CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP019936	Chromatiaceae bacterium 2141T.STBD.0c.01a chromosome, complete genome	3 crisprs	DEDDh,cas6,DinG,csa3,cas3,WYL,RT,Cas9_archaeal	3	5	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP019936_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP019936_1

2100505-2100645

Orphan

Consensus_repeat	Method
CCGAGCGACTAGTCTTTCCCATTCATACCTTCAACTTGCCAACGCAAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP019936_1

>merge|NZ_CP019936|1|2100505-2100645|CRISPRCasFinder
CCGAGCGACTAGTCTTTCCCATTCATACCTTCAACTTGCCAACGCAAAAAAAATCAAGGGGTCAGAGTACTTGATCTGTTGATCCGCCAGGCTCCGAGCGACTAGTCTTTCCCATTCATGCCTTCAACTTGCCAACGCAAA

>NZ_CP019936|1|1|2100505-2100645|CRISPRCasFinder
CCGAGCGACTAGTCTTTCCCATTCATACCTTCAACTTGCCAACGCAAA	AAAAATCAAGGGGTCAGAGTACTTGATCTGTTGATCCGCCAGGCT
CCGAGCGACTAGTCTTTCCCATTCATGCCTTCAACTTGCCAACGCAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP019936.1\|WP_078119548.1\|2089563_2090781_-\|type-II-secretion-system-F-family-protein	unknown	unknown	gnl\|CDD\|224376
NZ_CP019936.1\|WP_164513327.1\|2102314_2103889_-\|protein-kinase	unknown	unknown	gnl\|CDD\|270916
NZ_CP019936.1\|WP_078119544.1\|2087613_2088267_-\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	unknown	unknown	gnl\|CDD\|181557
NZ_CP019936.1\|WP_125932263.1\|2105653_2106475_-\|chain-length-determinant-protein-tyrosine-kinase-EpsG	unknown	unknown	gnl\|CDD\|132074
NZ_CP019936.1\|WP_078119551.1\|2093346_2100072_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274730
NZ_CP019936.1\|WP_078119546.1\|2088655_2089114_-\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	unknown	unknown	gnl\|CDD\|227305
NZ_CP019936.1\|WP_125932009.1\|2104635_2105361_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019936.1\|WP_078119554.1\|2101353_2102289_-\|diguanylate-cyclase	unknown	unknown	gnl\|CDD\|143635
NZ_CP019936.1\|WP_078119562.1\|2110392_2111079_-\|sulfotransferase-family-2-domain-containing-protein	unknown	unknown	gnl\|CDD\|367564
NZ_CP019936.1\|WP_125932010.1\|2109095_2110334_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|132059
NZ_CP019936.1\|WP_078119558.1\|2106618_2107980_-\|chain-length-determinant-protein-EpsF	unknown	unknown	gnl\|CDD\|132062
NZ_CP019936.1\|WP_125932264.1\|2107995_2108769_-\|polysaccharide-export-protein-EpsE	unknown	unknown	gnl\|CDD\|132073
NZ_CP019936.1\|WP_078119553.1\|2100655_2101366_+\|transposase	unknown	unknown	gnl\|CDD\|224854
NZ_CP019936.1\|WP_078119545.1\|2088263_2088656_-\|type-II-secretion-system-protein	unknown	unknown	gnl\|CDD\|225076
NZ_CP019936.1\|WP_078119547.1\|2089126_2089540_-\|type-II-secretion-system-major-pseudopilin-GspG	unknown	unknown	gnl\|CDD\|130771
NZ_CP019936.1\|WP_125932007.1\|2092912_2093293_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019936.1\|WP_125932008.1\|2100071_2100383_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019936.1\|WP_078119543.1\|2086699_2087617_-\|general-secretion-pathway-protein-GspK	unknown	unknown	gnl\|CDD\|377165
NZ_CP019936.1\|WP_078119563.1\|2111132_2114471_-\|DUF4838-domain-containing-protein	unknown	unknown	gnl\|CDD\|374379
NZ_CP019936.1\|WP_078119549.1\|2090786_2092469_-\|type-II-secretion-system-ATPase-GspE	unknown	unknown	gnl\|CDD\|131585

Protein	Function_ID	Function_description	E-value
NZ_CP019936.1\|WP_078119548.1\|2089563_2090781_-\|type-II-secretion-system-F-family-protein	gnl\|CDD\|224376	COG1459, PulF, Type II secretory pathway, component PulF [Cell motility and secretion / Intracellular trafficking and secretion].	5.6338e-114
NZ_CP019936.1\|WP_164513327.1\|2102314_2103889_-\|protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	4.33455e-73
NZ_CP019936.1\|WP_125932263.1\|2105653_2106475_-\|chain-length-determinant-protein-tyrosine-kinase-EpsG	gnl\|CDD\|132074	TIGR03029, EpsG, chain length determinant protein tyrosine kinase EpsG. The proteins in this family are homologs of the EpsG protein found in Methylobacillus strain 12S and are generally found in operons with other Eps homologs. The protein is believed to function as the protein tyrosine kinase component of the chain length regulator (along with the transmembrane component EpsF).	5.52132e-103
NZ_CP019936.1\|WP_078119551.1\|2093346_2100072_+\|hypothetical-protein	gnl\|CDD\|274730	TIGR03696, tRNA_nuclease_WapA, RHS repeat-associated core domain. This model represents a conserved unique core sequence shared by large numbers of proteins. It is occasional in the Archaea Methanosarcina barkeri) but common in bacteria and eukaryotes. Most fall into two large classes. One class consists of long proteins in which two classes of repeats are abundant: an FG-GAP repeat (pfam01839) class, and an RHS repeat (pfam05593) or YD repeat (TIGR01643). This class includes secreted bacterial insecticidal toxins and intercellular signalling proteins such as the teneurins in animals. The other class consists of uncharacterized proteins shorter than 400 amino acids, where this core domain of about 75 amino acids tends to occur in the N-terminal half. Over twenty such proteins are found in Pseudomonas putida alone; little sequence similarity or repeat structure is found among these proteins outside the region modeled by this domain.	3.45966e-20
NZ_CP019936.1\|WP_078119544.1\|2087613_2088267_-\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	gnl\|CDD\|181557	PRK08808, PRK08808, type II secretion system protein J.	6.35706e-19
NZ_CP019936.1\|WP_078119553.1\|2100655_2101366_+\|transposase	gnl\|CDD\|224854	COG1943, COG1943, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	3.47997e-22
NZ_CP019936.1\|WP_078119554.1\|2101353_2102289_-\|diguanylate-cyclase	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	5.42899e-65
NZ_CP019936.1\|WP_078119562.1\|2110392_2111079_-\|sulfotransferase-family-2-domain-containing-protein	gnl\|CDD\|367564	pfam03567, Sulfotransfer_2, Sulfotransferase family. This family includes a variety of sulfotransferase enzymes. Chondroitin 6-sulfotransferase catalyzes the transfer of sulfate to position 6 of the N-acetylgalactosamine residue of chondroitin. This family also includes Heparan sulfate 2-O-sulfotransferase (HS2ST) and Heparan sulfate 6-sulfotransferase (HS6ST). Heparan sulfate (HS) is a co-receptor for a number of growth factors, morphogens, and adhesion proteins. HS biosynthetic modifications may determine the strength and outcome of HS-ligand interactions. Mice that lack HS2ST undergo developmental failure only after midgestation,the most dramatic effect being the complete failure of kidney development. Heparan sulphate 6- O -sulfotransferase (HS6ST) catalyzes the transfer of sulphate from adenosine 3'-phosphate, 5'-phosphosulphate to the 6th position of the N -sulphoglucosamine residue in heparan sulphate.	1.46068e-07
NZ_CP019936.1\|WP_125932010.1\|2109095_2110334_-\|hypothetical-protein	gnl\|CDD\|132059	TIGR03014, Hypothetical_protein., exopolysaccharide biosynthesis operon protein EpsL. The epsL gene is described as a component of the methanolan exopolysaccharide biosynthesis operon in Methylobacillus sp strain 12S, although no other information regarding its possible function is suggested. Homologs of this gene are found in several other exopolysaccharide operons in a small number of species. These operons contain a subset of the methanolan operon genes by homology and synteny, including the epsH gene which is proposed to act as an "exosortase" directing proteins with a C-terminal tag (PEP-CTERM) to the exopolysaccharide layer. Each of the genomes in which these genes and epsL are found also encode genes with these C-terminal tags.	3.52055e-74
NZ_CP019936.1\|WP_078119558.1\|2106618_2107980_-\|chain-length-determinant-protein-EpsF	gnl\|CDD\|132062	TIGR03017, Lipopolysaccharide_biosynthesis., chain length determinant protein EpsF. Sequences in this family of proteins are members of the chain length determinant family (pfam02706) which includes the wzc protein from E.coli. This family of proteins are homologous to the EpsF protein of the methanolan biosynthesis operon of Methylobacillus species strain 12S. The distribution of this protein appears to be restricted to a subset of exopolysaccharide operons containing a syntenic grouping of genes including a variant of the EpsH exosortase protein. Exosortase has been proposed to be involved in the targetting and processing of proteins containing the PEP-CTERM domain to the exopolysaccharide layer.	3.42138e-171
NZ_CP019936.1\|WP_125932264.1\|2107995_2108769_-\|polysaccharide-export-protein-EpsE	gnl\|CDD\|132073	TIGR03028, EpsE, polysaccharide export protein EpsE. Sequences in this family of proteins are members of a polysaccharide export protein family (pfam02563) which includes the wza protein from E.coli. This family of proteins are homologous to the EpsE protein of the methanolan biosynthesis operon of Methylobacillus species strain 12S. The distribution of this protein appears to be restricted to a subset of exopolysaccharide operons containing a syntenic grouping of genes including a variant of the EpsH exosortase protein. Exosortase has been proposed to be involved in the targetting and processing of proteins containing the PEP-CTERM domain to the exopolysaccharide layer.	5.60705e-112
NZ_CP019936.1\|WP_078119546.1\|2088655_2089114_-\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	gnl\|CDD\|227305	COG4970, FimT, Tfp pilus assembly protein FimT [Cell motility and secretion / Intracellular trafficking and secretion].	2.39763e-08
NZ_CP019936.1\|WP_078119545.1\|2088263_2088656_-\|type-II-secretion-system-protein	gnl\|CDD\|225076	COG2165, PulG, Type II secretory pathway, pseudopilin PulG [Cell motility and secretion / Intracellular trafficking and secretion].	6.15433e-07
NZ_CP019936.1\|WP_078119547.1\|2089126_2089540_-\|type-II-secretion-system-major-pseudopilin-GspG	gnl\|CDD\|130771	TIGR01710, Type_II_secretion_system_protein_G, type II secretion system protein G. This model represents GspG, protein G of the main terminal branch of the general secretion pathway, also called type II secretion. It transports folded proteins across the bacterial outer membrane and is widely distributed in Gram-negative pathogens. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis].	7.93423e-42
NZ_CP019936.1\|WP_078119563.1\|2111132_2114471_-\|DUF4838-domain-containing-protein	gnl\|CDD\|374379	pfam16126, DUF4838, Domain of unknown function (DUF4838). This family consists of several uncharacterized proteins found in various Bacteroides and Chloroflexus species. The function of this family is unknown.	8.46598e-49
NZ_CP019936.1\|WP_078119543.1\|2086699_2087617_-\|general-secretion-pathway-protein-GspK	gnl\|CDD\|377165	pfam03934, T2SSK, Type II secretion system (T2SS), protein K. Members of this family are involved in the Type II protein secretion system. The T2SK family includes proteins such as ExeK, PulK, OutX and XcpX.	1.2437e-21
NZ_CP019936.1\|WP_078119549.1\|2090786_2092469_-\|type-II-secretion-system-ATPase-GspE	gnl\|CDD\|131585	TIGR02533, Type_II_secretion_system_protein_E, type II secretion system protein E. This family describes GspE, the E protein of the type II secretion system, also called the main terminal branch of the general secretion pathway. This model separates GspE from the PilB protein of type IV pilin biosynthesis. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis].	0

>NZ_CP019936.1|WP_125932008.1|2100071_2100383_+|hypothetical-protein
MMKADVVITVRFLTQEEGGRNTPIVSDSYGCPLMLGDEGFDCRFVLDGKTCFELGKEYAIPIKFLNRDKAFESLKANSEISLWEGKTIATGRIVDVCDRGFDS
>NZ_CP019936.1|WP_078119551.1|2093346_2100072_+|hypothetical-protein
MKFSSIVKSGASALLVAAFCLPLQTNAAAPTELQSYVVGSLAGRFSVEQGAANYSVPIAVPPGVAGVQPELAFSYSSSGGNGTLGVGWSLSGLSAITRCGRTLVQDGQLGTVEWKRSDRYCLDGQRLVLVSGTYGEDGSEYRTETDGFTRIRAHGQAGEGPASFSVQTKAGLTVEYGNTADSSAKAQGRSEVQAWSQNKITDAVGNSMAMIYVEDPQTGQQMIDRIEYAANIVQFIYEPASRVQMYHLSGTAKGLSNRLSKVEVRAEGSLISDYRLAYEEVGASILQLLTSITQCLADGPCLSPTIFLWDGENSNTIVNRQIWHSDTAPNFNGDWHQAFVDMTGDGLPDFVQHYQGSSGSRVWVYENTAAGFKDRVIWDHDTAPNFNSDWHQQFVDMTGDGLPDYVRHYQGSSGSRVWVGINTGSGFETRKIWHSDTAPNFNSDWHQAFVDMTGDGLPDFVQHYQGSSGSRVWVYENTAAGFKDRVIWDHDTAPNFNSDWHQQFVDMTGDGLPDYVRHYQGSSGSRVWVGINTGSGFETRKIWHSDTAPNFNSDWHQAFADMTGDGLPDFVQHYQGSSGSRVWVYENTAAGFKDRVIWDHDTTPKFNGDWHQQFVDMTGDGLPDHVRHYQGSSGERVWVGVNTGSGFETRAIWRSDTVPNFNSDWHQAFVDMTGDGLSDFVQHYQGKSGGRVWVHSNIGGVSRHITEFKDSLGAKIAVRYDALTTKGFYVKGEGGVHPTPNLQMPMWVVSDVEKSNGLGGTTSTGYRYGGLRAHVQGRGLLGFAWDEATDESTGVTTRTEYHQDYPFTGMPKAVTTYAADGTVLSSTTTTYEDLYAVHPETRPDGSVWDYETHFPYLVEKVEKSYELDGTLVSTAITRQSNYDAYGNVGTVEVITEAGGETFSKVTTSNYDNIVTADKWHLGRLRDATVVHTHSNGSTETRKSAFTYYAETGLLKDEIIEPDQPAYRQVTTYEYDAFGNKVRVAVSADGLPTRISTSGYDPSGRFATSVQNALGHAEARTFDHATGKALSLTGPNNLTTRWEYDGLARVERELRADGTETLTTRTWVDASDAHAPVAAYYKVTEEISGSAPASVYYDQLGRVIRKLSTGFDGKAIYQDTEYDEQGREYRSSLPYFVDDPAYWVINHYDEVNRVVKKSFDTGKGTVVTQIDYQGLTTVETNTLGQVKRTTKNALGKVVLVEEEEGGKVTYEYDAIGNLLKTHQHDDASAKVVTTELWYDVRGQKTAMQDPDMGYWTYQHNAFGELVSQTDAKNRSVSMTYDNLGRMIRRVEPEGETVWTYDTAQKGIGKLYKVEQFDTTGTLLYSTEHSYDNFGREIVSVNAFDGKVFNTAVEYDAFGRVAKSWRPNGFETENLYNQYGYLLAKRSPSNHVNDYDAQHLAGLYDDAVTSAQSALDAAADLLDRQAYFLTKAAEYEALGDTAVNLPQDLLDHLQEAAELSHYAAQALSADIDNALTLAEQLIVVAGGLRDRMEQAELWVDASQSETLDAMLADPAYVTWWRATSRDAAGRLTGHRTGNGLVTIQDYDRATGQLNTIQTGFGHGDLIRHLDYEYDALDNVQARRDRIQDAHETFDYDGLNRLVTSTVDGTADGIAYHAETTYVYDALGNMLNKSDVGTYLYGNAAKSVGNAGPHALSHAANDEYIYDDNGSITEGGGRTITWTSFNKPTSFQKDGTVVQFHYGPDRARYKKTVGGMVGFDETTLYLGKSYERVEKSNGEVTHKYFIYADDGLAAIHIEHEDGNGVIDESRDETRYLHRDALGSIDTITDGQGVIVERTGYSPFGERRAGDWRTIGGLNLALYTNRGFTGHEHIDEVGLIHMNGRVYDPQLGRFLSADPHVQAPYSSQSYNRYAYAMNNPLKYTDPSGYFFKKLFKSIKKAFKSIGKFLKKYGRVIVAIAAAAFIGPAAAGALGFTSGTLAFSIAAGAVGGFVSGAILGGSLKAGLKGALFGGISAGLAFDIGHGSIGNWLEGAFDGAVAVARDIAHGIAQGIVSELSGGDFKSGFLGGALGHYAGRRAQHYFGNMEGATGVAARTTVAAVAGGTASTLGGGKFGNGAISAAFSHLFNNEGQSICKGSCHGYDGTPGRSMTKNEQLVLTVSSMVVPGSGFFSAVRSLFNGLRSITLYRAVGPAELLDIQATGQLINRGSAEGKYFTSSAAYASDYARQAVNSFGDPAYTIVSTRVRISSLPTPVSVDGGIPAYVLSNDSLQSLRPEILNYMALPH
>NZ_CP019936.1|WP_125932007.1|2092912_2093293_+|hypothetical-protein
MWASVSREPLQEKSLFDAAESKTDSGETSITRPSDESAPAGESPYKSTASSSLDRTVRSLKDDVGAIGHSPTSETANAVKSADDAIARADAALSAAGVSPPKNADKNNASSEKLTALQARLDRLRD
>NZ_CP019936.1|WP_078119549.1|2090786_2092469_-|type-II-secretion-system-ATPase-GspE
MTATLGDILISSGKLAADQLERVRNLQAEKGGLLGPLLVQLGFVSERDLAAALAESLGSPLAEKKDYEEPAEVDGQISPEFLRKHHLVPLRVSHEEVEVALADPGDGFVIDAVKLAFGRDVAVRIGLISDIQAALNRHYAEEADETAAESLSTTNEVDEIAHLRDMASEAPVIRRVNQLIGRALELRASDIHIEPFERDVVIRYRVDGVLRTIDFPKGVTPAAIVSRIKVMAHLNIAERRLPQDGRIKLRVEGREIDLRISTVPTLYGESVVMRLLDRGDVTLDLPSLGFGDQTLKRFEQLLARPHGIMLVTGPTGSGKTTTLYAALSTLNTPDRKILTVEDPVEYQIEGINQIPIKPNIDLTFANALRAILRQDPDIIMIGEMRDVETARIAVQAALTGHKVFSTLHTNDAASSITRLQDMQVDDYLITSTVDGILAQRLVRRLCPDCREAYQPTDIMVEELGLTLLLKTETPTLYRATGCEACDHTGYRGRTTILELLVMTEPLRRAIIAKEDADALRRIALAEGMLDMRSDGLRKAAAGLTSVEEVERVVQSLVAIE
>NZ_CP019936.1|WP_078119548.1|2089563_2090781_-|type-II-secretion-system-F-family-protein
MPLFRYKAARNDGTVIDGQLEAADEQRAAQVLQAQGHVPIQIDSAVGQAASGVTRQVRRSSKANAATIDFFTLELATLLRAGLPLAQALETLTGLADSPAMAELAESVNTLVRDGQSLSNALEQTHPGFDAFYCNMVRAGESSGALDLALERLAEFRASRRELRNSLISALIYPVILLVMALIAVAVLLAFVVPQFTQMFADAGRELPLLTRIVAGAGEIVTNYWWLIIAVIGGSIWWAIRDWRTPTGRLRWDRWLINAILVGPLVRKLNAARFARTLATLLDNGVHLMPALGIAKEIVGNSVMAQGLDVVAERVREGAGLSAPLAETEVLPPLATQLIRLGESSGKLEMMLTQVADIYERDVQNSMKRLLTLAEPVIIIMIALLVTVIILSVVLMILESNNLAF
>NZ_CP019936.1|WP_078119547.1|2089126_2089540_-|type-II-secretion-system-major-pseudopilin-GspG
MHIQRRNRGFTLIELIVVIALVAVLAAVVAPNLLSKASDANRKTAGVQIEKIFNAVELYRLETGSYPEALSDLVKRPEGNERWNGPYVRKLSTLKDPWGNELVIQRPGQNGPFDIVSYGADGQPGGEDDAADINSAE
>NZ_CP019936.1|WP_078119546.1|2088655_2089114_-|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein
MTVALRSPARGFTLVEVIIVIALVAVMAAVLSPMLMTSPIRALQAEARDVATTLRETRRLALARQSRQRFVVDTDSGRYGIASNTLSAALPDGMQAQLTTDESLLTNESTGSIDFFPDGSSSGGRVSLVMADRFLDVDVEWLTGRIRVREPH
>NZ_CP019936.1|WP_078119545.1|2088263_2088656_-|type-II-secretion-system-protein
MKPAHGFTLLEILVALTMFAVVGGSLLQLFQGGLRTARISTEHTHAIFLARSKLTELQAYGHLEPGTLSGNFGDGYRWQAELTPAPVDESVGENPWLQPLALTLTVYWGEHDDERTFALQSLLLSQQGPS
>NZ_CP019936.1|WP_078119544.1|2087613_2088267_-|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein
MMRRQHGFTLVEILIALSIGALLISLVYGAVRIGQRSTTALIDQTGDNEVMRIGWQFTHDALTRALPIPSRDNSDDKTLFIGNPDRVQFVADMPAYVGIGGLMQIELGINASPKGEQLVLTRQHFDKATASATAETAQQAVLVDELDGFDVRYFGATDIGVAPSWQSDWPSQVILPNLIQIKVTPKDGEPWPLLVARPLTGTVPLDDEIQPDEGGLQ
>NZ_CP019936.1|WP_078119543.1|2086699_2087617_-|general-secretion-pathway-protein-GspK
MSRPCTQRQNGFALILVIWAVIMLASLASGFSLAVRHETRVAGDTAAIAHAEAAATAALHTAVLAFGSADAETRWQSNLEPHQLAWPGASIVVRAQSESGRIDINRAPRELLVGLFEQVLPNNDANELADAVVDWRDRDDEALAGGSEKRAYSGAGFAYTPPNMPFHSVNELSQVMGFNSAMVSRVRQYLTVYSRQPRINATSADLVTLNAVPGIDRDDAEAFIAERDRTLAEGGTLDFTALRNGRRYLDTRPGHMLLSLDIDVRLSDGLRRREHAVIQLNRARGYNLLLRETLPIPLDSEANGG
>NZ_CP019936.1|WP_078119553.1|2100655_2101366_+|transposase
MARRPRHVVPGQALHLIQRGNNRQAIFFADEDYQFYYEALQDAAHRYQCAVHAYVFMTNHVHLLLTPSSEDGPSRVMQSVGRRYVRYVNTAYRRTGTLWEGRFKSAIVDSERYLLVCSRYIEMNPIRAGMVSAPQQYRWSSYRGNAQGQADSLLSSHDVYQRLGQDLASCREGYRQLFERQLDVVTLGQIRLATETGAVIGNDRFRDEIELALNRRVRPYRHGGDRKSKAFRDQEL
>NZ_CP019936.1|WP_078119554.1|2101353_2102289_-|diguanylate-cyclase
MSDQDSITQNLAETILESTVGDDSRPDTTPKPEPYLVILSGSDEGQLFALARARNSFGRGHDADIVLTDPKLSRSHGAFLVDGERIEIIDFQSTNGTFLDGERIDRAIVQPTSRVLAGASEMKIEFKRATEIEAERKLYEAANTDPLTSALNRRAFMARAEQELANAERTGSRTSLMMCDIDHFKRINDNHGHPAGDHVLKELVDILRSHIRKEDLLARFGGEEFVLLLCRTEQDAAGDWAERIRSAVEQHQFVFDGKSIPVTLSMGISCPAQAAGVPLDKMIQDADGALYRAKQAGRNRVVEAESRGQSS
>NZ_CP019936.1|WP_164513327.1|2102314_2103889_-|protein-kinase
MPESTLLNDRFVIGRVLGKPGGFGITYLAWDKVLETAAAIKEFLPLSSVSREAGTISVLPNSDEDAAAFDTGLQVFMKEAKTLAQFSHPNIVRVRDYFPANNTAYLVMDFHRGQSLDEFVKSEQGPLSETLALQIMLPILDGLKEVHAKGFLHRDIKPQNIYLTDKATPMLLDFGAARMALAGVTKTMTVMLSAGFAPFEQYHAKGRQGPWTDVYGVAATLYYMVTGKVPQDAIERQHEDKLLPPIVFNKNLSKRFSQAIMRGLAVEPGNRPQTAMALRNALSGDFHQDGTATVATLAPTVASAAPPRPIAASSPQTVIFDSQPPDTRGGLNRWIALALILAVGLLVWSKWQPDTPQSGDQVARPNMPAKPTTVVRAPSPTPPNPTTETTAQPAPVEHQQRQPAEVAGAPRVSGQPSAPQVLAPPPPVESAPPPSTRPREAATAPPPERLRPTQPAFANQRPRPPQQAFDACRNRSVGSTCKIRSPRGEETGQCESFDTSGVACVPDFHRADGRQPPAARSARF
>NZ_CP019936.1|WP_125932009.1|2104635_2105361_+|hypothetical-protein
MNRLITIGGFSAAIALSGYGHAALITEGLTYTVASAPSEIHTHSDPSCCDSSPFGNPPDKAEVGAFSGEPGFVEEIRGFSEFDLTGVTSGSPAYLTFDVYNDGGLFLDVAPVVPNNDFPFFGPITIEAFEADGNFTFSDVTDNFFIATSIVIDTFDTSPLSVGDILSFDVQSVVSDAIDNGWSALGVRLRADPVVLSGAWTFDQLGLTTTDESTGVPLPATFAFLLIGVAAMGASRKQMLT
>NZ_CP019936.1|WP_125932263.1|2105653_2106475_-|chain-length-determinant-protein-tyrosine-kinase-EpsG
MGAILIRAGRLSPTDAERILQKQSEENLQFGAAGLKLGLITKDDIQYALNRQFDFPCLSPQTSLISTEVTAAFDPGSPQIEALRALRSQLLLRWFSDAPSRKTLAIVSPNQGDGRSWLTANLAVVFSQLGQRTLVIDANMRQPTLHRWFGLDNRLGLAAVLSRRGGPQCIQPVPDIRALSVLPAGAQPPNPQELLARRAFAGLLKQSADAFDVVLIDTPPAGQYADAQTVSVRADGALVIARKDSTPVDVLKTLRQELHQAGAIVCGSVLNQH
>NZ_CP019936.1|WP_078119558.1|2106618_2107980_-|chain-length-determinant-protein-EpsF
MTIIQLLRLVRARWRIVLLTFVLVVGAAAALNAYLPEKYTSTASVVIDVRQADFTYGSTLPGQTLTSYVATQVDIISSVRVAQRVVEMLELDKLPGVRERWLDKTGGEGTLVSWMALVVKDNLEVYPGRDSNVIYISYSGANPERAAAIANAFAQAYIETNLELKVDPARQYSEWSSGRSQSLRDELESARKRLSDYQQEHGIVAVDDERLDIEVARLSELSSQLSTAQGQRADSASRLSQSSSPDTLPEVMQNSLIQSLKSDLAKLETQRDQLSVRLGSNHPERQRVETEIAGLRGKIRAETKRVANSLSTTNLVSESRLTEIKAAVEAQKAHVLQLRAQRDQIAVLQRDVEHAQNTFDLVTQRLAQSNLEKQTQQTNVVVLTPAIPATRPSSPKVMRNMALSVVMGMTLGFGLAYLLEFFNPRVRSRDDLATSLEAPVLGVIPGANMASKH
>NZ_CP019936.1|WP_125932264.1|2107995_2108769_-|polysaccharide-export-protein-EpsE
MLFILLAMGTQSWAQDREYALGAGDVIRITVFQNPDLTTEARVSENGNITFPLIGSVAVGGRSIANAERNIADHLRDGGYVLQPQVSILPIQIRGNQVAVLGHVNRPGRYPLETLKTRLSDMLATAGGISSTGSDIVVLVGERDGKPLRVTVNIPEVFAAGDFSKDMLLHDGDRIYVQRAPSFYIYGAVNKPGIYRLEDKMTVMQGLATGGGINPRGTQSGLRIHRRGKSNNIEVIEPDLNQALAPNDVIYVKESLF
>NZ_CP019936.1|WP_125932010.1|2109095_2110334_-|hypothetical-protein
METSGTTAGFERTRPLRGLPGLTAVICLIAVTSSHAADDEDPLQFVISQSFRHDDNLFRLSDDESPPGDGSRSDTLSVTSAKARFAKRYSRQFVSASARVSSVAFDKWDELDYTTKGASAAWRWAVGSRWTGLLNANYDEVPRDFSEILTIDDEVSINEQRTLGGTANYWFHPDWAVSGGVEQYDSSLSDTASESAEYQAMIYDLGVTYRPGSGNRLALTGRYTDGEYPNRIATSTQDEGYTQKDIRLAGEWKFTGASKLSGYVGLTEREYENLGAKDFSGVTARIQHDWDISGKTKLRTTARREIGAREDLINNFVVVTAFSVAPSWTPTERISVSGLWEIKKRDFEGDPGFVVNSTDLDDTTNRFRASVAYQPLDNLNLELSQTYIERESDRASAEFDANVTELTMRLLF
>NZ_CP019936.1|WP_078119562.1|2110392_2111079_-|sulfotransferase-family-2-domain-containing-protein
MISHDHHCIFVHIPKAAGTSIETAFGHLDGHAGREGQDHRTFRMMLWPSLALSSFSSVDNVKEVIKATVYPFTSHPNARNRVSANKHQIEQYFKFTVVRNPWARAFSWYQNVKRDAEHQRLLGVDADIDFKTFFKRFRGRGMLKPQTHWLKDFDGKIPMDYICRFESLQQDFSVACERMGIDEIQLPHALKGSGKHYADFYDAETKALADETYADDIELFGYQFGDKS
>NZ_CP019936.1|WP_078119563.1|2111132_2114471_-|DUF4838-domain-containing-protein
MPLDRQRVLLFSLVILASSVVAAVDGRNESLLLHDFENRNAWRGSGKPTAHEGREGNGLAVHGGFAMSPSVGRIEVSNPRDLEVTAWVKCTDCRPHSAGIAVLAKNAGDKVLGSWLEGEIPRYWMDRGQSAVLAANETAGWERLTGRIPAQHIPAGTHYLDIYLRADLDAADHATAVFDTLSVNALPPGVVEPTRIMRNGGFEQGRRPWWGKTGKIVDSTSFAGNHALELDSGFVAQDRRPVQAGQNYRISLAVKSVGAPNDSVFVQLSFRGNGVSPGWFGPERIKLKRRTERALLVTGGDSDWRQYSTVVTAPHGANELLLYLRKKKGTPGLAYFDAIETVATTEAAATPASIKLKELRAKLIGQMPPGRLPSGWNDDSTALLIADAQVPHLRIAVQKSPDVVVLNAVGELAEYLQRMSGADFLPIQEGMTPDAQGLIGVGAGPDWMARFFPALDTDSLGADGFAIRAEGQRIVIGGGTARGAMYGVYWFLDRKLGVKWLSPDFTHVPNMHRLSVEHFDTVQIPRFSYREILSHEGEDKRFRAHNLLNGESHGPSFLDSPPEIDVWDQSWLAKGGSANFWQLAQRKKNAKVHPEWFTGGQVAMMNPALRRKTAESVIEQLRRQKDYRAIWFGILDMDWGWDMDRQSAAFAEQHGGMPSAPRLDMMIEVAEIVRESLPGAKLAFNAYHWSMTPPDKLSVPDHILVFPMTINVDYSSALNKGNNLQLGADLVGWNERARHVLVWDHIANFSGFLQPTPNIYPIAESVKWLATLENVQGYFAEGSWNTPSAEFAQLRAWMLSRLLWNPDLDPEEVVREFCELYYGPAAQPVMQYIDLMHRAIRQSGDVLAEKTQVDLKMFNLEFVSEVDAFFDRAEKLAADDPVRLKHVRAARMPIDYVAAARHLDLRNEADAKGIVWPRDNAARIARLMASAKAAGVKWYRQGGDLKKMERMLRVKRKDPTPPPASLLTAANDWHDFQDLSLNRYAATSIVADADASDGGAARIPAGKKGWLIQFKLDKLPSVGAWDLYVAMRPERTAAVSAEPYANVGSYPPMTLFRAVRKAANDSGYQYIKVPGGPFEREVNHQRGIYVQSQTDKDTTGVLVDRIVAVRKK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP019936_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP019936_2

2132437-2132565

Orphan

Consensus_repeat	Method
CGATGGCGACGGCGTACCGGACGACAAAGACAAGTGCCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP019936_2

>merge|NZ_CP019936|2|2132437-2132565|CRISPRCasFinder
CGATGGCGACGGCGTACCGGACGACAAAGACAAGTGCCCCGGCACCCCGGCTGGCGCGCCGGTCGATGCCGATGGCTGCCCGCTGGATAGCGATGGCGACGGCGTACCGGACTACAAAGACAAGTGCCC

>NZ_CP019936|2|2|2132437-2132565|CRISPRCasFinder
CGATGGCGACGGCGTACCGGACGACAAAGACAAGTGCCC	CGGCACCCCGGCTGGCGCGCCGGTCGATGCCGATGGCTGCCCGCTGGATAG
CGATGGCGACGGCGTACCGGACTACAAAGACAAGTGCCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP019936.1\|WP_078119586.1\|2138695_2139952_+\|NADP-dependent-isocitrate-dehydrogenase	unknown	unknown	gnl\|CDD\|180792
NZ_CP019936.1\|WP_078119580.1\|2134569_2135073_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019936.1\|WP_078119585.1\|2138004_2138625_-\|pseudouridine-synthase	unknown	unknown	gnl\|CDD\|211334
NZ_CP019936.1\|WP_078119576.1\|2129695_2130883_-\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|225406
NZ_CP019936.1\|WP_078119583.1\|2136920_2137553_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019936.1\|WP_164513330.1\|2135142_2135799_-\|high-frequency-lysogenization-protein-HflD	unknown	unknown	gnl\|CDD\|377325
NZ_CP019936.1\|WP_078119572.1\|2125700_2126291_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|238009
NZ_CP019936.1\|WP_078119571.1\|2124205_2124481_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019936.1\|WP_078119577.1\|2131074_2131956_-\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|273359
NZ_CP019936.1\|WP_078119575.1\|2129262_2129709_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379326
NZ_CP019936.1\|WP_078119582.1\|2135779_2136850_-\|tRNA-2-thiouridine(34)-synthase-MnmA	unknown	unknown	gnl\|CDD\|234664
NZ_CP019936.1\|WP_125932011.1\|2124924_2125161_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019936.1\|WP_078119573.1\|2126644_2128228_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|143598
NZ_CP019936.1\|WP_078119588.1\|2140728_2141052_+\|ATP-dependent-Clp-protease-adapter-ClpS	unknown	unknown	gnl\|CDD\|225038
NZ_CP019936.1\|WP_078119587.1\|2140052_2140265_-\|cold-shock-protein	unknown	unknown	gnl\|CDD\|224197
NZ_CP019936.1\|WP_078119579.1\|2133059_2134427_-\|adenylosuccinate-lyase	unknown	unknown	gnl\|CDD\|236452
NZ_CP019936.1\|WP_078119569.1\|2121038_2121869_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133029
NZ_CP019936.1\|WP_078119570.1\|2121970_2123380_-\|undecaprenyl-phosphate-glucose-phosphotransferase	unknown	unknown	gnl\|CDD\|274396
NZ_CP019936.1\|WP_164513329.1\|2128424_2129180_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224367
NZ_CP019936.1\|WP_078119584.1\|2137539_2137986_-\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|239647

Protein	Function_ID	Function_description	E-value
NZ_CP019936.1\|WP_078119585.1\|2138004_2138625_-\|pseudouridine-synthase	gnl\|CDD\|211334	cd02566, PseudoU_synth_RluE, Pseudouridine synthase, Escherichia coli RluE. This group is comprised of bacterial proteins similar to E. coli RluE. Pseudouridine synthases catalyze the isomerization of specific uridines in an RNA molecule to pseudouridines (5-ribosyluracil, psi). No cofactors are required. Escherichia coli RluE makes psi2457 in 23S RNA. psi2457 is not universally conserved.	1.68672e-89
NZ_CP019936.1\|WP_078119576.1\|2129695_2130883_-\|cupin-domain-containing-protein	gnl\|CDD\|225406	COG2850, COG2850, Uncharacterized conserved protein [Function unknown].	3.59076e-95
NZ_CP019936.1\|WP_078119586.1\|2138695_2139952_+\|NADP-dependent-isocitrate-dehydrogenase	gnl\|CDD\|180792	PRK07006, PRK07006, isocitrate dehydrogenase; Reviewed.	0
NZ_CP019936.1\|WP_164513330.1\|2135142_2135799_-\|high-frequency-lysogenization-protein-HflD	gnl\|CDD\|377325	pfam04356, DUF489, Protein of unknown function (DUF489). Protein of unknown function, cotranscribed with purB in Escherichia coli, but with function unrelated to purine biosynthesis.	2.0779e-84
NZ_CP019936.1\|WP_078119572.1\|2125700_2126291_-\|hypothetical-protein	gnl\|CDD\|238009	cd00052, EH, Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction. The alignment contains a pair of EF-hand motifs, typically one of them is canonical and binds to Ca2+, while the other may not bind to Ca2+. A hydrophobic binding pocket is formed by residues from both EF-hand motifs. The EH domain binds to proteins containing NPF (class I), [WF]W or SWG (class II), or H[TS]F (class III) sequence motifs.	4.70503e-05
NZ_CP019936.1\|WP_078119570.1\|2121970_2123380_-\|undecaprenyl-phosphate-glucose-phosphotransferase	gnl\|CDD\|274396	TIGR03023, Sugar_transferase., Undecaprenyl-phosphate glucose phosphotransferase. This family of proteins encompasses the E. coli WcaJ protein involved in colanic acid biosynthesis, the Methylobacillus EpsB protein involved in methanolan biosynthesis, as well as the GumD protein involved in the biosynthesis of xanthan. All of these are closely related to the well-characterized WbaP (formerly RfbP) protein, which is the first enzyme in O-antigen biosynthesis in Salmonella typhimurium. The enzyme transfers galactose from UDP-galactose (NOTE: not glucose) to a polyprenyl carrier (utilizing the highly conserved C-terminal sugar transferase domain, pfam02397) a reaction which takes place at the cytoplasmic face of the inner membrane. The N-terminal hydrophobic domain is then believed to facilitate the "flippase" function of transferring the liposaccharide unit from the cytoplasmic face to the periplasmic face of the inner membrane. Most of these genes are found within large operons dedicated to the production of complex exopolysaccharides such as the enterobacterial O-antigen. Colanic acid biosynthesis utilizes a glucose-undecaprenyl carrier, knockout of EpsB abolishes incorporation of UDP-glucose into the lipid phase, and the C-terminal portion of GumD has been shown to be responsible for the glucosyl-1-transferase activity.	0
NZ_CP019936.1\|WP_078119582.1\|2135779_2136850_-\|tRNA-2-thiouridine(34)-synthase-MnmA	gnl\|CDD\|234664	PRK00143, mnmA, tRNA-specific 2-thiouridylase MnmA; Reviewed.	0
NZ_CP019936.1\|WP_078119579.1\|2133059_2134427_-\|adenylosuccinate-lyase	gnl\|CDD\|236452	PRK09285, PRK09285, adenylosuccinate lyase; Provisional.	0
NZ_CP019936.1\|WP_078119573.1\|2126644_2128228_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|143598	cd07574, nitrilase_Rim1_like, Uncharacterized subgroup of the nitrilase superfamily; some members of this subgroup have an N-terminal RimI domain (class 12 nitrilases). Some members of this subgroup are implicated in post-translational modification, as they contain an N-terminal GCN5-related N-acetyltransferase (GNAT) protein RimI family domain. The nitrilase superfamily is comprised of nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes, which depend on a Glu-Lys-Cys catalytic triad. This superfamily has been classified in the literature based on global and structure based sequence analysis into thirteen different enzyme classes (referred to as 1-13), this subgroup corresponds to class 12. Members of this superfamily generally form homomeric complexes, the basic building block of which is a homodimer.	5.11214e-143
NZ_CP019936.1\|WP_078119588.1\|2140728_2141052_+\|ATP-dependent-Clp-protease-adapter-ClpS	gnl\|CDD\|225038	COG2127, COG2127, Uncharacterized conserved protein [Function unknown].	3.96289e-47
NZ_CP019936.1\|WP_078119587.1\|2140052_2140265_-\|cold-shock-protein	gnl\|CDD\|224197	COG1278, CspC, Cold shock proteins [Transcription].	8.04106e-38
NZ_CP019936.1\|WP_078119577.1\|2131074_2131956_-\|DMT-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	6.6325e-12
NZ_CP019936.1\|WP_078119569.1\|2121038_2121869_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133029	cd04186, GT_2_like_c, Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	4.98272e-44
NZ_CP019936.1\|WP_078119575.1\|2129262_2129709_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379326	pfam13673, Acetyltransf_10, Acetyltransferase (GNAT) domain. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.46574e-28
NZ_CP019936.1\|WP_164513329.1\|2128424_2129180_-\|hypothetical-protein	gnl\|CDD\|224367	COG1450, PulD, Type II secretory pathway, component PulD [Cell motility and secretion / Intracellular trafficking and secretion].	4.27474e-07
NZ_CP019936.1\|WP_078119584.1\|2137539_2137986_-\|NUDIX-hydrolase	gnl\|CDD\|239647	cd03675, Nudix_Hydrolase_2, Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function. In general, members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity. They also contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which forms a structural motif that functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	2.35452e-67

>NZ_CP019936.1|WP_078119577.1|2131074_2131956_-|DMT-family-transporter
MVDNRLISGALLIVAAELMFALMGASIRMVSVDLNNGMVVFARNVVGLALLASLASHPDYRDMRTRVPHLHLLRGAAGLGAMYCFYYAIAHMPSLANAMLLKLTAPLFIPLVALLWLAERFTWHVLAAITIGFAGVAVILTPDFSSMAPVALIASLGGILAAIAKVAVRKLSATEPASRTVFYFALIGTLVSAIPLIWLWRTPTSSQLLWLLMVGGLATAGQLLLTRGMACAPAARLGPFTFFSVVFGAALGWFFWQQTLGWSTIAGTLLVLLSAVLVGRGMPHSTPLPAKAG
>NZ_CP019936.1|WP_078119576.1|2129695_2130883_-|cupin-domain-containing-protein
MTGQHTTIRLPDGIDRETFLRDYWQKKPLLMRAAISPQHFQLMPDELAGLACENEFESRLIIEQSETAWTVQHGPFDEQDFASLPESHWTLLVQDVDKFVPDVAALIDLFDFVPSWRIDDIMISYATDQGGVGPHTDAYDVFLMQAQGRRRWRISDRRYTDDDLIPGLEQRILSHFITSDDWLLEPGDILYLPPGVAHWGTAEGDCMTYSLGFRSPNQQELAADWFQYLVDQCAAQRLQDPDDIDADHLGQITPGAIDNAARLFAALPTLDSTAFALWLGDHLTEAKTQFQIEPPESPWSDADLTAWLRGGHALVRHPFARLAWQALPDGAPALFYQGEHRIYPAAATATVNTLCMHRRLDTRTVSALLADNADSRTVVLDLLNEGVLEAEDADE
>NZ_CP019936.1|WP_078119575.1|2129262_2129709_-|GNAT-family-N-acetyltransferase
MPMSDYQVVEADWSSQQDALLGIRFTVFVDEQSVPPELERDHYDREALHLLALNGDGKPIATARMLTDGHIGRMAVLKEWRGRGIGSALMNRLIDIARQRGYAEVFLHAQCTAEPFYRRLGFVAEGEVFVDAGIDHRAMRMSLDAENA
>NZ_CP019936.1|WP_164513329.1|2128424_2129180_-|hypothetical-protein
MAAHGESAVIQIRSQPAAALVDTIRPLVGPNGSVSAYHDKLVVSGTPQQIATVRATLQQLDRPPRRLIIEVRQSGSLSSSRRDIGYGVNTDNVRLGRVPPGSKAQITYQEAQTRGQDDSLQRVQALDGRPALIRAGQSVPVYSAHQQVIGNSVVQGFNMQYRDTGSGFYAVPRVHGDHVTVEIFQQHSRAASGGRFINQEASTVLQGAIGQWLMLGAIGGDDSNNRNEFGRHVQTHRSQDRSLELRVIPVD
>NZ_CP019936.1|WP_078119573.1|2126644_2128228_-|GNAT-family-N-acetyltransferase
MSADDLSNALDDPRSRLEVRNAKLTDIPAIAGLSAKVYTGTGMYGYTEGPLTGQINNFPEGQFVAVIGDKVVGYCATFRVAESEGLGKHNWTEITGNGYASRHDPQGDWLYGMEVCVDPDLRGYRIGQRLYNERKKLCQSLGLKGIVFAGRLPTLARRIKKFGSAEAYVEQVVQKKQRDPVLSFQLRNGFEVIGVIPHYLDADQQSMGYGVHLTWNNPKVDQEQLEGRQKRYGGRLPDTIRVGTVQYMQRRVKSFDEFLSFIEYFVEVVSDYKGDFVVFPEMFALQLLSIENQELNPAESIEALSRHTPRFKEALRDMAIRYNINIIGGSHPTLMPNGRVENIAYVFLRNGAIFEQPKIHPTPNEVYWWNIEGGSVLNAIDTDCGPIGVLICYDSEFPELARHLADQGAQILFVPFCTDERQSYLRVRYCCQARAVENQFYVVMSGNVGNLPGVANMDIQYGQSCILTPCDFPFARDGVAADTTPNVEMVAFADLRPDTLKMARNSGTVQNLRDRRHDLYSVQWRGK
>NZ_CP019936.1|WP_078119572.1|2125700_2126291_-|hypothetical-protein
MSKHVHTKRFPRVAAMIAALSLVALPATAAFAGDTTDTGIYSKDSEKLGGADYSQLRPQGDDGNPGVVEAGDSPSAETGITGEDSRKHGGPDYSGIRPESSGDMAEQPSGPAAQPNAETGIYGSDSKEHGGSDYSSLRPEDDEFAKYDEDGDGKLSRTEGAKSEQLSQSWQDMDTNNDMEIDRAEFSAFELKPDQQ
>NZ_CP019936.1|WP_125932011.1|2124924_2125161_-|hypothetical-protein
MRGTQETRSIGEHALRAERCDFDFACLEDTSFCACMKYTNRDVDVLKCLETCPCGHRKSCDGLQICTCSVKLQQYELS
>NZ_CP019936.1|WP_078119571.1|2124205_2124481_+|hypothetical-protein
MASENLIGQHRELRHMAMVFQWHSVARDRRRVKTQTVKYRKAIAYPTDGCALDTGRKRVVKLAGGLGGVPPEFRAHRHHAMLLRRRLTVHE
>NZ_CP019936.1|WP_078119570.1|2121970_2123380_-|undecaprenyl-phosphate-glucose-phosphotransferase
MHGQGLLRQHQSKLDAIYRISDTLLICGTLLISTMLAGAEFATPYWVAMLLATTVFAITGEAHSVYRSYRGASVTQQAIPILVAWGLTVFFLLVLGVFLGAAGSFSRPVIITWMLATPIAVIAWRIAIKYVLSMLRTAGYNSRRVAIIGAEKNGAELGSILENSPAYGLKLVGFFDDRHNNPDRVSASIPSEQLRGSINDAIVLARNGDVDLIYIALSSTGRDRALRIINELADSAVAVHVVPDLFVFDLLHSQLINIGRIPTLSVYESPYFGTSGWLKRSEDIVLSLIILSICAIPMLAIAIGVKLSSPGPVIFKQRRYGVDGKEIRVWKFRSMTTCDDGDKVVQATKGDARVTPLGAFLRKTSLDELPQFINVLKGDMSVVGPRPHAVAHNEHYRRIISGYMLRHKVKPGITGWAQVNGWRGETDSPDKMSRRVEHDIDYIRSWSLWLDLKIVVRTMLVGFNDKSAY
>NZ_CP019936.1|WP_078119569.1|2121038_2121869_+|glycosyltransferase-family-2-protein
MSTVGRVNAVIVNYRTPDLVLKCVHSIIEHGVAAAGDIIVVENASPDDSLEKLTEPLKALNVQLLASQKNDGFGAGVNIGVSHADKPYVVVLNPDTYFEDGSFSRAIDYFEQHPETGLLGLNLVYPGGERQFSARRFYSLVDVAARRLPIGNWWPFKRLVDRHLMVKAWHSGDAFEAEWVMGTGFVVRRELFQQIEGMDEAYFLYMEDVDLCARVWRAGFSVVCLPQARLVHDHQRSSAAQPFSWAGKMHIKSLLYFRRKFCVPVFRPPGVAGILK
>NZ_CP019936.1|WP_078119579.1|2133059_2134427_-|adenylosuccinate-lyase
MELDSLTAISPIDGRYGSKTADLRPVFSEYGLIRHRVIVEVRWLQSLAAHAGITEVASFSDATEQQLNKIANDFSLGDAQRVKEIERTTNHDVKAVEYLLKEKIAGNAELEKVSEFIHFACTSEDINNLSHALMLKQGRDEVLLPQADKVIDAIRSLAHRYADQPMLSRTHGQPASPTTLGKEMANVVARLERQRAQIAAIPLLGKINGAVGNYNAHLSAYPDVDWQAHAQQFVESLGLSWNPYTIQIEPHDYMAELFDAVARFNTIVIDFCRDVWSYISIGYFKQKTVAGEVGSSTMPHKVNPIDFENAEGNLGIANALLDHLAMKLPVSRWQRDLTDSTVLRNMGVGFAYSTIAWQSALRGIGKLEVDAKRLDADLDANWEVLAEPIQTVMRRYGIEQPYEKLKALTRGNRVDQQGMQAFIDTLDLPEQVKTELKAMTPASYIGNAAEQARKV
>NZ_CP019936.1|WP_078119580.1|2134569_2135073_-|hypothetical-protein
MKLWKITLLSLPFVLGACSQEESTDQAATEQPSELQQKVDTAVKETKEAGSAIGEATKQAASDTAEAGKGYYETAKEKTSAAYEATKEKSGELYDSAKESTSEAYDATKDKASEVYDAAKEKTSAAYDATKQKAGELYDSAKEKGSEIIDEAKQNQREGDGFPPATE
>NZ_CP019936.1|WP_164513330.1|2135142_2135799_-|high-frequency-lysogenization-protein-HflD
MAESSTDRNMASYSNNDRIIALSGVFQAAKLARDIARTGQCDANAFRAARQSLFDFEPESVAGVFGGIGGVTIGLRTLTSQLEKPQRPDMEISRYVISVIHLADRLMRSDNGMQNLHTDLSALARRLNHFDLSESVQNEQLSQIYQEQISPLGPRIMVQGEPLHLQNPENTARIRAVLLAGIRAAVLWRQAGGKKWQLLFKRRAIAESARDMVDRFAN
>NZ_CP019936.1|WP_078119582.1|2135779_2136850_-|tRNA-2-thiouridine(34)-synthase-MnmA
MKGKVIVGLSGGVDSSVAALRLLDQDWQVEGLFMKNWEEDDDADYCAAAEDLADARAVAEQLSIPLHTINFASEYWDRVFAYFLDEYRAGRTPNPDVLCNREIKFKAFLDYALHLGADKIATGHYAGVACDEQQCHLLTAHDANKDQTYFLYMLGQHALRHTLFPLNDIDKQDVRRLAEQAGFPNHKKKDSTGICFIGERRFRDFLAQYLPANPGEIRTADGKCIGEHQGLMYYTLGQRQGLGIGGVADAPDEPWYVVAKDLVNNRLVVAQGHDNPLLFRDRLTARQLHWVDGAGPTQTIRCMARCRHRQPLQACTASVEGDTLSVIFEQPQRAVTPGQSVVLYDGECCLGGGIID
>NZ_CP019936.1|WP_078119583.1|2136920_2137553_-|hypothetical-protein
MRLFSTLIVTLTLAGCIVAEDNVTPYAELYRLYDYPQTLTREQVPVCFHHGCASVKHVEIDERHWQQVSRHLRQPAADAAAEREQVRAAVAEMEHVTGELAGTSGDIAGDLGSFGTLEPQMDCIDESANTTTYLTLFEQAGLLRFHRVSSRANRGMIFYGGMPHYSAMLTENQTGKQWVIDSWFRDNGQPPDVVDLQTWKDGWKPDGFTF
>NZ_CP019936.1|WP_078119584.1|2137539_2137986_-|NUDIX-hydrolase
MRWSPSVTVAAVVRRQDAFLVVEERPQGVSVINQPAGHLEQGETLIEAVCREVLEETGCHFTPAGLVGVYQWQVPSTDRSYLRFCFAGDVGDPVPGHSLDPDIIATHWLSRAQIADGALQPRSPMVLQCIDDALHRSPLPLEVLHAFV
>NZ_CP019936.1|WP_078119585.1|2138004_2138625_-|pseudouridine-synthase
MPQLILFNKPYNVLTQFTDREGRATLADFISLPNVYPAGRLDRDSEGLLLLTDDGALAHQLTEPRKKTWKTYWAQVERVPSDADLKPLRDGVTLKDGPAKPAKVRLIDAPGLWPRDPPVRFRANIPTQWLEIRIHEGRNRQVRRMTAAIGFPTLRLVRVAIGDWSLGNLQPGEWKALQVESPTRSNTRPRSPARPKVHKSPRGTRR
>NZ_CP019936.1|WP_078119586.1|2138695_2139952_+|NADP-dependent-isocitrate-dehydrogenase
MAFDKIQIPSDGDKITVNADYSLNVPANPIIPYIEGDGIGVDISPVMMKVVDAAVAKAYGGDRKIAWMEIYAGEKSTRVYGEGVWLPDESLEAVKDYVVSIKGPLTTPVGGGIRSLNVTLRQELDLYVCLRPVRYFNGTPSPLLHPEYTDMVIFRENSEDIYAGVEWQSGSAEVKKVIDFLINEMGVTKIRFPETSGIGVKPVSSEGTKRLVRKAIQYAIDNDRASVTLVHKGNIMKFTEGAFKEWGYELAKEEFGATELDGGPWCTFKNPRTGKEIVVKDVIADAFLQQILLRPKEYDVIATLNLNGDYVSDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGQDKVNPGSLILSAEMMLRHMGWVEAADLIITSMETTIGAKTVTYDFERLMDDAKLLSCSEFGDAMIANM
>NZ_CP019936.1|WP_078119587.1|2140052_2140265_-|cold-shock-protein
MATGVVKWFNNAKGYGFVTPDDGEQDVFVHFSAIDMEGYRTLKEGQRVEFEVEQGPKGLHAQNLHAASAV
>NZ_CP019936.1|WP_078119588.1|2140728_2141052_+|ATP-dependent-Clp-protease-adapter-ClpS
MSKDNEHQGSDGDLAVEQSRPKLKRPPLFKVLLLNDDYTPMEFVVHVLEQFFGMNREKATQVMLHVHTRGMGVCGVFSKDVAETKVAQVNEHSRANQHPLLCTLEEA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP019936_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP019936_3

2586397-2586731

Orphan

Consensus_repeat	Method
CCCATGCCCGACATTCCGGACAT	CRT

6 spacers

The CRISPR arrays of NZ_CP019936_3

>merge|NZ_CP019936|3|2586397-2586731|CRT
CCCATGCCCGACATTCCGGACATGCCACCCATGCCGGACATGCCGCTCATGCCACCCATGCCCGACATTCCGGACATACCGCCCATGCCCGACATTCCGCCCATGCCGGACATTCCCGACATGCCGGACGGAACCCAGACCCAGTTGCCGCCCATGCCCGACATTCCGGACATACCGCCCATGCCGGACATGCCGCTCATGCCACCCATGCCCGACATCCCGGACATACCGCCCATGCCGGACATACCACCCATGCCGGACATCCCCGACATGCCGGACATCCCCGACATGCCGCCCATACCGGACATACCACCCATGCCCGACATTCCGGACAT

>NZ_CP019936|3|1|2586397-2586731|CRT
CCCATGCCCGACATTCCGGACAT	GCCACCCATGCCGGACATGCCGCTCATGCCA
CCCATGCCCGACATTCCGGACAT	ACCGCCCATGCCCGACATTCCG
CCCATGCCGGACATTCCCGACAT	GCCGGACGGAACCCAGACCCAGTTGCCG
CCCATGCCCGACATTCCGGACAT	ACCGCCCATGCCGGACATGCCGCTCATGCCA
CCCATGCCCGACATCCCGGACAT	ACCGCCCATGCCGGACATACCA
CCCATGCCGGACATCCCCGACAT	GCCGGACATCCCCGACATGCCGCCCATACCGGACATACCA
CCCATGCCCGACATTCCGGACAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP019936.1\|WP_164513370.1\|2577250_2577532_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019936.1\|WP_078119971.1\|2587064_2587355_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019936.1\|WP_078119978.1\|2595205_2595493_+\|polyhydroxyalkanoic-acid-system-family-protein	unknown	unknown	gnl\|CDD\|378230
NZ_CP019936.1\|WP_078119974.1\|2591047_2592400_+\|sigma-54-dependent-Fis-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225114
NZ_CP019936.1\|WP_078119968.1\|2581641_2581950_-\|c-type-cytochrome	unknown	unknown	gnl\|CDD\|227001
NZ_CP019936.1\|WP_174575436.1\|2593431_2594025_+\|SEL1-like-repeat-protein	unknown	unknown	gnl\|CDD\|276807
NZ_CP019936.1\|WP_078122038.1\|2582689_2585272_-\|molybdopterin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|274006
NZ_CP019936.1\|WP_078119966.1\|2579771_2580818_-\|4Fe-4S-dicluster-domain-containing-protein	unknown	unknown	gnl\|CDD\|224071
NZ_CP019936.1\|WP_078122036.1\|2575837_2576869_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237727
NZ_CP019936.1\|WP_078119964.1\|2574080_2575841_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP019936.1\|WP_125932062.1\|2587754_2588927_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019936.1\|WP_078119975.1\|2592484_2593288_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019936.1\|WP_078119976.1\|2594132_2594585_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019936.1\|WP_164513373.1\|2596479_2596626_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019936.1\|WP_164513371.1\|2580844_2581594_-\|molecular-chaperone-TorD-family-protein	unknown	unknown	gnl\|CDD\|225916
NZ_CP019936.1\|WP_078119969.1\|2582003_2582672_-\|4Fe-4S-dicluster-domain-containing-protein	unknown	unknown	gnl\|CDD\|319893
NZ_CP019936.1\|WP_125932060.1\|2577528_2579637_+\|PhoX-family-phosphatase	unknown	unknown	gnl\|CDD\|225752
NZ_CP019936.1\|WP_078119979.1\|2595503_2596328_-\|EcsC-family-protein	unknown	unknown	gnl\|CDD\|378945
NZ_CP019936.1\|WP_078119970.1\|2585296_2586079_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019936.1\|WP_164513372.1\|2589197_2591051_+\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|236901

Protein	Function_ID	Function_description	E-value
NZ_CP019936.1\|WP_174575436.1\|2593431_2594025_+\|SEL1-like-repeat-protein	gnl\|CDD\|276807	sd00010, SLR, Sel1-like repeat. Sel1-like repeats (SLRs) share similar alpha-helical conformations with Tetratricopeptide repeats (TPRs), but with different consensus sequence lengths and superhelical topologies. SLRs contain 36 to 44 amino acids and are present in bacteria and eukaryotes but not in archaea. SLR proteins are involved in a variety of functions, and many serve as adaptor proteins for the assembly of macromolecular complexes. The SLR family was named after the Caenorhabditis elegans Sel1 protein which is predicted to fold into 11 SLRs, a transmembrane domain, and an N-terminal signal sequence. The human Sel1L protein contains an additional fibronectin type-II domain and an N-terminal PEST sequence. Its downregulation is associated with the development of breast and pancreatic carcinomas.	2.50509e-12
NZ_CP019936.1\|WP_078119978.1\|2595205_2595493_+\|polyhydroxyalkanoic-acid-system-family-protein	gnl\|CDD\|378230	pfam09650, PHA_gran_rgn, Putative polyhydroxyalkanoic acid system protein (PHA_gran_rgn). Proteins in this entry are encoded by genes involved in either polyhydroxyalkanoic acid (PHA) biosynthesis or utilisation, including proteins found at the surface of PHA granules. These proteins have so far been found in the Pseudomonadales, Xanthomonadales, and Vibrionales, all of which belong to the Gammaproteobacteria.	6.70409e-19
NZ_CP019936.1\|WP_078119974.1\|2591047_2592400_+\|sigma-54-dependent-Fis-family-transcriptional-regulator	gnl\|CDD\|225114	COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms].	3.85495e-168
NZ_CP019936.1\|WP_078119968.1\|2581641_2581950_-\|c-type-cytochrome	gnl\|CDD\|227001	COG4654, COG4654, Cytochrome c551/c552 [Energy production and conversion].	1.13406e-25
NZ_CP019936.1\|WP_078122038.1\|2582689_2585272_-\|molybdopterin-dependent-oxidoreductase	gnl\|CDD\|274006	TIGR02166, Putative_dimethyl_sulfoxide_reductase_chain_YnfE, anaerobic dimethyl sulfoxide reductase, A subunit, DmsA/YnfE family. Members of this family include known and probable dimethyl sulfoxide reductase (DMSO reductase) A chains. In E. coli, dmsA encodes the canonical anaerobic DMSO reductase A chain. The paralog ynfE, as part of ynfFGH expressed from a multicopy plasmid, could complement a dmsABC deletion, suggesting a similar function and some overlap in specificity, although YnfE could not substitute for DmsA in a mixed complex.	0
NZ_CP019936.1\|WP_078119966.1\|2579771_2580818_-\|4Fe-4S-dicluster-domain-containing-protein	gnl\|CDD\|224071	COG1149, COG1149, MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion].	8.72155e-11
NZ_CP019936.1\|WP_078122036.1\|2575837_2576869_-\|hypothetical-protein	gnl\|CDD\|237727	PRK14489, PRK14489, putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional.	4.82766e-05
NZ_CP019936.1\|WP_078119964.1\|2574080_2575841_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	5.12989e-88
NZ_CP019936.1\|WP_164513371.1\|2580844_2581594_-\|molecular-chaperone-TorD-family-protein	gnl\|CDD\|225916	COG3381, TorD, Uncharacterized component of anaerobic dehydrogenases [General function prediction only].	6.56473e-15
NZ_CP019936.1\|WP_078119969.1\|2582003_2582672_-\|4Fe-4S-dicluster-domain-containing-protein	gnl\|CDD\|319893	cd16371, DMSOR_beta_like, uncharacterized subfamily of DMSO Reductase beta subunit family. This family consists of the small beta iron-sulfur (FeS) subunit of the DMSO Reductase (DMSOR) family. Members of this family also contain a large, periplasmic molybdenum-containing alpha subunit and may have a small gamma subunit as well. Examples of heterodimeric members with alpha and beta subunits include arsenite oxidase, and tungsten-containing formate dehydrogenase (FDH-T) while heterotrimeric members containing alpha, beta, and gamma subunits include formate dehydrogenase-N (FDH-N), and nitrate reductase (NarGHI). The beta subunit contains four Fe4/S4 and/or Fe3/S4 clusters which transfer the electrons from the alpha subunit to a hydrophobic integral membrane protein, presumably a cytochrome containing two b-type heme groups. The reducing equivalents are then transferred to menaquinone, which finally reduces the electron-accepting enzyme system.	3.8837e-72
NZ_CP019936.1\|WP_125932060.1\|2577528_2579637_+\|PhoX-family-phosphatase	gnl\|CDD\|225752	COG3211, PhoX, Predicted phosphatase [General function prediction only].	0
NZ_CP019936.1\|WP_078119979.1\|2595503_2596328_-\|EcsC-family-protein	gnl\|CDD\|378945	pfam12787, EcsC, EcsC protein family. Proteins in this family are related to EcsC from B. subtilis. This protein is found in an operon with EcsA and EcsB which are components of an ABC transport system. The function of this protein is unknown.	1.33184e-34
NZ_CP019936.1\|WP_164513372.1\|2589197_2591051_+\|HAMP-domain-containing-protein	gnl\|CDD\|236901	PRK11360, PRK11360, two-component system sensor histidine kinase AtoS.	8.82678e-52

>NZ_CP019936.1|WP_078119970.1|2585296_2586079_-|hypothetical-protein
MIRMQTPWVLIWLLALCGVAAAASNGSSYDQSRWNEIHFKPAIEQATDAQCLACHREIVDRRVLESSPAGIPAQSTLAWYQTLDTYQGEQDTFHRRHLVTAYAKQVMNLRCNTCHQGNDPREETANSSATGPSDLVQRKQVDPQICLMCHGQFNYQVMGVPGSWLEHGKLFGDNCLTCHAAVRTNRHQVNFLQPEAIEQAAQKDSDVCYGCHGGRAWYRINYPYPRHAWPGDGGVVPEWAKDRPTSSNPRFAVTSQANDH
>NZ_CP019936.1|WP_078122038.1|2582689_2585272_-|molybdopterin-dependent-oxidoreductase
MNDDKSYDFLNDRLNMTRRSFIKSTAAGAAALGAGSLVKTDTANAFAYEPYPRDDELQTVVTSCAHNCGSRHMLVAHKKGDVIVRISTDDGRYQRDGFFDKDTEDEPQLRGCLRGRSYRQRLYSAERLLYPMGRVGKRGEGKFKRISWDEALDYVARKMIELKNKYGSTALLDQSYAGASYGVLHKSDQIEGLLGRFLGMFGCRTNSWSVPSYQGTTASSRWTFGTIEDGNEDDTFAHSKLIIMWGWNPAYTFHGGNTFYYMRMAKQRGCKFVLIDPQYTDSAAAYDAWWIPIRPNTDAAMMAGMAHYIFVNNLQDQAFIDRFCQGMDAGTMPDWATNSANGTENFKDYILGTYDGVPKTPEWAAAICGVSADDIRKLADMYARTKPAALKASWAPGRNAYGEQYNRMAAALQAMTGNIGVLGGCAEGVGKAWHAEAVAYPYDQYANIWFASIKSDRWAHCVLNYPNVKREEIGLWPRQDQTDGMIPNIKGIFWQGSDWFNQLTNINKEIQAMDKLELVVCMDSTITPSGLYADVLLPIATHFERHDVALPWYKGHYYIHRPKVIEPLGESKSDLQVFTELAYRLGHLTGIGDYFGKTYNPKADRSYFNNPDAVDEAYLRDWWEGKVMPHQHVDMGWDEFKQRGVYKFKLDQPHVAFREQVENGKPFQTPSGRIEILSSELGQIADWTRTMYGYHIPSIPKWIEPWESLNSPKTSEYPFHLISPHPRWRTHSIFNNCTWLRETYEQEVTLNAADARGLGIKTGDRVEVWNDRGMVVVPAYVTERCMPGVAVLHEGAWLDLDENGVDRSGNPDVLTLDEPSPAGAFAYNTVLCNMRKSELEHRPGWDRMATARSHVFRRDL
>NZ_CP019936.1|WP_078119969.1|2582003_2582672_-|4Fe-4S-dicluster-domain-containing-protein
MKKIKDRAALKTAIKRRKKAVYEPVKPAQQLGFVHNNVDCIGCRACEIACKDKNGLPPGPRFRRVQYVEGGTYPDVFAYKVNVSCNHCAEPACLPTCPTGAIWKRADNGIVDIDSTLCIGCRRCEAACPYGAPQWDPEAQIVKKCNLCIDELEAGRKPYCVMACMMRVLDVGPIDLLRLNEYATKAIAPHEAPVDAVKNFADPKLTHPSIVFVPHSKGRVDK
>NZ_CP019936.1|WP_078119968.1|2581641_2581950_-|c-type-cytochrome
MSKETTLIGAVASLLLCGPALADMALAQAKGCTACHQVETKLVGPSYKEVAAKYQGDANAKAMLIGKVRNGGVGAWGEIMMPPNTTASDAELDTLITWVLAQ
>NZ_CP019936.1|WP_164513371.1|2580844_2581594_-|molecular-chaperone-TorD-family-protein
MNPSLTRFRTEVALDLMTLAQLHDRELTPATLQALKKADFPHCFAFKLTGSTAAEAVLVLESALAELDGSRAQCDELAADYAAIYLTHAYVAAPCESVWLDDDGLAMQAPMFEVRKIYARFGFCAPNWRMRSDDHLVHQIQFLAELLDPREPDGMNECARFLDDHTLRWLPDFVRRVAARAQTPFYAGVALLTHALLDELRDVLAEIIGEARPSPEEIEQRAQRAARERREAVAVPLPDRYVPGTAPSW
>NZ_CP019936.1|WP_078119966.1|2579771_2580818_-|4Fe-4S-dicluster-domain-containing-protein
MAIDDADDGVDAEGHAWLPTLHAERCVHTHVEVASCDRCVAACPHDAWVLDDEQLAVDTARCDGCGLCVAACPEGALAHDHEPQRRRVARDPVLFAACRHAASDLPGTRVPCVHAFTIEQFAGWYVNGVRRLWMVAGQCEGCACHTQAANNPAWQRLNRLLDACGLTAFEVSMLPTEDWRRIYLQSSPDSSKGADSGRRNFLRRMFATTAPSAAENSEWRPAGVLIWPLVQDRAALHVPNIDVERCSGCDACARVCRHAAIVVTSDPAAYVIDPAACTGCGVCQDVCEQSAIALAECAPVNVMVVPLSDRRCRSCGANYHQPSLDTVIDGRCPVCRHADHASKLFQVV
>NZ_CP019936.1|WP_125932060.1|2577528_2579637_+|PhoX-family-phosphatase
MTDKSLEDPKNQTVWEDDGTADVLPGSAARPTAAEPIQTVMHKAMSRRAMLKGVAAGATLVITPSALMLASDDAEAGWKRRRHHGHGRNPGDRLTFETVPPGNEVDVVVPPNYTVDVILKWGDPLTPDAPPFDVNNQTGASQAQQFGYNADLVLWYPLPRYVTRSVKLTGKLTRLADRLIGMQYPLLKHHSSDDALMVVNHEYTSGDDMFPGYVSGSPTLDQVETEIEAHGFSIVQVYQNFDGAWHFDISAPFNRRVTGTTPIEISGPLRGHPMLQTSTDPAGETVLGCFNNCAGGKTPWGTILTCEENFDQYFANFDSVPAEVKSLSERIPAEDAETGRRWEDYVSRFDLAQEPTEYNRFGYIVEIDPYDPNAKPKKRTALGRFKHEGAASRIAKNGQVAVYSGDDARFEYVYKFVSKGRYNKYNRAANKDLLDRGTLFVARFDAGEVEGDDMGTGVWLPLVWKPGNALDQAGFNSQEEVLLNTRGAADALGATPMDRPEDIEISPKTGKVYVALTNNSRRTEPNEANPRIDNQHGHVVEIIEDGNDAGAQTFAWNILVKCGDPTVAEHDTSFGDVDDPVAAGVSPISDPDNLVHDSDGNLWISTDGQYFSGSVGFGQNDGVFAVPVEGPDRGLLRQFLSGVPGGEVCGPEFSGDNKTFFCAIQHPNDGEAFDKIWPLSETDVSKPSLIAVREVTGKKIGA
>NZ_CP019936.1|WP_164513370.1|2577250_2577532_+|hypothetical-protein
MDDFYCLVLRIHQTRPWRAMTDVHIVANEPTTTLSAFAVANPDVTKTVHLVSPHLNGGKFQWITHEKVVRHSILRDRPCFNQSIQHVPNGETT
>NZ_CP019936.1|WP_078122036.1|2575837_2576869_-|hypothetical-protein
MHAARARLSRARRGFSTRRADISEAEYLLTGGVVPQPGDLVLAQVTNIGQHTRIEQPDGRRAQLYVGDEIVVAYGNRYAPDQFEAEVPDDLGACHLVAAGGIASQLINKNSRMKNPTRITPIGLLADADLKPLNLKKWRVDGQSIPKQLPPVIVVAGTAMNAGKTTAAARLIKGLERAGKRVGGAKVTGTGAGGDYWQMKDAGAVDVVDFTDAGYASTYLLGTKELEQGFLRLLSYLGNRNLDAIVVEVADGILQTETAELLASRGFGFYCSKLIFAASDAIGAHAGVQWLHSKGLKVGAISGSLTASPLAVREAMTATGLPVLSKQALADPDVALGLLGESA
>NZ_CP019936.1|WP_078119964.1|2574080_2575841_-|ABC-transporter-ATP-binding-protein
MSAIRLPSLFIRRRRATLLKLVLNGMTQGVLAIAGAWLVMSIFDGLGKQADHAAWWFAGLALIVVSGVMLRRTERVHAEWLGQNYAASIRRRLYKRLLFSDQRTLQRRRTGGLLLKFVGDLSALRRWVSLGMARLLVAGVATLIAMTALAWLHWPFFVAVSAVLSVSAAWIVYQGGTLREAIAESRRCQANISSNVTEKLHNLSTVQAFGQAEREQKVLRRQSDRLLRASVGKAAKIGTLRGVIEAAAGACVLAVLLMAYLFPPPDLTAGMVAAVVSIIGFLTPPLRDLGRAHEYWLGAEVAKDNLRSVMRGAVRVRDRRDSVPLNIDRAEIQLDDVSVSGVFDAVNVHIRNGCKILLSGANGSGKSTLLGLIGRLFDPDKGRILIDGQDIAGVRMASLRRQVAFVSSDIPLLRGTLKKNLCYGAETDLCDDVAAVIERFDCGDVFNRLPDGLDTRIAEGGSNLSQGERLQISLVRALLRRPRILLLDEADANLDSDAVKTLERVIERFEGTLIMASHRRRNLHLFDEQWLLKGGAIVSAATSSNVSRLHKGRAREVPDDEAPSTMSGAEAGRSVADHDVERDRYA
>NZ_CP019936.1|WP_078119971.1|2587064_2587355_-|hypothetical-protein
MKQARLVVLLAAVLASAASVHADVAVMGLAPAERPEGAPWIDHVNHTGDWYSHALRGVDQPYPHSLRFLEDQGNWHTPFNRPGMTGRYDIRGWYQQ
>NZ_CP019936.1|WP_125932062.1|2587754_2588927_-|hypothetical-protein
MSTRCTFVLFSFALLAMTGSTSLFAESGDGELHSGSSLQSALQQSGWHTVVADDGSVVFHVPAPAAAQPEAQAKPHQQLRQELEAQGWATSDAPDGGVYYFPPTPKPTSTIEPTPQPSLADQVSGELEAQGWQAQKQADGSVIYRRPQSSEAADGDDDLPPMPQSSLTDQLRGELEAQGWQAQKQADGSVIYRRPQSSEAADGDDDLPPTPKSSLTDQLRGELEAQGWQAQKQADGSVIYRRPQTSMEPDAAAPNKPSNGFADSLRDALEAQGWVRHTNADGDVIMTKPDTTPDAAEGGTEPESLPSAPLLQDAAPPDSATGWNAQMLRQTNERDVSTAAASRPIARHRSFAYPPPWPGFRPAPAWITRPPTYWRPQPYWPRPLPGFPPY
>NZ_CP019936.1|WP_164513372.1|2589197_2591051_+|HAMP-domain-containing-protein
MYWLRSRLSRKFMLGTSAGLLISSLVFLVMYLGLYRNELSNERADAAEQVNRLLQTSLENAMLKRDLDGLRTIISRLGQQQLVMQVFITNPTGEVRFANLPDMLGRSIPPPTDVSAPSTHFIADAEGRDVLRSINPVANRSACTACHGLPSQHPINGILYVDYDAVPIRHKAQRTTLLLMGSGALIVLINLAGGWWFIHRFITSPVAQLSRASQALAQGDLSARTTLKGQDELSELGTTFNNMAGELQDKVTELRHQGEFLQALVDAIPDGVRVIGDDYRVLLTNRAYRQQCGLVDEDGVGDLCYRITHQRSQPCPATLTTCPVAELRARNVPVKALHRHHDVDNSPLDVEIYAAAMTATIDTVPQTLVVESIRDLSKQIEYSQEQKLSELGKLATGIAHEIHNPLASVRLALDAMRENTGESEEDIREFKDYLKLVDREVDNCVNFTERLLRLGMPPSSEPDLVALKTIVDDTLSLVRWEAERLHIDLHTEVAPDLRVLGSDSELRMVVLNLIQNAFHAMPDGGELNVTARAIDDAIELAFVDSGTGIAPEQLRLIFDPFYSRRGDGSHGTGLGLPISRAIVDHHHGDIRVASELGCGSTFTVRLPNAASVPGESA
>NZ_CP019936.1|WP_078119974.1|2591047_2592400_+|sigma-54-dependent-Fis-family-transcriptional-regulator
MSQQILIVEDDATLNQLITRQLAKAGYDTHGVTLWADGHRYLEAHEPALIITDVRLPDGDSLELLPDLVDTYPVIVLTAFGSVRNAVDAMKQGAADYLLKPISQDELLLTVGRTLENSQLRRENQFCKRQLHARDARNRFLIGESPAIADVKRTIEAVAADDITVLIQGESGSGKELVAQAVHKHSPRAGRSFVTVDCCTLQEKLFESELFGHEKGSFTGADRQKKGLIEVAEGGTLFLDEIGEIDGVIQAKLLRVLETGRFRRLGGTKDLNSHVRIVAATNRDLAEMVEHGDFRADLYYRLNAFNILVPPLRDRREDIALLAGHFMRHHSFSRRIEKRLSNATIRKLVSYDWPGNIRELKNVIERAIILSRDKTVIAPEHLAFGSATQRNNARITIAFDHNPTLEELEAEYLSLQLKKYSGRRAEVADTLGVSERSVYRMIKRYGLNSD
>NZ_CP019936.1|WP_078119975.1|2592484_2593288_-|hypothetical-protein
MKGMKLRGLAAGLCGLALAGCVTTGTNSTAVSGSAAGGASVDADSSLERCDQPFGTLAVDDGRAANWYGAFGSQTKVTTVEPLIRLAVQQSNCFIITSIGNLRTDSRLSRITDIQRNSGEYRAGSKQQKGQRVAADYYLEPQIIIDDSSVGKVGGVLGGLVNSTVGAIAGGLEMKSSVVTLSLFDIRSAVQISASEGSSTSNNYGAAVGALGRSGGGGLGGFSTTPAGKATVAAFVDAYNGMVRSLRNYEAQDVKGGLGRGGTLKVN
>NZ_CP019936.1|WP_174575436.1|2593431_2594025_+|SEL1-like-repeat-protein
MTRQLYLAIFLGVVLAGCQSEPKKDTMRVCDSSGCSDRPSDSASYDPSSAVPDEDPDGRIAALEDLARQDPRAAYDLGLRFFRGDGVRQDSYRALQWMRDAAERGDLDAQKAVGRLYLTGLEEMGSDPREAEKWLTIAAGRGDKEAATLLREATAARQNEDAWYRWRSHWQPVFYRYWYTGYPYHWHWRHGSWYYRY
>NZ_CP019936.1|WP_078119976.1|2594132_2594585_+|hypothetical-protein
MQVVESQIYEGEVSALGGEGPAMRWIVVSPFGKTHAHSIDDPRNLHCMPLGILQRCIDEARLKHIDTRPNHPAIQLQRAKEERGLRDTHMGLHGDLLDLMLRFLRTAVAEHAEYAPFLAGEITALLATTELPADEIDTVRAEVAEIIGAK
>NZ_CP019936.1|WP_078119978.1|2595205_2595493_+|polyhydroxyalkanoic-acid-system-family-protein
MSQIHISHPHGVSQQKASKLIKKFVDDLEHEYDFEGEWEGHELLLTRTGAKGTVRVLDDVIEVDVKLGVLLKPLSKKIEHRILAQLDELFPSETA
>NZ_CP019936.1|WP_078119979.1|2595503_2596328_-|EcsC-family-protein
MNTRKPTLVTLPQTTLSATDLAVLREAVRHLEHPSLAARLSSVVGTPIEMALQLLPRKWYLRLHEAAERAIGNALQIAIAPMDDTPTPKSRDVVYNLFGMASGAAGGLFGLPGLAVELPISTGIMLRAIAEVARREGEDVHSLETRMACVQVFALGGRATSDDAAETGYYGVRFALATSVSSAIEQLAGHGTASAPVLASVVRAVASRFGVNLSHKVAAQMVPIVGAAGAATVNAIFIRHFQEMARSHFAVRRLERLYGTDVVKARYEALAAEH
>NZ_CP019936.1|WP_164513373.1|2596479_2596626_-|hypothetical-protein
MFAIRIVALLGVGAGLLALGYFVGREVGRLEPVREELRHRRIAHSEPE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP019936_3	3.2\|2586474\|22\|NZ_CP019936\|CRT	2586474-2586495	22	NZ_CP019936.1	2586804-2586825	0	1.0
NZ_CP019936_3	3.4\|2586570\|31\|NZ_CP019936\|CRT	2586570-2586600	31	NZ_CP019936.1	2586831-2586861	0	1.0
NZ_CP019936_3	3.2\|2586474\|22\|NZ_CP019936\|CRT	2586474-2586495	22	NZ_CP019936.1	2586222-2586243	2	0.909
NZ_CP019936_3	3.2\|2586474\|22\|NZ_CP019936\|CRT	2586474-2586495	22	NZ_CP019936.1	2586831-2586852	2	0.909
NZ_CP019936_3	3.6\|2586669\|40\|NZ_CP019936\|CRT	2586669-2586708	40	NZ_CP019936.1	2586177-2586216	2	0.95

1. spacer 3.2|2586474|22|NZ_CP019936|CRT matches to position: 2586804-2586825, mismatch: 0, identity: 1.0

accgcccatgcccgacattccg	CRISPR spacer
accgcccatgcccgacattccg	Protospacer
**********************

2. spacer 3.4|2586570|31|NZ_CP019936|CRT matches to position: 2586831-2586861, mismatch: 0, identity: 1.0

accgcccatgccggacatgccgctcatgcca	CRISPR spacer
accgcccatgccggacatgccgctcatgcca	Protospacer
*******************************

3. spacer 3.2|2586474|22|NZ_CP019936|CRT matches to position: 2586222-2586243, mismatch: 2, identity: 0.909

accgcccatgcccgacattccg	CRISPR spacer
acctcccatgcccgacatgccg	Protospacer
*** ************** ***

4. spacer 3.2|2586474|22|NZ_CP019936|CRT matches to position: 2586831-2586852, mismatch: 2, identity: 0.909

accgcccatgcccgacattccg	CRISPR spacer
accgcccatgccggacatgccg	Protospacer
************ ***** ***

5. spacer 3.6|2586669|40|NZ_CP019936|CRT matches to position: 2586177-2586216, mismatch: 2, identity: 0.95

gccggacatccccgacatgccgcccataccggacatacca	CRISPR spacer
gccggacattcccgacatgccgcccataccggacatccca	Protospacer
*********.************************** ***

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP019936_3	3.5\|2586624\|22\|NZ_CP019936\|CRT	2586624-2586645	22	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	14174-14195	1	0.955
NZ_CP019936_3	3.5\|2586624\|22\|NZ_CP019936\|CRT	2586624-2586645	22	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	14228-14249	1	0.955
NZ_CP019936_3	3.5\|2586624\|22\|NZ_CP019936\|CRT	2586624-2586645	22	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	14381-14402	1	0.955
NZ_CP019936_3	3.5\|2586624\|22\|NZ_CP019936\|CRT	2586624-2586645	22	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	14435-14456	1	0.955
NZ_CP019936_3	3.5\|2586624\|22\|NZ_CP019936\|CRT	2586624-2586645	22	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	123450-123471	1	0.955
NZ_CP019936_3	3.5\|2586624\|22\|NZ_CP019936\|CRT	2586624-2586645	22	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	123504-123525	1	0.955
NZ_CP019936_3	3.5\|2586624\|22\|NZ_CP019936\|CRT	2586624-2586645	22	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	123656-123677	1	0.955
NZ_CP019936_3	3.5\|2586624\|22\|NZ_CP019936\|CRT	2586624-2586645	22	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	123710-123731	1	0.955
NZ_CP019936_3	3.2\|2586474\|22\|NZ_CP019936\|CRT	2586474-2586495	22	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	14273-14294	2	0.909
NZ_CP019936_3	3.2\|2586474\|22\|NZ_CP019936\|CRT	2586474-2586495	22	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	14453-14474	2	0.909
NZ_CP019936_3	3.2\|2586474\|22\|NZ_CP019936\|CRT	2586474-2586495	22	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	123728-123749	2	0.909
NZ_CP019936_3	3.2\|2586474\|22\|NZ_CP019936\|CRT	2586474-2586495	22	NZ_CP014277	Martelella sp. AD-3 plasmid unnamed2, complete sequence	83651-83672	2	0.909
NZ_CP019936_3	3.2\|2586474\|22\|NZ_CP019936\|CRT	2586474-2586495	22	NZ_CP039965	Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence	138088-138109	2	0.909
NZ_CP019936_3	3.4\|2586570\|31\|NZ_CP019936\|CRT	2586570-2586600	31	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	14708-14738	2	0.935
NZ_CP019936_3	3.4\|2586570\|31\|NZ_CP019936\|CRT	2586570-2586600	31	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	123982-124012	2	0.935
NZ_CP019936_3	3.5\|2586624\|22\|NZ_CP019936\|CRT	2586624-2586645	22	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	14708-14729	2	0.909
NZ_CP019936_3	3.5\|2586624\|22\|NZ_CP019936\|CRT	2586624-2586645	22	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	123982-124003	2	0.909
NZ_CP019936_3	3.6\|2586669\|40\|NZ_CP019936\|CRT	2586669-2586708	40	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	14237-14276	2	0.95
NZ_CP019936_3	3.6\|2586669\|40\|NZ_CP019936\|CRT	2586669-2586708	40	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	123513-123552	2	0.95
NZ_CP019936_3	3.1\|2586420\|31\|NZ_CP019936\|CRT	2586420-2586450	31	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	14156-14186	3	0.903
NZ_CP019936_3	3.1\|2586420\|31\|NZ_CP019936\|CRT	2586420-2586450	31	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	14318-14348	3	0.903
NZ_CP019936_3	3.1\|2586420\|31\|NZ_CP019936\|CRT	2586420-2586450	31	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	14363-14393	3	0.903
NZ_CP019936_3	3.1\|2586420\|31\|NZ_CP019936\|CRT	2586420-2586450	31	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	14471-14501	3	0.903
NZ_CP019936_3	3.1\|2586420\|31\|NZ_CP019936\|CRT	2586420-2586450	31	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	14516-14546	3	0.903
NZ_CP019936_3	3.1\|2586420\|31\|NZ_CP019936\|CRT	2586420-2586450	31	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	14672-14702	3	0.903
NZ_CP019936_3	3.1\|2586420\|31\|NZ_CP019936\|CRT	2586420-2586450	31	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	123432-123462	3	0.903
NZ_CP019936_3	3.1\|2586420\|31\|NZ_CP019936\|CRT	2586420-2586450	31	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	123593-123623	3	0.903
NZ_CP019936_3	3.1\|2586420\|31\|NZ_CP019936\|CRT	2586420-2586450	31	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	123638-123668	3	0.903
NZ_CP019936_3	3.1\|2586420\|31\|NZ_CP019936\|CRT	2586420-2586450	31	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	123746-123776	3	0.903
NZ_CP019936_3	3.1\|2586420\|31\|NZ_CP019936\|CRT	2586420-2586450	31	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	123946-123976	3	0.903
NZ_CP019936_3	3.1\|2586420\|31\|NZ_CP019936\|CRT	2586420-2586450	31	NZ_CP042167	Burkholderia contaminans strain ZCC plasmid unnamed1, complete sequence	177741-177771	3	0.903
NZ_CP019936_3	3.1\|2586420\|31\|NZ_CP019936\|CRT	2586420-2586450	31	NZ_CP042167	Burkholderia contaminans strain ZCC plasmid unnamed1, complete sequence	177858-177888	3	0.903
NZ_CP019936_3	3.1\|2586420\|31\|NZ_CP019936\|CRT	2586420-2586450	31	NZ_CP028810	Burkholderia contaminans strain SK875 plasmid p875, complete sequence	29176-29206	3	0.903
NZ_CP019936_3	3.1\|2586420\|31\|NZ_CP019936\|CRT	2586420-2586450	31	NZ_CP028810	Burkholderia contaminans strain SK875 plasmid p875, complete sequence	29293-29323	3	0.903
NZ_CP019936_3	3.4\|2586570\|31\|NZ_CP019936\|CRT	2586570-2586600	31	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	14435-14465	3	0.903
NZ_CP019936_3	3.4\|2586570\|31\|NZ_CP019936\|CRT	2586570-2586600	31	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	123710-123740	3	0.903
NZ_CP019936_3	3.6\|2586669\|40\|NZ_CP019936\|CRT	2586669-2586708	40	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	14183-14222	3	0.925
NZ_CP019936_3	3.6\|2586669\|40\|NZ_CP019936\|CRT	2586669-2586708	40	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	14390-14429	3	0.925
NZ_CP019936_3	3.6\|2586669\|40\|NZ_CP019936\|CRT	2586669-2586708	40	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	123459-123498	3	0.925
NZ_CP019936_3	3.6\|2586669\|40\|NZ_CP019936\|CRT	2586669-2586708	40	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	123665-123704	3	0.925
NZ_CP019936_3	3.1\|2586420\|31\|NZ_CP019936\|CRT	2586420-2586450	31	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	14708-14738	4	0.871
NZ_CP019936_3	3.1\|2586420\|31\|NZ_CP019936\|CRT	2586420-2586450	31	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	123982-124012	4	0.871
NZ_CP019936_3	3.1\|2586420\|31\|NZ_CP019936\|CRT	2586420-2586450	31	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	123790-123820	4	0.871
NZ_CP019936_3	3.4\|2586570\|31\|NZ_CP019936\|CRT	2586570-2586600	31	NZ_CP042167	Burkholderia contaminans strain ZCC plasmid unnamed1, complete sequence	177741-177771	5	0.839
NZ_CP019936_3	3.4\|2586570\|31\|NZ_CP019936\|CRT	2586570-2586600	31	NZ_CP042167	Burkholderia contaminans strain ZCC plasmid unnamed1, complete sequence	177858-177888	5	0.839
NZ_CP019936_3	3.4\|2586570\|31\|NZ_CP019936\|CRT	2586570-2586600	31	NZ_CP028810	Burkholderia contaminans strain SK875 plasmid p875, complete sequence	29176-29206	5	0.839
NZ_CP019936_3	3.4\|2586570\|31\|NZ_CP019936\|CRT	2586570-2586600	31	NZ_CP028810	Burkholderia contaminans strain SK875 plasmid p875, complete sequence	29293-29323	5	0.839
NZ_CP019936_3	3.4\|2586570\|31\|NZ_CP019936\|CRT	2586570-2586600	31	NZ_CP034351	Streptomyces sp. W1SF4 plasmid p1, complete sequence	23831-23861	6	0.806
NZ_CP019936_3	3.4\|2586570\|31\|NZ_CP019936\|CRT	2586570-2586600	31	NZ_CP040937	Hymenobacter sp. DG01 plasmid unnamed, complete sequence	62208-62238	6	0.806
NZ_CP019936_3	3.4\|2586570\|31\|NZ_CP019936\|CRT	2586570-2586600	31	NZ_CP006588	Hymenobacter sp. APR13 plasmid pHA, complete sequence	50588-50618	6	0.806
NZ_CP019936_3	3.4\|2586570\|31\|NZ_CP019936\|CRT	2586570-2586600	31	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	638313-638343	6	0.806
NZ_CP019936_3	3.4\|2586570\|31\|NZ_CP019936\|CRT	2586570-2586600	31	NZ_MK757441	Alcaligenes faecalis strain AN70 plasmid pAN70-1, complete sequence	49774-49804	6	0.806
NZ_CP019936_3	3.1\|2586420\|31\|NZ_CP019936\|CRT	2586420-2586450	31	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	14570-14600	7	0.774
NZ_CP019936_3	3.1\|2586420\|31\|NZ_CP019936\|CRT	2586420-2586450	31	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	123844-123874	7	0.774
NZ_CP019936_3	3.1\|2586420\|31\|NZ_CP019936\|CRT	2586420-2586450	31	NZ_CP053022	Sphingobium yanoikuyae strain YC-XJ2 plasmid p-A-Sy, complete sequence	195383-195413	7	0.774
NZ_CP019936_3	3.1\|2586420\|31\|NZ_CP019936\|CRT	2586420-2586450	31	NZ_CP029986	Sphingomonas sp. FARSPH plasmid p01, complete sequence	150309-150339	7	0.774
NZ_CP019936_3	3.1\|2586420\|31\|NZ_CP019936\|CRT	2586420-2586450	31	NZ_CP034351	Streptomyces sp. W1SF4 plasmid p1, complete sequence	23831-23861	7	0.774
NZ_CP019936_3	3.1\|2586420\|31\|NZ_CP019936\|CRT	2586420-2586450	31	NZ_CP040937	Hymenobacter sp. DG01 plasmid unnamed, complete sequence	62208-62238	7	0.774
NZ_CP019936_3	3.1\|2586420\|31\|NZ_CP019936\|CRT	2586420-2586450	31	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	638313-638343	7	0.774
NZ_CP019936_3	3.1\|2586420\|31\|NZ_CP019936\|CRT	2586420-2586450	31	NZ_CP006588	Hymenobacter sp. APR13 plasmid pHA, complete sequence	50588-50618	7	0.774
NZ_CP019936_3	3.4\|2586570\|31\|NZ_CP019936\|CRT	2586570-2586600	31	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	123790-123820	7	0.774
NZ_CP019936_3	3.4\|2586570\|31\|NZ_CP019936\|CRT	2586570-2586600	31	NZ_CP053022	Sphingobium yanoikuyae strain YC-XJ2 plasmid p-A-Sy, complete sequence	195383-195413	7	0.774
NZ_CP019936_3	3.4\|2586570\|31\|NZ_CP019936\|CRT	2586570-2586600	31	NZ_CP029986	Sphingomonas sp. FARSPH plasmid p01, complete sequence	150309-150339	7	0.774
NZ_CP019936_3	3.4\|2586570\|31\|NZ_CP019936\|CRT	2586570-2586600	31	NC_014838	Pantoea sp. At-9b plasmid pPAT9B01, complete sequence	614423-614453	7	0.774
NZ_CP019936_3	3.4\|2586570\|31\|NZ_CP019936\|CRT	2586570-2586600	31	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	638487-638517	7	0.774
NZ_CP019936_3	3.4\|2586570\|31\|NZ_CP019936\|CRT	2586570-2586600	31	NC_023283	Streptomyces sp. FR1 plasmid pFRL3, complete sequence	92157-92187	8	0.742
NZ_CP019936_3	3.4\|2586570\|31\|NZ_CP019936\|CRT	2586570-2586600	31	NC_023284	Streptomyces sp. F2 plasmid pFRL4, complete sequence	124709-124739	8	0.742
NZ_CP019936_3	3.4\|2586570\|31\|NZ_CP019936\|CRT	2586570-2586600	31	NZ_CP049908	Hymenobacter sp. HDW8 plasmid p_unnamed1, complete sequence	55302-55332	8	0.742
NZ_CP019936_3	3.4\|2586570\|31\|NZ_CP019936\|CRT	2586570-2586600	31	NZ_CP049142	Pseudomonas nitroreducens strain HBP1 plasmid pPniHBP1_1, complete sequence	42936-42966	8	0.742
NZ_CP019936_3	3.4\|2586570\|31\|NZ_CP019936\|CRT	2586570-2586600	31	NZ_CP037921	Hymenobacter sp. 17J36-26 plasmid unnamed1, complete sequence	156797-156827	8	0.742
NZ_CP019936_3	3.6\|2586669\|40\|NZ_CP019936\|CRT	2586669-2586708	40	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	14570-14609	8	0.8
NZ_CP019936_3	3.6\|2586669\|40\|NZ_CP019936\|CRT	2586669-2586708	40	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	123844-123883	8	0.8
NZ_CP019936_3	3.6\|2586669\|40\|NZ_CP019936\|CRT	2586669-2586708	40	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	123548-123587	8	0.8
NZ_CP019936_3	3.1\|2586420\|31\|NZ_CP019936\|CRT	2586420-2586450	31	NC_023283	Streptomyces sp. FR1 plasmid pFRL3, complete sequence	92157-92187	9	0.71
NZ_CP019936_3	3.1\|2586420\|31\|NZ_CP019936\|CRT	2586420-2586450	31	NC_023284	Streptomyces sp. F2 plasmid pFRL4, complete sequence	124709-124739	9	0.71
NZ_CP019936_3	3.1\|2586420\|31\|NZ_CP019936\|CRT	2586420-2586450	31	AP021851	Deinococcus grandis ATCC 43672 plasmid: pDEGR-2 DNA, complete genome	239404-239434	9	0.71
NZ_CP019936_3	3.1\|2586420\|31\|NZ_CP019936\|CRT	2586420-2586450	31	NZ_CP049908	Hymenobacter sp. HDW8 plasmid p_unnamed1, complete sequence	55302-55332	9	0.71
NZ_CP019936_3	3.1\|2586420\|31\|NZ_CP019936\|CRT	2586420-2586450	31	NZ_CP037921	Hymenobacter sp. 17J36-26 plasmid unnamed1, complete sequence	156797-156827	9	0.71
NZ_CP019936_3	3.1\|2586420\|31\|NZ_CP019936\|CRT	2586420-2586450	31	NZ_CP049142	Pseudomonas nitroreducens strain HBP1 plasmid pPniHBP1_1, complete sequence	42936-42966	9	0.71
NZ_CP019936_3	3.4\|2586570\|31\|NZ_CP019936\|CRT	2586570-2586600	31	AP021851	Deinococcus grandis ATCC 43672 plasmid: pDEGR-2 DNA, complete genome	239404-239434	9	0.71
NZ_CP019936_3	3.4\|2586570\|31\|NZ_CP019936\|CRT	2586570-2586600	31	NZ_CP035710	Sphaerotilus natans subsp. sulfidivorans strain D-507 plasmid pSna507_unt10, complete sequence	170886-170916	9	0.71
NZ_CP019936_3	3.4\|2586570\|31\|NZ_CP019936\|CRT	2586570-2586600	31	NC_016586	Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence	572566-572596	9	0.71

1. spacer 3.5|2586624|22|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 1, identity: 0.955

accgcccatgccggacatacca	CRISPR spacer
accgcccatgccggacataccc	Protospacer
*********************

2. spacer 3.5|2586624|22|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 1, identity: 0.955

accgcccatgccggacatacca	CRISPR spacer
accgcccatgccggacataccc	Protospacer
*********************

3. spacer 3.5|2586624|22|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 1, identity: 0.955

accgcccatgccggacatacca	CRISPR spacer
accgcccatgccggacataccc	Protospacer
*********************

4. spacer 3.5|2586624|22|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 1, identity: 0.955

accgcccatgccggacatacca	CRISPR spacer
accgcccatgccggacataccg	Protospacer
*********************.

5. spacer 3.5|2586624|22|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 1, identity: 0.955

accgcccatgccggacatacca	CRISPR spacer
accgcccatgccggacataccc	Protospacer
*********************

6. spacer 3.5|2586624|22|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 1, identity: 0.955

accgcccatgccggacatacca	CRISPR spacer
accgcccatgccggacataccc	Protospacer
*********************

7. spacer 3.5|2586624|22|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 1, identity: 0.955

accgcccatgccggacatacca	CRISPR spacer
accgcccatgccggacataccc	Protospacer
*********************

8. spacer 3.5|2586624|22|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 1, identity: 0.955

accgcccatgccggacatacca	CRISPR spacer
accgcccatgccggacataccg	Protospacer
*********************.

9. spacer 3.2|2586474|22|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 2, identity: 0.909

accgcccatgcccgacattccg	CRISPR spacer
accgcccatgcccgacatgcca	Protospacer
****************** **.

10. spacer 3.2|2586474|22|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 2, identity: 0.909

accgcccatgcccgacattccg	CRISPR spacer
accgcccatgcccgacatgcca	Protospacer
****************** **.

11. spacer 3.2|2586474|22|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 2, identity: 0.909

accgcccatgcccgacattccg	CRISPR spacer
accgcccatgcccgacatgcca	Protospacer
****************** **.

12. spacer 3.2|2586474|22|NZ_CP019936|CRT matches to NZ_CP014277 (Martelella sp. AD-3 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.909

accgcccatgcccgacattccg	CRISPR spacer
tccgcccatgccggacattccg	Protospacer
 *********** *********

13. spacer 3.2|2586474|22|NZ_CP019936|CRT matches to NZ_CP039965 (Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.909

accgcccatgcccgacattccg	CRISPR spacer
gccgcccatgcccggcattccg	Protospacer
.*************.*******

14. spacer 3.4|2586570|31|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 2, identity: 0.935

accgcccatgccggacatgccgctcatgcca	CRISPR spacer
accgcccatgccggacatgccgctcataccc	Protospacer
***************************.**

15. spacer 3.4|2586570|31|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 2, identity: 0.935

accgcccatgccggacatgccgctcatgcca	CRISPR spacer
accgcccatgccggacatgccgctcataccc	Protospacer
***************************.**

16. spacer 3.5|2586624|22|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 2, identity: 0.909

accgcccatgccggacatacca	CRISPR spacer
accgcccatgccggacatgccg	Protospacer
******************.**.

17. spacer 3.5|2586624|22|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 2, identity: 0.909

accgcccatgccggacatacca	CRISPR spacer
accgcccatgccggacatgccg	Protospacer
******************.**.

18. spacer 3.6|2586669|40|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 2, identity: 0.95

gccggacatccccgacatgccgcccataccggacatacca	CRISPR spacer
gccggacatacccgacatgccgcccataccggacataccg	Protospacer
********* *****************************.

19. spacer 3.6|2586669|40|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 2, identity: 0.95

gccggacatccccgacatgccgcccataccggacatacca	CRISPR spacer
gccggacatacccgacatgccgcccataccggacataccg	Protospacer
********* *****************************.

20. spacer 3.1|2586420|31|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 3, identity: 0.903

gccacccatgccggacatgccgctcatgcca	CRISPR spacer
gccacccatgccggacataccgcccatgccg	Protospacer
******************.****.******.

21. spacer 3.1|2586420|31|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 3, identity: 0.903

gccacccatgccggacatgccgctcatgcca	CRISPR spacer
gccacccatgccggacataccgcccatgccg	Protospacer
******************.****.******.

22. spacer 3.1|2586420|31|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 3, identity: 0.903

gccacccatgccggacatgccgctcatgcca	CRISPR spacer
gccacccatgccggacataccgcccatgccg	Protospacer
******************.****.******.

23. spacer 3.1|2586420|31|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 3, identity: 0.903

gccacccatgccggacatgccgctcatgcca	CRISPR spacer
gccacccatgccggacataccgcccatgccg	Protospacer
******************.****.******.

24. spacer 3.1|2586420|31|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 3, identity: 0.903

gccacccatgccggacatgccgctcatgcca	CRISPR spacer
gccacccatgccggacataccgcccatgccg	Protospacer
******************.****.******.

25. spacer 3.1|2586420|31|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 3, identity: 0.903

gccacccatgccggacatgccgctcatgcca	CRISPR spacer
gccacccatcccggacataccgctcatgccc	Protospacer
********* ********.***********

26. spacer 3.1|2586420|31|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 3, identity: 0.903

gccacccatgccggacatgccgctcatgcca	CRISPR spacer
gccacccatgccggacataccgcccatgccg	Protospacer
******************.****.******.

27. spacer 3.1|2586420|31|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 3, identity: 0.903

gccacccatgccggacatgccgctcatgcca	CRISPR spacer
gccacccatgccggacataccgcccatgccg	Protospacer
******************.****.******.

28. spacer 3.1|2586420|31|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 3, identity: 0.903

gccacccatgccggacatgccgctcatgcca	CRISPR spacer
gccacccatgccggacataccgcccatgccg	Protospacer
******************.****.******.

29. spacer 3.1|2586420|31|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 3, identity: 0.903

gccacccatgccggacatgccgctcatgcca	CRISPR spacer
gccacccatgccggacataccgcccatgccg	Protospacer
******************.****.******.

30. spacer 3.1|2586420|31|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 3, identity: 0.903

gccacccatgccggacatgccgctcatgcca	CRISPR spacer
gccacccatcccggacataccgctcatgccc	Protospacer
********* ********.***********

31. spacer 3.1|2586420|31|NZ_CP019936|CRT matches to NZ_CP042167 (Burkholderia contaminans strain ZCC plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

gccacccatgccggacatgccgctcatgcca	CRISPR spacer
gccatccattccggacatgccgctcatgcct	Protospacer
****.**** ********************

32. spacer 3.1|2586420|31|NZ_CP019936|CRT matches to NZ_CP042167 (Burkholderia contaminans strain ZCC plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

gccacccatgccggacatgccgctcatgcca	CRISPR spacer
gccatccattccggacatgccgctcatgcct	Protospacer
****.**** ********************

33. spacer 3.1|2586420|31|NZ_CP019936|CRT matches to NZ_CP028810 (Burkholderia contaminans strain SK875 plasmid p875, complete sequence) position: , mismatch: 3, identity: 0.903

gccacccatgccggacatgccgctcatgcca	CRISPR spacer
gccatccattccggacatgccgctcatgcct	Protospacer
****.**** ********************

34. spacer 3.1|2586420|31|NZ_CP019936|CRT matches to NZ_CP028810 (Burkholderia contaminans strain SK875 plasmid p875, complete sequence) position: , mismatch: 3, identity: 0.903

gccacccatgccggacatgccgctcatgcca	CRISPR spacer
gccatccattccggacatgccgctcatgcct	Protospacer
****.**** ********************

35. spacer 3.4|2586570|31|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 3, identity: 0.903

accgcccatgccggacatgccgctcatgcca	CRISPR spacer
accgcccatgccggacataccgcccatgccc	Protospacer
******************.****.******

36. spacer 3.4|2586570|31|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 3, identity: 0.903

accgcccatgccggacatgccgctcatgcca	CRISPR spacer
accgcccatgccggacataccgcccatgccc	Protospacer
******************.****.******

37. spacer 3.6|2586669|40|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 3, identity: 0.925

gccggacatccccgacatgccgcccataccggacatacca	CRISPR spacer
gccggacatacccgacatgccacccataccggacataccg	Protospacer
********* ***********.*****************.

38. spacer 3.6|2586669|40|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 3, identity: 0.925

gccggacatccccgacatgccgcccataccggacatacca	CRISPR spacer
gccggacatacccgacatgccacccataccggacataccg	Protospacer
********* ***********.*****************.

39. spacer 3.6|2586669|40|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 3, identity: 0.925

gccggacatccccgacatgccgcccataccggacatacca	CRISPR spacer
gccggacatacccgacatgccacccataccggacataccg	Protospacer
********* ***********.*****************.

40. spacer 3.6|2586669|40|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 3, identity: 0.925

gccggacatccccgacatgccgcccataccggacatacca	CRISPR spacer
gccggacatacccgacatgccacccataccggacataccg	Protospacer
********* ***********.*****************.

41. spacer 3.1|2586420|31|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 4, identity: 0.871

gccacccatgccggacatgccgctcatgcca	CRISPR spacer
accgcccatgccggacatgccgctcataccc	Protospacer
.**.***********************.**

42. spacer 3.1|2586420|31|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 4, identity: 0.871

gccacccatgccggacatgccgctcatgcca	CRISPR spacer
accgcccatgccggacatgccgctcataccc	Protospacer
.**.***********************.**

43. spacer 3.1|2586420|31|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 4, identity: 0.871

-gccacccatgccggacatgccgctcatgcca	CRISPR spacer
tgcca-ccatgccggacataccgcccatgccg	Protospacer
 **** *************.****.******.

44. spacer 3.4|2586570|31|NZ_CP019936|CRT matches to NZ_CP042167 (Burkholderia contaminans strain ZCC plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.839

accgcccatgccggacatgccgctcatgcca	CRISPR spacer
gccatccattccggacatgccgctcatgcct	Protospacer
.**..**** ********************

45. spacer 3.4|2586570|31|NZ_CP019936|CRT matches to NZ_CP042167 (Burkholderia contaminans strain ZCC plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.839

accgcccatgccggacatgccgctcatgcca	CRISPR spacer
gccatccattccggacatgccgctcatgcct	Protospacer
.**..**** ********************

46. spacer 3.4|2586570|31|NZ_CP019936|CRT matches to NZ_CP028810 (Burkholderia contaminans strain SK875 plasmid p875, complete sequence) position: , mismatch: 5, identity: 0.839

accgcccatgccggacatgccgctcatgcca	CRISPR spacer
gccatccattccggacatgccgctcatgcct	Protospacer
.**..**** ********************

47. spacer 3.4|2586570|31|NZ_CP019936|CRT matches to NZ_CP028810 (Burkholderia contaminans strain SK875 plasmid p875, complete sequence) position: , mismatch: 5, identity: 0.839

accgcccatgccggacatgccgctcatgcca	CRISPR spacer
gccatccattccggacatgccgctcatgcct	Protospacer
.**..**** ********************

48. spacer 3.4|2586570|31|NZ_CP019936|CRT matches to NZ_CP034351 (Streptomyces sp. W1SF4 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.806

accgcccatgccggacatgccgctcatgcca	CRISPR spacer
ccagtccatgccggccatgccggtcatgccg	Protospacer
 * *.********* ******* *******.

49. spacer 3.4|2586570|31|NZ_CP019936|CRT matches to NZ_CP040937 (Hymenobacter sp. DG01 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.806

accgc-ccatgccggacatgccgctcatgcca	CRISPR spacer
-cagcaccatgccggacatgccgggcatgcgc	Protospacer
 * ** *****************  *****

50. spacer 3.4|2586570|31|NZ_CP019936|CRT matches to NZ_CP006588 (Hymenobacter sp. APR13 plasmid pHA, complete sequence) position: , mismatch: 6, identity: 0.806

accgc-ccatgccggacatgccgctcatgcca	CRISPR spacer
-cagcaccatgccggacatgccgggcatgcgc	Protospacer
 * ** *****************  *****

51. spacer 3.4|2586570|31|NZ_CP019936|CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.806

accgc-ccatgccggacatgccgctcatgcca	CRISPR spacer
-cggcgcgatgccggacacgccgctgatgccg	Protospacer
 * ** * **********.****** *****.

52. spacer 3.4|2586570|31|NZ_CP019936|CRT matches to NZ_MK757441 (Alcaligenes faecalis strain AN70 plasmid pAN70-1, complete sequence) position: , mismatch: 6, identity: 0.806

accgcccatgccggacatgccgc--tcatgcca	CRISPR spacer
accgcccatgccgcccatgccgccgccgtgc--	Protospacer
*************  ********  .*.***

53. spacer 3.1|2586420|31|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 7, identity: 0.774

gccacccatgccggacatgccgctcatgcca	CRISPR spacer
accggacatccccgacatgccgctcatgcct	Protospacer
.**.  *** ** *****************

54. spacer 3.1|2586420|31|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 7, identity: 0.774

gccacccatgccggacatgccgctcatgcca	CRISPR spacer
accggacatccccgacatgccgctcatgcct	Protospacer
.**.  *** ** *****************

55. spacer 3.1|2586420|31|NZ_CP019936|CRT matches to NZ_CP053022 (Sphingobium yanoikuyae strain YC-XJ2 plasmid p-A-Sy, complete sequence) position: , mismatch: 7, identity: 0.774

gccacccatgccggacatgccgctcatgcca	CRISPR spacer
gtggtccatgccggacatgccgctcatatcc	Protospacer
*. ..**********************..*

56. spacer 3.1|2586420|31|NZ_CP019936|CRT matches to NZ_CP029986 (Sphingomonas sp. FARSPH plasmid p01, complete sequence) position: , mismatch: 7, identity: 0.774

gccacccatgccggacatgccgctcatgcca	CRISPR spacer
gtggtccatgccggacatgccggacatgccc	Protospacer
*. ..*****************  ******

57. spacer 3.1|2586420|31|NZ_CP019936|CRT matches to NZ_CP034351 (Streptomyces sp. W1SF4 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.774

gccacccatgccggacatgccgctcatgcca	CRISPR spacer
ccagtccatgccggccatgccggtcatgccg	Protospacer
 * ..********* ******* *******.

58. spacer 3.1|2586420|31|NZ_CP019936|CRT matches to NZ_CP040937 (Hymenobacter sp. DG01 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.774

gccac-ccatgccggacatgccgctcatgcca	CRISPR spacer
-cagcaccatgccggacatgccgggcatgcgc	Protospacer
 * .* *****************  *****

59. spacer 3.1|2586420|31|NZ_CP019936|CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.774

gccac-ccatgccggacatgccgctcatgcca	CRISPR spacer
-cggcgcgatgccggacacgccgctgatgccg	Protospacer
 * .* * **********.****** *****.

60. spacer 3.1|2586420|31|NZ_CP019936|CRT matches to NZ_CP006588 (Hymenobacter sp. APR13 plasmid pHA, complete sequence) position: , mismatch: 7, identity: 0.774

gccac-ccatgccggacatgccgctcatgcca	CRISPR spacer
-cagcaccatgccggacatgccgggcatgcgc	Protospacer
 * .* *****************  *****

61. spacer 3.4|2586570|31|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 7, identity: 0.774

accgcccatgccggacatgccgctcatgcca	CRISPR spacer
tgccaccatgccggacataccgcccatgccg	Protospacer
  *  *************.****.******.

62. spacer 3.4|2586570|31|NZ_CP019936|CRT matches to NZ_CP053022 (Sphingobium yanoikuyae strain YC-XJ2 plasmid p-A-Sy, complete sequence) position: , mismatch: 7, identity: 0.774

accgcccatgccggacatgccgctcatgcca	CRISPR spacer
gtggtccatgccggacatgccgctcatatcc	Protospacer
.. *.**********************..*

63. spacer 3.4|2586570|31|NZ_CP019936|CRT matches to NZ_CP029986 (Sphingomonas sp. FARSPH plasmid p01, complete sequence) position: , mismatch: 7, identity: 0.774

accgcccatgccggacatgccgctcatgcca	CRISPR spacer
gtggtccatgccggacatgccggacatgccc	Protospacer
.. *.*****************  ******

64. spacer 3.4|2586570|31|NZ_CP019936|CRT matches to NC_014838 (Pantoea sp. At-9b plasmid pPAT9B01, complete sequence) position: , mismatch: 7, identity: 0.774

accgcccatgccggacatgccgctcatgcca	CRISPR spacer
accggccatgccggacatgcggctgacagcg	Protospacer
**** *************** *** *.. *.

65. spacer 3.4|2586570|31|NZ_CP019936|CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.774

accgcccatgccggacatgccgctcatgcca	CRISPR spacer
gcccgcgatgccggtcatgccgctcgtgccg	Protospacer
.**  * ******* **********.****.

66. spacer 3.4|2586570|31|NZ_CP019936|CRT matches to NC_023283 (Streptomyces sp. FR1 plasmid pFRL3, complete sequence) position: , mismatch: 8, identity: 0.742

accgcccatgccggacatgccgctcatgcca	CRISPR spacer
cgggcccatgccggacatgccgttcatcatc	Protospacer
   *******************.****  .

67. spacer 3.4|2586570|31|NZ_CP019936|CRT matches to NC_023284 (Streptomyces sp. F2 plasmid pFRL4, complete sequence) position: , mismatch: 8, identity: 0.742

accgcccatgccggacatgccgctcatgcca	CRISPR spacer
cgggcccatgccggacatgccgttcatcatc	Protospacer
   *******************.****  .

68. spacer 3.4|2586570|31|NZ_CP019936|CRT matches to NZ_CP049908 (Hymenobacter sp. HDW8 plasmid p_unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

accgcccatgccggacatgccgctcatgcca	CRISPR spacer
catgtccatgcccgacatgccgcccatgtcc	Protospacer
  .*.******* **********.****.*

69. spacer 3.4|2586570|31|NZ_CP019936|CRT matches to NZ_CP049142 (Pseudomonas nitroreducens strain HBP1 plasmid pPniHBP1_1, complete sequence) position: , mismatch: 8, identity: 0.742

accgcccatgccggacatgccgctcatgcca	CRISPR spacer
cgcgccgatgccgtacatgccgctcatctgc	Protospacer
  **** ****** ************* .

70. spacer 3.4|2586570|31|NZ_CP019936|CRT matches to NZ_CP037921 (Hymenobacter sp. 17J36-26 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

accgcccatgccggacatgccgctcatgcca	CRISPR spacer
catgtccatgcccgacatgccgcccatgtcc	Protospacer
  .*.******* **********.****.*

71. spacer 3.6|2586669|40|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 8, identity: 0.8

gccggacatccccgacatgccgcccataccggacatacca	CRISPR spacer
accggacatccccgacatgccgctcatgccttgcattgca	Protospacer
.**********************.***.**  .***  **

72. spacer 3.6|2586669|40|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 8, identity: 0.8

gccggacatccccgacatgccgcccataccggacatacca	CRISPR spacer
accggacatccccgacatgccgctcatgccttgcattgca	Protospacer
.**********************.***.**  .***  **

73. spacer 3.6|2586669|40|NZ_CP019936|CRT matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 8, identity: 0.8

-gccggacatccccgacatgccgcccataccggacatacca	CRISPR spacer
taccgcccat-gccgacatgccacccatgccggacataccc	Protospacer
 .***  ***  **********.*****.***********

74. spacer 3.1|2586420|31|NZ_CP019936|CRT matches to NC_023283 (Streptomyces sp. FR1 plasmid pFRL3, complete sequence) position: , mismatch: 9, identity: 0.71

gccacccatgccggacatgccgctcatgcca	CRISPR spacer
cgggcccatgccggacatgccgttcatcatc	Protospacer
   .******************.****  .

75. spacer 3.1|2586420|31|NZ_CP019936|CRT matches to NC_023284 (Streptomyces sp. F2 plasmid pFRL4, complete sequence) position: , mismatch: 9, identity: 0.71

gccacccatgccggacatgccgctcatgcca	CRISPR spacer
cgggcccatgccggacatgccgttcatcatc	Protospacer
   .******************.****  .

76. spacer 3.1|2586420|31|NZ_CP019936|CRT matches to AP021851 (Deinococcus grandis ATCC 43672 plasmid: pDEGR-2 DNA, complete genome) position: , mismatch: 9, identity: 0.71

gccacccatgccggacatgccgctcatgcca	CRISPR spacer
cttcaccatgtcggccatgccgctcatgctg	Protospacer
 ..  *****.*** **************..

77. spacer 3.1|2586420|31|NZ_CP019936|CRT matches to NZ_CP049908 (Hymenobacter sp. HDW8 plasmid p_unnamed1, complete sequence) position: , mismatch: 9, identity: 0.71

gccacccatgccggacatgccgctcatgcca	CRISPR spacer
catgtccatgcccgacatgccgcccatgtcc	Protospacer
  ...******* **********.****.*

78. spacer 3.1|2586420|31|NZ_CP019936|CRT matches to NZ_CP037921 (Hymenobacter sp. 17J36-26 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.71

gccacccatgccggacatgccgctcatgcca	CRISPR spacer
catgtccatgcccgacatgccgcccatgtcc	Protospacer
  ...******* **********.****.*

79. spacer 3.1|2586420|31|NZ_CP019936|CRT matches to NZ_CP049142 (Pseudomonas nitroreducens strain HBP1 plasmid pPniHBP1_1, complete sequence) position: , mismatch: 9, identity: 0.71

gccacccatgccggacatgccgctcatgcca	CRISPR spacer
cgcgccgatgccgtacatgccgctcatctgc	Protospacer
  *.** ****** ************* .

80. spacer 3.4|2586570|31|NZ_CP019936|CRT matches to AP021851 (Deinococcus grandis ATCC 43672 plasmid: pDEGR-2 DNA, complete genome) position: , mismatch: 9, identity: 0.71

accgcccatgccggacatgccgctcatgcca	CRISPR spacer
cttcaccatgtcggccatgccgctcatgctg	Protospacer
 ..  *****.*** **************..

81. spacer 3.4|2586570|31|NZ_CP019936|CRT matches to NZ_CP035710 (Sphaerotilus natans subsp. sulfidivorans strain D-507 plasmid pSna507_unt10, complete sequence) position: , mismatch: 9, identity: 0.71

accgcccatgccggacatgccgctcatgcca	CRISPR spacer
gtcgccggtgccggacatgccgctcaccagg	Protospacer
..**** .******************.   .

82. spacer 3.4|2586570|31|NZ_CP019936|CRT matches to NC_016586 (Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence) position: , mismatch: 9, identity: 0.71

accgcccatgccggacatgccgctcatgcca	CRISPR spacer
cgcgcccatcccggatatgccgctcccggtc	Protospacer
  ******* *****.********* .* .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3123681 : 3172348

uncultured_Caudovirales_phage(40.0%)

plate,transposase,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_164513411.1\|3123681_3124752_+\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_078120404.1\|3124761_3125319_+	hypothetical protein	NA	NA	NA	NA
WP_125932278.1\|3125327_3126326_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_078120406.1\|3126497_3127181_-	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_078120407.1\|3127199_3129344_-	VTT domain-containing protein	NA	NA	NA	NA
WP_125932112.1\|3129577_3130993_-	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	2.1e-54	37.8
WP_078120409.1\|3131212_3131980_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_078120410.1\|3131972_3133367_+	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_078120411.1\|3133429_3135802_+	response regulator	Q8QKV7	Ectocarpus_siliculosus_virus	5.0e-32	28.4
WP_078120412.1\|3135819_3136161_-	TusE/DsrC/DsvC family sulfur relay protein	NA	NA	NA	NA
WP_078120413.1\|3136192_3136387_-	PLDc N-terminal domain-containing protein	NA	NA	NA	NA
WP_078120414.1\|3136449_3136641_-	CsbD family protein	NA	NA	NA	NA
WP_164513412.1\|3136717_3137227_-	DUF1269 domain-containing protein	NA	NA	NA	NA
WP_164513413.1\|3137563_3138814_+	DUF2254 domain-containing protein	NA	NA	NA	NA
WP_164513414.1\|3138880_3139057_-	hypothetical protein	NA	NA	NA	NA
WP_164513415.1\|3139174_3139756_-	OmpA family protein	NA	NA	NA	NA
WP_078120418.1\|3140697_3140862_-	DUF1328 domain-containing protein	NA	NA	NA	NA
WP_078120419.1\|3141232_3141466_-	hypothetical protein	NA	NA	NA	NA
WP_125932113.1\|3141711_3142083_+	TusE/DsrC/DsvC family sulfur relay protein	NA	NA	NA	NA
WP_078120421.1\|3142119_3142890_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_078120422.1\|3143090_3143696_+	DUF502 domain-containing protein	NA	NA	NA	NA
WP_125932114.1\|3143731_3144010_-	hypothetical protein	NA	NA	NA	NA
WP_078120424.1\|3144290_3144815_+	DUF805 domain-containing protein	NA	NA	NA	NA
WP_078120425.1\|3144834_3145509_+	RDD family protein	NA	NA	NA	NA
WP_078120426.1\|3145505_3146489_+	stage II sporulation protein M	NA	NA	NA	NA
WP_078120427.1\|3146478_3147963_+	DUF4129 domain-containing protein	NA	NA	NA	NA
WP_078120428.1\|3147955_3149128_+	DUF4350 domain-containing protein	NA	NA	NA	NA
WP_078120429.1\|3149234_3150218_+	MoxR family ATPase	NA	NA	NA	NA
WP_078120430.1\|3150214_3151525_+	DUF58 domain-containing protein	NA	NA	NA	NA
WP_078120431.1\|3151549_3154252_-	type VI secretion system ATPase TssH	H6X3M6	Enterobacteria_phage	2.9e-92	31.4
WP_078120432.1\|3154268_3155321_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_078120433.1\|3155284_3157123_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_078120434.1\|3157124_3157604_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_078120435.1\|3157665_3158202_-	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_078120436.1\|3158232_3159714_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_078122087.1\|3159713_3160214_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_078122088.1\|3160356_3160956_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_078120437.1\|3161343_3161964_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_078120438.1\|3161978_3163319_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_078120439.1\|3163315_3164086_+	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_078120440.1\|3164114_3166928_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	7.0e-49	27.5
WP_078120441.1\|3166928_3168488_+	hypothetical protein	NA	NA	NA	NA
WP_078120442.1\|3168506_3169511_+	DUF1911 domain-containing protein	NA	NA	NA	NA
WP_078120443.1\|3169529_3169985_+	hypothetical protein	NA	NA	NA	NA
WP_125932115.1\|3170055_3170583_+	hypothetical protein	NA	NA	NA	NA
WP_078120445.1\|3170586_3170886_+	hypothetical protein	NA	NA	NA	NA
WP_125931932.1\|3171279_3172348_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.9e-61	47.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP019936

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection