CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP014843	Bacillus licheniformis strain SCDB 14 plasmid pSCDB14, complete sequence	0 crisprs	cas4	0	0	1	0
NZ_CP014842	Bacillus licheniformis strain SCDB 14 chromosome, complete genome	1 crisprs	csa3,DEDDh,cas3,DinG,WYL	0	1	5	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

32821 : 40709

Bacillus_phage(87.5%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080623724.1\|32821_33292_+	hypothetical protein	R4JKA5	Bacillus_phage	2.1e-22	67.1
WP_080623725.1\|33301_33511_+	hypothetical protein	NA	NA	NA	NA
WP_080623726.1\|33610_33802_+	hypothetical protein	A0A142F1P8	Bacillus_phage	4.7e-18	69.4
WP_080623728.1\|33922_34117_+	hypothetical protein	R4JF30	Bacillus_phage	6.7e-28	90.5
WP_080623729.1\|34113_34302_+	hypothetical protein	A0A0A0RMX5	Bacillus_phage	2.0e-13	62.7
WP_080623730.1\|34298_34505_+	hypothetical protein	NA	NA	NA	NA
WP_080623732.1\|34504_34729_+	hypothetical protein	NA	NA	NA	NA
WP_080623733.1\|34794_35004_+	hypothetical protein	NA	NA	NA	NA
WP_080623734.1\|35074_35491_+	hypothetical protein	NA	NA	NA	NA
WP_080623890.1\|35567_36719_+	AAA family ATPase	A0A172JHS6	Bacillus_phage	4.2e-69	41.9
WP_080623736.1\|36827_37187_+	hypothetical protein	NA	NA	NA	NA
WP_080623737.1\|37228_37522_+	hypothetical protein	S5MM68	Bacillus_phage	1.7e-06	46.5
WP_080623738.1\|37534_37813_+	hypothetical protein	NA	NA	NA	NA
WP_080623739.1\|37799_38159_+	hypothetical protein	NA	NA	NA	NA
WP_080623740.1\|38155_38341_+	hypothetical protein	NA	NA	NA	NA
WP_087635023.1\|38404_39112_+	single-stranded DNA-binding protein	A0A2H4J1P3	uncultured_Caudovirales_phage	7.0e-06	37.0
WP_080623743.1\|39169_39553_+	hypothetical protein	NA	NA	NA	NA
WP_080623745.1\|39533_40709_+	recombinase RecA	A0A0S2MVG1	Bacillus_phage	1.6e-68	42.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP014842

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP014842_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP014842_1

2016848-2016921

Unclear

Consensus_repeat	Method
TCCTTTTTGCAGTAATCGTAATCCTT	CRISPRCasFinder

1 spacers

cas3,DinG

The CRISPR arrays of NZ_CP014842_1

>merge|NZ_CP014842|1|2016848-2016921|CRISPRCasFinder
TCCTTTTTGCAGTAATCGTAATCCTTTTTGCAAGGCTTGTGGTAATCGTAGTCTTTTTTGTAATCCTCATCCTT

>NZ_CP014842|1|1|2016848-2016921|CRISPRCasFinder
TCCTTTTTGCAGTAATCGTAATCCTT	TTTGCAAGGCTTGTGGTAATCG
TAGTCTTTTTTGTAATCCTCATCCTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP014842.1\|WP_009328012.1\|2013972_2014524_+\|DUF1273-domain-containing-protein	unknown	unknown	gnl\|CDD\|237461
NZ_CP014842.1\|WP_003182854.1\|2029691_2029961_+\|YpbS-family-protein	unknown	unknown	gnl\|CDD\|313867
NZ_CP014842.1\|WP_003182875.1\|2013587_2013857_+\|spore-coat-protein-CotH	unknown	unknown	gnl\|CDD\|371387
NZ_CP014842.1\|WP_003182882.1\|2008091_2008535_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372950
NZ_CP014842.1\|WP_003182879.1\|2009148_2009655_+\|PTS-glucose-transporter-subunit-IIA	unknown	unknown	gnl\|CDD\|376324
NZ_CP014842.1\|WP_003182862.1\|2023549_2024101_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP014842.1\|WP_011198064.1\|2007711_2007912_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|290882
NZ_CP014842.1\|WP_003182859.1\|2025247_2025751_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224669
NZ_CP014842.1\|WP_009328017.1\|2024142_2025240_+\|chalcone-synthase	unknown	unknown	gnl\|CDD\|225958
NZ_CP014842.1\|WP_003182872.1\|2015435_2016587_+\|class-I-SAM-dependent-RNA-methyltransferase	unknown	unknown	gnl\|CDD\|223194
NZ_CP014842.1\|WP_080623597.1\|2017675_2019595_+\|ATP-dependent-DNA-helicase	DinG	COG1199_DinG_CAS-IV-A	gnl\|CDD\|224120
NZ_CP014842.1\|WP_003182864.1\|2022148_2023465_+\|purine-permease	unknown	unknown	gnl\|CDD\|274468
NZ_CP014842.1\|WP_009328010.1\|2009750_2012027_+\|DEAD/DEAH-box-helicase	cas3	mkCas0139_cas3_CAS-I	gnl\|CDD\|224126
NZ_CP014842.1\|WP_003182873.1\|2014604_2014901_+\|cell-division-regulator-GpsB	unknown	unknown	gnl\|CDD\|237616
NZ_CP014842.1\|WP_003182867.1\|2019705_2021211_+\|carboxypeptidase-M32	unknown	unknown	gnl\|CDD\|341054
NZ_CP014842.1\|WP_003182877.1\|2012032_2013346_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225895
NZ_CP014842.1\|WP_003182865.1\|2021567_2022152_+\|xanthine-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|181705
NZ_CP014842.1\|WP_003182880.1\|2008553_2008973_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223149
NZ_CP014842.1\|WP_003182857.1\|2025814_2025910_+\|Fur-regulated-basic-protein-FbpC	unknown	unknown	gnl\|CDD\|380216
NZ_CP014842.1\|WP_009328018.1\|2026053_2029617_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|206739

Protein	Function_ID	Function_description	E-value
NZ_CP014842.1\|WP_009328012.1\|2013972_2014524_+\|DUF1273-domain-containing-protein	gnl\|CDD\|237461	PRK13660, PRK13660, hypothetical protein; Provisional.	6.9834e-100
NZ_CP014842.1\|WP_003182854.1\|2029691_2029961_+\|YpbS-family-protein	gnl\|CDD\|313867	pfam10752, DUF2533, Protein of unknown function (DUF2533). This family of proteins with unknown function appears to be restricted to Bacillus spp.	1.35699e-40
NZ_CP014842.1\|WP_003182875.1\|2013587_2013857_+\|spore-coat-protein-CotH	gnl\|CDD\|371387	pfam11122, Spore-coat_CotD, Inner spore coat protein D. This family is conserved in the Enterobacteriaceae family. CotD is an inner spore coat protein that is expressed in the middle phase of mother cell gene expression. Along with CotD, CotH, CotS and CotT it is assumed to assemble into the loose skeleton of the matrix, between the shells of SpoIVA and CotE. Coat proteins do not share much sequence similarity between species, but this does not imply they do not share secondary, tertiary, or quaternary features.	5.84885e-11
NZ_CP014842.1\|WP_003182882.1\|2008091_2008535_+\|hypothetical-protein	gnl\|CDD\|372950	pfam14179, YppG, YppG-like protein. The YppG-like protein family includes the B. subtilis YppG protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 115 and 181 amino acids in length. There are two completely conserved residues (F and G) that may be functionally important.	1.37994e-16
NZ_CP014842.1\|WP_003182879.1\|2009148_2009655_+\|PTS-glucose-transporter-subunit-IIA	gnl\|CDD\|376324	pfam00358, PTS_EIIA_1, phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1.	4.10065e-68
NZ_CP014842.1\|WP_003182862.1\|2023549_2024101_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	7.35941e-15
NZ_CP014842.1\|WP_011198064.1\|2007711_2007912_-\|hypothetical-protein	gnl\|CDD\|290882	pfam14178, YppF, YppF-like protein. The YppF-like protein family includes the B. subtilis YppF protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 60 amino acids in length. There is a conserved LLDF sequence motif.	8.01632e-25
NZ_CP014842.1\|WP_003182859.1\|2025247_2025751_+\|hypothetical-protein	gnl\|CDD\|224669	COG1755, COG1755, Uncharacterized protein conserved in bacteria [Function unknown].	4.59386e-51
NZ_CP014842.1\|WP_009328017.1\|2024142_2025240_+\|chalcone-synthase	gnl\|CDD\|225958	COG3424, BcsA, Predicted naringenin-chalcone synthase [Secondary metabolites biosynthesis, transport, and catabolism].	2.01395e-153
NZ_CP014842.1\|WP_003182872.1\|2015435_2016587_+\|class-I-SAM-dependent-RNA-methyltransferase	gnl\|CDD\|223194	COG0116, COG0116, Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair].	0
NZ_CP014842.1\|WP_080623597.1\|2017675_2019595_+\|ATP-dependent-DNA-helicase	gnl\|CDD\|224120	COG1199, DinG, Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair].	8.37692e-126
NZ_CP014842.1\|WP_003182864.1\|2022148_2023465_+\|purine-permease	gnl\|CDD\|274468	TIGR03173, pbuX, xanthine permease. All the seed members of this model are observed adjacent to genes for either xanthine phosphoribosyltransferase (for the conversion of xanthine to guanine, GenProp0696) or genes for the conversion of xanthine to urate and its concomitant catabolism (GenProp0640, GenProp0688, GenProp0686 and GenProp0687). A number of sequences scoring higher than trusted to this model are found in different genomic contexts, and the possibility exist that these transport related compounds in addition to or instead of xanthine itself. The outgroup to this family are sequences which are characterized as uracil permeases or are adjacent to established uracil phosphoribosyltransferases.	0
NZ_CP014842.1\|WP_009328010.1\|2009750_2012027_+\|DEAD/DEAH-box-helicase	gnl\|CDD\|224126	COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only].	0
NZ_CP014842.1\|WP_003182873.1\|2014604_2014901_+\|cell-division-regulator-GpsB	gnl\|CDD\|237616	PRK14127, PRK14127, cell division regulator GpsB.	2.30627e-48
NZ_CP014842.1\|WP_003182867.1\|2019705_2021211_+\|carboxypeptidase-M32	gnl\|CDD\|341054	cd06460, M32_Taq, Peptidase family M32, which includes thermostable carboxypeptidases TaqCP, PfuCP and FisCP. Peptidase family M32 is a subclass of metallocarboxypeptidases, distributed mainly in bacteria and archaea, whose members contain a HEXXH motif that participates in coordinating a divalent cation such as Zn2+ or Co2+. It includes the thermostable carboxypeptidases (E.C. 3.4.17.19) from Thermus aquaticus (TaqCP) and Pyrococcus furiosus (PfuCP), which have broad specificities toward a wide range of C-terminal substrates that include basic, aromatic, neutral and polar amino acids. These enzymes have a similar fold to the M3 peptidases such as neurolysin and the M2 angiotensin converting enzyme (ACE). The keratin-degrading extremophilic eubacterium Fervidobacterium islandicum M32 carboxypeptidase (FisCP) plays an important role in cellular metabolism, and significantly enhances the degradation of native chicken feathers. It has been shown to mainly cleave the C-termini of peptides with a basic amino acid sequence. Novel M32 peptidases from some eukaryotes: protozoa Trypanosoma cruzi, a causative agent of Chagas' disease, and Leishmania major, a parasite that causes leishmaniasis, have been identified, thus making these enzymes an attractive potential target for drug development against these organisms.	0
NZ_CP014842.1\|WP_003182877.1\|2012032_2013346_+\|hypothetical-protein	gnl\|CDD\|225895	COG3359, COG3359, Predicted exonuclease [DNA replication, recombination, and repair].	5.46715e-98
NZ_CP014842.1\|WP_003182865.1\|2021567_2022152_+\|xanthine-phosphoribosyltransferase	gnl\|CDD\|181705	PRK09219, PRK09219, xanthine phosphoribosyltransferase; Validated.	9.4737e-122
NZ_CP014842.1\|WP_003182880.1\|2008553_2008973_-\|hypothetical-protein	gnl\|CDD\|223149	COG0071, IbpA, Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones].	8.58059e-07
NZ_CP014842.1\|WP_003182857.1\|2025814_2025910_+\|Fur-regulated-basic-protein-FbpC	gnl\|CDD\|380216	NF033217, Fur_reg_FbpC, Fur-regulated basic protein FbpC. Members of this family are FbpC, Fur-regulated basic protein C. This protein has also been described as MrgC (metal-regulated gene C). Members of this family are found so far only in the genus Bacillus, although the small size may have interferred in gene-finding.	8.14213e-08
NZ_CP014842.1\|WP_009328018.1\|2026053_2029617_+\|hypothetical-protein	gnl\|CDD\|206739	cd09912, DLP_2, Dynamin-like protein including dynamins, mitofusins, and guanylate-binding proteins. The dynamin family of large mechanochemical GTPases includes the classical dynamins and dynamin-like proteins (DLPs) that are found throughout the Eukarya. This family also includes bacterial DLPs. These proteins catalyze membrane fission during clathrin-mediated endocytosis. Dynamin consists of five domains; an N-terminal G domain that binds and hydrolyzes GTP, a middle domain (MD) involved in self-assembly and oligomerization, a pleckstrin homology (PH) domain responsible for interactions with the plasma membrane, GED, which is also involved in self-assembly, and a proline arginine rich domain (PRD) that interacts with SH3 domains on accessory proteins. To date, three vertebrate dynamin genes have been identified; dynamin 1, which is brain specific, mediates uptake of synaptic vesicles in presynaptic terminals; dynamin-2 is expressed ubiquitously and similarly participates in membrane fission; mutations in the MD, PH and GED domains of dynamin 2 have been linked to human diseases such as Charcot-Marie-Tooth peripheral neuropathy and rare forms of centronuclear myopathy. Dynamin 3 participates in megakaryocyte progenitor amplification, and is also involved in cytoplasmic enlargement and the formation of the demarcation membrane system. This family also includes mitofusins (MFN1 and MFN2 in mammals) that are involved in mitochondrial fusion. Dynamin oligomerizes into helical structures around the neck of budding vesicles in a GTP hydrolysis-dependent manner.	8.03649e-47

>NZ_CP014842.1|WP_003182872.1|2015435_2016587_+|class-I-SAM-dependent-RNA-methyltransferase
MKTYTLIATAPMGIEAIVAKEVRDLGYDCTVDNGKVVFEGDALAICRANLWLRTADRVKVQAAEFTAKTFDELFEKTKAIDWSAYLPEHASFPVTGKSVKSVLASVPDCQRIVKKAIAEKLKSEYQTQGEWLEETGPEYKIEVSLLKDKAVITLDSSGAGLHKRGYRTGQGEAPLKETLAAALILLTNWTPDRPFVDPFCGSGTIPIEAALIGQNIAPGFNRDFASERWEWIGKEVWDQARLEVEEKANYDQPLSISGYDLDHRMIEIAKANAEEAGLADFIEFKQMQVKDFRTKEEYGVIVGNPPYGERLGEKKAVEAMYKDMGKAFAELDTWSVYMLTSNERFEECYGKKATKKRKLFNGFIKTDYYQYWGKRPPKPNKEK
>NZ_CP014842.1|WP_003182873.1|2014604_2014901_+|cell-division-regulator-GpsB
MLADKVKLSAKEILEKEFKTGVRGYKQEDVDKFLDMVIKDYEAFHQEIEELQQENLQLKKQLEEANKRQPAQSNTTNFDILKRLSNLEKHVFGSKLYD
>NZ_CP014842.1|WP_009328012.1|2013972_2014524_+|DUF1273-domain-containing-protein
MKVLAVTGYKPFELGIFKHDDKALFYIKKALENRMIALLEEGLEWVLISGQLGTELWAAEVAFSLQEEFPDLKVAVITPFLEQEKKWSEKNQEQYEAVLAASDFTESLTHRPYESPVQFKQKNRFFIEKADGLLILYDEEIEGSPVYMLNEAKKAQEKRDFPIYTITMDDLRVTVEECSFYEE
>NZ_CP014842.1|WP_003182875.1|2013587_2013857_+|spore-coat-protein-CotH
MHCKPHVMAPIVHPTQCCYNHTHSKTVVPHIHPQHTTNVNHQHFQHVHYYPQTQSAVNKASHQHFVSPGAGMMPGPGGMPGPGMGMGPY
>NZ_CP014842.1|WP_003182877.1|2012032_2013346_+|hypothetical-protein
MSLKRKLNRYKHHLGNQAKEEKTEPPADKLTSLSVSFEKEWAELGVKPYVFEECYCLIREVVYPLTHVHGHYAFSELHETVRRWNNSAVSHSLSSKGYTPSQLFFFDTETTGLGGGAGNAIFLLGHARVYDDRVVVKQHLLPKPGYEAALYHSFLSEVDIQSLVTYNGKAFDWPQVKTRHTLIRDRVPKLPDFGHFDLLHGSRRLWKHKFDRVSLGTVEKEELGVVRTEDTPGYLAPMMYFHFLKEERPEIIEGVLRHNELDVLSLITLYIHLSKKILTPEQTAEANEKYAMAKWLLANRETELATAQLQELEKKPFEHSERASFDLSMQYKKQGMLKEAAALWLKLQNGEDGKTAWRAGIELAKYFEHRKRDIRAALEVAENLLEQHGSQKFELTEKEMAGLLRRRERLERKYGRNIPRASAENDDLRKPNISSTL
>NZ_CP014842.1|WP_009328010.1|2009750_2012027_+|DEAD/DEAH-box-helicase
MTALFQKRNLTDMIQLLKEDQAFSRQIVHWHTIEGKEADYRDFPEGLDKRIVHALQQRGVEKLYSHQADAFLHSAAGKNVTLVTPTASGKTLCYNLPVIQRITEDQDARSLYLFPTKALSQDQKSELNELIDEIGASINCYTYDGDTSPSIRQKVRKAGHIVITNPDMLHSAILPHHTKWVSLFENLKYIVIDELHVYRGVFGSHVANVIRRLMRIAEFYGSKPQFICTSATIANPLELAETLTGQPMHLISNNGAPSGRKHFLFYNPPMVNRSLNIRKSATLEVRKLASEFLKNGIQTIVFARSRVRVEIILTYLQEVMKPIVGPHSIQGYRGGYLPNERRVIEKGLRSGDIKGVVSTNALELGVDIGQLQTCIMTGYPGTISSAWQQAGRAGRRHNEALIVMVASSAPLDQYIVQNPDYFFKQNPETAVINPDNLVILVDHIKCAAFELPFKRTDTFGGIEIEDILDYLAEERVLHLTGNTYHWMNDAFPAHGISLRSASQENVVIIDQSRREKAKVIGEMDRFSAMTLLHDEAIYLHQGIQYQVEKLDWEEKKAFVREVQVDYYTDANLAVLLRVLEVDKEKKTETAAFGFGDVTVQAKATIFKKIKFETHENIGSGPIHLPEEELHTNAAWVQVNDSERQNWNDIKLEEALLGTANVLGHVAALKVMCDPSDLHVFPQIKAVHNEKPTIFLYDRYPGGVGLSQKVYEQMPEIISEAHRLISRCPCESGCPSCIGVSGGDQTKNNALRLLKGWKG
>NZ_CP014842.1|WP_003182879.1|2009148_2009655_+|PTS-glucose-transporter-subunit-IIA
MLKKLFGIGQKQDEVKEETVFSPVDGQVLELSKVPDPVFSQKMMGDGMAVEPSAGEIVSPVDGEVIQLFHTKHAIGIRSLSGVELLIHIGLETVAMEGEGFTAHVKEGDKVKVGDPLITCDLELIKEKASSTITPIVIMNGDVLERVTKHEEAAAKKSETKLMELKVK
>NZ_CP014842.1|WP_003182880.1|2008553_2008973_-|hypothetical-protein
MDFKENDNHSLSKKDEIQEAVEQLFYNSPFHDILNSFQKLISDQLQNSTISMNIREDDGALYVDIAVPESFQNGDIMIEAKSRYLHIALKEKQESGGSSSFTSLSRTVLLPYPVREETMKTSWNRNVLTVSFSEQKKHE
>NZ_CP014842.1|WP_003182882.1|2008091_2008535_+|hypothetical-protein
MEERRSAVYPYSGPGAHIQAYQQNHQAYHPVQPYFSQESVPYAHPAQRPQPYQQPIEQNLDPFSVYHQPVQQQMQPLPPFQGFPYQHPYPSPRPNLHQPSQFQSFLSQFKKKNGQIDFSKMMDTAGQMVSTVNQVGALAKGFMGFFK
>NZ_CP014842.1|WP_011198064.1|2007711_2007912_-|hypothetical-protein
MNVSYLRNCFAEMKQYETDCMNKLMDFAKFLYIQGHLTLNEFRTSMKVLEANGAQHPAYDMNTDAS
>NZ_CP014842.1|WP_080623597.1|2017675_2019595_+|ATP-dependent-DNA-helicase
MTASRLPFSLTKTKNFYEELNNWIGDVFYDILPEKGFDLRDEQIFMAFQLERAFKEKKVMFAEAGVGTGKTLVYLLFALSYARYTGKPAVIACADETLIEQLVKKEGDIYKISEHLGLTIDARLSKSHDQYLCLKKLEKTMQRSDDEKWLDLYESLPSFVHESQGMQAFYPYGDRKEYSSLSNDEWSEIGYDSFQDCLTCDMRHRCGLTLSRDHYRKSTDFIICSHDFYMEHVWTEEARKREGQLPLLPEHSAVVFDEGHLLEFAAQKALTYRVKQSTLEMFLERLLGNDIREEFAELVEEALRANDEFFGLLTENAEKAEGSERMRIKDDTDVKKAAAELYDLLEKIGEALVFEGELYTIDQYALTVVEEYLEQMAYSLSLYRKNAISWLEQKELESTFVVMPRTVSEVLGEKVFSKQIPFIFSSATLSENGSFDYLATSLGIRDYLSFTVDSPYDYEEQMKVYIHQIEEKEAKEEAAIRAIKESGGKTLILFPSFEELLSFKRRTAQESFSFPVYFEGDEEISTIVEKFQTVEESVLCSVHLWEGLDIPGDPLQNVIIWSLPFPPHDPVFEAKRSGVENAFREVDLPYMLLRLRQGIGRLIRSNSDSGTISIFAGDEKEWNVIKEVESVLPVQPVYV
>NZ_CP014842.1|WP_003182867.1|2019705_2021211_+|carboxypeptidase-M32
MMSINTYEKEFLETLKKISRYEQAINVMYWDMRTGAPRKGEESRAEAIGQLSADVFQMRTSPRMKELLDTLAGQKQDLPFDTQKAVEEAKKEYDLNSKIPEEEFKEYTTLTSKAESVWEKAKKASDFSLFAPYLEKIIDFKKRFISYWGYEGHPYNTLLDQYEPGVTVEKLDALFSELREAIVPLVQKIAASDKKPDTGFVHDHFPKERQRDVCHFFLQELGYDFEAGRLDETVHPFQVTISQGDARVTTAYNENDFRSAVFGTIHECGHAIYEQNIDEALGGTNLSDGASMGIHESQSLFYENFIGRHQSFWTRYFDKIKEASPDQFAGVTAEGFYRAVNESKPSLIRIEADELTYPLHIMIRYEIEKAIFSGEVSVGDLPKLWNDKYEAYLGITPPDDAKGILQDVHWSGGDFGYFPSYALGYMYAAQLKSSMLKDLPEFDRLIENGDFQPIRKWLTEHVHIHGKRKKPLEIIKSATGEELNVRHLIRYLEEKYTTLYL
>NZ_CP014842.1|WP_003182865.1|2021567_2022152_+|xanthine-phosphoribosyltransferase
MEKLKRKIAEQGTVLSDEVLKVDSFLNHQIDPELMLAVGEEFASLFREEGVTKIVTIESSGIAPAVMAGLKLGVPVVFARKRQSLTLTENLLTASVYSFTKKTESTVAVSASHLSKDDKVLIIDDFLANGQAAKGLVSIIEQAGAKVCGIGIVIEKSFQTGREELENLGIRVESLARIASLAGGKVTFLQEVGS
>NZ_CP014842.1|WP_003182864.1|2022148_2023465_+|purine-permease
MKLTAGKTVSLSIQHVLAMYAGAVVVPLIVGGALGLTPAQLTYLVSADILMCGVATLLQVWKNRFFGIGLPVVLGCTFTAVSPMISIASTYGIPAIYGSIIAGGVIVVIISFFFGKLVKFFPPVVTGSVVTVIGITLIPVAMNNMAGGEGSSDFGELSNLALAFSVLLVIVLLYRFTSGFIKSISILIGLIAGTAGAALMGKVDFTEVANAGWVQMIHPFYFGAPVFEVTPILTMSLVLIVSLVESTGVYFALGDLTDRRLTEKDLGKGYRAEGIAVLLGGVFNAFPYTAYSQNVGLVQLTGVKKNSVIALAGAFLILLGLFPKAAALTTIIPKPVLGGAMVAMFGMVIAYGIKMLSRVDFGKQENLLIVACSIGIGLGVTVVPQMFQNLPDAVKLLTENGIVAGSFAAILLNAIFHIHPFSRHAEQPEAVSAEKSAV
>NZ_CP014842.1|WP_003182862.1|2023549_2024101_+|GNAT-family-N-acetyltransferase
METVNELVERIRTKDGGEAVIRPVKMADAPDIIEAVKDVIQTGVYIQKERPRTLEEERAFISDMMKKDNMYAAVEIDGTVYGIARVIRGELKMKRHTGLFRTWLHSKAQGLGIGREIMSYTLKWCRLHRLHKLCLTVFSENEAALSLYKKSGFIVEGVQKEQVLSDGKYEDEVLMAYFFNGST
>NZ_CP014842.1|WP_009328017.1|2024142_2025240_+|chalcone-synthase
MAYVISAGTSIPRCHVDQKEAAVFAREMFKDSFKDIDRLLSAFQNGEIASRQFVMPLDWYKEAKSFKEKNQTYIDMAVRHSAEAVSNCLSDDRFLKKEIPCEKIDAIFFISSTGISTPSIEAKLMNILPFSKRAKRIPIWGLGCAGGASGIARAFEYCKAFPKAHVLVIAAELCSLTFQKDDQSKSNLIGTSLFGDGIAALLMCGKEADFSEARFEVLPEVLGSQSSTLEDSEEVMGWEINDNGFRVVFSRDIPTLIKTHLKNDIEAFLNKEHIALENIQVFLAHPGGKKVLDAYMEILGFSEAHIDCSRKILARHGNMSSATVMHVLKEYCLHGGPVPGKYGLLGALGPGFSSELLLLRWTKRE
>NZ_CP014842.1|WP_003182859.1|2025247_2025751_+|hypothetical-protein
MFWTILSIFAAQRLLELAVAKFNEKNALKEGAVEYGKRHYPYIVAMHVSFFVSLIWETTAFQRGTLPMALVVLTGLIFTQVLRYWALFSLGKCWNTKILVIPGTNLVRKGPYQWIKHPNYLAVALEFLLLPLLFQAYATALLFTVLNAAVMYIRIRTEEQALEKLHH
>NZ_CP014842.1|WP_003182857.1|2025814_2025910_+|Fur-regulated-basic-protein-FbpC
MTMFFLLAAVSTYSLLIGYVLKGIAGANPQK
>NZ_CP014842.1|WP_009328018.1|2026053_2029617_+|hypothetical-protein
MAQINTKDDLMKRAGAVFGELTKNGDDKRSAQLAGIIRKWLRKEVYIALTGHYSAGKSSLLNALLQEEVLPTSPIPTSANLVLVRRGEMKTTLHTVDGRYAQMDGSYDKEKVQAYCRDGSQIEMVEIGGPFSGIAPQAVLIDTPGIDSTDDAHFLSASSILHQADALFYVVHYNHVHSEENVKFLRSIKDKIPNIFFIVNQIDRHDEAETDFHAYKKQVLDMLLKEGISEEHLFFTSVTAADHPLNEFNRLRAELERLQHQSEQQLQAYTEQKISSLIHEHIKMLISDEDTALSEETASLRETVETLKSQLADLTEQEKRAEEQIKKDIQTIAQNANITPFEMRELAKSYLESIEKGFKKGILFSKAKTLEEKQKRKEAFLADVQKRVQAEIDWHVIEAIKAFMKCFNVQNDEMLREVLQFRTVIDENDLLRSRKKGAELTPEYVLNYTKELAENIRRKAKRQAQPLIDQLKTFIKERSVLQAEAIKAEYDAEQAKLAERERRLIEQQKSYEKANRLWDQWEHGNQSDLPANWYAAERKPLEKTLDAKRAEPVRAQGENSSRKDEALHPKKGVSESIEHFFELARILADIPALEKQRKAFLHKTERLHTRQFTLALFGAFSSGKSSFANALCGRKVLPSSPTPTTATINKITKPSGTKRDGTAEVAFKTEGEITAELDQLLDGKMASAKGSAFGEKLKNLLKKEELHDDERLLIKNFLKAYKRYGSYINDQEILTISADDLHPYVAEEQTACAVREVTVYLSTPVTEKGITIVDTPGASSMNKRHTELAFQYMKDADALLYLTYYQHSFSKADRSFLRKLGLIKDAFSMDKMFFILNAADLAKSPVELQTVEDYVRGELLKEGIQNPHLYHVSSKQELNKKTSPYNDFSRLKRELDDFIENGLARTAVEELLDEGKKLCETVFQLRGSLHRSAEEKEAEQKRVAKAYQEALAAIEEAEKGSSILQMTEKDVEEQFYHMKQRLAFFAHDLFKAAIHPGLQNGDWRANLQTALKSCLKEYEFEFLQELKALDIRMENLMLKFAGEQWANAVKERLAGNPYFSVHIQADRPETESWETTEASADEGEFTDELKMFKTPKTFFQQNGKARLVEAFTAKLSAITDNWIQREKQTFLNRCKTSAGQLQKAAVLSAKAQLEEQKEAYFHEALESAERENIEKAHALAGEWLRSC
>NZ_CP014842.1|WP_003182854.1|2029691_2029961_+|YpbS-family-protein
MTNVHEAITAHSKKQHQHIKQFVRLEQEREKAIDDVVDKCRRNEAFSTDLINQITVQMNELAKKGIVPTRRLVSKEMVAEYVSRKYPQA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP014842_1	1.1\|2016874\|22\|NZ_CP014842\|CRISPRCasFinder	2016874-2016895	22	JQ680357	Unidentified phage clone 2011_scaffold13 genomic sequence	29666-29687	2	0.909

1. spacer 1.1|2016874|22|NZ_CP014842|CRISPRCasFinder matches to JQ680357 (Unidentified phage clone 2011_scaffold13 genomic sequence) position: , mismatch: 2, identity: 0.909

tttgcaaggcttgtggtaatcg	CRISPR spacer
gttgcaaggcttgtgataatcg	Protospacer
 **************.******

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

832694 : 899053

Bacillus_phage(55.26%)

plate,tRNA,protease,tail,holin,head,coat,integrase,terminase,portal,capsid

attL 842492:842509|attR 886496:886513

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003185439.1\|832694_833834_+\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	F2Y1V5	Organic_Lake_phycodnavirus	8.6e-14	30.6
WP_009329612.1\|833855_834509_+	ABC transporter permease	NA	NA	NA	NA
WP_009329611.1\|834522_835440_+	osmoprotectant ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003185432.1\|835456_836134_+	ABC transporter permease	NA	NA	NA	NA
WP_011201739.1\|836181_836586_-	helix-turn-helix transcriptional regulator	S6C481	Thermus_phage	2.1e-15	49.5
WP_009329609.1\|836749_837151_-	transcriptional regulator	S6C481	Thermus_phage	4.2e-16	45.3
WP_085959538.1\|837303_837537_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003185421.1\|837565_837850_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	5.8e-12	52.7
WP_003185418.1\|838020_838251_+	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_003185416.1\|838391_839138_+	carboxylesterase	NA	NA	NA	NA
WP_003185414.1\|839151_841455_+	ribonuclease R	Q0GXV6	Lactococcus_phage	6.9e-95	41.7
WP_009329604.1\|841566_842040_+	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	1.0e-45	61.1
842492:842509	attL	NA	NA	NA	NA
WP_021837735.1\|842615_843710_-\|integrase	site-specific integrase	A0A1B2AQ00	Phage_Wrath	1.4e-98	52.5
WP_003185408.1\|843780_844419_-	LexA family transcriptional regulator	A0A2I7SCV6	Paenibacillus_phage	1.8e-45	47.7
WP_021837734.1\|844595_844814_+	helix-turn-helix transcriptional regulator	Q8SBM9	Clostridium_phage	2.3e-16	59.7
WP_011198327.1\|844837_845632_+	ORF6N domain-containing protein	A0A2I7SCV5	Paenibacillus_phage	3.7e-64	52.4
WP_003185403.1\|845628_845817_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_016886536.1\|845948_846137_+	hypothetical protein	NA	NA	NA	NA
WP_003185401.1\|846194_846749_+	hypothetical protein	A0A288WGQ2	Bacillus_phage	1.3e-31	42.7
WP_021837733.1\|846874_847033_+	hypothetical protein	NA	NA	NA	NA
WP_021837732.1\|847029_847359_-	hypothetical protein	NA	NA	NA	NA
WP_021837731.1\|847421_847688_+	hypothetical protein	Q9ZXC9	Bacillus_phage	6.0e-19	54.7
WP_011198322.1\|847775_848018_+	hypothetical protein	NA	NA	NA	NA
WP_021837730.1\|848110_848668_+	hypothetical protein	Q9ZXC8	Bacillus_phage	2.8e-71	72.4
WP_011198320.1\|848671_849604_+	AAA family ATPase	Q9ZXC7	Bacillus_phage	1.9e-152	88.1
WP_009329263.1\|849603_850041_+	DUF669 domain-containing protein	Q9ZXC5	Bacillus_phage	8.2e-74	90.3
WP_021837729.1\|850101_852534_+	primase	D6R422	Bacillus_phage	0.0e+00	81.1
WP_021837728.1\|852754_853126_+	hypothetical protein	NA	NA	NA	NA
WP_021837727.1\|853103_853541_+	hypothetical protein	Q9ZXC3	Bacillus_phage	3.2e-62	75.9
WP_021837726.1\|853537_854077_+	nuclease	Q9ZXC2	Bacillus_phage	1.1e-88	89.9
WP_021837725.1\|854073_854244_+	Fur-regulated basic protein FbpA	A0A0S2SXY0	Bacillus_phage	6.7e-08	56.6
WP_021837724.1\|854246_854762_+	hypothetical protein	D6R425	Bacillus_phage	1.5e-82	83.0
WP_021837723.1\|854777_855155_+	hypothetical protein	R4JMS5	Bacillus_phage	6.3e-30	57.1
WP_021837721.1\|855267_855648_+	ArpU family transcriptional regulator	Q9ZXB9	Bacillus_phage	2.0e-47	82.1
WP_006637235.1\|856398_856623_+\|coat	spore coat protein	NA	NA	NA	NA
WP_006637236.1\|856839_857067_+	hypothetical protein	NA	NA	NA	NA
WP_021837719.1\|857264_857825_+	hypothetical protein	NA	NA	NA	NA
WP_021837717.1\|858152_858527_+	HNH endonuclease	A0A1U7Q1S7	Geobacillus_virus	2.4e-29	51.7
WP_003185364.1\|858756_859272_+\|terminase	phage terminase small subunit P27 family	A6M947	Geobacillus_virus	9.8e-34	45.8
WP_003185362.1\|859268_860978_+\|terminase	terminase large subunit	A0A0S2GLF0	Bacillus_phage	2.7e-205	62.0
WP_021837716.1\|860989_861181_+	DUF1056 family protein	NA	NA	NA	NA
WP_021837715.1\|861181_862492_+\|portal	phage portal protein	D6R3Y6	Bacillus_phage	4.9e-106	46.7
WP_021837714.1\|862436_863168_+\|protease	Clp protease ClpP	A0A2I7SCY8	Paenibacillus_phage	1.2e-56	53.7
WP_021837713.1\|863205_864489_+\|capsid	phage major capsid protein	A0A288WG01	Bacillus_phage	1.3e-79	44.5
WP_021837712.1\|864960_865263_+\|head,tail	phage gp6-like head-tail connector protein	A0A0S2GLH6	Bacillus_phage	4.7e-12	45.1
WP_003185349.1\|865252_865561_+\|head	phage head closure protein	NA	NA	NA	NA
WP_003185346.1\|865560_865959_+	hypothetical protein	NA	NA	NA	NA
WP_021837711.1\|865955_866339_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_003185341.1\|866353_866971_+\|tail	tail protein	NA	NA	NA	NA
WP_003185339.1\|867024_867387_+	hypothetical protein	NA	NA	NA	NA
WP_021837710.1\|867595_872071_+\|tail	phage tail tape measure protein	A6M961	Geobacillus_virus	1.2e-71	42.4
WP_003185333.1\|872067_872904_+\|tail	phage tail family protein	D6R3Z9	Bacillus_phage	5.5e-111	69.3
WP_003185331.1\|872916_874629_+	alkaline phosphatase	D6R400	Bacillus_phage	6.0e-221	66.6
WP_021837708.1\|874664_876620_+	hypothetical protein	U5PWM6	Bacillus_phage	1.0e-43	31.8
WP_021837707.1\|876640_877978_+\|plate	phage baseplate upper protein	M4ZRP1	Bacillus_phage	1.6e-67	45.5
WP_003185326.1\|877990_878314_+	bZIP transcription factor	M4ZR44	Bacillus_phage	2.0e-13	47.4
WP_003185324.1\|878310_878496_+	XkdX family protein	NA	NA	NA	NA
WP_009329192.1\|878558_878828_+	protein xhlA	A0A2H4JD40	uncultured_Caudovirales_phage	1.4e-20	58.4
WP_011198302.1\|878843_879107_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	6.7e-31	73.6
WP_021837706.1\|879158_880001_+	N-acetylmuramoyl-L-alanine amidase	S6BFI4	Thermus_phage	3.7e-46	55.5
WP_021837705.1\|880074_880419_-	hypothetical protein	NA	NA	NA	NA
WP_095010844.1\|880436_881105_-	hypothetical protein	NA	NA	NA	NA
WP_021837701.1\|882756_882987_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_080623576.1\|883220_883772_+	hypothetical protein	NA	NA	NA	NA
WP_021837699.1\|883832_884153_+	hypothetical protein	NA	NA	NA	NA
WP_021837698.1\|884149_884566_+	hypothetical protein	NA	NA	NA	NA
WP_118381831.1\|885102_885555_-	hypothetical protein	NA	NA	NA	NA
WP_026699399.1\|885898_886117_+	transcriptional regulator	NA	NA	NA	NA
WP_003185302.1\|887025_887310_-	hypothetical protein	NA	NA	NA	NA
886496:886513	attR	NA	NA	NA	NA
WP_011198290.1\|887433_887976_-	hypothetical protein	NA	NA	NA	NA
WP_003185296.1\|888091_888577_-	hypothetical protein	NA	NA	NA	NA
WP_003185294.1\|888673_889072_-	peptidase	NA	NA	NA	NA
WP_003185292.1\|889144_890299_-	oxalate decarboxylase family bicupin	NA	NA	NA	NA
WP_003185290.1\|890392_890542_-	YvrJ family protein	NA	NA	NA	NA
WP_003185288.1\|890698_891280_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_003185286.1\|891263_891473_+	hypothetical protein	NA	NA	NA	NA
WP_003185283.1\|891668_892637_+	rhodanese-related sulfurtransferase	NA	NA	NA	NA
WP_003185281.1\|892937_893573_+	FMN-dependent NADH-azoreductase 2	NA	NA	NA	NA
WP_017474573.1\|893604_894654_-	oxidoreductase	NA	NA	NA	NA
WP_021837694.1\|894843_896022_+	amidase	NA	NA	NA	NA
WP_003185275.1\|896144_896618_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_003185273.1\|896634_897090_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_003185271.1\|897086_898307_-	cytochrome P450, cyclodipeptide synthase-associated	NA	NA	NA	NA
WP_003185269.1\|898303_899053_-\|tRNA	tRNA-dependent cyclodipeptide synthase	NA	NA	NA	NA

DBSCAN-SWA_2

1447636 : 1504342

Bacillus_phage(30.0%)

tRNA,protease,coat,integrase,terminase

attL 1445561:1445586|attR 1450277:1450302

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1445561:1445586	attL	NA	NA	NA	NA
WP_026699140.1\|1447636_1449631_+\|integrase	integrase	A0A1P8CWI7	Bacillus_phage	2.7e-15	23.6
WP_009329324.1\|1449636_1450116_+	antitoxin YezG family protein	NA	NA	NA	NA
WP_003184124.1\|1450528_1450885_+	hypothetical protein	A0A1B1P7B5	Bacillus_phage	1.8e-23	52.0
1450277:1450302	attR	NA	NA	NA	NA
WP_026080840.1\|1450893_1451664_+	DNA (cytosine-5-)-methyltransferase	A0A1B1P7C6	Bacillus_phage	1.3e-87	63.1
WP_009329322.1\|1451969_1452743_+	DUF4145 domain-containing protein	NA	NA	NA	NA
WP_017474640.1\|1453233_1454238_+	hypothetical protein	NA	NA	NA	NA
WP_026699142.1\|1454283_1455153_+\|terminase	terminase	D2IYW0	Enterococcus_phage	7.4e-34	39.6
WP_026699143.1\|1456448_1456664_+	hypothetical protein	NA	NA	NA	NA
WP_017474379.1\|1456885_1457086_+	hypothetical protein	NA	NA	NA	NA
WP_003184110.1\|1457099_1457591_+	hypothetical protein	NA	NA	NA	NA
WP_009329319.1\|1457634_1457889_-	hypothetical protein	NA	NA	NA	NA
WP_003184106.1\|1458301_1459684_+	NADP-specific glutamate dehydrogenase	NA	NA	NA	NA
WP_003184104.1\|1459726_1459954_-	hypothetical protein	NA	NA	NA	NA
WP_003184102.1\|1460410_1461325_+	branched-chain-amino-acid transaminase	NA	NA	NA	NA
WP_003184100.1\|1461749_1463474_+	acetolactate synthase large subunit	A0A0P0CDR3	Ostreococcus_lucimarinus_virus	1.5e-62	30.2
WP_003184097.1\|1463470_1463989_+	acetolactate synthase small subunit	NA	NA	NA	NA
WP_003184095.1\|1464012_1465041_+	ketol-acid reductoisomerase	NA	NA	NA	NA
WP_044822493.1\|1465027_1466584_+	2-isopropylmalate synthase	E5EQ69	Micromonas_sp._RCC1109_virus	1.5e-08	24.6
WP_003184091.1\|1466611_1467724_+	3-isopropylmalate dehydrogenase	NA	NA	NA	NA
WP_009329313.1\|1467757_1469176_+	3-isopropylmalate dehydratase large subunit	NA	NA	NA	NA
WP_003184088.1\|1469188_1469788_+	3-isopropylmalate dehydratase small subunit	NA	NA	NA	NA
WP_017474376.1\|1469917_1470925_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_003184085.1\|1471151_1472426_+	trigger factor	NA	NA	NA	NA
WP_003184083.1\|1472694_1473960_+\|protease	ATP-dependent protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	7.2e-147	63.5
WP_003184080.1\|1474142_1475798_+\|protease	ATP-dependent protease LonB	A0A0R6PGP8	Moraxella_phage	1.4e-17	35.7
WP_016885551.1\|1476016_1478341_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	1.0e-186	45.2
WP_003184076.1\|1478337_1478925_+	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_003184074.1\|1478972_1479458_-	hypothetical protein	NA	NA	NA	NA
WP_017474375.1\|1479646_1481008_+\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_003184070.1\|1481013_1481844_+	cytochrome c	NA	NA	NA	NA
WP_003184068.1\|1481883_1482825_+	hydroxymethylbilane synthase	NA	NA	NA	NA
WP_003184065.1\|1482814_1483606_+	uroporphyrinogen-III synthase	NA	NA	NA	NA
WP_003184063.1\|1483609_1484584_+	porphobilinogen synthase	NA	NA	NA	NA
WP_003184061.1\|1484609_1485905_+	glutamate-1-semialdehyde 2,1-aminomutase	NA	NA	NA	NA
WP_063906779.1\|1486053_1487511_+	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_003184059.1\|1487538_1488561_+\|coat	spore coat protein YsxE	NA	NA	NA	NA
WP_003184058.1\|1488580_1488772_-	hypothetical protein	NA	NA	NA	NA
WP_003184055.1\|1489233_1491876_+\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	2.8e-161	42.3
WP_003184054.1\|1491951_1493256_+	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_011198164.1\|1493398_1494148_+	prepilin peptidase	NA	NA	NA	NA
WP_003184050.1\|1494351_1495383_+	SPOR domain-containing protein	NA	NA	NA	NA
WP_003184048.1\|1495536_1496109_+	septum formation inhibitor Maf	NA	NA	NA	NA
WP_003184045.1\|1496163_1496838_+	JAB domain-containing protein	NA	NA	NA	NA
WP_003184042.1\|1496925_1497936_+	rod shape-determining protein	NA	NA	NA	NA
WP_003184040.1\|1497966_1498875_+	rod shape-determining protein MreC	NA	NA	NA	NA
WP_003184039.1\|1498871_1499390_+	rod shape-determining protein MreD	NA	NA	NA	NA
WP_011198163.1\|1499444_1500125_+	septum site-determining protein MinC	NA	NA	NA	NA
WP_003184035.1\|1500127_1500934_+	septum site-determining protein MinD	NA	NA	NA	NA
WP_003184034.1\|1500978_1501299_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003184032.1\|1501298_1501727_-	SRPBCC domain-containing protein	NA	NA	NA	NA
WP_044789852.1\|1501872_1502664_+	M23 family metallopeptidase	NA	NA	NA	NA
WP_003184028.1\|1502656_1503523_+	stage IV sporulation protein FB	NA	NA	NA	NA
WP_003184027.1\|1503679_1503988_+	50S ribosomal protein L21	NA	NA	NA	NA
WP_003184025.1\|1504000_1504342_+\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA

DBSCAN-SWA_3

1902178 : 1914358

Staphylococcus_phage(55.56%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003183133.1\|1902178_1902616_+	peptidylprolyl isomerase	A0A2H4UTF4	Bodo_saltans_virus	5.4e-17	44.6
WP_009327959.1\|1902846_1903977_+	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	1.4e-77	43.3
WP_003183128.1\|1903966_1904272_+	hypothetical protein	NA	NA	NA	NA
WP_080623594.1\|1904430_1904868_+	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_003183125.1\|1904994_1907181_+	AAA family ATPase	A0A220BYT7	Staphylococcus_phage	1.4e-150	41.3
WP_003183123.1\|1907443_1907788_+	hypothetical protein	NA	NA	NA	NA
WP_011198083.1\|1908148_1909237_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	5.1e-64	38.1
WP_003183118.1\|1909248_1909896_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	7.4e-39	41.5
WP_003183117.1\|1909917_1911114_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	2.1e-116	53.9
WP_003183115.1\|1911148_1911613_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.7e-45	70.7
WP_003183113.1\|1911714_1912089_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003183111.1\|1912099_1912621_-	DUF309 domain-containing protein	NA	NA	NA	NA
WP_003183108.1\|1912741_1912837_-	YjcZ family sporulation protein	NA	NA	NA	NA
WP_009327962.1\|1913019_1913775_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	1.4e-07	23.6
WP_003183104.1\|1913764_1914358_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	3.4e-14	37.6

DBSCAN-SWA_4

2886067 : 2956500

Bacillus_phage(28.21%)

plate,tail,holin,coat,terminase,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009328728.1\|2886067_2886916_-	SDR family oxidoreductase	M1NMS3	Moumouvirus	5.6e-10	33.3
WP_003180867.1\|2886891_2887989_-	mannonate dehydratase	NA	NA	NA	NA
WP_003180865.1\|2888009_2889026_-	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_003180863.1\|2889048_2889726_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_009328730.1\|2889827_2890892_-	N-acetylmuramoyl-L-alanine amidase	S6BFI4	Thermus_phage	2.0e-44	50.8
WP_003180859.1\|2890942_2891206_-\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	5.3e-28	67.8
WP_003180856.1\|2891220_2891490_-	protein xhlA	A0A2H4JD40	uncultured_Caudovirales_phage	1.6e-24	64.0
WP_003180853.1\|2891592_2892624_-	hypothetical protein	A0A1P8CWR7	Bacillus_phage	1.0e-18	48.2
WP_003180851.1\|2892661_2893867_-	hypothetical protein	A0A2H4J4R1	uncultured_Caudovirales_phage	9.3e-27	48.3
WP_003180850.1\|2893882_2894269_-	hypothetical protein	NA	NA	NA	NA
WP_009328731.1\|2894282_2895203_-	YmfQ family protein	A0A0A7RTT8	Clostridium_phage	5.0e-12	28.3
WP_009328732.1\|2895189_2896233_-\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	9.7e-73	44.3
WP_003180844.1\|2896225_2896651_-	DUF2634 domain-containing protein	A0A2H4J6K5	uncultured_Caudovirales_phage	5.4e-14	39.0
WP_003180843.1\|2896669_2896978_-	DUF2577 domain-containing protein	S6C459	Thermus_phage	1.0e-06	37.3
WP_009328734.1\|2896974_2897955_-	hypothetical protein	H7BV96	unidentified_phage	9.2e-41	32.3
WP_003180838.1\|2898011_2898668_-	LysM peptidoglycan-binding domain-containing protein	A0A090DBR9	Clostridium_phage	4.0e-24	32.6
WP_080623616.1\|2898660_2902443_-	transglycosylase SLT domain-containing protein	A0A1L2JY60	Aeribacillus_phage	1.7e-42	45.3
WP_003180833.1\|2902446_2902584_-	hypothetical protein	NA	NA	NA	NA
WP_003180832.1\|2902625_2903075_-\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	4.1e-12	38.7
WP_003180830.1\|2903257_2903701_-\|tail	phage tail tube protein	A0A0K2CNG3	Brevibacillus_phage	2.1e-24	44.7
WP_011197804.1\|2903702_2905049_-\|portal	phage portal protein	S5MNC1	Brevibacillus_phage	1.5e-78	40.2
WP_003180826.1\|2905048_2905273_-	hypothetical protein	NA	NA	NA	NA
WP_003180824.1\|2905273_2905714_-	hypothetical protein	NA	NA	NA	NA
WP_003180822.1\|2905726_2906215_-	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	1.9e-34	44.6
WP_003180819.1\|2906211_2906568_-	DUF3599 family protein	NA	NA	NA	NA
WP_011201613.1\|2906564_2906945_-	DUF3199 family protein	NA	NA	NA	NA
WP_009328739.1\|2907032_2907968_-\|portal	phage portal protein	A0A1B1P7E3	Bacillus_phage	1.1e-102	64.1
WP_009328740.1\|2907985_2908834_-\|portal	phage portal protein	A0A1B1P7E4	Bacillus_phage	2.1e-57	62.8
WP_080623617.1\|2908841_2910356_-\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	9.9e-143	55.3
WP_009328741.1\|2910359_2911658_-\|terminase	PBSX family phage terminase large subunit	M4ZRM5	Bacillus_phage	7.2e-150	60.2
WP_003180804.1\|2911654_2912455_-\|terminase	terminase	A0A0S2MVB6	Bacillus_phage	5.7e-65	51.4
WP_003180803.1\|2912597_2913101_-	sigma-70 family RNA polymerase sigma factor	A0A0K2CNQ1	Brevibacillus_phage	1.4e-21	38.7
WP_003180800.1\|2913221_2913425_-	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	1.9e-12	54.7
WP_003180798.1\|2913421_2913763_-	hypothetical protein	NA	NA	NA	NA
WP_155589718.1\|2913863_2914037_-	hypothetical protein	NA	NA	NA	NA
WP_011197802.1\|2914033_2914834_-	ATP-binding protein	A6XMI1	Bacillus_virus	3.6e-59	48.1
WP_003180792.1\|2914733_2915564_-	hypothetical protein	S6BFM4	Thermus_phage	1.3e-27	31.0
WP_003180790.1\|2915564_2915861_-	hypothetical protein	NA	NA	NA	NA
WP_003180788.1\|2915850_2916111_-	helix-turn-helix transcriptional regulator	S5MA07	Brevibacillus_phage	7.9e-08	41.2
WP_025805657.1\|2916283_2916637_+	helix-turn-helix transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	6.1e-19	49.2
WP_003180785.1\|2916825_2917482_+	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	4.0e-40	49.7
WP_003180784.1\|2917495_2918143_-	poly-gamma-glutamate hydrolase family protein	A0A0Y0AJU6	Bacillus_phage	4.1e-45	47.5
WP_080623618.1\|2918363_2920412_+	hypothetical protein	O64023	Bacillus_phage	2.1e-26	25.2
WP_003180781.1\|2920415_2920898_+	DUF600 family protein	NA	NA	NA	NA
WP_003180779.1\|2921272_2921686_+	hypothetical protein	NA	NA	NA	NA
WP_003180778.1\|2921714_2922050_+	hypothetical protein	NA	NA	NA	NA
WP_003180775.1\|2922062_2922641_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_011197798.1\|2922656_2924081_+	DHA2 family efflux MFS transporter permease subunit	A0A0M3UL24	Mycobacterium_phage	5.1e-16	24.6
WP_003180772.1\|2924136_2924871_-	LysM peptidoglycan-binding domain-containing protein	A0A217ER34	Bacillus_phage	4.2e-30	60.8
WP_009328757.1\|2925323_2925872_+	hypothetical protein	NA	NA	NA	NA
WP_003180768.1\|2925915_2926293_-	glyoxalase	NA	NA	NA	NA
WP_003180767.1\|2926340_2927213_-	DMT family transporter	NA	NA	NA	NA
WP_003180765.1\|2927304_2928192_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_080623619.1\|2928249_2929968_-	assimilatory sulfite reductase (NADPH) hemoprotein subunit	NA	NA	NA	NA
WP_080623620.1\|2929995_2931825_-	assimilatory sulfite reductase (NADPH) flavoprotein subunit	NA	NA	NA	NA
WP_080623621.1\|2932145_2933036_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_016885896.1\|2933243_2933531_+	hypothetical protein	NA	NA	NA	NA
WP_009328767.1\|2933622_2934201_-	maltose O-acetyltransferase	NA	NA	NA	NA
WP_003180752.1\|2934234_2934414_-	hypothetical protein	NA	NA	NA	NA
WP_016885898.1\|2934852_2934936_+	hypothetical protein	NA	NA	NA	NA
WP_011197792.1\|2935538_2936525_+	family 43 glycosylhydrolase	NA	NA	NA	NA
WP_080623622.1\|2936829_2938203_-	serine hydrolase	A0A1D8EXR7	Mycobacterium_phage	2.9e-08	23.9
WP_009328774.1\|2938378_2938663_-	hypothetical protein	NA	NA	NA	NA
WP_011197790.1\|2938652_2939222_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_080623623.1\|2939395_2940586_+	DUF819 domain-containing protein	NA	NA	NA	NA
WP_009328782.1\|2940631_2941807_-	cystathionine beta-lyase	A0A0B5JD48	Pandoravirus	6.7e-22	29.3
WP_009328785.1\|2941796_2942921_-	methionine biosynthesis PLP-dependent protein	A0A0B5JD48	Pandoravirus	5.3e-16	25.6
WP_009328787.1\|2943229_2944177_+	YafY family transcriptional regulator	NA	NA	NA	NA
WP_025808330.1\|2944257_2944746_+	damage-inducible protein DinB	NA	NA	NA	NA
WP_011197786.1\|2944939_2945272_+	hypothetical protein	NA	NA	NA	NA
WP_009328793.1\|2945262_2945985_+	esterase family protein	NA	NA	NA	NA
WP_009328796.1\|2946049_2946559_+	hypothetical protein	NA	NA	NA	NA
WP_009328797.1\|2946568_2946988_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_009328798.1\|2947152_2947548_+	GtrA family protein	NA	NA	NA	NA
WP_009328799.1\|2947570_2948461_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.2e-84	55.6
WP_011197784.1\|2948457_2949444_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	1.6e-53	38.4
WP_009328801.1\|2949539_2950127_+	DedA family protein	NA	NA	NA	NA
WP_009328802.1\|2950166_2950424_-	hypothetical protein	NA	NA	NA	NA
WP_011197782.1\|2950545_2952828_+	ATP-dependent helicase	A0A068EQC7	Bacillus_phage	1.0e-90	35.6
WP_009328805.1\|2952866_2953124_-	sporulation protein	NA	NA	NA	NA
WP_011197781.1\|2953253_2953385_-	YjcZ family sporulation protein	NA	NA	NA	NA
WP_009328806.1\|2953464_2953674_-	hypothetical protein	NA	NA	NA	NA
WP_011197779.1\|2953960_2954317_-	DUF1360 domain-containing protein	NA	NA	NA	NA
WP_009328807.1\|2954463_2954850_+\|coat	spore coat protein	NA	NA	NA	NA
WP_009328808.1\|2954898_2955297_+	hypothetical protein	NA	NA	NA	NA
WP_009328809.1\|2955367_2955880_+\|coat	spore coat protein	NA	NA	NA	NA
WP_011197778.1\|2956011_2956500_+\|coat	spore coat protein	NA	NA	NA	NA

DBSCAN-SWA_5

3528833 : 3538757

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003179539.1\|3528833_3530372_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	4.3e-77	52.0
WP_003179538.1\|3530368_3530956_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.4e-28	41.1
WP_011197613.1\|3530952_3531993_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.7e-62	46.3
WP_003179536.1\|3532116_3533547_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	4.5e-52	32.9
WP_003179534.1\|3533522_3535751_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	4.2e-158	41.5
WP_003179533.1\|3535734_3536418_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003179532.1\|3536414_3536669_-	phosphoribosylformylglycinamidine synthase subunit PurS	A0A0E3FJ99	Synechococcus_phage	8.0e-05	34.6
WP_003179531.1\|3536670_3537387_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3G7P8	Synechococcus_phage	2.4e-46	42.4
WP_003179530.1\|3537461_3538757_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	5.9e-19	27.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP014843

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP014842

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection