576_750467_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_032950252.1\|752514_753354_+	thymidylate synthase	U5J9N5	Bacillus_phage	2.1e-86	55.0
WP_031559015.1\|753389_754325_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5
WP_032950249.1\|754700_755573_+	hypothetical protein	A0A1P8BMN5	Lactococcus_phage	5.5e-13	54.5
WP_011834907.1\|755836_756283_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_032950248.1\|756279_757653_+	MFS transporter	NA	NA	NA	NA
WP_011834909.1\|757873_758626_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_032950247.1\|758642_759011_+	DUF2255 family protein	NA	NA	NA	NA
WP_015082612.1\|759045_759360_+	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_011676481.1\|759372_759666_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_011676480.1\|759681_760089_+	cupin domain-containing protein	NA	NA	NA	NA
WP_015082611.1\|760227_760938_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A1D7SLB8	Cyanophage	9.0e-46	43.2
WP_011676478.1\|760992_761259_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_011676477.1\|761255_761936_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_011676476.1\|762152_764372_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	6.5e-151	41.0
WP_050574197.1\|764422_765877_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.2e-55	35.0
WP_015082608.1\|765989_766613_+	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_153041297.1\|767960_769108_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	5.5e-45	40.2
WP_153041282.1\|769185_770579_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	7.7e-57	45.0
WP_021166106.1\|770592_770742_-	hypothetical protein	NA	NA	NA	NA
WP_032950237.1\|770952_771759_+	hypothetical protein	A0A1P8BMN5	Lactococcus_phage	2.2e-11	47.6
WP_015082606.1\|771945_774549_+	ATP-dependent chaperone ClpB	K4FB40	Cronobacter_phage	1.4e-123	32.7
WP_014734994.1\|774738_775755_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.9e-60	41.5
WP_011676469.1\|775784_776333_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.5e-19	32.0
WP_081196078.1\|776523_778113_+	ABC transporter ATP-binding protein	F2Y1V6	Organic_Lake_phycodnavirus	1.9e-11	34.1
WP_015082602.1\|778164_778695_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_011676466.1\|779890_780433_+	hypoxanthine phosphoribosyltransferase	A0A218MMB5	uncultured_virus	4.7e-10	30.6
WP_021166101.1\|780609_782166_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	1.6e-71	46.5
780532:780549	attR	NA	NA	NA	NA

DBSCAN-SWA_8

806801 : 921151

Staphylococcus_phage(20.0%)

integrase,transposase

attL 838378:838437|attR 895828:897141

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081196080.1\|806801_807977_+\|transposase	IS256-like element IS905 family transposase	A0A0N9STL0	Staphylococcus_phage	2.5e-32	32.3
WP_032950214.1\|808060_809860_+	1-deoxy-D-xylulose-5-phosphate synthase	NA	NA	NA	NA
WP_081146222.1\|809969_810701_-	SDR family oxidoreductase	A0A2P0VP75	Tetraselmis_virus	5.5e-06	28.8
WP_081196081.1\|812251_813142_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_032945982.1\|813322_813712_-	transcriptional repressor	NA	NA	NA	NA
WP_011834952.1\|813858_814548_+	VIT family protein	NA	NA	NA	NA
WP_011834953.1\|814547_815228_+	VIT family protein	NA	NA	NA	NA
WP_032950210.1\|815303_816047_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_011834955.1\|816156_816576_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_031286704.1\|816587_817226_+	nitroreductase family protein	NA	NA	NA	NA
WP_032950206.1\|818085_818850_-	pilus assembly protein	NA	NA	NA	NA
WP_081196082.1\|818913_819804_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_032950203.1\|820028_820583_-	DUF1211 domain-containing protein	NA	NA	NA	NA
WP_101961446.1\|821036_822147_+\|transposase	IS3-like element IS981 family transposase	A0A1P8CWQ3	Bacillus_phage	1.2e-49	41.4
WP_011675801.1\|822251_823082_-	SP_1767 family glycosyltransferase	NA	NA	NA	NA
WP_014572862.1\|823387_824806_+	dipeptidase PepV	NA	NA	NA	NA
WP_011675803.1\|824934_825294_+	holo-ACP synthase	NA	NA	NA	NA
WP_011675804.1\|825337_826441_+	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	6.3e-30	28.1
WP_031559015.1\|826938_827874_+\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5
WP_031559015.1\|828151_829087_+\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5
WP_081196083.1\|829192_830083_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_081196084.1\|830208_831099_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_032949837.1\|831278_833321_-	cadmium-translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.2e-61	30.9
WP_032949839.1\|833509_834367_+	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase	A0A249XZQ2	Enterococcus_phage	2.6e-39	39.0
WP_031286477.1\|834537_835791_+	exodeoxyribonuclease VII large subunit	A0A2H4UVM9	Bodo_saltans_virus	1.2e-45	32.3
WP_011675817.1\|835793_836033_+	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
WP_081196085.1\|836259_837150_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_063280633.1\|837208_838354_+	glycerate kinase	W6LM47	Streptococcus_phage	2.0e-47	38.8
838378:838437	attL	NA	NA	NA	NA
WP_081196086.1\|838426_839602_-\|transposase	IS256-like element IS905 family transposase	A0A0N9STL0	Staphylococcus_phage	5.5e-32	31.9
WP_014572853.1\|839899_840757_+	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_021165631.1\|840757_841258_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_021165632.1\|841333_842140_+	TlyA family RNA methyltransferase	NA	NA	NA	NA
WP_011675823.1\|842136_842583_+	transcriptional regulator	NA	NA	NA	NA
WP_011675824.1\|842762_844430_+	DNA repair protein RecN	NA	NA	NA	NA
WP_133265005.1\|844546_845693_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	8.6e-46	41.0
WP_153041283.1\|845748_846672_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	5.6e-56	42.2
WP_081196088.1\|846563_847124_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_031559015.1\|847219_848155_+\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5
WP_015082274.1\|848954_849521_+	DUF1211 domain-containing protein	NA	NA	NA	NA
WP_011835491.1\|849615_850137_+	DUF805 domain-containing protein	NA	NA	NA	NA
WP_032940916.1\|851327_852269_+	16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH	NA	NA	NA	NA
WP_011675830.1\|852424_852805_+	cell division protein FtsL	NA	NA	NA	NA
WP_081196089.1\|852801_855099_+	penicillin-binding protein	NA	NA	NA	NA
WP_011835486.1\|855173_856163_+	phospho-N-acetylmuramoyl-pentapeptide- transferase	NA	NA	NA	NA
WP_032949842.1\|856361_856646_+	hypothetical protein	NA	NA	NA	NA
WP_032949846.1\|858421_859084_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-21	32.3
WP_032949848.1\|859443_860331_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_081196090.1\|860589_861480_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_153041284.1\|861603_862619_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	4.2e-36	35.4
WP_011675837.1\|862697_863372_+	GTP pyrophosphokinase family protein	NA	NA	NA	NA
WP_011675838.1\|863531_863876_+	50S ribosomal protein L19	NA	NA	NA	NA
WP_011675839.1\|864051_864468_-	SnoaL-like domain-containing protein	NA	NA	NA	NA
WP_011675840.1\|864805_865267_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_021037017.1\|865520_866030_+	hypothetical protein	NA	NA	NA	NA
WP_063280607.1\|866022_867351_+	glycosyltransferase	NA	NA	NA	NA
WP_003138385.1\|867375_868551_-\|transposase	IS256-like element IS905 family transposase	A0A0N9STL0	Staphylococcus_phage	2.5e-32	32.3
WP_032949860.1\|868902_869460_+	HdeD family acid-resistance protein	NA	NA	NA	NA
WP_011675844.1\|869522_869768_-	hypothetical protein	NA	NA	NA	NA
WP_011675845.1\|870040_870766_+	nicotinamide mononucleotide transporter	A0A2P0ZKW0	Lactobacillus_phage	1.4e-14	28.7
WP_014572836.1\|871318_871744_+	universal stress protein	NA	NA	NA	NA
WP_015082285.1\|871911_872274_+	HU family DNA-binding protein	NA	NA	NA	NA
WP_011675849.1\|872335_872869_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_081196092.1\|873540_874431_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_031559015.1\|875218_876154_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5
WP_003131392.1\|877701_878034_+	metal-sulfur cluster assembly factor	NA	NA	NA	NA
WP_032949873.1\|878168_879143_+\|integrase	tyrosine-type recombinase/integrase	A0A142F1N9	Bacillus_phage	7.3e-30	28.3
WP_021165731.1\|879767_880010_+	hypothetical protein	NA	NA	NA	NA
WP_153041285.1\|880061_881173_-\|transposase	IS3-like element IS981 family transposase	A0A1P8CWQ3	Bacillus_phage	2.1e-49	41.4
WP_032949877.1\|882354_882984_+	hypothetical protein	NA	NA	NA	NA
WP_032949879.1\|882980_883979_+	sensor histidine kinase	NA	NA	NA	NA
WP_021165122.1\|884006_884636_+	response regulator transcription factor	NA	NA	NA	NA
WP_011675857.1\|884706_885513_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_014572825.1\|885612_886203_+	peptidylprolyl isomerase	A0A1V0S9I2	Catovirus	3.2e-28	45.5
WP_011675859.1\|886204_886636_+	S1 RNA-binding domain-containing protein	NA	NA	NA	NA
WP_032949881.1\|886632_887238_+	TVP38/TMEM64 family protein	M1Q152	Streptococcus_phage	1.5e-28	36.4
WP_011835464.1\|887449_888694_+	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_063280777.1\|890025_890787_+	(S)-acetoin forming diacetyl reductase	NA	NA	NA	NA
WP_021165126.1\|891331_892882_+	ABC-F type ribosomal protection protein	Q6DMX7	Streptococcus_phage	1.3e-25	23.6
WP_011835459.1\|893292_894915_+	NAD-dependent malic enzyme	NA	NA	NA	NA
WP_081196086.1\|895876_897052_-\|transposase	IS256-like element IS905 family transposase	A0A0N9STL0	Staphylococcus_phage	5.5e-32	31.9
WP_011675866.1\|897169_898069_+	EamA family transporter	NA	NA	NA	NA
895828:897141	attR	NA	NA	NA	NA
WP_011835457.1\|898191_898956_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.5e-27	28.4
WP_014572815.1\|898936_900517_+	hypothetical protein	NA	NA	NA	NA
WP_014572814.1\|900691_901537_+	VOC family protein	NA	NA	NA	NA
WP_011675869.1\|901602_902250_+	HAD family hydrolase	NA	NA	NA	NA
WP_011675870.1\|902375_904331_+	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	3.7e-142	44.7
WP_011675871.1\|904429_904615_+	hypothetical protein	NA	NA	NA	NA
WP_032949893.1\|904838_905576_+	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	5.3e-81	58.3
WP_081196095.1\|905660_906110_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.8e-28	46.4
WP_015082299.1\|906653_907118_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_050595588.1\|908654_909383_+	DUF4811 domain-containing protein	NA	NA	NA	NA
WP_081196096.1\|909661_910552_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_063280659.1\|910715_911624_+	exopolysaccharide biosynthesis protein	NA	NA	NA	NA
WP_032949909.1\|914859_917967_+	DUF4422 domain-containing protein	NA	NA	NA	NA
WP_081196086.1\|919975_921151_+\|transposase	IS256-like element IS905 family transposase	A0A0N9STL0	Staphylococcus_phage	5.5e-32	31.9

DBSCAN-SWA_9

939924 : 1105309

169

Lactococcus_phage(53.68%)

capsid,tail,protease,transposase,plate,head,tRNA,holin,terminase,integrase,portal

attL 1006026:1006085|attR 1105269:1106337

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031559015.1\|939924_940860_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5
WP_011675898.1\|941005_941269_+	ACT domain-containing protein	NA	NA	NA	NA
WP_011675899.1\|941385_942723_+	PFL family protein	NA	NA	NA	NA
WP_031559015.1\|942788_943724_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5
WP_032949932.1\|943893_944373_+	hypothetical protein	NA	NA	NA	NA
WP_011675901.1\|944443_945139_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_011675902.1\|945135_945882_+	D-alanyl-D-alanine carboxypeptidase family protein	NA	NA	NA	NA
WP_011675903.1\|945896_946301_+	hypothetical protein	NA	NA	NA	NA
WP_011675904.1\|946448_947492_+	heat-inducible transcriptional repressor HrcA	NA	NA	NA	NA
WP_014572780.1\|947521_948061_+	nucleotide exchange factor GrpE	NA	NA	NA	NA
WP_011675956.1\|948132_949956_+	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	3.4e-129	45.8
WP_032949936.1\|950118_951963_+	hypothetical protein	NA	NA	NA	NA
WP_032949938.1\|952132_953896_+	oleate hydratase	NA	NA	NA	NA
WP_032949940.1\|953962_955102_+	amidohydrolase	NA	NA	NA	NA
WP_032949942.1\|955223_955925_+	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_032949944.1\|956007_956925_+	1-phosphofructokinase	NA	NA	NA	NA
WP_032949946.1\|956924_958829_+	PTS transporter subunit EIIA	NA	NA	NA	NA
WP_153041286.1\|958912_960285_-\|transposase	IS3-like element ISLla3 family transposase	A0A1B1P773	Bacillus_phage	2.1e-54	43.1
WP_011675965.1\|962321_962723_+	hypothetical protein	NA	NA	NA	NA
WP_081196098.1\|963282_964173_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_081196099.1\|964361_966224_+	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	3.1e-98	34.3
WP_021165185.1\|966293_966521_+	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_011675969.1\|966535_967075_+	hypothetical protein	NA	NA	NA	NA
WP_032949960.1\|967950_969396_+	cardiolipin synthase	NA	NA	NA	NA
WP_011675972.1\|969460_970348_+	RNase adapter RapZ	NA	NA	NA	NA
WP_032949962.1\|970344_971328_+	YvcK family protein	A1IMD5	Streptococcus_phage	1.3e-119	65.2
WP_011675974.1\|971423_972341_+	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	2.2e-60	43.9
WP_011675975.1\|972373_972931_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_032949965.1\|973219_974128_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.4e-21	29.5
WP_032949972.1\|975884_976688_+	formate/nitrite transporter family protein	NA	NA	NA	NA
WP_003130958.1\|976702_977233_-	DUF402 domain-containing protein	NA	NA	NA	NA
WP_014572762.1\|977396_978302_-	phosphohydrolase	NA	NA	NA	NA
WP_032949978.1\|978439_979537_+	peptide chain release factor 2	NA	NA	NA	NA
WP_011675982.1\|979866_980559_+	cell division ATP-binding protein FtsE	G9BWD6	Planktothrix_phage	1.6e-31	34.8
WP_021165191.1\|980551_981487_+	ABC transporter permease	NA	NA	NA	NA
WP_011675984.1\|981596_982574_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	6.0e-117	65.7
WP_011675985.1\|982978_985147_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	3.3e-256	60.7
WP_032949980.1\|985283_985706_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A142F1R4	Bacillus_phage	1.3e-12	36.4
WP_011675987.1\|985707_985926_-	redoxin NrdH	C3U2K9	Lactococcus_phage	5.8e-12	47.6
WP_011675988.1\|986099_986741_-	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_011675989.1\|987019_988954_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	1.8e-125	43.4
WP_015082341.1\|989060_989597_+	cysteine hydrolase	NA	NA	NA	NA
WP_032949983.1\|989589_990423_+	3'-5' exonuclease	A0A0K2SUJ2	Clostridium_phage	2.0e-20	39.4
WP_014572756.1\|990419_990869_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_011675994.1\|991141_993616_+	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	1.0e-96	31.9
WP_032949986.1\|993641_994547_-	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_031559015.1\|995966_996902_+\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5
WP_032949994.1\|997202_997850_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	4.7e-41	44.2
WP_021165199.1\|997861_999058_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	5.1e-110	50.5
WP_014572751.1\|999084_999549_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.4e-39	55.3
WP_153041287.1\|999730_1000841_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.3e-48	41.1
WP_063280861.1\|1000874_1001777_-	YafY family transcriptional regulator	NA	NA	NA	NA
WP_014572493.1\|1001876_1002257_+	hypothetical protein	NA	NA	NA	NA
WP_011676002.1\|1002545_1002998_+	lipoprotein signal peptidase	NA	NA	NA	NA
WP_011676003.1\|1003060_1003966_+	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	6.0e-10	27.8
WP_011676004.1\|1004123_1004567_+	divergent PAP2 family protein	NA	NA	NA	NA
1006026:1006085	attL	NA	NA	NA	NA
WP_003130410.1\|1006044_1006992_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	3.4e-32	33.0
WP_011835358.1\|1007493_1009311_+	glutamine--fructose-6-phosphate transaminase (isomerizing)	Q76DQ7	Chlorella_virus	4.8e-91	36.1
WP_032950002.1\|1009429_1010113_+	JAB domain-containing protein	NA	NA	NA	NA
WP_081196102.1\|1010412_1011537_-\|integrase	site-specific integrase	A0A1B1IME4	Lactococcus_phage	1.3e-211	98.9
WP_021211870.1\|1011660_1012242_-	hypothetical protein	A0A182BQD0	Lactococcus_phage	9.0e-44	73.7
WP_032950004.1\|1012302_1013124_-	helix-turn-helix domain-containing protein	Q9AZQ8	Lactococcus_phage	4.6e-118	79.5
WP_032950005.1\|1013409_1014171_-	hypothetical protein	NA	NA	NA	NA
WP_155723377.1\|1014489_1014657_-	hypothetical protein	NA	NA	NA	NA
WP_032950007.1\|1014765_1015014_+	helix-turn-helix transcriptional regulator	J7KK54	Streptococcus_phage	2.9e-07	51.7
WP_032950008.1\|1015024_1015753_+	hypothetical protein	A0A1P8BLQ9	Lactococcus_phage	3.8e-116	89.3
WP_021212446.1\|1015765_1016098_+	DUF771 domain-containing protein	Q38331	Lactococcus_phage	2.4e-57	100.0
WP_015966882.1\|1016099_1016348_+	hypothetical protein	Q77K30	Lactococcus_phage	1.7e-36	100.0
WP_032950010.1\|1016344_1016521_+	putative transcriptional regulator	A0A059NT92	Lactococcus_phage	2.8e-25	98.3
WP_032950012.1\|1016623_1017019_+	hypothetical protein	Q6JM08	Lactococcus_phage	3.0e-67	97.7
WP_063280746.1\|1017027_1017786_+	hypothetical protein	Q0ILF6	Lactococcus_phage	1.3e-143	96.8
WP_032950018.1\|1017778_1018204_+	single-stranded DNA-binding protein	Q9AZV6	Lactococcus_phage	5.7e-72	95.0
WP_063282452.1\|1018332_1019082_+	DNA replication protein	A0A1P8BKE9	Lactococcus_phage	2.1e-114	83.2
WP_021165556.1\|1019091_1019982_+	ATP-binding protein	R9QM21	Lactococcus_phage	3.0e-163	99.3
WP_081196103.1\|1020144_1020534_+	RusA family crossover junction endodeoxyribonuclease	R9QLL1	Lactococcus_phage	1.7e-67	97.7
WP_032950022.1\|1020537_1020774_+	DUF1031 family protein	A0A1B1IMV7	Lactococcus_phage	7.1e-32	89.9
WP_014572169.1\|1020885_1021065_+	DUF1497 domain-containing protein	Q9AYU3	Lactococcus_phage	4.6e-23	98.3
WP_032950024.1\|1021054_1021624_+	DUF658 family protein	Q38104	Lactococcus_phage	1.3e-87	95.2
WP_014572171.1\|1021634_1022024_+	hypothetical protein	A0A1P8BKW8	Lactococcus_phage	2.6e-71	99.2
WP_011676933.1\|1022020_1022227_+	DUF1125 domain-containing protein	A0A1P8BL00	Lactococcus_phage	2.4e-31	100.0
WP_014572172.1\|1022219_1022720_+	DUF1642 domain-containing protein	Q9AYU5	Lactococcus_phage	1.5e-42	55.6
WP_032950026.1\|1022716_1023136_+	dUTP diphosphatase	A5GYP0	Lactococcus_phage	3.1e-70	97.1
WP_032950027.1\|1023328_1023502_+	DUF1660 domain-containing protein	A0A1P8BLJ5	Lactococcus_phage	1.7e-27	96.4
WP_032950029.1\|1023540_1023732_-	hypothetical protein	NA	NA	NA	NA
WP_014572177.1\|1024228_1024651_+	RinA family protein	Q9AZ68	Lactococcus_phage	4.7e-50	97.9
WP_011676523.1\|1025078_1025489_+\|terminase	terminase	Q9AZ67	Lactococcus_phage	1.4e-67	100.0
WP_032950031.1\|1025481_1026870_+\|terminase	phage terminase large subunit	Q8LTR4	Lactococcus_phage	7.2e-265	97.2
WP_032950051.1\|1026906_1028277_+\|portal	phage portal protein	Q9AYX0	Lactococcus_phage	2.2e-237	99.3
WP_032950034.1\|1028263_1028452_+	hypothetical protein	A0A1P8BM11	Lactococcus_phage	3.3e-24	96.8
WP_032950037.1\|1028455_1030150_+\|capsid	minor capsid protein	Q9AZ64	Lactococcus_phage	0.0e+00	97.3
WP_014572181.1\|1030164_1030392_+	hypothetical protein	Q9AZ63	Lactococcus_phage	5.4e-37	97.3
WP_032950039.1\|1030506_1031169_+	DUF4355 domain-containing protein	B5SP30	Lactococcus_phage	2.1e-76	98.6
WP_032950041.1\|1031170_1031989_+\|capsid	N4-gp56 family major capsid protein	Q9AZ61	Lactococcus_phage	2.9e-141	98.5
WP_014570729.1\|1031988_1032186_+	hypothetical protein	B5SP32	Lactococcus_phage	2.8e-29	100.0
WP_014572184.1\|1032172_1032505_+\|head,tail	phage head-tail connector protein	B5SP33	Lactococcus_phage	3.9e-52	98.2
WP_032950043.1\|1032501_1032813_+	hypothetical protein	A0A1P8BLL1	Lactococcus_phage	1.3e-54	98.1
WP_032950045.1\|1032809_1033148_+	HK97 gp10 family phage protein	Q77K21	Lactococcus_phage	1.6e-53	97.3
WP_032950048.1\|1033144_1033540_+\|capsid	phage capsid protein	A0A1P8BM84	Lactococcus_phage	3.7e-65	96.9
WP_063280537.1\|1033550_1034060_+\|tail	phage major tail protein, TP901-1 family	Q77K19	Lactococcus_phage	1.1e-85	96.4
WP_015966829.1\|1034175_1034511_+	hypothetical protein	Q77RZ7	Lactococcus_phage	1.5e-54	100.0
WP_032951117.1\|1034606_1034870_+	hypothetical protein	Q9AYV9	Lactococcus_phage	8.5e-42	100.0
WP_032951114.1\|1034884_1037698_+\|tail	phage tail tape measure protein	Q9G097	Lactococcus_phage	1.4e-291	96.0
WP_032951113.1\|1037711_1038473_+	hypothetical protein	Q9AYV7	Lactococcus_phage	2.6e-139	98.0
WP_050595610.1\|1038472_1041319_+	peptidoglycan DD-metalloendopeptidase family protein	A0A1P8BMB8	Lactococcus_phage	0.0e+00	84.9
WP_133265003.1\|1041331_1043458_+\|plate	BppU family phage baseplate upper protein	A0A1L2JXK8	Streptococcus_phage	1.5e-133	71.0
WP_032951112.1\|1043632_1043884_+	hypothetical protein	NA	NA	NA	NA
WP_032951111.1\|1044159_1044510_+	hypothetical protein	A0A1P8BKU2	Lactococcus_phage	1.7e-53	96.6
WP_032951110.1\|1044522_1044729_+\|holin	holin	NA	NA	NA	NA
WP_081196104.1\|1044725_1046015_+	LysM peptidoglycan-binding domain-containing protein	A0A1B1IMZ6	Lactococcus_phage	1.0e-241	98.4
WP_161940336.1\|1046203_1046458_+	hypothetical protein	NA	NA	NA	NA
WP_063280787.1\|1046481_1047519_-	acyltransferase	A0A0S2SXM2	Bacillus_phage	4.4e-17	30.4
WP_153041288.1\|1047639_1048751_-\|transposase	IS3-like element IS981 family transposase	A0A1P8CWQ3	Bacillus_phage	1.2e-49	41.4
WP_011676403.1\|1048864_1049167_+	helix-turn-helix transcriptional regulator	A0A1S5SAD3	Streptococcus_phage	6.0e-07	51.7
WP_021037426.1\|1049448_1050393_+	cation transporter	NA	NA	NA	NA
WP_011676401.1\|1050446_1050878_+	phosphate-starvation-inducible protein PsiE	NA	NA	NA	NA
WP_011676400.1\|1050948_1051869_-	type I pantothenate kinase	A0A1B1ISL9	uncultured_Mediterranean_phage	1.9e-32	37.7
WP_011834977.1\|1052057_1052654_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_032951108.1\|1052688_1053981_+	pyrimidine-nucleoside phosphorylase	A0A0H3UZD4	Geobacillus_virus	1.2e-117	53.5
WP_011676397.1\|1053982_1054171_+	hypothetical protein	NA	NA	NA	NA
WP_011676396.1\|1054183_1054846_+	deoxyribose-phosphate aldolase	NA	NA	NA	NA
WP_011676395.1\|1054832_1055225_+	cytidine deaminase	NA	NA	NA	NA
WP_011676394.1\|1055492_1056548_+	BMP family ABC transporter substrate-binding protein	A0A0A7DN02	Lactobacillus_phage	5.1e-61	41.5
WP_011676393.1\|1056731_1057439_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_011676392.1\|1057446_1057887_-	DUF4395 domain-containing protein	NA	NA	NA	NA
WP_032951107.1\|1057984_1059538_-	sensor histidine kinase	W8CYF6	Bacillus_phage	1.7e-33	37.3
WP_011676390.1\|1059527_1060238_-	response regulator transcription factor	A0A1V0SGR9	Hokovirus	5.3e-06	30.1
WP_031559015.1\|1060392_1061328_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5
WP_011676389.1\|1061497_1061833_+	putative DNA-binding protein	NA	NA	NA	NA
WP_032951106.1\|1062447_1063527_-\|integrase	site-specific integrase	A5GYP9	Lactococcus_phage	2.7e-203	98.9
WP_032951105.1\|1063711_1064299_-	hypothetical protein	Q9AZW4	Lactococcus_phage	1.7e-106	99.0
WP_032951104.1\|1064308_1064797_-	helix-turn-helix domain-containing protein	Q9AZW3	Lactococcus_phage	1.3e-35	75.5
WP_003138385.1\|1065200_1066376_-\|transposase	IS256-like element IS905 family transposase	A0A0N9STL0	Staphylococcus_phage	2.5e-32	32.3
WP_015966839.1\|1067686_1067953_+\|holin	phage holin	Q38613	Lactococcus_phage	4.3e-41	100.0
WP_081196105.1\|1067949_1069239_+	LysM peptidoglycan-binding domain-containing protein	A0A1B1IMU2	Lactococcus_phage	2.4e-238	96.5
WP_081196106.1\|1069456_1070071_+\|protease	CAAX protease	A0A059NT88	Lactococcus_phage	4.0e-34	40.3
WP_003130410.1\|1070030_1070978_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	3.4e-32	33.0
WP_153041298.1\|1071316_1071514_+	hypothetical protein	A0A182BQ75	Lactococcus_phage	1.3e-10	57.1
WP_003132737.1\|1072545_1073196_-	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_011676069.1\|1073418_1073811_+	Spx/MgsR family RNA polymerase-binding regulatory protein	NA	NA	NA	NA
WP_014572500.1\|1076054_1076195_-	hypothetical protein	NA	NA	NA	NA
WP_021165209.1\|1076312_1076942_+	orotate phosphoribosyltransferase	Q58MW1	Prochlorococcus_phage	8.9e-05	26.2
WP_032951099.1\|1077094_1078366_+	dihydroorotase	NA	NA	NA	NA
WP_080683454.1\|1078667_1079690_+	hypothetical protein	NA	NA	NA	NA
WP_063280786.1\|1081316_1081922_+	hypothetical protein	NA	NA	NA	NA
WP_003138385.1\|1081985_1083161_-\|transposase	IS256-like element IS905 family transposase	A0A0N9STL0	Staphylococcus_phage	2.5e-32	32.3
WP_032951097.1\|1083773_1086359_+	BspA family leucine-rich repeat surface protein	NA	NA	NA	NA
WP_011676080.1\|1086623_1087292_+	DnaD domain-containing protein	C5J987	Streptococcus_phage	1.1e-05	31.4
WP_011676081.1\|1087313_1087970_+	endonuclease III	NA	NA	NA	NA
WP_015082362.1\|1087962_1088652_+\|tRNA	tRNA (adenine-N(1))-methyltransferase	NA	NA	NA	NA
WP_011676083.1\|1088648_1089422_+	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
WP_011676084.1\|1089456_1089822_-	hypothetical protein	NA	NA	NA	NA
WP_021165230.1\|1089960_1090776_-	sugar-phosphatase	NA	NA	NA	NA
WP_021165231.1\|1090828_1092172_-	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	1.2e-27	33.0
WP_011676087.1\|1092344_1092743_+	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_011676088.1\|1092735_1093911_+	DUF998 domain-containing protein	NA	NA	NA	NA
WP_003130644.1\|1094080_1094395_+	50S ribosomal protein L21	NA	NA	NA	NA
WP_011676089.1\|1094397_1094733_+\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_003130646.1\|1094734_1095019_+	50S ribosomal protein L27	NA	NA	NA	NA
WP_015082368.1\|1095291_1096824_+	divalent metal cation transporter	NA	NA	NA	NA
WP_021165232.1\|1096897_1097866_+	phosphate starvation-inducible protein PhoH	H6X2N1	Pseudomonas_phage	2.0e-48	48.4
WP_011676092.1\|1097935_1098430_+	NUDIX hydrolase	NA	NA	NA	NA
WP_032951096.1\|1098520_1099009_+	rRNA maturation RNase YbeY	NA	NA	NA	NA
WP_011676094.1\|1098992_1099448_+	diacylglycerol kinase	NA	NA	NA	NA
WP_011676095.1\|1099464_1100043_+	nucleotidyltransferase family protein	NA	NA	NA	NA
WP_032951095.1\|1100100_1100751_-	ComF family protein	NA	NA	NA	NA
WP_031559015.1\|1101302_1102238_+\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5
WP_011676097.1\|1103177_1103813_+	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	6.6e-56	54.5
WP_063280772.1\|1103854_1104313_+	glycopeptide antibiotics resistance protein	NA	NA	NA	NA
WP_003130410.1\|1104361_1105309_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	3.4e-32	33.0
1105269:1106337	attR	NA	NA	NA	NA

DBSCAN-SWA_10

1120822 : 1246240

101

unidentified_phage(19.23%)

protease,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003130410.1\|1120822_1121770_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	3.4e-32	33.0
WP_031559015.1\|1121908_1122844_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5
WP_014572528.1\|1122993_1123779_-	type 1 glutamine amidotransferase	NA	NA	NA	NA
WP_032951080.1\|1123779_1125129_-	Mur ligase family protein	NA	NA	NA	NA
WP_011676114.1\|1125227_1125893_+	acetolactate decarboxylase	NA	NA	NA	NA
WP_011676115.1\|1126165_1127989_+	elongation factor 4	A0A2K9L2P9	Tupanvirus	9.8e-20	38.8
WP_011676116.1\|1128055_1128691_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_096824163.1\|1130528_1131086_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_032951082.1\|1131075_1134132_+	type I restriction endonuclease subunit R	NA	NA	NA	NA
WP_081196109.1\|1134194_1135085_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_032951069.1\|1135233_1135620_+	hypothetical protein	NA	NA	NA	NA
WP_050595609.1\|1135628_1136411_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_032951067.1\|1136427_1138041_+	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	2.3e-121	50.8
WP_032951065.1\|1138256_1140746_+	DNA gyrase subunit A	A0A172JHV7	Bacillus_phage	2.4e-101	34.6
WP_011676121.1\|1140827_1141913_+	FAD:protein FMN transferase	NA	NA	NA	NA
WP_032951064.1\|1142035_1142788_+	sortase	NA	NA	NA	NA
WP_081196110.1\|1143017_1145771_+	DUF2156 domain-containing protein	NA	NA	NA	NA
WP_011676124.1\|1145757_1146387_+	DUF998 domain-containing protein	NA	NA	NA	NA
WP_032951062.1\|1146331_1147108_-	hypothetical protein	NA	NA	NA	NA
WP_021214375.1\|1150079_1150652_+	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
WP_015082395.1\|1150732_1151182_+	glyoxalase/bleomycin resistance/extradiol dioxygenase family protein	NA	NA	NA	NA
WP_011676129.1\|1151357_1152866_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	1.0e-51	29.8
WP_081196111.1\|1152963_1153854_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_011676130.1\|1154005_1154944_+	phosphotransferase	NA	NA	NA	NA
WP_021212251.1\|1156877_1157102_+	hypothetical protein	NA	NA	NA	NA
WP_021212250.1\|1157186_1157585_+	hypothetical protein	NA	NA	NA	NA
WP_011676235.1\|1157653_1158334_+	hypothetical protein	NA	NA	NA	NA
WP_014572551.1\|1158472_1158613_+	hypothetical protein	NA	NA	NA	NA
WP_063280816.1\|1158605_1159184_+	hypothetical protein	NA	NA	NA	NA
WP_011676238.1\|1159519_1160233_+	hypothetical protein	NA	NA	NA	NA
WP_011676239.1\|1160372_1161365_+\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_032951054.1\|1161396_1162299_+	bifunctional riboflavin kinase/FAD synthetase	A0A1V0SJE1	Klosneuvirus	9.8e-13	36.4
WP_011676241.1\|1162384_1163356_+	L-lactate dehydrogenase	NA	NA	NA	NA
WP_014572555.1\|1163505_1164567_+	DUF871 domain-containing protein	NA	NA	NA	NA
WP_011835285.1\|1164559_1165453_+	N-acetylmuramic acid 6-phosphate etherase	NA	NA	NA	NA
WP_050595608.1\|1165488_1167441_+	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_011676245.1\|1167502_1168354_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_011676246.1\|1168486_1169245_+	triose-phosphate isomerase	NA	NA	NA	NA
WP_014572562.1\|1170373_1170961_+	hypothetical protein	NA	NA	NA	NA
WP_021165274.1\|1172584_1173112_+	ParB-like nuclease domain-containing protein	A0A220GKT8	Streptococcus_phage	9.6e-61	64.9
WP_011676249.1\|1173301_1174441_+	oxygen-independent coproporphyrinogen III oxidase	NA	NA	NA	NA
WP_021037184.1\|1174486_1175302_+	glycoside hydrolase GH25 family	NA	NA	NA	NA
WP_032951053.1\|1175404_1175845_+	dCMP deaminase family protein	A7KUY9	Bacillus_phage	1.6e-24	46.0
WP_011676253.1\|1175946_1176675_+	acyl-[acyl-carrier-protein] thioesterase	NA	NA	NA	NA
WP_015082408.1\|1176726_1177500_+	TIGR01457 family HAD-type hydrolase	NA	NA	NA	NA
WP_011676255.1\|1177640_1178258_+	TIGR01906 family membrane protein	NA	NA	NA	NA
WP_011676256.1\|1178520_1179510_+	GMP reductase	G3MBI2	Bacillus_virus	3.0e-140	74.4
WP_032951051.1\|1179682_1180633_-	glycosyltransferase	NA	NA	NA	NA
WP_063280817.1\|1180709_1182140_-	flagellar hook-length control protein FliK	NA	NA	NA	NA
WP_015082412.1\|1184023_1184641_+	hypothetical protein	NA	NA	NA	NA
WP_003138385.1\|1184840_1186016_+\|transposase	IS256-like element IS905 family transposase	A0A0N9STL0	Staphylococcus_phage	2.5e-32	32.3
WP_014572576.1\|1186323_1186917_+	xanthine phosphoribosyltransferase	NA	NA	NA	NA
WP_014572577.1\|1186974_1188279_+	purine permease	Q9KX94	Enterobacteria_phage	6.5e-34	29.9
WP_014572578.1\|1188314_1188725_-	hypothetical protein	NA	NA	NA	NA
WP_081196113.1\|1188898_1189789_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_011676268.1\|1189885_1190395_-\|tRNA	tRNA (cytidine(34)-2'-O)-methyltransferase	NA	NA	NA	NA
WP_031559015.1\|1190839_1191775_+\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5
WP_011835213.1\|1191901_1192408_+	dihydrofolate reductase	A0A1L7N103	Ralstonia_phage	2.2e-09	29.8
WP_011676271.1\|1192656_1193892_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	2.4e-134	58.6
WP_011676272.1\|1193888_1194476_+	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_032951044.1\|1194529_1194880_+	dihydroneopterin aldolase	NA	NA	NA	NA
WP_032951043.1\|1194959_1196009_+	GTP cyclohydrolase I FolE	A0A088F7Y4	Vibrio_phage	8.7e-37	45.1
WP_032951041.1\|1196005_1197079_+	dihydropteroate synthase	NA	NA	NA	NA
WP_014572580.1\|1197081_1197582_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_011676277.1\|1197597_1198881_+	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_032951040.1\|1199828_1201115_+	homoserine dehydrogenase	NA	NA	NA	NA
WP_011676280.1\|1201119_1202010_+	homoserine kinase	NA	NA	NA	NA
WP_161631177.1\|1202193_1202862_+	niacin ECF transporter S component NiaX	NA	NA	NA	NA
WP_032951038.1\|1202904_1203804_+	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_032951037.1\|1204263_1205544_+	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	2.1e-32	38.9
WP_032951035.1\|1205540_1206329_+	ABC transporter permease	NA	NA	NA	NA
WP_021212202.1\|1206330_1207131_+	ABC transporter permease	NA	NA	NA	NA
WP_032951034.1\|1207178_1208246_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_032951033.1\|1209454_1210651_-	MFS transporter	NA	NA	NA	NA
WP_003138385.1\|1210908_1212084_-\|transposase	IS256-like element IS905 family transposase	A0A0N9STL0	Staphylococcus_phage	2.5e-32	32.3
WP_031559015.1\|1212325_1213261_+\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5
WP_021037230.1\|1213367_1213613_+	hypothetical protein	NA	NA	NA	NA
WP_081196114.1\|1213760_1214651_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_063280857.1\|1215069_1217415_+	HAD-IC family P-type ATPase	NA	NA	NA	NA
WP_153041289.1\|1217451_1218562_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	4.7e-49	41.1
WP_014572649.1\|1218902_1219607_-	N-acetylmannosamine-6-phosphate 2-epimerase	NA	NA	NA	NA
WP_021165388.1\|1219744_1220566_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_011676170.1\|1220628_1221999_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	E4ZFI6	Streptococcus_phage	3.8e-141	56.0
WP_021165386.1\|1222043_1223651_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_011676167.1\|1224337_1225510_+	AI-2E family transporter	NA	NA	NA	NA
WP_032950056.1\|1225537_1226794_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_032950057.1\|1226948_1228613_+	acetolactate synthase AlsS	NA	NA	NA	NA
WP_032950058.1\|1228719_1229865_-	MFS transporter	NA	NA	NA	NA
WP_014572641.1\|1229972_1230371_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_081196115.1\|1230686_1231577_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_063280603.1\|1232157_1232490_+	helix-turn-helix transcriptional regulator	A0A1S5SAD3	Streptococcus_phage	4.5e-08	44.0
WP_081196116.1\|1232667_1233843_-\|transposase	IS256-like element IS905 family transposase	A0A0N9STL0	Staphylococcus_phage	1.9e-32	32.3
WP_063280698.1\|1234015_1236019_+	ribonuclease R	Q0GXV6	Lactococcus_phage	2.4e-80	39.6
WP_081196117.1\|1237103_1237784_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.4e-109	83.2
WP_032950066.1\|1239158_1240466_+	histidinol dehydrogenase	NA	NA	NA	NA
WP_011676150.1\|1240466_1241075_+	imidazoleglycerol-phosphate dehydratase HisB	NA	NA	NA	NA
WP_032950068.1\|1241902_1242511_+	imidazole glycerol phosphate synthase subunit HisH	NA	NA	NA	NA
WP_011676147.1\|1242510_1243251_+	1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase	NA	NA	NA	NA
WP_061777892.1\|1243219_1243999_+	imidazole glycerol phosphate synthase subunit HisF	NA	NA	NA	NA
WP_032950069.1\|1243995_1244634_+	bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE	NA	NA	NA	NA
WP_031559015.1\|1245304_1246240_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5

DBSCAN-SWA_11

1267448 : 1337198

Staphylococcus_phage(25.0%)

protease,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032950090.1\|1267448_1268795_+\|tRNA	methylenetetrahydrofolate--tRNA-(uracil(54)- C(5))-methyltransferase (FADH(2)-oxidizing) TrmFO	NA	NA	NA	NA
WP_014572599.1\|1268844_1269915_-	tyrosine recombinase XerS	NA	NA	NA	NA
WP_021165347.1\|1270541_1271249_-	hypothetical protein	NA	NA	NA	NA
WP_014572597.1\|1271427_1271574_-	hypothetical protein	NA	NA	NA	NA
WP_031559015.1\|1271705_1272641_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5
WP_032950096.1\|1275495_1275828_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011676291.1\|1275990_1277058_-	DUF475 domain-containing protein	A0A172Q0Y5	Acinetobacter_phage	1.2e-54	41.5
WP_003138385.1\|1277403_1278579_+\|transposase	IS256-like element IS905 family transposase	A0A0N9STL0	Staphylococcus_phage	2.5e-32	32.3
WP_153041290.1\|1278781_1279892_+\|transposase	IS3-like element IS981 family transposase	A0A1P8CWQ3	Bacillus_phage	1.2e-49	41.4
WP_032950105.1\|1280309_1281167_-	methylenetetrahydrofolate reductase [NAD(P)H]	NA	NA	NA	NA
WP_032950106.1\|1281156_1283430_-	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	NA	NA	NA	NA
WP_014572659.1\|1283589_1284243_-	metal-dependent transcriptional regulator	NA	NA	NA	NA
WP_081196118.1\|1284335_1287068_-	magnesium-translocating P-type ATPase	A0A1J0FA34	Only_Syngen_Nebraska_virus	3.3e-43	23.3
WP_011676183.1\|1287542_1288829_-	D-alanyl-lipoteichoic acid biosynthesis protein DltD	NA	NA	NA	NA
WP_011676184.1\|1288818_1289058_-	D-alanine--poly(phosphoribitol) ligase subunit DltC	NA	NA	NA	NA
WP_032950108.1\|1289093_1290317_-	D-alanyl-lipoteichoic acid biosynthesis protein DltB	A0A125RNP0	Pseudomonas_phage	2.4e-22	30.8
WP_015082475.1\|1290316_1291816_-	D-alanine--poly(phosphoribitol) ligase subunit DltA	A0A2K9L3I8	Tupanvirus	1.8e-40	30.0
WP_021212171.1\|1291840_1291972_-	teichoic acid D-Ala incorporation-associated protein DltX	NA	NA	NA	NA
WP_031559015.1\|1292199_1293135_+\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5
WP_015082476.1\|1293225_1293882_-	thiamine phosphate synthase	NA	NA	NA	NA
WP_011676188.1\|1293874_1294675_-	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_021212172.1\|1294687_1295440_-	hydroxyethylthiazole kinase	NA	NA	NA	NA
WP_081196119.1\|1296779_1297670_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_011675620.1\|1299639_1300530_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_050595591.1\|1300818_1302378_-	multidrug efflux MFS transporter	NA	NA	NA	NA
WP_031286422.1\|1302383_1302761_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_032950119.1\|1303210_1303576_-	50S ribosomal protein L7/L12	NA	NA	NA	NA
WP_011676195.1\|1303645_1304161_-	50S ribosomal protein L10	NA	NA	NA	NA
WP_011676196.1\|1304414_1304840_-	hypothetical protein	NA	NA	NA	NA
WP_011676197.1\|1305087_1305276_-	hypothetical protein	NA	NA	NA	NA
WP_032950121.1\|1305289_1306048_-	helix-turn-helix transcriptional regulator	R9TNM0	Vibrio_phage	3.7e-05	26.2
WP_032950124.1\|1306166_1307951_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.3e-45	29.2
WP_032950127.1\|1307934_1309752_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	1.1e-44	27.4
WP_003138385.1\|1309900_1311076_+\|transposase	IS256-like element IS905 family transposase	A0A0N9STL0	Staphylococcus_phage	2.5e-32	32.3
WP_032950131.1\|1311210_1312461_-\|protease	trypsin-like serine protease	A0A2H4PQN5	Staphylococcus_phage	1.6e-05	26.8
WP_014572677.1\|1312474_1313065_-	hypothetical protein	NA	NA	NA	NA
WP_081196120.1\|1313730_1314906_-\|transposase	IS256-like element IS905 family transposase	A0A0N9STL0	Staphylococcus_phage	5.5e-32	31.9
WP_011835093.1\|1315338_1315959_-	ECF transporter S component	NA	NA	NA	NA
WP_011676202.1\|1316308_1317028_-	rRNA pseudouridine synthase	NA	NA	NA	NA
WP_011676203.1\|1317014_1317581_-	segregation/condensation protein B	A0A1B1IVT7	uncultured_Mediterranean_phage	9.5e-14	34.4
WP_011676204.1\|1317573_1318302_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	4.5e-08	35.5
WP_014572682.1\|1318332_1319049_-	site-specific tyrosine recombinase XerD	NA	NA	NA	NA
WP_011676206.1\|1319026_1319488_-	CBS domain-containing protein	NA	NA	NA	NA
WP_011676207.1\|1319518_1320022_-	metallophosphoesterase	NA	NA	NA	NA
WP_014572683.1\|1320060_1320666_-	nucleoside-triphosphate diphosphatase	NA	NA	NA	NA
WP_011676209.1\|1320666_1321482_-	glutamate racemase	NA	NA	NA	NA
WP_003130191.1\|1321657_1321897_-	YneF family protein	NA	NA	NA	NA
WP_032950140.1\|1322047_1323307_-	diaminopimelate decarboxylase	NA	NA	NA	NA
WP_014572686.1\|1323421_1324861_-	glutamate synthase subunit beta	NA	NA	NA	NA
WP_032950142.1\|1324860_1329330_-	glutamate synthase large subunit	NA	NA	NA	NA
WP_021165321.1\|1329498_1330110_+	sugar O-acetyltransferase	NA	NA	NA	NA
WP_011676214.1\|1330142_1331165_-	branched-chain amino acid aminotransferase	NA	NA	NA	NA
WP_021165320.1\|1331324_1332080_+	mechanosensitive ion channel	NA	NA	NA	NA
WP_032950144.1\|1335119_1336010_-	Rgg/GadR/MutR family transcriptional regulator	NA	NA	NA	NA
WP_081196121.1\|1336487_1337198_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_12

1341349 : 1415013

Bacillus_phage(27.27%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003138385.1\|1341349_1342525_-\|transposase	IS256-like element IS905 family transposase	A0A0N9STL0	Staphylococcus_phage	2.5e-32	32.3
WP_032950154.1\|1342670_1345811_-	SMC family ATPase	NA	NA	NA	NA
WP_032950156.1\|1345813_1346986_-	exonuclease SbcCD subunit D	NA	NA	NA	NA
WP_011676318.1\|1347131_1348070_-	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_011676319.1\|1348267_1348642_-	Spx/MgsR family RNA polymerase-binding regulatory protein	NA	NA	NA	NA
WP_081196122.1\|1348840_1349731_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_003130410.1\|1349837_1350785_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	3.4e-32	33.0
WP_153041291.1\|1351565_1352676_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	1.2e-49	41.4
WP_063280718.1\|1352687_1355504_-	LPXTG cell wall anchor domain-containing protein	Q9MCC0	Lactococcus_phage	6.6e-07	48.2
WP_011676322.1\|1355836_1356280_-	hypothetical protein	NA	NA	NA	NA
WP_021165422.1\|1356584_1358207_+	fibronectin/fibrinogen-binding protein	Q84500	Paramecium_bursaria_Chlorella_virus	7.2e-06	32.1
WP_021165423.1\|1358248_1359064_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_014572714.1\|1359245_1360766_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.8e-20	32.5
WP_014572715.1\|1360758_1361853_+	ABC transporter permease	NA	NA	NA	NA
WP_011676327.1\|1361849_1362803_+	ABC transporter permease	NA	NA	NA	NA
WP_161631171.1\|1362918_1363899_-	L-lactate dehydrogenase	NA	NA	NA	NA
WP_021165427.1\|1364013_1365522_-	pyruvate kinase	NA	NA	NA	NA
WP_032950160.1\|1365609_1366632_-	6-phosphofructokinase	NA	NA	NA	NA
WP_032950161.1\|1367019_1368168_-	N-acetylglucosamine-6-phosphate deacetylase	NA	NA	NA	NA
WP_011676330.1\|1368338_1369517_-	toxic anion resistance protein	A0A291I9K4	Lactobacillus_phage	1.5e-37	28.8
WP_011835023.1\|1369658_1370285_-	XpaC-like protein	NA	NA	NA	NA
WP_011835022.1\|1370475_1371504_+	NAD(P)H-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_021165431.1\|1371545_1372487_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.4e-78	51.9
WP_063280719.1\|1372557_1372965_+	NusG domain II-containing protein	NA	NA	NA	NA
WP_032950163.1\|1372961_1373492_+	heptaprenyl diphosphate synthase	NA	NA	NA	NA
WP_021165432.1\|1373482_1374442_+	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_014572720.1\|1374438_1375155_+	16S rRNA (guanine(527)-N(7))-methyltransferase RsmG	NA	NA	NA	NA
WP_021165433.1\|1375163_1375622_-	hypothetical protein	NA	NA	NA	NA
WP_011676339.1\|1375623_1376337_-	orotidine-5'-phosphate decarboxylase	NA	NA	NA	NA
WP_015082533.1\|1376466_1377402_-	dihydroorotate dehydrogenase	NA	NA	NA	NA
WP_014572723.1\|1377632_1378421_-	dihydroorotate dehydrogenase electron transfer subunit	NA	NA	NA	NA
WP_032950165.1\|1378670_1380035_-	MFS transporter	NA	NA	NA	NA
WP_032950167.1\|1380231_1380948_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_153041292.1\|1381699_1382809_+\|transposase	IS3-like element IS981 family transposase	A0A1P8CWQ3	Bacillus_phage	4.7e-49	41.1
WP_032950174.1\|1383681_1384422_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_011676346.1\|1384422_1384968_-	hypothetical protein	NA	NA	NA	NA
WP_011676347.1\|1384964_1385801_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_011676348.1\|1385800_1386754_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_032950176.1\|1386791_1388111_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_011676350.1\|1388223_1389153_-	hypothetical protein	NA	NA	NA	NA
WP_081196124.1\|1389253_1390192_+	prolyl oligopeptidase family serine peptidase	NA	NA	NA	NA
WP_032950194.1\|1390358_1391570_+	virion core protein	NA	NA	NA	NA
WP_032950178.1\|1391778_1392930_+	ATP-binding protein	NA	NA	NA	NA
WP_011676353.1\|1392926_1393712_+	hypothetical protein	NA	NA	NA	NA
WP_011676354.1\|1393746_1394280_-	rRNA large subunit pseudouridine synthase E	NA	NA	NA	NA
WP_014572735.1\|1394579_1396097_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_014572736.1\|1396149_1397727_+	glycerol-3-phosphate dehydrogenase/oxidase	NA	NA	NA	NA
WP_011676357.1\|1397745_1398474_+	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	6.9e-33	32.6
WP_011676358.1\|1398531_1398738_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_032950184.1\|1398734_1399694_-	DUF916 and DUF3324 domain-containing protein	NA	NA	NA	NA
WP_014572741.1\|1399772_1400585_-	WxL domain-containing protein	NA	NA	NA	NA
WP_011676366.1\|1402420_1403002_-	hypothetical protein	NA	NA	NA	NA
WP_014572744.1\|1403200_1406395_-	carbamoyl-phosphate synthase large subunit	NA	NA	NA	NA
WP_011676368.1\|1406744_1407218_-	glutathione peroxidase	NA	NA	NA	NA
WP_032950186.1\|1408116_1410750_-	calcium-translocating P-type ATPase, PMCA-type	M1HX51	Paramecium_bursaria_Chlorella_virus	7.6e-90	30.8
WP_014572748.1\|1411007_1411730_-	epoxyqueuosine reductase QueH	NA	NA	NA	NA
WP_032950188.1\|1411952_1412381_-	hypothetical protein	NA	NA	NA	NA
WP_063280541.1\|1413619_1414057_-	hypothetical protein	NA	NA	NA	NA
WP_081196125.1\|1414122_1415013_-\|transposase	IS982 family transposase	NA	NA	NA	NA

DBSCAN-SWA_13

1535027 : 1608630

Staphylococcus_phage(33.33%)

bacteriocin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031559015.1\|1535027_1535963_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5
WP_032949753.1\|1536206_1537559_+	aspartate kinase	NA	NA	NA	NA
WP_011675710.1\|1537595_1539107_-	flotillin family protein	NA	NA	NA	NA
WP_031559015.1\|1539259_1540195_+\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5
WP_032949752.1\|1540242_1540587_-	hypothetical protein	NA	NA	NA	NA
WP_011675708.1\|1540673_1542062_-	Cof-type HAD-IIB family hydrolase	A0A0N9SIY2	Staphylococcus_phage	5.3e-26	41.8
WP_032949751.1\|1542256_1543225_+	asparaginase	NA	NA	NA	NA
WP_032949750.1\|1543265_1543658_+	hypothetical protein	NA	NA	NA	NA
WP_011675705.1\|1543671_1544595_-	bifunctional oligoribonuclease/PAP phosphatase NrnA	NA	NA	NA	NA
WP_021166147.1\|1544689_1545970_-	CBS domain-containing protein	NA	NA	NA	NA
WP_011835598.1\|1545976_1546558_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_032949748.1\|1546823_1547963_+	isochorismate synthase	NA	NA	NA	NA
WP_081196129.1\|1548004_1549669_+	2-succinyl-5-enolpyruvyl-6-hydroxy-3- cyclohexene-1-carboxylic-acid synthase	NA	NA	NA	NA
WP_014572947.1\|1549658_1550474_+	2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase	NA	NA	NA	NA
WP_011675699.1\|1550862_1551705_+	1,4-dihydroxy-2-naphthoyl-CoA synthase	NA	NA	NA	NA
WP_032949742.1\|1551862_1553218_+	o-succinylbenzoate--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	2.7e-59	32.6
WP_011675697.1\|1553214_1554327_+	o-succinylbenzoate synthase	NA	NA	NA	NA
WP_011675695.1\|1554712_1555123_+	PaaI family thioesterase	NA	NA	NA	NA
WP_031298996.1\|1555130_1556138_-	LacI family transcriptional regulator	NA	NA	NA	NA
WP_050574209.1\|1558445_1559087_-	YesL family protein	NA	NA	NA	NA
WP_032949740.1\|1559164_1560727_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_081196130.1\|1561469_1562360_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_050595584.1\|1562710_1563661_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_032950572.1\|1564645_1565620_-	D-ribose ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_081196131.1\|1566577_1568056_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	5.9e-15	30.1
WP_011834764.1\|1568074_1568473_-	D-ribose pyranase	NA	NA	NA	NA
WP_032950566.1\|1569408_1570392_-	LacI family transcriptional regulator	NA	NA	NA	NA
WP_011676545.1\|1570526_1571822_-	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	2.0e-19	33.8
WP_011676546.1\|1572036_1572726_-	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	1.9e-48	46.2
WP_011676547.1\|1572998_1573202_-	DUF2969 family protein	NA	NA	NA	NA
WP_032950564.1\|1573443_1573758_-	thioredoxin	A0A1J0GW78	Streptomyces_phage	4.3e-16	44.2
WP_032950563.1\|1573854_1576185_-	endonuclease MutS2	Q94M10	Lactobacillus_phage	1.2e-14	55.4
WP_011676550.1\|1576228_1576789_-	CvpA family protein	NA	NA	NA	NA
WP_011676551.1\|1577097_1578063_-	NAD(P)/FAD-dependent oxidoreductase	A0A249XZT7	Enterococcus_phage	1.7e-18	27.9
WP_032950561.1\|1578196_1579195_-	catabolite control protein A	NA	NA	NA	NA
WP_032950559.1\|1579408_1580497_+	aminopeptidase P family protein	NA	NA	NA	NA
WP_011676555.1\|1580600_1582610_-	hypothetical protein	NA	NA	NA	NA
WP_021165574.1\|1582791_1583946_-	class I SAM-dependent RNA methyltransferase	NA	NA	NA	NA
WP_011676557.1\|1584581_1584968_-	cell division regulator GpsB	NA	NA	NA	NA
WP_011676558.1\|1585021_1586026_-	DNA polymerase III subunit delta	NA	NA	NA	NA
WP_011676559.1\|1586027_1586606_-	hypothetical protein	NA	NA	NA	NA
WP_021165576.1\|1586602_1588870_-	DNA translocase FtsK	S5VNE3	Mycobacterium_phage	1.6e-80	48.0
WP_032950557.1\|1589061_1589847_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_011676562.1\|1589886_1590279_-	hypothetical protein	NA	NA	NA	NA
WP_015082685.1\|1590416_1591397_-	phosphate acetyltransferase	NA	NA	NA	NA
WP_011676564.1\|1591612_1592233_-	uridine kinase	A0A1V0SAA3	Catovirus	5.3e-34	40.9
WP_011676565.1\|1592529_1593510_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_021165578.1\|1593775_1594375_-	transglycosylase	E0YIP1	Lactococcus_phage	3.9e-26	53.9
WP_014572273.1\|1595045_1596005_+	1,4-dihydroxy-2-naphthoate polyprenyltransferase	NA	NA	NA	NA
WP_011676568.1\|1596029_1597568_-	ClC family H(+)/Cl(-) exchange transporter	NA	NA	NA	NA
WP_014572271.1\|1597735_1597969_-	hypothetical protein	NA	NA	NA	NA
WP_032950547.1\|1598340_1598655_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_014572269.1\|1598672_1598861_-\|bacteriocin	lactococcin family bacteriocin	NA	NA	NA	NA
WP_011676573.1\|1599187_1600021_-	Rgg/GadR/MutR family transcriptional regulator	NA	NA	NA	NA
WP_011676574.1\|1600057_1600798_-	demethylmenaquinone methyltransferase	NA	NA	NA	NA
WP_081196132.1\|1600896_1603362_-	YhgE/Pip domain-containing protein	NA	NA	NA	NA
WP_061777731.1\|1603622_1605056_-	6-phospho-beta-glucosidase	NA	NA	NA	NA
WP_011676678.1\|1605174_1605447_-	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	1.5e-17	55.1
WP_032950539.1\|1605567_1607310_-	1-deoxy-D-xylulose-5-phosphate synthase	NA	NA	NA	NA
WP_003138385.1\|1607454_1608630_+\|transposase	IS256-like element IS905 family transposase	A0A0N9STL0	Staphylococcus_phage	2.5e-32	32.3

DBSCAN-SWA_14

1779346 : 1877343

Lactococcus_phage(44.44%)

capsid,protease,transposase,head,tRNA,holin,terminase,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011675620.1\|1779346_1780237_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_015082786.1\|1780928_1781615_-	HAD family hydrolase	NA	NA	NA	NA
WP_021165694.1\|1781784_1783662_-\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG	NA	NA	NA	NA
WP_011676860.1\|1784045_1784609_-	hypothetical protein	NA	NA	NA	NA
WP_011835756.1\|1784741_1785110_-	DUF1033 family protein	NA	NA	NA	NA
WP_011676862.1\|1785224_1785626_-	Mini-ribonuclease 3	NA	NA	NA	NA
WP_021211905.1\|1785618_1786965_-\|tRNA	cysteine--tRNA ligase	A0A2L2DK39	Acanthamoeba_polyphaga_mimivirus	1.0e-50	30.7
WP_021165696.1\|1786977_1787571_-	DUF1211 domain-containing protein	NA	NA	NA	NA
WP_021165697.1\|1787584_1788184_-	serine O-acetyltransferase	NA	NA	NA	NA
WP_032950401.1\|1788289_1789060_-	hypothetical protein	NA	NA	NA	NA
WP_011676867.1\|1789328_1791638_-	polyribonucleotide nucleotidyltransferase	NA	NA	NA	NA
WP_021165699.1\|1791918_1793064_-	hypothetical protein	NA	NA	NA	NA
WP_031559015.1\|1793332_1794268_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5
WP_032950399.1\|1794503_1795469_+	ribose-phosphate diphosphokinase	A0A2K9L2G2	Tupanvirus	4.0e-36	32.5
WP_011676870.1\|1795573_1796005_-	universal stress protein	NA	NA	NA	NA
WP_032950393.1\|1796304_1797429_+	cysteine desulfurase	A0A1X7C038	Faustovirus	2.7e-28	28.4
WP_014572106.1\|1797454_1797799_+	DUF1831 domain-containing protein	NA	NA	NA	NA
WP_003132374.1\|1797887_1799075_-	elongation factor Tu	A0A076FFS6	Aureococcus_anophage	2.0e-34	29.4
WP_021165701.1\|1799318_1799501_+	hypothetical protein	NA	NA	NA	NA
WP_011835767.1\|1799559_1799676_+	DUF4044 domain-containing protein	NA	NA	NA	NA
WP_032950391.1\|1799735_1802534_-\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	2.5e-83	26.1
WP_021165703.1\|1802983_1803919_-	DivIVA domain-containing protein	NA	NA	NA	NA
WP_011676876.1\|1803975_1804767_-	RNA-binding protein	NA	NA	NA	NA
WP_011676877.1\|1804763_1805039_-	YggT family protein	NA	NA	NA	NA
WP_014572100.1\|1805038_1805629_-	cell division protein SepF	NA	NA	NA	NA
WP_021165705.1\|1805662_1806340_-	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_021213780.1\|1806343_1807597_-	cell division protein FtsZ	NA	NA	NA	NA
WP_032950387.1\|1807626_1808997_-	cell division protein FtsA	NA	NA	NA	NA
WP_032950385.1\|1809158_1810028_-	DegV family protein	A0A0N9SI50	Staphylococcus_phage	4.2e-13	33.8
WP_014572097.1\|1810144_1810873_-	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	A0A2D1A6G0	Rhodococcus_phage	4.6e-05	27.7
WP_081196172.1\|1811065_1811956_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_014572095.1\|1812032_1813145_-	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_032950380.1\|1813282_1814128_-	aldo/keto reductase	A0A1V0SDE7	Indivirus	2.3e-32	33.7
WP_032950378.1\|1814139_1815465_-	MFS transporter	NA	NA	NA	NA
WP_032950376.1\|1816957_1818268_-	aminopeptidase C	R4TV59	Phaeocystis_globosa_virus	4.4e-62	31.5
WP_050595596.1\|1818438_1819071_-	HD domain-containing protein	NA	NA	NA	NA
WP_014572089.1\|1819088_1819592_-	hypothetical protein	NA	NA	NA	NA
WP_011676892.1\|1819728_1820409_-	5'-methylthioadenosine/adenosylhomocysteine nucleosidase	NA	NA	NA	NA
WP_011676893.1\|1820436_1820715_-	hypothetical protein	NA	NA	NA	NA
WP_011835788.1\|1820707_1821292_-	NUDIX hydrolase	NA	NA	NA	NA
WP_032950374.1\|1821393_1822770_-	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A0G2Y8M0	Acanthamoeba_polyphaga_mimivirus	5.5e-31	35.7
WP_032950372.1\|1822987_1823779_+	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	1.4e-31	33.2
WP_010906184.1\|1823862_1824132_-	30S ribosomal protein S15	NA	NA	NA	NA
WP_032950368.1\|1824302_1826180_-	Stk1 family PASTA domain-containing Ser/Thr kinase	A0A1V0SDC3	Indivirus	9.8e-23	32.4
WP_011676898.1\|1826179_1826956_-	Stp1/IreP family PP2C-type Ser/Thr phosphatase	NA	NA	NA	NA
WP_011676899.1\|1827078_1828353_-	16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB	NA	NA	NA	NA
WP_031286545.1\|1828856_1829795_-	glycosyltransferase family 2 protein	V9QJB1	Oenococcus_phage	7.9e-82	50.6
WP_003138385.1\|1831424_1832600_-\|transposase	IS256-like element IS905 family transposase	A0A0N9STL0	Staphylococcus_phage	2.5e-32	32.3
WP_014571872.1\|1832815_1833385_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_161940335.1\|1833471_1833696_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.4e-05	46.6
WP_081196084.1\|1833768_1834659_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_081196140.1\|1834718_1835207_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.6e-33	47.5
WP_032950357.1\|1835280_1836348_-\|holin	phage holin	A0A1P8BKR7	Lactococcus_phage	3.3e-124	97.3
WP_032950355.1\|1836360_1836588_-\|holin	holin	Q9AZR4	Lactococcus_phage	2.6e-31	95.8
WP_021212325.1\|1836600_1836837_-	hypothetical protein	A0A1P8BKU6	Lactococcus_phage	4.2e-32	93.6
WP_080683436.1\|1839009_1841208_-	tape measure protein	Q9AZL5	Lactococcus_phage	4.4e-285	92.7
WP_021166226.1\|1841189_1841360_-	hypothetical protein	NA	NA	NA	NA
WP_021166227.1\|1841377_1841722_-	hypothetical protein	Q9AZL6	Lactococcus_phage	1.6e-27	98.2
WP_032950354.1\|1841781_1842387_-	small major structural protein	Q9AZL7	Lactococcus_phage	9.9e-102	93.5
WP_010905383.1\|1842388_1842784_-	DUF806 family protein	Q9AZL8	Lactococcus_phage	1.4e-67	100.0
WP_032950353.1\|1842780_1843266_-	HK97 gp10 family phage protein	Q9AZL9	Lactococcus_phage	4.8e-83	98.1
WP_021166229.1\|1843262_1843598_-\|head	phage head closure protein	Q9AZM0	Lactococcus_phage	1.4e-52	94.6
WP_021166230.1\|1843584_1843890_-	hypothetical protein	Q9AZM1	Lactococcus_phage	2.9e-49	97.0
WP_032950352.1\|1843900_1845214_-\|capsid	phage major capsid protein	Q9AZM2	Lactococcus_phage	4.1e-185	88.3
WP_032950351.1\|1845203_1845791_-\|head,protease	HK97 family phage prohead protease	Q9AZM3	Lactococcus_phage	1.7e-106	99.5
WP_050595595.1\|1845790_1846870_-\|portal	phage portal protein	Q9AZM4	Lactococcus_phage	6.7e-194	97.8
WP_032950350.1\|1847039_1848854_-\|terminase	terminase large subunit	Q9AZM6	Lactococcus_phage	0.0e+00	98.5
WP_014573149.1\|1848853_1849306_-\|terminase	phage terminase small subunit P27 family	Q9AZM7	Lactococcus_phage	6.5e-82	99.3
WP_014573151.1\|1850148_1850571_-	DUF722 domain-containing protein	Q9AYX5	Lactococcus_phage	5.5e-75	100.0
WP_153041295.1\|1850650_1851762_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	1.2e-49	41.4
WP_063280716.1\|1851782_1851965_-	hypothetical protein	NA	NA	NA	NA
WP_032950879.1\|1851961_1852450_-	hypothetical protein	NA	NA	NA	NA
WP_011675518.1\|1852452_1852851_-	DUF4288 domain-containing protein	NA	NA	NA	NA
WP_032950880.1\|1852831_1853689_-	hypothetical protein	NA	NA	NA	NA
WP_011675516.1\|1853900_1855508_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.6e-130	44.9
WP_011675514.1\|1856920_1857463_-	TIGR01440 family protein	NA	NA	NA	NA
WP_050595603.1\|1857443_1857944_-	thiamine transporter	NA	NA	NA	NA
WP_032950882.1\|1857983_1858772_-	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_011675511.1\|1858805_1859567_-\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
WP_032950883.1\|1859967_1861347_-	LCP family protein	NA	NA	NA	NA
WP_032950885.1\|1861451_1861970_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_011675508.1\|1861966_1862413_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_011675507.1\|1862571_1863270_-	hypothetical protein	NA	NA	NA	NA
WP_021165922.1\|1863381_1864149_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_021165921.1\|1864206_1864872_-	beta-phosphoglucomutase	A7ITQ4	Paramecium_bursaria_Chlorella_virus	4.7e-12	29.2
WP_032950887.1\|1865024_1867334_-	glycoside hydrolase family 65 protein	NA	NA	NA	NA
WP_032950889.1\|1867400_1868966_-	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_081196142.1\|1869113_1870004_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_081196143.1\|1870128_1870506_-	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_014572071.1\|1872232_1872949_+	trehalose operon repressor	NA	NA	NA	NA
WP_021165919.1\|1873022_1874381_-	phosphoglucosamine mutase	NA	NA	NA	NA
WP_021212832.1\|1874425_1875385_-	hypothetical protein	NA	NA	NA	NA
WP_011675498.1\|1875374_1876253_-	TIGR00159 family protein	NA	NA	NA	NA
WP_081196113.1\|1876452_1877343_+\|transposase	IS982 family transposase	NA	NA	NA	NA

DBSCAN-SWA_15

1903407 : 1960117

unidentified_phage(18.18%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003130410.1\|1903407_1904355_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	3.4e-32	33.0
WP_014572053.1\|1904584_1905517_+	mevalonate kinase	NA	NA	NA	NA
WP_015082048.1\|1905647_1906148_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_011675476.1\|1906279_1907209_+	daunorubicin resistance protein DrrA family ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	6.3e-23	28.1
WP_014572051.1\|1907221_1908031_+	ABC transporter permease	NA	NA	NA	NA
WP_032950911.1\|1908105_1908297_+	hypothetical protein	NA	NA	NA	NA
WP_031559015.1\|1908357_1909293_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5
WP_032950912.1\|1909450_1910326_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	2.7e-100	66.1
WP_011675472.1\|1910325_1910652_-	DNA replication initiation control protein YabA	NA	NA	NA	NA
WP_011834464.1\|1910644_1911427_-	stage 0 sporulation family protein	NA	NA	NA	NA
WP_011675470.1\|1911476_1912337_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	3.1e-64	44.8
WP_015082045.1\|1912468_1913104_-	dTMP kinase	M1PSC7	Streptococcus_phage	1.6e-73	66.0
WP_003131580.1\|1913281_1913983_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.2e-42	39.7
WP_011675468.1\|1913975_1915403_+	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	3.9e-32	32.9
WP_011675466.1\|1915592_1916405_+	MBL fold metallo-hydrolase	A0A0C5AJ83	Bacteriophage	1.5e-33	38.1
WP_032950921.1\|1916456_1918085_-	chaperonin GroEL	A0A219YK78	uncultured_virus	4.9e-156	56.6
WP_011675464.1\|1918171_1918456_-	co-chaperone GroES	A0A221S386	uncultured_virus	2.3e-13	43.0
WP_021165898.1\|1918574_1918964_-	single-stranded DNA-binding protein	A0A218MNB4	uncultured_virus	2.0e-23	47.4
WP_032950924.1\|1919054_1920395_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_011675461.1\|1920556_1921183_-\|tRNA	DUF4479 and tRNA-binding domain-containing protein	NA	NA	NA	NA
WP_011675460.1\|1921288_1921606_-	thioredoxin family protein	A0A0K2FIM3	Achromobacter_phage	9.0e-06	31.9
WP_011675459.1\|1921650_1921935_-	hypothetical protein	NA	NA	NA	NA
WP_021165896.1\|1922037_1923105_+	glutamyl aminopeptidase	NA	NA	NA	NA
WP_021165895.1\|1923143_1925582_-	penicillin-binding protein	NA	NA	NA	NA
WP_011675456.1\|1925726_1926986_+\|tRNA	tyrosine--tRNA ligase	A0A1S6UA79	Serratia_phage	1.6e-77	42.9
WP_032950928.1\|1927110_1927581_+	hypothetical protein	NA	NA	NA	NA
WP_021165893.1\|1927670_1929713_+	sodium:proton antiporter	NA	NA	NA	NA
WP_011675453.1\|1929768_1930203_-	OsmC family protein	NA	NA	NA	NA
WP_011675452.1\|1930300_1930906_-	FMN-dependent NADH-azoreductase	NA	NA	NA	NA
WP_032950930.1\|1932684_1933905_-\|tRNA	tRNA 4-thiouridine(8) synthase ThiI	NA	NA	NA	NA
WP_032950931.1\|1934261_1935236_-	TDT family transporter	NA	NA	NA	NA
WP_081196146.1\|1935397_1936288_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_063282446.1\|1936397_1937240_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_031559015.1\|1937236_1938172_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5
WP_003138385.1\|1938535_1939711_+\|transposase	IS256-like element IS905 family transposase	A0A0N9STL0	Staphylococcus_phage	2.5e-32	32.3
WP_032950938.1\|1939929_1940874_+	L-lactate dehydrogenase	NA	NA	NA	NA
WP_050595604.1\|1941091_1942132_-	YeiH family protein	NA	NA	NA	NA
WP_003130410.1\|1942255_1943203_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	3.4e-32	33.0
WP_050574203.1\|1944377_1945832_+\|tRNA	lysine--tRNA ligase	A0A2K9L3L6	Tupanvirus	3.0e-88	38.6
WP_021165888.1\|1947320_1948298_-	FAD:protein FMN transferase	NA	NA	NA	NA
WP_011675441.1\|1948294_1949098_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	8.1e-43	47.8
WP_003138385.1\|1949229_1950405_-\|transposase	IS256-like element IS905 family transposase	A0A0N9STL0	Staphylococcus_phage	2.5e-32	32.3
WP_032950945.1\|1950578_1952012_-	amino acid permease	NA	NA	NA	NA
WP_011675439.1\|1952321_1953155_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_015082027.1\|1953198_1954080_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_011675422.1\|1954079_1954892_-	NAD kinase	NA	NA	NA	NA
WP_021165882.1\|1954878_1955538_-	GTP pyrophosphokinase family protein	F8K9M7	Nitrososphaera_phage	1.0e-06	29.1
WP_032950948.1\|1955726_1956533_-	DUF817 domain-containing protein	NA	NA	NA	NA
WP_011834433.1\|1956752_1957346_+	CYTH domain-containing protein	NA	NA	NA	NA
WP_014572025.1\|1957409_1957928_-	hypothetical protein	NA	NA	NA	NA
WP_011834431.1\|1958152_1958476_-	DUF2129 domain-containing protein	NA	NA	NA	NA
WP_011675416.1\|1958450_1958831_-	hypothetical protein	NA	NA	NA	NA
WP_003138385.1\|1958941_1960117_-\|transposase	IS256-like element IS905 family transposase	A0A0N9STL0	Staphylococcus_phage	2.5e-32	32.3

DBSCAN-SWA_16

2191857 : 2255584

uncultured_Mediterranean_phage(33.33%)

protease,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011675227.1\|2191857_2192550_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_021036584.1\|2192539_2193073_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_011675226.1\|2193191_2193389_+	cold-shock protein	Q9AZD3	Lactococcus_phage	3.5e-24	83.1
WP_011675225.1\|2193569_2194910_+	MATE family efflux transporter	NA	NA	NA	NA
WP_032950734.1\|2194975_2196475_-	amidase	NA	NA	NA	NA
WP_011675223.1\|2196598_2198032_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_014571887.1\|2198056_2199517_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_011675221.1\|2199516_2199822_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_011834262.1\|2200099_2200888_-	GTP-sensing pleiotropic transcriptional regulator CodY	NA	NA	NA	NA
WP_011675219.1\|2201040_2202255_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_032950732.1\|2202384_2203965_-	glycosyl transferase	NA	NA	NA	NA
WP_011675217.1\|2204162_2204402_-	hypothetical protein	NA	NA	NA	NA
WP_032950730.1\|2204413_2204623_-	hypothetical protein	NA	NA	NA	NA
WP_014571883.1\|2204791_2205577_-	DNAse	NA	NA	NA	NA
WP_011675214.1\|2205713_2206151_+	CoA-binding protein	NA	NA	NA	NA
WP_021166017.1\|2207565_2208255_-	DUF975 family protein	NA	NA	NA	NA
WP_011675211.1\|2208454_2209603_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.4e-85	42.9
WP_011675210.1\|2209891_2210206_-	helix-turn-helix transcriptional regulator	A0A1S5SC02	Streptococcus_phage	2.8e-07	40.0
WP_081196155.1\|2210317_2213059_-	hypothetical protein	NA	NA	NA	NA
WP_081196174.1\|2213165_2213810_-	WxL domain-containing protein	NA	NA	NA	NA
WP_011675205.1\|2213924_2214245_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_011675204.1\|2214259_2215390_-	DUF916 and DUF3324 domain-containing protein	NA	NA	NA	NA
WP_011675203.1\|2215547_2215691_-	hypothetical protein	NA	NA	NA	NA
WP_031559015.1\|2216814_2217750_+\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5
WP_081196156.1\|2217753_2217927_-	DNA alkylation repair protein	NA	NA	NA	NA
WP_021164969.1\|2217944_2218424_-	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
WP_021164968.1\|2218799_2220023_+\|protease	serine protease	A0A1B1IRD3	uncultured_Mediterranean_phage	2.4e-06	25.8
WP_032951305.1\|2220144_2221143_+	glycosyltransferase	NA	NA	NA	NA
WP_014573350.1\|2221280_2222621_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_011677198.1\|2222728_2222953_+	YkuJ family protein	NA	NA	NA	NA
WP_021164965.1\|2223096_2224101_+	hypothetical protein	NA	NA	NA	NA
WP_021164964.1\|2224157_2224910_-\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
WP_021164963.1\|2225117_2227751_-	DNA polymerase I	A0A218MKQ4	uncultured_virus	2.2e-57	31.3
WP_031559015.1\|2227843_2228779_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5
WP_032951307.1\|2229896_2230502_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_015082943.1\|2236196_2236688_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_011677205.1\|2236951_2238682_-	septation ring formation regulator EzrA	NA	NA	NA	NA
WP_011677206.1\|2238886_2239915_-	elongation factor Ts	NA	NA	NA	NA
WP_032951471.1\|2240036_2240804_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_032951472.1\|2241198_2242224_+	lactonase family protein	NA	NA	NA	NA
WP_032951473.1\|2242478_2245190_+	bifunctional acetaldehyde-CoA/alcohol dehydrogenase	NA	NA	NA	NA
WP_032951474.1\|2245653_2246151_-	hypothetical protein	NA	NA	NA	NA
WP_011677212.1\|2246137_2246347_-	hypothetical protein	NA	NA	NA	NA
WP_081196119.1\|2246633_2247524_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_014573366.1\|2247630_2248950_-	KxxxW cyclic peptide radical SAM maturase	NA	NA	NA	NA
WP_011836076.1\|2249017_2249131_-	KxxxW-cyclized peptide pheromone	NA	NA	NA	NA
WP_011677213.1\|2249448_2250480_-	PDZ domain-containing protein	NA	NA	NA	NA
WP_011677214.1\|2250463_2250964_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	2.0e-15	32.1
WP_031286167.1\|2251011_2251551_-	16S rRNA (guanine(966)-N(2))-methyltransferase RsmD	NA	NA	NA	NA
WP_011677216.1\|2251721_2252942_-	MFS transporter	NA	NA	NA	NA
WP_003138385.1\|2254408_2255584_+\|transposase	IS256-like element IS905 family transposase	A0A0N9STL0	Staphylococcus_phage	2.5e-32	32.3

DBSCAN-SWA_17

2322764 : 2378870

Lactococcus_phage(12.5%)

protease,tRNA,integrase,transposase

attL 2364740:2364757|attR 2380637:2380654

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081196084.1\|2322764_2323655_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_032951377.1\|2323778_2324648_-	rod shape-determining protein MreC	NA	NA	NA	NA
WP_014573430.1\|2324939_2325380_+	NUDIX hydrolase	NA	NA	NA	NA
WP_011677274.1\|2325404_2326079_-	ribose-5-phosphate isomerase RpiA	NA	NA	NA	NA
WP_011836134.1\|2326162_2326846_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_021212104.1\|2326947_2328153_-	MFS transporter	NA	NA	NA	NA
WP_011677277.1\|2328215_2328653_-	universal stress protein	NA	NA	NA	NA
WP_011677278.1\|2328672_2328876_-	hypothetical protein	NA	NA	NA	NA
WP_080683465.1\|2329101_2333412_-	2-hydroxyacyl-CoA dehydratase	NA	NA	NA	NA
WP_014573433.1\|2333822_2334437_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_021164812.1\|2334520_2335249_-	rRNA pseudouridine synthase	NA	NA	NA	NA
WP_014573435.1\|2335479_2336115_-	hypothetical protein	A0A1W6JNE9	Lactococcus_phage	5.2e-61	53.3
WP_021164811.1\|2336413_2337781_+\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE	NA	NA	NA	NA
WP_081196084.1\|2338428_2339319_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_063280661.1\|2340029_2341874_-	hypothetical protein	NA	NA	NA	NA
WP_032951371.1\|2342107_2342947_-	Rgg/GadR/MutR family transcriptional regulator	NA	NA	NA	NA
WP_032951370.1\|2343025_2343763_-	hypothetical protein	NA	NA	NA	NA
WP_021213390.1\|2343762_2345763_-	ATP-dependent DNA helicase RecG	B2CRJ8	Acidianus_filamentous_virus	2.1e-07	23.7
WP_015082981.1\|2345901_2346246_-	alkylphosphonate utilization protein	NA	NA	NA	NA
WP_011677291.1\|2346313_2347324_-	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_032951369.1\|2347600_2348113_-	DUF536 domain-containing protein	NA	NA	NA	NA
WP_032951368.1\|2348250_2350944_+	cation-translocating P-type ATPase	M1IAU8	Acanthocystis_turfacea_Chlorella_virus	2.8e-71	29.6
WP_032951367.1\|2350985_2351513_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_011677295.1\|2351637_2352657_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_031559015.1\|2353081_2354017_+\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.5e-37	36.5
WP_032951365.1\|2354204_2354738_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_032951364.1\|2354761_2355217_+	hypothetical protein	NA	NA	NA	NA
WP_081196158.1\|2361621_2362719_-	restriction endonuclease	NA	NA	NA	NA
WP_063280665.1\|2362715_2363615_-	adenine-specific DNA-methyltransferase	S0A0D5	Cellulophaga_phage	1.9e-24	33.2
WP_081196159.1\|2363741_2364938_-	ATP-binding protein	NA	NA	NA	NA
2364740:2364757	attL	NA	NA	NA	NA
WP_063280664.1\|2365049_2366276_-	hypothetical protein	NA	NA	NA	NA
WP_011677303.1\|2366445_2366727_+	hypothetical protein	NA	NA	NA	NA
WP_063280663.1\|2366749_2367091_+	hypothetical protein	NA	NA	NA	NA
WP_021213934.1\|2367341_2368436_+	hypothetical protein	NA	NA	NA	NA
WP_011677306.1\|2368713_2370204_+	ATPase AAA	NA	NA	NA	NA
WP_011677307.1\|2370437_2370629_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_011677308.1\|2370720_2371770_+\|integrase	site-specific integrase	O34032	Streptococcus_phage	1.3e-19	26.9
WP_004254378.1\|2371832_2372225_-	30S ribosomal protein S9	NA	NA	NA	NA
WP_010906417.1\|2372244_2372691_-	50S ribosomal protein L13	NA	NA	NA	NA
WP_014573446.1\|2373089_2374160_+	ABC transporter permease	NA	NA	NA	NA
WP_011677310.1\|2374175_2374847_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.5e-34	40.0
WP_032951517.1\|2374993_2375872_+	ribonuclease HIII	NA	NA	NA	NA
WP_032951516.1\|2375883_2376510_+	signal peptidase I	NA	NA	NA	NA
WP_011677314.1\|2376557_2377373_-	pur operon repressor	NA	NA	NA	NA
WP_003138385.1\|2377694_2378870_+\|transposase	IS256-like element IS905 family transposase	A0A0N9STL0	Staphylococcus_phage	2.5e-32	32.3
2380637:2380654	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP016746

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP015899

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection