CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP014760	Legionella pneumophila strain F4469 chromosome, complete genome	3 crisprs	csa3,DEDDh,DinG,cas3,RT,WYL	0	0	5	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP014760_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP014760_1

2364323-2364413

Unclear

Consensus_repeat	Method
GGCTCTTCCCCAAATCCGGGGGCA	CRISPRCasFinder

1 spacers

cas3

The CRISPR arrays of NZ_CP014760_1

>merge|NZ_CP014760|1|2364323-2364413|CRISPRCasFinder
GGCTCTTCCCCAAATCCGGGGGCACTAATCAAGAACACAAAACTTTAACCCTTAACCTATAGTTTTCGGCTCTTCCCCAAATCCGGGGGCA

>NZ_CP014760|1|1|2364323-2364413|CRISPRCasFinder
GGCTCTTCCCCAAATCCGGGGGCA	CTAATCAAGAACACAAAACTTTAACCCTTAACCTATAGTTTTC
GGCTCTTCCCCAAATCCGGGGGCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP014760.1\|WP_010947820.1\|2356968_2357823_-\|DUF692-domain-containing-protein	unknown	unknown	gnl\|CDD\|377459
NZ_CP014760.1\|WP_010947824.1\|2360563_2361085_-\|peptide-methionine-(R)-S-oxide-reductase-MsrB	unknown	unknown	gnl\|CDD\|234692
NZ_CP014760.1\|WP_027224833.1\|2366918_2367497_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014760.1\|WP_060871595.1\|2361256_2361811_+\|peroxidase	unknown	unknown	gnl\|CDD\|130981
NZ_CP014760.1\|WP_010947823.1\|2359146_2359635_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225886
NZ_CP014760.1\|WP_015444232.1\|2360178_2360406_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014760.1\|WP_010947826.1\|2362244_2362445_+\|ATP-dependent-DNA-helicase	unknown	unknown	unknown
NZ_CP014760.1\|WP_027224832.1\|2364419_2365595_-\|ISL3-family-transposase	unknown	unknown	gnl\|CDD\|376574
NZ_CP014760.1\|WP_064319116.1\|2365633_2366764_-\|ISL3-family-transposase	unknown	unknown	gnl\|CDD\|376574
NZ_CP014760.1\|WP_010947832.1\|2370793_2371003_+\|cold-shock-protein	unknown	unknown	gnl\|CDD\|224197
NZ_CP014760.1\|WP_014844324.1\|2368759_2369056_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|226194
NZ_CP014760.1\|WP_010947822.1\|2358320_2358842_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014760.1\|WP_010947827.1\|2362538_2362922_+\|transposase	unknown	unknown	unknown
NZ_CP014760.1\|WP_014844326.1\|2371242_2372649_+\|ATP-dependent-RNA-helicase-DbpA	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|236977
NZ_CP014760.1\|WP_014844327.1\|2372805_2373717_+\|cation-diffusion-facilitator-family-transporter	unknown	unknown	gnl\|CDD\|226474
NZ_CP014760.1\|WP_027224834.1\|2367601_2368168_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014760.1\|WP_027224835.1\|2368515_2368770_+\|type-II-toxin-antitoxin-system-ParD-family-antitoxin	unknown	unknown	gnl\|CDD\|274227
NZ_CP014760.1\|WP_076613127.1\|2373808_2374327_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340883
NZ_CP014760.1\|WP_010947828.1\|2362975_2363929_-\|Abi-family-protein	unknown	unknown	gnl\|CDD\|377910
NZ_CP014760.1\|WP_010947821.1\|2357837_2358131_-\|DUF2282-domain-containing-protein	unknown	unknown	gnl\|CDD\|370796

Protein	Function_ID	Function_description	E-value
NZ_CP014760.1\|WP_010947820.1\|2356968_2357823_-\|DUF692-domain-containing-protein	gnl\|CDD\|377459	pfam05114, DUF692, Protein of unknown function (DUF692). This family consists of several uncharacterized bacterial proteins.	8.36279e-137
NZ_CP014760.1\|WP_010947823.1\|2359146_2359635_-\|hypothetical-protein	gnl\|CDD\|225886	COG3350, COG3350, Uncharacterized conserved protein [Function unknown].	5.37707e-05
NZ_CP014760.1\|WP_060871595.1\|2361256_2361811_+\|peroxidase	gnl\|CDD\|130981	TIGR01926, peroxid_rel, uncharacterized peroxidase-related enzyme. This protein family with length of about 200 amino acids. One member, from Myxococcus xanthus, is a selenoprotein, with an otherwise conserved Cys replaced by Sec. This family is drawn narrowly enough to suggest that These proteins contain a domain described by TIGR00778, with a CxxCxxxHxxxxxxxG motif. Some members of that family are known to act as peroxidases or correlate with resistance to oxidative stress.	2.31648e-20
NZ_CP014760.1\|WP_027224832.1\|2364419_2365595_-\|ISL3-family-transposase	gnl\|CDD\|376574	pfam01610, DDE_Tnp_ISL3, Transposase. Transposase proteins are necessary for efficient DNA transposition. Contains transposases for IS204, IS1001, IS1096 and IS1165.	8.4756e-65
NZ_CP014760.1\|WP_010947821.1\|2357837_2358131_-\|DUF2282-domain-containing-protein	gnl\|CDD\|370796	pfam10048, DUF2282, Predicted integral membrane protein (DUF2282). Members of this family of hypothetical bacterial proteins and putative signal peptide proteins have no known function.	5.52647e-13
NZ_CP014760.1\|WP_014844327.1\|2372805_2373717_+\|cation-diffusion-facilitator-family-transporter	gnl\|CDD\|226474	COG3965, COG3965, Predicted Co/Zn/Cd cation transporters [Inorganic ion transport and metabolism].	2.15747e-100
NZ_CP014760.1\|WP_064319116.1\|2365633_2366764_-\|ISL3-family-transposase	gnl\|CDD\|376574	pfam01610, DDE_Tnp_ISL3, Transposase. Transposase proteins are necessary for efficient DNA transposition. Contains transposases for IS204, IS1001, IS1096 and IS1165.	2.31561e-49
NZ_CP014760.1\|WP_010947832.1\|2370793_2371003_+\|cold-shock-protein	gnl\|CDD\|224197	COG1278, CspC, Cold shock proteins [Transcription].	3.52513e-27
NZ_CP014760.1\|WP_014844324.1\|2368759_2369056_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|226194	COG3668, ParE, Plasmid stabilization system protein [General function prediction only].	3.80144e-18
NZ_CP014760.1\|WP_010947824.1\|2360563_2361085_-\|peptide-methionine-(R)-S-oxide-reductase-MsrB	gnl\|CDD\|234692	PRK00222, PRK00222, peptide-methionine (R)-S-oxide reductase MsrB.	2.12177e-84
NZ_CP014760.1\|WP_014844326.1\|2371242_2372649_+\|ATP-dependent-RNA-helicase-DbpA	gnl\|CDD\|236977	PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional.	0
NZ_CP014760.1\|WP_027224835.1\|2368515_2368770_+\|type-II-toxin-antitoxin-system-ParD-family-antitoxin	gnl\|CDD\|274227	TIGR02606, Antitoxin_ParD, putative addiction module antidote protein, CC2985 family. This bacterial protein family has a very similar seed alignment to that of pfam03693 but is a more stringent model with higher cutoff scores. Proteins that score above the trusted cutoff to this model almost invariably are found adjacent to a ParE family protein (pfam05016), where ParE is the killing partner of an addiction module for plasmid stabilization. Members of this family, therefore, are putative addiction module antidote proteins. Some are encoded on plasmids or in prophage regions, but others appear chromosomal. A genome may contain several identical copies, such as the four in Magnetococcus sp. MC-1. This family is named for one member, CC2985 of Caulobacter crescentus CB15. [Cellular processes, Other, Mobile and extrachromosomal element functions, Plasmid functions].	1.27591e-15
NZ_CP014760.1\|WP_076613127.1\|2373808_2374327_+\|MFS-transporter	gnl\|CDD\|340883	cd17325, MFS_MdtG_SLC18_like, bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters. This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	5.73229e-05
NZ_CP014760.1\|WP_010947828.1\|2362975_2363929_-\|Abi-family-protein	gnl\|CDD\|377910	pfam07751, Abi_2, Abi-like protein. This family, found in various bacterial species, contains sequences that are similar to the Abi group of proteins, which are involved in bacteriophage resistance mediated by abortive infection in Lactococcus species. The proteins are thought to have helix-turn-helix motifs, found in many DNA-binding proteins, allowing them to perform their function.	1.08058e-61

>NZ_CP014760.1|WP_010947828.1|2362975_2363929_-|Abi-family-protein
MMRTTTGYFFMAEKSYTKPALTVSQQLEFLFSQGLQIEDQKLAIRALETVSYYRLSSYLLPFKQSHNAKNPRQFKENATFEQVWQLYQFDRELRLLVADAIEKIEVAFRAALTNVTSIRFNPFWYVERNYFKAKAGANRERDFFDDYLKTIKTISTNKQELFIQHYHKNYDKPYFPPIWMMVEALSFGVCSKMFNNIQSKDVRNEIASFLGQHTTVIESWIKSLTYTRNLCAHHSRLWNRWLVIPPLIPKNAPIKTHIDGNYRFQLIAFIIDQLLETIAPESNWKIKLFELFERNEQFSGIEMGFINNWRDDPIWHC
>NZ_CP014760.1|WP_010947827.1|2362538_2362922_+|transposase
MLNFIILLEKQLKKQALLLISFAFNKAILTKQPDAKIVIPPPSVAVISWKANTQRDDHIRLLQDEGDMVWQKKNNYGLRSHIELAILRYKKVMGTAMKARELPQQKTECGIATRALNESLHWVCQSL
>NZ_CP014760.1|WP_010947826.1|2362244_2362445_+|ATP-dependent-DNA-helicase
MIKELNRIVSNQTFDEQPLTALNSEAIDFRAALEQFEKIRKIDKKDLETVVILMDYQGKKVPTVQG
>NZ_CP014760.1|WP_060871595.1|2361256_2361811_+|peroxidase
MQRIKKISIANAQGKAKELLEGTKKAMGTELNLFSTLANSPAALEAYIGIMTSLSKGALNPKLREQIALVSAGYNGCNYCASAHTYLGEKAGINKDELKENLSGKSSDKKTQVALNFATQLIERRGGVSEFDIKTVREAGFSDEEMVEILAHVAMNTFTNYFNEAFKTDIDFPVVDTHKGRTAT
>NZ_CP014760.1|WP_010947824.1|2360563_2361085_-|peptide-methionine-(R)-S-oxide-reductase-MsrB
MKSIIKGLLFFFMSVASLTAYAEQAYKRPSDAVIKQKLSTIQYNVTQQQGTESPFNNAYWNNEEQGIYVDVVTGEPLFISLDKYDSKTGWPSFTKPLEPGNIIYKDDSSMFTSRTEVISKHGKSHLGHVFGDGPPPTNKRFCMNSAALEFIPVKDLQKRGYGKYLPLFKNAGK
>NZ_CP014760.1|WP_015444232.1|2360178_2360406_-|hypothetical-protein
MKFYLHPSCHLLSMHWNSFDLIKASRDGYKHPPRPKKMAHSQSLVIWRRQLQIRYYLMDKLEQNMLSQSKTRLLS
>NZ_CP014760.1|WP_010947823.1|2359146_2359635_-|hypothetical-protein
MVNNFIRIAAMKKIKSLYIPQLIFIFMMPVLAWASDISYSLVGIQGYDPVSYFQQGGPVRGSGNYTGYYEGVSYIFSNQENKKTFLANPEKYLPAYGGYCAYGVSVGSKIVSDPLAWRIVDGTLYLNLNSKTQDVWAKNIPGNIKKANINWPKIKGIDPKDL
>NZ_CP014760.1|WP_010947822.1|2358320_2358842_-|hypothetical-protein
MKEKKRSKTSKYLSNLVLILALSMMVSSAVISYFFIRQNELLISSLKMQAQNKQILIKDVWNNIVKKETRADIAILLSVLPVKDEVEVQAIKKDYLRDFSELTGTSSTADIVKEVKKEIERYGEYIDNLYLDQVTIQNKATAIEGSNKLYSEIAFFLQIFSVVLIILRKDFTE
>NZ_CP014760.1|WP_010947821.1|2357837_2358131_-|DUF2282-domain-containing-protein
MIKNGIFTAVAAAITLTTSVAFAEGEMEKCSVVKDGKGLIKENKADCKGSSHSCAGQNKAGDSESWILVPKGQCDKINAGDFSAVGQDIKDKIEVSN
>NZ_CP014760.1|WP_010947820.1|2356968_2357823_-|DUF692-domain-containing-protein
MTLNPLIGIGLRYPHYTQVLEERPSIGWFEVHSENFFSNGGNEIKALLNISEYYPISLHGVGLSLGSSDGISKVHLDRLSNLVHQVQPKFVSEHLSWGHVGGIHMPDLLPVPYTEESFNTFKRSISIAQDFLKREILIENPSSYIEYKSSRLHESYFLVELCNQTGAKILLDVNNLFISSWNHGWNTKEYIDSIPFNLVKEIHIAGHSIKELSNDSTLRIDTHNNYVCDEVWALYDYTVQRFGPIPTLLEWDADIPSLNVLIEEASKCESYLSSYKVNRGVANA
>NZ_CP014760.1|WP_027224832.1|2364419_2365595_-|ISL3-family-transposase
MPKKDCILNLPGYSIKKVSGENPVYIEVSYRNVVRCIYCGNKKLRKKDSFIRRIRHESIGLRRSYLCIKAHKYYCSVCSRYFNQRFPGIGKYQRASESLRKQVFHYHSKGVSQKDLARDLKLGKSTVERWYHYGYELRYKKIATRSCPRVLGLDEHSFNRKVGYATTFCDLAKHKIFDVVEGRSEKDLEGYLNTLEGKEKVQVVCIDLSSSYRKLIRRYFPNAMIVADRFHVIRLLNQFCLQTYQQIDPEMKYQRGLLAALRTNPNNLSVKRLNKRERYLQQQPVIAALYNFKQRLHRLLMRKHRTAKQCTRLIPLFLKLVASLKESPFESLKTLGRTLYQWREEVVRMWRFTKNNGITEGFHRKMKLIQRRAYGFRNFENYRLRVRVLCG
>NZ_CP014760.1|WP_064319116.1|2365633_2366764_-|ISL3-family-transposase
MPKKDCILNLPGYSIKKVSGENPVYIEVSYRNVVRCIYCGNKKLRKKDSFIRRIRHESIGLRRSYLCIKAHKYYCSVCSRYFNQRFPGIGKYQRASESLRKQVFHYHSKGVSQKDLARDLKLGKSTVERWYHYGYELRYKKIATRSCPRVLGLDEHSFNRKVGYATTFCDLAKHKIFDVVEGRSEKDLEGYLNTLEGKEKVQVVCIDLSSSYRKLIRRYFPNAMIVADRFHVIRLLNQFCLQTYQQIDPEMKYQRGLLAALRTNPNNLSVKRLNKRERYLQQQPVIAALYNFKQRLHRLLMRKHRTAKQCTRLIPLFLKLVASLKESPFESLKTLGRTLYQWREEVVRMWRFTKNNGITEGFRLYPNKGGILIKLV
>NZ_CP014760.1|WP_027224833.1|2366918_2367497_+|hypothetical-protein
MVNITGGNINKKIYDEYLFYYQSRLPKDAHRHAPVLANVSVFLSNPSLITQALAVLEQEVKFLWDFENSTRTADKQLKLNQSIQFCRFMNLLWPVPNEELISNKTNNLLSKVLLYREQKHGFNFDENLSQRPVPTFVGFVDKKEADKVLEKNQLWSEENKLSPLFFHGKETHRLQLNLIMIAVELGLLDIGG
>NZ_CP014760.1|WP_027224834.1|2367601_2368168_+|hypothetical-protein
MNLRHPLILRKTPAIITDNMEHNSQYIYGMDPFYFHSYLMSIARKDYPYLAQCVTEKFCKSAFKLNQIENALGYKYGNDELRALGTNERDIMSTLERLAKAYNTNIHVITSEHILQYQQAKKEGKAFNEVTNSKKLEIRAGTIKSNGFTFKDTVGVVLFKKPYQGWQEYKKHKNSHSIMEASEKKRGI
>NZ_CP014760.1|WP_027224835.1|2368515_2368770_+|type-II-toxin-antitoxin-system-ParD-family-antitoxin
MTRTMTVDLGNELRNYVESLVRSGDYRSNSEVLRESLRLLREKQAESKLEQLRHLIDEGAASGKPETWDAHDFLKKMKKKSHVK
>NZ_CP014760.1|WP_014844324.1|2368759_2369056_+|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MSNKTYRLYPKAVEDLESIYLYSTNEFGIKRTEDYILAIDLSFQRLADDPLIARKCDYIRPELRAFNVGSHIIFFKTTDYGISVIRVLHQSMDFNRHL
>NZ_CP014760.1|WP_010947832.1|2370793_2371003_+|cold-shock-protein
MSKTVNGVVKWFNEIKGFGFIEQEGGPDVFAHFKEISSSGFKTLTEGQRVQFIVTQGAKGLQAQNITAL
>NZ_CP014760.1|WP_014844326.1|2371242_2372649_+|ATP-dependent-RNA-helicase-DbpA
MIQSEHNDQHLSFSQFPLRQELIKSLASSNYENMTPIQMQSLPIILRNEDIIAQAKTGSGKTAAFALCLLNNLKISFFAVQALVLCPTRELAEQVSQAIRRLACLMPNVKIINLSGGIPMQPQLDSLRHGAHIIVGTPGRILKHLKNASLDLSQVKALVLDEADRMLDMGFFDDIKNIISVCPKQRQTLLFSATYPEEIKRLSKQFMKDPKEVHVVTPPEEIDIEQHFYEVSRHTQKFPLLKSLLLHYRPVSVLIFCNTKQETVEVTDQLINEGFSAIALNGDMEQIERDLAVLRFANQSCSILVATDVAARGLDIKELSAVINFDLAFDHDVHIHRIGRTGRAGSKGIALSIVTPADAQRICAIEDNYPHPIHWRNINELENHNTARLVPEMVTLCIASGKKDKIRPGDILGALTKDAGLASNTIGKINITAMYSYVAIHHSQADKAYQYLQSGKLKGRKVNVRKIN
>NZ_CP014760.1|WP_014844327.1|2372805_2373717_+|cation-diffusion-facilitator-family-transporter
MTIQKGLHERRALKISIAVTFLLAVVGILFGLLSGSLAIVFDGMFNMVDTVISILAFFVARLLTSKGNRRFQYGYWHIEPMVLVLNGSILILLCTYALVNAIGSLMSGGHELNFDYAFVFALLVFFLSTGMYFYLVKTNRKIKSEFLRLDIQSWLMSALISTSLLLAFGIAALLHGGAYGYFTPYIDPLILAILTAFLIFVPMAAVRDAMRDIFRMAPVGLDERIREFLDELIKQHDFKTYTSYVAKIGRAQFIEIHIVVPMDYPISSIETLDKIRNEIALAIGEDTPQRWLTIAFTANENWI
>NZ_CP014760.1|WP_076613127.1|2373808_2374327_+|MFS-transporter
MDFLEQHYHLSQIDATLVNGFSTLGYIVGAPFFGVLSHKVKNVIPIMFYAALIESILLAFNILYLHDLHLKMIFYAIVGFFTGAVTIGFSLVKDYVKPTMIGTWIGILNMGQICVGMILSLLFGELLDLFHDNYIWAAIPVILCSFISVYASYWLWKKSQSPELPARAPYKH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP014760_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP014760_2

2680980-2681073

Orphan

Consensus_repeat	Method
TTCGGCTCTTCCCCAAATCCGGGGGCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP014760_2

>merge|NZ_CP014760|2|2680980-2681073|CRISPRCasFinder
TTCGGCTCTTCCCCAAATCCGGGGGCACTAATCAAGAACACAAAACTTTAACCCTTAACCTATAGTTTTCGGCTCTTCCCCAAATCCGGGGGCA

>NZ_CP014760|2|2|2680980-2681073|CRISPRCasFinder
TTCGGCTCTTCCCCAAATCCGGGGGCA	CTAATCAAGAACACAAAACTTTAACCCTTAACCTATAGTT
TTCGGCTCTTCCCCAAATCCGGGGGCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP014760.1\|WP_027224443.1\|2689057_2689312_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014760.1\|WP_027224445.1\|2688182_2688533_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014760.1\|WP_014844504.1\|2673493_2674495_-\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-transferase-subunit-TsaD	unknown	unknown	gnl\|CDD\|236585
NZ_CP014760.1\|WP_076613041.1\|2675581_2677336_+\|DNA-primase	unknown	unknown	gnl\|CDD\|235551
NZ_CP014760.1\|WP_014844503.1\|2672483_2673317_+\|glycerol-3-phosphate-1-O-acyltransferase-PlsY	unknown	unknown	gnl\|CDD\|234691
NZ_CP014760.1\|WP_014844505.1\|2675141_2675585_+\|lpg2359-family-Dot/Icm-T4SS-effector	unknown	unknown	gnl\|CDD\|370480
NZ_CP014760.1\|WP_014844501.1\|2669561_2670689_+\|radical-SAM-family-heme-chaperone-HemW	unknown	unknown	gnl\|CDD\|235550
NZ_CP014760.1\|WP_145955627.1\|2687264_2688002_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014760.1\|WP_050598153.1\|2684097_2684958_+\|trypsin-like-peptidase-domain-containing-protein	unknown	unknown	gnl\|CDD\|379142
NZ_CP014760.1\|WP_145955626.1\|2685231_2685648_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014760.1\|WP_080020061.1\|2678643_2680515_+\|RNA-polymerase-sigma-factor-RpoD	unknown	unknown	gnl\|CDD\|235549
NZ_CP014760.1\|WP_076613040.1\|2668919_2669483_-\|ADP-compounds-hydrolase-NudE	unknown	unknown	gnl\|CDD\|183303
NZ_CP014760.1\|WP_027224442.1\|2689533_2690334_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014760.1\|WP_014844522.1\|2683252_2684041_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014760.1\|WP_010948064.1\|2674699_2674939_+\|30S-ribosomal-protein-S21	unknown	unknown	gnl\|CDD\|234707
NZ_CP014760.1\|WP_013101436.1\|2677320_2678442_-\|ISAs1-family-transposase	unknown	unknown	gnl\|CDD\|379382
NZ_CP014760.1\|WP_014844502.1\|2670720_2672130_-\|amidase	unknown	unknown	gnl\|CDD\|223232
NZ_CP014760.1\|WP_027224832.1\|2681079_2682255_-\|ISL3-family-transposase	unknown	unknown	gnl\|CDD\|376574
NZ_CP014760.1\|WP_027224444.1\|2688508_2688862_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014760.1\|WP_027224446.1\|2685799_2687065_+\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|376773

Protein	Function_ID	Function_description	E-value
NZ_CP014760.1\|WP_014844504.1\|2673493_2674495_-\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-transferase-subunit-TsaD	gnl\|CDD\|236585	PRK09604, PRK09604, tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD.	0
NZ_CP014760.1\|WP_076613041.1\|2675581_2677336_+\|DNA-primase	gnl\|CDD\|235551	PRK05667, dnaG, DNA primase; Validated.	0
NZ_CP014760.1\|WP_014844503.1\|2672483_2673317_+\|glycerol-3-phosphate-1-O-acyltransferase-PlsY	gnl\|CDD\|234691	PRK00220, PRK00220, glycerol-3-phosphate 1-O-acyltransferase PlsY.	1.43687e-89
NZ_CP014760.1\|WP_014844505.1\|2675141_2675585_+\|lpg2359-family-Dot/Icm-T4SS-effector	gnl\|CDD\|370480	pfam09424, YqeY, Yqey-like protein. The function of this domain found in the YqeY protein is uncertain.	1.56528e-59
NZ_CP014760.1\|WP_014844501.1\|2669561_2670689_+\|radical-SAM-family-heme-chaperone-HemW	gnl\|CDD\|235550	PRK05660, PRK05660, radical SAM family heme chaperone HemW.	0
NZ_CP014760.1\|WP_050598153.1\|2684097_2684958_+\|trypsin-like-peptidase-domain-containing-protein	gnl\|CDD\|379142	pfam13365, Trypsin_2, Trypsin-like peptidase domain. This family includes trypsin-like peptidase domains.	1.36798e-06
NZ_CP014760.1\|WP_080020061.1\|2678643_2680515_+\|RNA-polymerase-sigma-factor-RpoD	gnl\|CDD\|235549	PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated.	0
NZ_CP014760.1\|WP_076613040.1\|2668919_2669483_-\|ADP-compounds-hydrolase-NudE	gnl\|CDD\|183303	PRK11762, nudE, adenosine nucleotide hydrolase NudE; Provisional.	3.11856e-106
NZ_CP014760.1\|WP_010948064.1\|2674699_2674939_+\|30S-ribosomal-protein-S21	gnl\|CDD\|234707	PRK00270, rpsU, 30S ribosomal protein S21; Reviewed.	2.18906e-16
NZ_CP014760.1\|WP_013101436.1\|2677320_2678442_-\|ISAs1-family-transposase	gnl\|CDD\|379382	pfam13808, DDE_Tnp_1_assoc, DDE_Tnp_1-associated. This domain is frequently found N-terminal to the transposase, IS family DDE_Tnp_1, pfam01609 and its relatives.	6.59636e-34
NZ_CP014760.1\|WP_014844502.1\|2670720_2672130_-\|amidase	gnl\|CDD\|223232	COG0154, GatA, Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ribosomal structure and biogenesis].	5.6537e-118
NZ_CP014760.1\|WP_027224832.1\|2681079_2682255_-\|ISL3-family-transposase	gnl\|CDD\|376574	pfam01610, DDE_Tnp_ISL3, Transposase. Transposase proteins are necessary for efficient DNA transposition. Contains transposases for IS204, IS1001, IS1096 and IS1165.	8.4756e-65
NZ_CP014760.1\|WP_027224446.1\|2685799_2687065_+\|IS110-family-transposase	gnl\|CDD\|376773	pfam02371, Transposase_20, Transposase IS116/IS110/IS902 family. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS116, IS110 and IS902. This region is often found with pfam01548. The exact function of this region is uncertain. This family contains a HHH motif suggesting a DNA-binding function.	1.05306e-26

>NZ_CP014760.1|WP_080020061.1|2678643_2680515_+|RNA-polymerase-sigma-factor-RpoD
MPMTMNDQDQQSSQITKVISLGKEQGYLTYSQINDLLPNIVDTEHFDVIISMLEGMNIKVFELPPSEDELALLLNTEEVPDIEEAAMVLASVDKETGRTTDPVRMYMREMGTVELLTREGEIRIAKRIEEGIYQVLKSLAHYPETVQLVLEDYDRFLAEEIRLNEIISGFADVDEEIAPATNIGSMLDEEQQEEILLDVDEEDEDGEGGISDVDDGPNPEQAKIYFDELREAFEKAMKALKEHGRTNKKTVELLDSMSESFLKLKLTSRQVDKLTRHFRQLRNHIREFERSIMRLCIEKARIPRKLFIDTFPGQETDLSWLETIISKHAKKLDLDRIEENREEILRLQSKLASFEIEYGLTISEIKDINRKMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRISRQILQETGREATPEELAEKMELSEDKIRKVLKIAKEPISMETPVGDDDDSHLGDFIEDNNIESPIDMATAEGLREATLEILETLTPREAKVLRMRFGIEMNTDHTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSEKLRSFLEGDEG
>NZ_CP014760.1|WP_013101436.1|2677320_2678442_-|ISAs1-family-transposase
MSFVENFSILKDPRSEINQRHNLLDILFLAGTAVMSGAEGWKDIKDFGEEKLDWLRQYRDFKHGIPADDTIARVISALDSEQFTLCFVNWVNELRSKDGREQIAIDGKTLRRSYTGDRTTALHSITAWSKRNGLILAQMRSNGKANEKASVLEMLDLLELKGAIVTADAMNTEKKIAKKIHDKGGDYVLCVKNNHKKLLNEIKDYFHIMERDHREIWSQNYFEEVDAGHGRIETRTCRQIAISPWVEGYADWQGLQTVIEVTRTREIKEKTGTEVQYYISSLPLEPKQIADAIREHWAVENKAHWVLDVTYKEDDSRVRRDNAAENLALLRRFALNLARLHPQKNSMKGKLKKAMWSDKFRSELLIGQIQGKV
>NZ_CP014760.1|WP_076613041.1|2675581_2677336_+|DNA-primase
MSSNMSGLIPQPFIDDLLNRTDLVELIDGYVPLKKRGNSHIACCPFHNEKTPSFNVVAKKQFYHCFGCGASGNAISFVMNYLNQGFTDAVETLATRLGLSVPRDGTGEKHKSSLNLYNLMSEVSQYYQKKLKYNGQVAIDYLRNRGLSGEIAKRYHLGYAPEGWHNLEKAFPNNQRELLSTGMLIKSDEGKIYDRYRNRIMFPIHDRNGRVIGFGGRVLDKDQKPKYLNSPETVLFQKSRELYGLHQVLSQQKNPDSIIVVEGYMDVIALAQHGIFNVVATLGTATSTFHIQLLAKHTKHLIFCFDGDAAGKQAAWRALESSLPHLNAGLDAGFIFLPNEHDPDSLVRNEGKNGFLELLQQATPLHRFFFDTLSKDINLSNPAGKTQLINAVKPYLQKMVEGSYKQLLIDDLARLTHIESHRLTNLITDKSESKPEVQAAISRSPLRIAIALLLQNPEIYSIAIQQINPALLHEQEHHILLKLLQQLKDKPNANTATLIEFWRNSSYFELIVKLAAWDHQVPEQELTKEFIDVLLFLQKQNREILIRQYIEKSRKTGLTEAERLSLQNLLKERHGQAGQNHTLP
>NZ_CP014760.1|WP_014844505.1|2675141_2675585_+|lpg2359-family-Dot/Icm-T4SS-effector
MTIKEQINNDIKDAMRAKDKNLLNALRLISAAVKQIEVDERIEVDDERMLVILDKMSKQRKESIAQFEKASRDDLVAQEQFELNVISKYLPEPLNDNEIEELISDAIKSTGAEKMSDMGKVMAILKPKLQGRADMAQVSARIKAKLS
>NZ_CP014760.1|WP_010948064.1|2674699_2674939_+|30S-ribosomal-protein-S21
MPTVRVKEGENPEYALRRFKRSCEKAGILTELRRREFYEKPTAERKRKQAAAVKRHLKKISRDVSSRRGVGHRRKKSTT
>NZ_CP014760.1|WP_014844504.1|2673493_2674495_-|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-transferase-subunit-TsaD
MLVLGIESSCDETGIAVYDSESGLLSHALHSQIATHRVHGGVVPELASRDHVNYLVPLVDEVLTKAQIRKNQLDGIAYTAGPGLIGALLVGSCFAKSLAYALNIPALAIHHLEAHLLAAKMETPSLDFPFIALLVSGGHCQLIEVNNIGEYRLLGDTLDDAVGEAFDKTAKLMGIPYPGGAVLANLADQCLSTPYQFPRPMTDRPGLDFSFSGLKTHALNTWNQSEKKESDRSEIAKAFQQAVVETLIIKCKRAIKESQSKRLVVAGGVGANKALRSALQKWIKDIKGEVYFPALEYCTDNGAMVAYAGCLRMVRGESDGGLGVMVKPRWPLA
>NZ_CP014760.1|WP_014844503.1|2672483_2673317_+|glycerol-3-phosphate-1-O-acyltransferase-PlsY
MALFIFLILVGYLMGSINSAIIVCRTFGLPDPREEGSKNPGATNVLRLGGKQYGIMVMVFDALKGILPVILAKFLSAEPVTVAFTALAAVVGHMYPVFFHFRGGKGVATTIGALLAFHFVIGVMVAATWLLVANFWRYSSLASIASISLAPFYSLILVGNLNIFPPLFMITILVLYKHRDNFNRLIDGKEPKIKFKHSVIEEIMEASPATSAEQEFPGKEVIDTNIDETEKTEQAKAVKKPKAKKATTKAKKTTSKEETTKKPKSTKPKTKTVKEKE
>NZ_CP014760.1|WP_014844502.1|2670720_2672130_-|amidase
MDGIHLLSAIEIIRRIKMKELSAAEVMVAHLNHIDKINPVINALTERIPPEECLKQAKEIDKSIASKKNLNKLMGLPVAIKDALYVKGLICSSACSGFYKGEKAVRDATLVSRLKKEGAIILGLTNVPELCRGGDSDNLIYGRTNNPYDLARTSGGSSGGSAALIAAGGVPFALGSDGGGSLMQPAHCCGIVALKPTHGHLPHTGSVGGDSYGLIGNLISFGPMARSVSDLRLGLSVLAGSDQYDPYTNPVPVMPAAPLKKLRVAYFTENGFTPVDAEIQNVVKSAALALQDDVAIVREVRPDCVSKAFDLHWELFLGGDRGAGFKTMLSELGVNNLSWELQEFLRQAEQTQFSVTQLHQRMREIDLFRLELALFMQDYDVLISPVFPTVAKPHGIGIKEISDFSYAMTHNLSGFPTISLRCGTSAEGLPINILIAANRWKDTTSLAVAERLEQLMGGYKPPSLIHSLQ
>NZ_CP014760.1|WP_014844501.1|2669561_2670689_+|radical-SAM-family-heme-chaperone-HemW
MLPLSLYIHIPWCIRKCPYCDFNSHKSPDVLPEHQYIQALIEDLKTDISSYNTREINSIFIGGGTPSLFSAEAYNNLFNELKRILPFAKNIEITMEANPGTVEQHRFTDYRQSGINRLSLGIQSFNPNHLKILGRIHDEKQAHSAIDTARKAGFDNLNLDIMHSLPNQSVTQGLQDLKTALSYQPEHLSWYQLTIEPNTVFYKHTPPLPSEEEDYLLEEQGFTLLHNSGYHRYEISAFSKPEKQARHNINYWLFGDYLGIGAGAHGKMTTPNEIIRTRKHRQPKDYLDNEKPYLAARETITGKELLFEFMLNTTRLEQSIPLELFTTATGLELNQLLPLLKLANKKQLINLTDTHWQVTPLGRQYTNDLQALFLP
>NZ_CP014760.1|WP_076613040.1|2668919_2669483_-|ADP-compounds-hydrolase-NudE
MMRNKPKCKQRTVIAKSRLFTVEEMYLEFSNGAQRVYERIKSHGHGAVLIVALTPGESLLLVREYAAGTDSYELSFPKGVIDRSETPIEAANRELREETGFAARELHWIRSMSLAPGYFGARIELIVAEGLYHSPLPGDEPEPPETVEWPLHAAYELLEKPDFTEARSIAALFLVKEWLNKRKSYDK
>NZ_CP014760.1|WP_027224832.1|2681079_2682255_-|ISL3-family-transposase
MPKKDCILNLPGYSIKKVSGENPVYIEVSYRNVVRCIYCGNKKLRKKDSFIRRIRHESIGLRRSYLCIKAHKYYCSVCSRYFNQRFPGIGKYQRASESLRKQVFHYHSKGVSQKDLARDLKLGKSTVERWYHYGYELRYKKIATRSCPRVLGLDEHSFNRKVGYATTFCDLAKHKIFDVVEGRSEKDLEGYLNTLEGKEKVQVVCIDLSSSYRKLIRRYFPNAMIVADRFHVIRLLNQFCLQTYQQIDPEMKYQRGLLAALRTNPNNLSVKRLNKRERYLQQQPVIAALYNFKQRLHRLLMRKHRTAKQCTRLIPLFLKLVASLKESPFESLKTLGRTLYQWREEVVRMWRFTKNNGITEGFHRKMKLIQRRAYGFRNFENYRLRVRVLCG
>NZ_CP014760.1|WP_014844522.1|2683252_2684041_+|hypothetical-protein
MLIFNCTKAASDFFTTIRKGNKLSPMSPTPKCELSEEPVLHDHQQWHWMVHVKKFGHRNVILAMDTDSRFCMIFWGLKKGNIQKFLEQFHDRFSLHIISVINMGGQDETLLNASMESFLENHHEYAFVPRGDRSVQAHINDALMNLQYEQYRWEDDLPTEEELFISDLRHNDTPRKRKQDRDYIFPTEILYNTWLSRYANLDEQTIKHTISKYRQTNSQLWRFPFDIDVGDLNFNEIETVIAEALSDNVLSFEDYFKQKNCK
>NZ_CP014760.1|WP_050598153.1|2684097_2684958_+|trypsin-like-peptidase-domain-containing-protein
MRVIQPRTVAEQLLYSTVRISGDNGTGTGFFFHIQLDQDKQIQLILTNKHVINCNRKLSFYFHEAVTDDKKFEPTNQSFSITIENYANLWIPHPKDEVDLGALLFVPIRNHAKEKLGKEIFNFSFDDSLIRDDDELAEESDVDNKVLMIGYPIGLWDEVNNFPIVRNGITASHPSLDFNGRSVGIIDMACFPGSSGSPVLICLQGFHDKVGNYHISANKNILLGLLSSGPYLTQSGQIEIKEIPTTNMVPVASFNQMIHLGYYVKAKEILVLYEHIKNQVLLNGNN
>NZ_CP014760.1|WP_145955626.1|2685231_2685648_-|hypothetical-protein
MTRSRPYHSDDNAHVEQKNWTHVRQLFGYERFDKKEVVELMNDLYRNEISLMNNYFLPNTKLIEKQRVDAKIIKKHDKAATPYQRLMKSKHISEEKKQELQKIYNTLNPFELRNNIKKKVDRIFRLINNKGDKNICYT
>NZ_CP014760.1|WP_027224446.1|2685799_2687065_+|IS110-family-transposase
MTVNVNSMKDAVLVAIDIAKARNDVLVQLPNSTKKKFKVANKMKDYKEFIDYLSSFNKPCFIAFEATSNYHRPIAYHLQKAGFTVHLVSSFAAAKTREALHNSWDKNDPKDAQVILHLLKTGVVQTYYDPLINQYNDIQEIAKTYHQISLRKVRVQHSIMNHYLPLYFPEAEMFFHSSRALWFSHFISHFPTPSTILKYTQEEFINAAWDVVGRKVDKRNWLINFYQTAKESIGLPTEPDAQAIRMFCIILQEHQDLCKQLKILEETAESFLEGNNDYKHLLSIPGIGPIIALTILAEAGNLKRFKHYRQFLKFCGFDLSTQQSGFFRGQTKLSKFGNARLRYVFWLAATVAIRMRENTFRKKYENYIKQDPLNDDLKRKGYTAVAAKIARVAYGIIKNETNYRCYHESVIPSGRIPSIGP
>NZ_CP014760.1|WP_145955627.1|2687264_2688002_-|hypothetical-protein
MDLYLDNIIRRYHAATRKEKSMILNELCTASGYHKKNAIRLLNQKKQPNKADKKRRGRPPQYKCPVYLEPLKKIWLCTEQLCGKRLKMALPLWLPHYGAIYGELDPVIYEGLLKMSASTIDRMLSSSRVKGKRGLSGTKPGTILKKHIPIKTDQWNEEKPGFLEADTVAHCGSSLAGDFAWSLTMTDMCSTWTENRAIWNKGAIGVLAQIEDIEKNLPFDILGFDSDNVLNLESMIFLKKSNPIR
>NZ_CP014760.1|WP_027224445.1|2688182_2688533_+|hypothetical-protein
MNRFNQLNTNEPELNNKLVNALKAIGVGICKKYLVDLSDINYEKVVFDNDTWININFVVDCIDQNQLSKLNIELSKELAKYTEFLNSDIEYIPSFTQGEIKCQSHTVNSCAPQKYL
>NZ_CP014760.1|WP_027224444.1|2688508_2688862_+|hypothetical-protein
MRSAKILVTGNNEIDFRNATSRAYYSALHKADIVAAKSNGISKKNSGLHAQLIQKLKSHTGSTIIDDNIRQIGVLLGMCKKYRVNADYKINHTIDRSFAQQTISLVEQLLILSNQIP
>NZ_CP014760.1|WP_027224443.1|2689057_2689312_-|hypothetical-protein
MYIIYFDEVKNRPHKQRYYWLGALAIPHDLALDLETKVNDISNEVFGSPLLSKDTEFHGNEIICGTRVRSCLLPLKNKKAKSKI
>NZ_CP014760.1|WP_027224442.1|2689533_2690334_-|hypothetical-protein
MAHYLRDQQITNVSIGESEIEQITTLFIRQVNTLNGLIPKGDDGAKTPIFYFTIRFDGKGYRVFSQEELLAHFKQAKEVERIIFTLETGESIRTVRNIGVVIELKLDQNNPGNCSLVVTSDDQEMVNTVFFSFQEVLMNCKNKYGFVRTAWMELFVQIVGIAFGFIFSLWAAVKIAPRISIENSFVICFFFIFLLFSNTWSYLSKLIHGFLNYIFPNVYFYRPDKHRVTWLMQIIVTAIIGAISLWILGALSSYFIGIISGFVVKN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP014760_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP014760_3

2714505-2714671

Orphan

Consensus_repeat	Method
AAATTTACCGCGATAACAGTAATTT	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP014760_3

>merge|NZ_CP014760|3|2714505-2714671|CRISPRCasFinder
AAATTTACCGCGATAACAGTAATTTTATGAGTTTAACATAAATAAATACACTGAAAATTAGAAAGCCGAGTAAATTTACCGCCATAACAGTAATTTATGGGGAATTAATGCAAAAAAATGCAATAATAAATTTATTTTAATCATTTTTACTGCTATAACAGTAATAT

>NZ_CP014760|3|3|2714505-2714671|CRISPRCasFinder
AAATTTACCGCGATAACAGTAATTT	TATGAGTTTAACATAAATAAATACACTGAAAATTAGAAAGCCGAGT
AAATTTACCGCCATAACAGTAATTT	ATGGGGAATTAATGCAAAAAAATGCAATAATAAATTTATTTTAATC
ATTTTTACTGCTATAACAGTAATAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP014760.1\|WP_027224433.1\|2708508_2709855_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014760.1\|WP_027224430.1\|2713332_2714250_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176109
NZ_CP014760.1\|WP_027224434.1\|2704365_2704626_-\|Rieske-2Fe-2S-domain-containing-protein	unknown	unknown	gnl\|CDD\|239560
NZ_CP014760.1\|WP_014844539.1\|2722498_2723398_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014760.1\|WP_027224429.1\|2714916_2715225_+\|toxin-HipA	unknown	unknown	gnl\|CDD\|274416
NZ_CP014760.1\|WP_014844538.1\|2722177_2722471_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|277194
NZ_CP014760.1\|WP_015961553.1\|2707704_2708340_-\|flavin-reductase-family-protein	unknown	unknown	gnl\|CDD\|224766
NZ_CP014760.1\|WP_013101792.1\|2714692_2714920_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|213767
NZ_CP014760.1\|WP_027224426.1\|2718884_2719829_+\|flippase-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|377103
NZ_CP014760.1\|WP_027224427.1\|2716282_2718850_+\|magnesium-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319772
NZ_CP014760.1\|WP_027224431.1\|2712680_2713154_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014760.1\|WP_014842401.1\|2710602_2710800_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014760.1\|WP_106202151.1\|2720093_2721875_+\|heavy-metal-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319844
NZ_CP014760.1\|WP_014844540.1\|2723559_2724999_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014760.1\|WP_027224432.1\|2710819_2712046_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340887
NZ_CP014760.1\|WP_014844541.1\|2725244_2726153_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP014760.1\|WP_027224435.1\|2703124_2704333_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|340863
NZ_CP014760.1\|WP_032802697.1\|2704874_2706443_+\|IS1182-like-element-ISLpn13-family-transposase	unknown	unknown	gnl\|CDD\|372705
NZ_CP014760.1\|WP_027224428.1\|2715221_2716154_+\|HipA-domain-containing-protein	unknown	unknown	gnl\|CDD\|377920
NZ_CP014760.1\|WP_042233675.1\|2709844_2710552_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|381179

Protein	Function_ID	Function_description	E-value
NZ_CP014760.1\|WP_027224430.1\|2713332_2714250_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176109	cd08417, PBP2_Nitroaromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators that involved in the catabolism of nitroaromatic/naphthalene compounds and that of related regulators; contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of dinitrotoluene and similar compounds, such as DntR, NahR, and LinR. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. Also included are related LysR-type regulators clustered together in phylogenetic trees, including NodD, ToxR, LeuO, SyrM, TdcA, and PnbR. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.68537e-55
NZ_CP014760.1\|WP_027224434.1\|2704365_2704626_-\|Rieske-2Fe-2S-domain-containing-protein	gnl\|CDD\|239560	cd03478, Rieske_AIFL_N, AIFL (apoptosis-inducing factor like) family, N-terminal Rieske domain; members of this family show similarity to human AIFL, containing an N-terminal Rieske domain and a C-terminal pyridine nucleotide-disulfide oxidoreductase domain (Pyr_redox). The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer. AIFL shares 35% homology with human AIF (apoptosis-inducing factor), mainly in the Pyr_redox domain. AIFL is predominantly localized to the mitochondria. AIFL induces apoptosis in a caspase-dependent manner.	1.28129e-10
NZ_CP014760.1\|WP_027224429.1\|2714916_2715225_+\|toxin-HipA	gnl\|CDD\|274416	TIGR03071, couple_hipA, HipA N-terminal domain. Although Pfam models pfam07805 and pfam07804 currently are called HipA-like N-terminal domain and HipA-like C-terminal domain, respectively, those models hit the central and C-terminal regions of E. coli HipA but not the N-terminal region. This model hits the N-terminal region of HipA and its homologs, and also identifies proteins that lack match regions for pfam07804 and pfam07805.	5.37248e-44
NZ_CP014760.1\|WP_015961553.1\|2707704_2708340_-\|flavin-reductase-family-protein	gnl\|CDD\|224766	COG1853, COG1853, Conserved protein/domain typically associated with flavoprotein oxygenases, DIM6/NTAB family [General function prediction only].	5.31538e-37
NZ_CP014760.1\|WP_013101792.1\|2714692_2714920_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|213767	TIGR03070, couple_hipB, transcriptional regulator, y4mF family. Members of this family belong to a clade of helix-turn-helix DNA-binding proteins, among the larger family pfam01381 (HTH_3; Helix-turn-helix). Members are similar in sequence to the HipB protein of E. coli. Genes for members of the seed alignment for this protein family were found to be closely linked to genes encoding proteins related to HipA. The HibBA operon appears to have some features in common with toxin-antitoxin post-segregational killing systems. [Regulatory functions, DNA interactions].	1.63778e-24
NZ_CP014760.1\|WP_027224426.1\|2718884_2719829_+\|flippase-like-domain-containing-protein	gnl\|CDD\|377103	pfam03706, LPG_synthase_TM, Lysylphosphatidylglycerol synthase TM region. LPG_synthase_TM is the N-terminal region of this family of bacterial phosphatidylglycerol lysyltransferases. The function of the family is to add lysyl groups to membrane lipids, and this region is the transmembrane domain of 7xTMs. In order to counteract attack by membrane-damaging external cationic antimicrobial molecules - from host immune systems, bacteriocins, defencins, etc - bacteria modify their anionic membrane phosphatidylglycerol with positively-charged L-lysine; this results in repulsion of the foreign cationic peptides.	6.70438e-18
NZ_CP014760.1\|WP_027224427.1\|2716282_2718850_+\|magnesium-translocating-P-type-ATPase	gnl\|CDD\|319772	cd02077, P-type_ATPase_Mg, magnesium transporting ATPase (MgtA), similar to Escherichia coli MgtA and Salmonella typhimurium MgtA. MgtA is a membrane protein which actively transports Mg(2+) into the cytosol with its electro-chemical gradient rather than against the gradient as other cation transporters do. It may act both as a transporter and as a sensor for Mg(2+). In Salmonella typhimurium and Escherichia coli, the two-component system PhoQ/PhoP regulates the transcription of the mgtA gene by sensing Mg(2+) concentrations in the periplasm. MgtA is activated by cardiolipin and it highly sensitive to free magnesium in vitro. It consists of a transmembrane domain and three cytosolic domains: nucleotide-binding domain, phosphorylation domain and actuator domain, and belongs to the P-type ATPase type III subfamily. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP014760.1\|WP_014844538.1\|2722177_2722471_-\|hypothetical-protein	gnl\|CDD\|277194	cd15841, SNARE_Qc, SNARE motif, subgroup Qc. SNARE (soluble N-ethylmaleimide-sensitive factor attachment protein receptor) proteins consist of coiled-coil helices (called SNARE motifs) which mediate the interactions between SNARE proteins, and a transmembrane domain. The SNARE complex mediates membrane fusion, important for trafficking of newly synthesized proteins, recycling of pre-existing proteins and organelle formation. SNARE proteins are classified into four groups, Qa-, Qb-, Qc- and R-SNAREs, depending on whether the residue in the hydrophilic center layer of the four-helical bundle is a glutamine (Q) or arginine (R). Qc-, as well as Qa- and Qb-SNAREs, are localized to target organelle membranes, while R-SNARE is localized to vesicle membranes. They form unique complexes consisting of one member of each subgroup, that mediate fusion between a specific type of vesicles and their target organelle. Their SNARE motifs form twisted and parallel heterotetrameric helix bundles. Examples for members of the Qc SNAREs are C-terminal domains of SNAP23 and SNAP25, syntaxin 8, syntaxin 6, and Bet1.	1.22334e-13
NZ_CP014760.1\|WP_042233675.1\|2709844_2710552_-\|hypothetical-protein	gnl\|CDD\|381179	cd19916, OphMA_like, tetrapyrrole methylase family protein similar to Omphalotus olearius omphalotin methyltransferase (OphMA) and Dendrothele bispora dbOphMA. OphMA, is the precursor protein of the fungal cyclic peptide Omphalotin A. Omphalotin A is a potent nematicide, having 9 out of 12 of its residues methylated at the backbone amide. Omphalotin A derives from the C-terminus of OphMA (also known as OphA). OphMA catalyzes the automethylation of its own C-terminus using S-adenosyl methionine (SAM); this C terminus is subsequently released and macrocyclized by the protease OphP to give Omphalotin A.	5.61241e-84
NZ_CP014760.1\|WP_106202151.1\|2720093_2721875_+\|heavy-metal-translocating-P-type-ATPase	gnl\|CDD\|319844	cd07544, P-type_ATPase_HM, P-type heavy metal-transporting ATPase; uncharacterized subfamily. Uncharacterized subfamily of the heavy metal-transporting ATPases (Type IB ATPases) which transport heavy metal ions (Cu(+), Cu(2+), Zn(2+), Cd(2+), Co(2+), etc.) across biological membranes. The characteristic N-terminal heavy metal associated (HMA) domain of this group is essential for the binding of metal ions. This subclass of P-type ATPase is also referred to as CPx-type ATPases because their amino acid sequences contain a characteristic CPC or CPH motif associated with a stretch of hydrophobic amino acids and N-terminal ion-binding sequences. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP014760.1\|WP_027224432.1\|2710819_2712046_-\|MFS-transporter	gnl\|CDD\|340887	cd17329, MFS_MdtH_MDR_like, Multidrug resistance protein MdtH and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli MdtH and similar multidrug resistance (MDR) transporters from bacteria and archaea, many of which remain uncharacterized. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtH confers resistance to norfloxacin and enoxacin. MdtH-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	9.6053e-13
NZ_CP014760.1\|WP_014844541.1\|2725244_2726153_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.67439e-50
NZ_CP014760.1\|WP_027224435.1\|2703124_2704333_-\|hypothetical-protein	gnl\|CDD\|340863	cd06173, MFS_MefA_like, Macrolide efflux protein A and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Streptococcus pyogenes macrolide efflux protein A (MefA) and similar transporters, many of which remain uncharacterized. Some members may be multidrug resistance (MDR) transporters, which are drug/H+ antiporters (DHAs) that mediate the efflux of a variety of drugs and toxic compounds, conferring resistance to these compounds. MefA confers resistance to 14-membered macrolides including erythromycin and to 15-membered macrolides. It functions as an efflux pump to regulate intracellular macrolide levels. The MefA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.7029e-13
NZ_CP014760.1\|WP_032802697.1\|2704874_2706443_+\|IS1182-like-element-ISLpn13-family-transposase	gnl\|CDD\|372705	pfam13751, DDE_Tnp_1_6, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis.	3.53077e-11
NZ_CP014760.1\|WP_027224428.1\|2715221_2716154_+\|HipA-domain-containing-protein	gnl\|CDD\|377920	pfam07804, HipA_C, HipA-like C-terminal domain. The members of this family are similar to a region close to the C-terminus of the HipA protein expressed by various bacterial species. This protein is known to be involved in high-frequency persistence to the lethal effects of inhibition of either DNA or peptidoglycan synthesis. When expressed alone, it is toxic to bacterial cells, but it is usually tightly associated with HipB, and the HipA-HipB complex may be involved in autoregulation of the hip operon. The hip proteins may be involved in cell division control and may interact with cell division genes or their products.	1.81154e-59

>NZ_CP014760.1|WP_027224430.1|2713332_2714250_+|LysR-family-transcriptional-regulator
MDKLNLNLLRALYALLTCRHLTLASKKMGISQSSMSIYLKQLREHFHDDLLVRGQGNIMQLTPLANSLIGKARQALSLIETLFNTIETFNPLISERSFSIGMTDLMSILLTPSLIKRLEQEAPGVKLNIKHPSYLNTVEVFESGDIDLMIGMFERVPEGLKQQKLFQDEAVIVGGNNHPGIQKGKICIEELFKYPLIQFSLRETPFYNYFDRYLRQLGHDKRVSISLGQGIMPLFVLTDSHYLTLSIRKVAEKLSHLIPLSIASVPFEVDSFNCYQYWHQKDDADPGHRWLREMVLSIAKKSYLK
>NZ_CP014760.1|WP_027224431.1|2712680_2713154_+|hypothetical-protein
MRSRTEKLSSKRSIINHDHLITDEACMIGIYREGGDLSIYAESSEGIEHFSINRGNSLDMVILPHTLVGTWGHHQLLRTVEQAAQIRALRIRSHDYIEQSVTRKELEQFKEVFMLACKEEISNQPEIEDYLQTALGKLHGEPEMTYKPKFTEQCSIL
>NZ_CP014760.1|WP_027224432.1|2710819_2712046_-|MFS-transporter
MRNFFKNISALYLDVPKLTKTLLPIIILEHLVASFCLNISAYFKKVNYFQYEQIGEFISCYYWGCLFGSLIGGALTLYYKTSKISGWGLMLLGVCLFGLMNSISLWLIAISMFLVGFIGTITATANLTSLIRSVKDNEKLKLKVISLDLIIFNLCFSFVTFVLLDLSPLYILKYVQIMICLLVFVGIGSLIFYQDSIFNPPKLGSLGFKIILPERKQEFMLLMSMVLFFGLIFSMVKVVFAPTLIERFGSNMMSVIAASINPWVVFLIQPLIVGRIKNSNSIWFLGIGGLIVGLSYFMFGMVNSFELTAIVLVLLTFGEMMFGPLSKHFNIQLYRSGQEGVATGIWRAVFLGSGAIGPGLSGYVAEYYGTYVVWDCCALLGLLCFVFSLYLRKIQIKMPYSKLVLDNQ
>NZ_CP014760.1|WP_014842401.1|2710602_2710800_-|hypothetical-protein
MNTYEKLVYLATEPIDNKVVLCDKKGSKLKSSLAVQEELKDEFIHADLSIDIRRACETHLSFVLR
>NZ_CP014760.1|WP_042233675.1|2709844_2710552_-|hypothetical-protein
MTLEVQSVIQKCDCVIYLVNEPAIKRWIDENSKKAISLDAIYFSFQERKEAYQAICQEVINIVTKNQNTCFIIYGHPLILSNSAEQLIKEIKEESLDLEIEILPGISSIDTLLCDLCIDPGNGGLQAFEATEFINTNYKINTNSHLILWQIGVVGVKSIIQNDKDLVDSIERKIAIFQLQRKLLDWYNETHPIVLYVASIYPQIPCEKFDICLSNLDKVNIPRLATAYIKPDLIP
>NZ_CP014760.1|WP_027224433.1|2708508_2709855_+|hypothetical-protein
MFTTIDNNEGIVQTYWTEVRNKFEKADPYLSKLIDNVSPDKLPIYLLYFPYGMLKGDTKSSYMPLLDGGYIKLSDTGVDKKIVNDLGYGMYSSPLGMVLDKFIEYFIEFDDKIFTYYISGPGTIFNTGMLLKNKNSRNYSPNGVLKATAGARTAFMLPSINSHNGINKLSKLVNQDLTTPRNHNDHFELFKAINQHDNSNWKVCLAYFSEKWVKHLLTDPAWVEIKNYMLEAKNKNDSFSVNSAYYDIFYSKAQKDRNLRTSSPYLTNTAIHLIKIALGEHPGYVPATTANFLPIESIQKFISESFQLKRTPTIMVPHSLVYEKEKEPVYYSLQNPTTPHFLTKKNEKVTANQEIDIIYRILNKFIEEMSKQDSLLAGTVFSDISDHIRFNYFHNYPPKDSNLINNSRQLSKLDPRFNFSSYKNGESEFCFEGQFLRGCIQIQPNVKE
>NZ_CP014760.1|WP_015961553.1|2707704_2708340_-|flavin-reductase-family-protein
MFLQTSQKLPKGMFKACVVPRPIAWIGTKDSEGNHNLSPFSFFNIVCEEPPMVMFATTGAHNSGGAKDTLKNVEDTKEFTVNLVSYGSKEAMNITSLDFSRGISEFDMAEVDHLPSRLIQTPRVKESPISLECVYHESIQLPIPIHSNLINRMVIGKVVGIHLKPEILTKDKRIDTNKLNLIARVGYNSYTKVKAHFDLNRPCGCCNKLMD
>NZ_CP014760.1|WP_032802697.1|2704874_2706443_+|IS1182-like-element-ISLpn13-family-transposase
MIKQENWIYPIELSKKEEKICSKLKQNGKLFIFLRKNRHLIFTADISQKLLSMYADYPRGKPLISPTLLAMVSILQAYEQLSDSSAVLETMFDQRWQMVLGCLGAEESIFSQGTLCDFRHRLVKHNLDTMLLEQTVEVAKEVGGFCYKQLRIALDSAPLEGAGRVEDTFNLIGHALELVVDCAAQIKQVDEIEIIKEAGTYLIGRSSIKAALDIDWSDIQEKQKAINTLLKDVEALQRWLSGQSDSLINNQYLKEALSLLDTVLNQNIEPDPDGGSKIIRGVSTDRRISISDSDMRHGRKSSSRTINGFKQHIAIDLDHKLILATSVRPANEPEHEASQWLKPKVEKYGEVASKSIDRGYLSASWTAELFSQGKKIIAKPWNPATHGKYGKKDFIIDLQNSMVICPAGKQQKITGKPGSLMAKFSAKLCGACPIKNKCSDSKTGRVIQIHDQEKMLQALKYYVTSPEGRQEARERVKVEHALATICNRKGPRARYIGLRLNEYDLNRTAMITNLHIAMNLAA
>NZ_CP014760.1|WP_027224434.1|2704365_2704626_-|Rieske-2Fe-2S-domain-containing-protein
MINKKHILNNRYFCKNDENYFIVKLNNKRFAIPDKCPHRGGPLSLGNICRESQRIQCPWHDGYFKISSLIKSAIPAVRVKDQIFYI
>NZ_CP014760.1|WP_027224435.1|2703124_2704333_-|hypothetical-protein
MVRHLKLIIILAFTLAGDILFGLALIWRVLALDGSAKTLGLFLCVITLVTFALQKSSVGFRRMLEKTPRRSFMWIRGVGVGFSIIFIPLLWHETTWLLYLVGAIATIINFLSILTLEAMMAHEVLEKRISSNKASRILQIAILTSSFLGASLLGTILALGNIVAVLLFCIATYLVGAICFSTQSDVGIQKISQVQTAKTASNQKMTYGNNLSVLRLAFIGLTLLMTQISAFNFLLPLIAQHEKFWTASQYGFIDAAAELGGLLATIIMFEKGIFSKLWIFAFLGIALVDILFFAVTDIYLISTATLFLGFCVSCFRIKQREYIYDSVSNTEEILEWTGRITAMTAIIKALTPLGLAFFISQPSFDLMIIGIVVGTVMLIVTSVLYFYTNKEFKQQIPSYSAV
>NZ_CP014760.1|WP_013101792.1|2714692_2714920_+|helix-turn-helix-transcriptional-regulator
MPTHEIANLVHYYRKQSGLSQQELAHLAGVGKTVIYDIEKGKESVRLNTLLKVLDVLNIQMKFETPFPQTTDNNS
>NZ_CP014760.1|WP_027224429.1|2714916_2715225_+|toxin-HipA
MRKAYVSVNGIKAGILEELQSGKYQFSYFDDYHGAPVSLTMPLTNKVYDFDVFPPFFEGLLPEGIMLEALLRKYKIDKNDYFGQLIIVGQDVVGAVTIEEIR
>NZ_CP014760.1|WP_027224428.1|2715221_2716154_+|HipA-domain-containing-protein
MKRCPITYEKISDQENYSQRGLRLLSPQLKNLSPLDLSADEQRQEAIARVGKMSIQGVQKKLSAKLKIKEGSFEIVDQNGHYILKPQSDIYPELPENEAITMTLAKTIGLEVPVHGLVYSKDNSLTYFIKRFDRIGHNKKLALEDFAQLSGEDRHTKYKSSMEKVIAIIEQFCTFPKIEFVKLFKLTLFNFLVGNEDMHLKNFSLITRDRKISISPAYDLLNSTIAQKNTKEEIALPLKGKKNNLTKSDFLNYFAVEKLGLNQNVINGIAQEFHQAIPEWRELISFSFLSQPMQEKYLQLLDQRCKRLNF
>NZ_CP014760.1|WP_027224427.1|2716282_2718850_+|magnesium-translocating-P-type-ATPase
MKINLDLNDLSTYDQDLLLNELNSSLEGLNNFQAQKRLTQYGTNEILRKPYHLIIIEAISHSINPLVAILFFAALISAFTGNVVNAAIIISIIIISIGLDYFQSHRALVAIKMLQKKIATTVTVLRENQWLEIPAKELVPGDLFRLSAGDMVPADSILLKSKDLHIHQSALTGESMPVEKEAIPLKTKPKNPLDALNVVFSGSSVIGGSATALAINTGSNSLYGHIAESLKKKPPHTEFEQGMMRFSTFIMKMVFLLVIFVFSINIYMHRPLLDSLLFAVALAVGLTPELLPMITTVTLASGAVRMSKKKVIIKNLSAIQNFGSIDILCSDKTGTLTSGEMNLTKYLDFSGKQSEFVMLLAYLNSVYITEIKSPFNIAVLKKARLNPLDLAILKHDHPDIQPYHKVDEIPFDFERRRSSVIVSKNENHLFICKGAPENIMSVCSYYDFAGERELFTEKEQKQCELLFQSLSSEGYRVLAIAYKLMDRQLKYTQSDEKEMIFAGFLAFTDPLLEDIPKVIKDLRHEGINIKILSGDNLIVTQHICQKVGMDTSRILTGEEISKISDDALPPLAEQIDIYARINPMQKQRIISALKKRGHVVGYLGDGINDVPSLHQADVGISVASAVDIAREAADIVLLEHHLKVLLNGIIEGRKSFRNVMKYLMMGTSSNFGNMISMAIAVLFLPFLPMLPRQILLNNLLYDISQITIPTDHVDPSSIHRYKRLDINIIRQFMFYVGPISSVFDFLTFFVMLKIFSANEALFQTGWFVESLATQTLVIFIIRTAKKPWQSMPSLPLTTTVLLIVMVGIWLPFSPFSGLFGFVPLPPLYFLFLVTATFTYLFLVELIKKKIMRKLY
>NZ_CP014760.1|WP_027224426.1|2718884_2719829_+|flippase-like-domain-containing-protein
MIKWISGFIILVVLIIVIGHFSQLRVFLGLIEQMKFSWLFFAVIFQSGTYMSLAAVWRLALRWFGEQISFFQLFLLSFSQLFVNQTIPTSGLSGVTIMTKFLLGRLITPKAIALAIALNVFSRQVAYLTSFIASIVVFWFYNELNKTLISLSLIFILIMVAVLILAALLWQQALKLKIPKLLNKYTSIRILINEIKKLDPKIVLNFKLFFPAVVFSVAIFIFDSLTLWTILKSLNLDLNFRLIFAAQVIASSIASLSFFPGGLGIFEGSLTGLLTFLGLSIEQAFTATILFRGFTYWLPMLPGFLLTQKELLRI
>NZ_CP014760.1|WP_106202151.1|2720093_2721875_+|heavy-metal-translocating-P-type-ATPase
MKIINVPYINVPLILIIIIGGLPLFIQISIKLVQGDLGADTLAALSLITGVILHEYLAACLIILMLASGQTLEVYARRKASSVLQALISRMPSKVHIRKNEQITDIPLSETQIGDEIIIYPHETCPVDGEVIDGHGTMDESYLTGEPYLIAKAPGVTVLSGAINGEALLVVKASKRPSDSRYAAIVEVLKEAEQKKPTLRRLGDQIGAIFTPIALFFALLAWYFSGDPIRFLSVLVIATPCPLLIAIPITIISAVSMAAKQAIIIKDPTILERLPTCQTAIFDKTGTLTYGKPTLTKIITTETYSHSDILQYAASLERYSKHPLSNSILDAAKERGLTLLQASEVFEKPGQGLLGKINDHSVQVTSRKKFLAKHPEEVGFLPEHSSGLECLILIDEQFAAVLQFHDAPREESHSFIHHLAPSHQFKKIMLVSGDRESEVKYLGKLLELTEIYSSQSPEQKLKIVRDETRKAPTLYMGDGINDAPALTAATVGIAFGQYSNVTAEAAGAVIMENTLNKVDELMHLSINTRKIALQSAIGGMLLSIIGMSFAALGFINPVTGAILQELIDILAIINALQLTWGSRVKIDLPGYKA
>NZ_CP014760.1|WP_014844538.1|2722177_2722471_-|hypothetical-protein
MKKNSSTKKILSSLSDTELQEKQELMMSEQDEQLDILLKTVTRTHEIAEAIQEELTSQNKLIDGLNEHVEKTDGKVKNTTKKVEALIPEVRSSCFLM
>NZ_CP014760.1|WP_014844539.1|2722498_2723398_-|hypothetical-protein
MFSPLQDPWSELEELGFNPEYLKRLKERAATSIEMTKNIEMLADYYEQFKEVGFTDSDLARIVSLVSFTADNRLANIGSRMMITLVCGGLNLVKAPLHFKPHKLTNMMLSLNGLEKLRTLVEMSKESGFTPLKNQAEFKAIFEKRCKKFPMLRVLWCYSDANESYMEYRKQDAIYKDWLSEEELHQLNRLSRISKTRDLHYWKRDTVRPVLLGDNYYSREDFGQTREEFEKAQDNPDAVESWCDSWANPFDQNPDSALTQSQEKSNQRNASKIPFFTVYENNGKSGVVDEQQSSNAFSN
>NZ_CP014760.1|WP_014844540.1|2723559_2724999_+|hypothetical-protein
MENKTKALNFLNRIERCLVPQSNPQIMKQLLSALGLDKLTTGNEEYKFFIQTIKKKSIDLNPLISKVKSDILNNDPLWTLLDYIEANELIDDAEIENASSTIQLQINLLCLLEAITITMANSNDFAHDIYNHMMKQRGKGATGNPFYNFLFGIPSRATLFERLKLISIDPGLTSIIFHRQMGENPETQADLDDFVSQNSLSGWNADIELANFDVASTSTLPAMGVNILEAVWEDATGHNKNTGGILNAQAGLGLIRVMEEQEYTTSFKLAETTLPQGTTLHSDFGYSLIPELKVDNSPKKVSQFHIDKQWMNLYNSWNLLFVIGNIDSVFVPLKLLMPSVFSAEPSNYKETRVLTLFLVANLFLNQQTLNNPLFSNNFSFRNGTVIMKKWGEINKNHASELLQQCKELDDLYNHVLGKNPHLNFGLKLFSYFQDSHQFRLTKKAQPSTSIDYSFFSGNTPSENNSEKMGVALHSSLYTK
>NZ_CP014760.1|WP_014844541.1|2725244_2726153_+|LysR-family-transcriptional-regulator
MNILSCLKGFITTVDCKSFSKAAQKLYISPSKLSKQITWLEEELKVTLLIRSTTRLTVTDSGHRLYEKSLQLFEQLEAVKVIATPDQLELNGVIRLYLTVTPAIPYLTTLSIQFMRQYPKIEVDIIVGSDTKELYSSTFDLAISFDDVKHSKLVCKRLFSIQRKVFASPGYIAQHGLPQTLDELPKHNCLINTLYGLQNKWVFNKKIIHVSGNFKSNNAGVLKQAAVADVGILWAPYFSVYEEIKNETLIPVLPQESSPDINLYAICPKSTVDEQKINLLLNFFCEKALSENIATSFIDGNN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

809422 : 872218

Escherichia_phage(25.0%)

coat,tRNA,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027220123.1\|809422_812188_-\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	9.0e-158	39.7
WP_027220122.1\|812444_815492_-	MMPL family transporter	S5VTK5	Leptospira_phage	5.0e-61	22.4
WP_011945869.1\|815608_816871_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_010946459.1\|817111_817516_+	hypothetical protein	NA	NA	NA	NA
WP_010946460.1\|817581_818019_+	hypothetical protein	NA	NA	NA	NA
WP_011214932.1\|818143_818455_+	BON domain-containing protein	NA	NA	NA	NA
WP_027220121.1\|818482_819736_+	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	2.8e-98	51.7
WP_010946463.1\|819738_820206_+	transcriptional regulator NrdR	NA	NA	NA	NA
WP_072364019.1\|820278_820707_+	transcription antitermination factor NusB	NA	NA	NA	NA
WP_076612804.1\|820678_821656_+	thiamine-phosphate kinase	NA	NA	NA	NA
WP_011945873.1\|821745_822228_+	phosphatidylglycerophosphatase A	NA	NA	NA	NA
WP_011945874.1\|822227_823280_+	AI-2E family transporter	NA	NA	NA	NA
WP_011945875.1\|823271_824009_-	outer membrane beta-barrel protein	NA	NA	NA	NA
WP_011945876.1\|824018_824657_-	porin family protein	NA	NA	NA	NA
WP_076612805.1\|824822_826271_+	Dot/Icm T4SS effector RavH	NA	NA	NA	NA
WP_011945878.1\|826322_827933_-	NAD+ synthase	A0A2L0UZF5	Agrobacterium_phage	3.7e-87	36.0
WP_013101194.1\|828140_829112_+\|transposase	transposase	NA	NA	NA	NA
WP_079996937.1\|829108_829594_+	hypothetical protein	NA	NA	NA	NA
WP_013101177.1\|829812_833079_+	helicase	M1GYP4	Paramecium_bursaria_Chlorella_virus	2.7e-36	27.8
WP_010946474.1\|833338_833773_+	DUF2147 domain-containing protein	NA	NA	NA	NA
WP_010946475.1\|833957_835340_+	replicative DNA helicase	O80281	Escherichia_phage	2.9e-141	58.1
WP_013101178.1\|835341_836415_+	alanine racemase	NA	NA	NA	NA
WP_010946477.1\|836487_836937_+	glycine zipper 2TM domain-containing protein	NA	NA	NA	NA
WP_014326726.1\|837182_837677_+	CBS domain-containing protein	NA	NA	NA	NA
WP_095197751.1\|837708_838980_+	hypothetical protein	NA	NA	NA	NA
WP_027220118.1\|839383_840934_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	4.9e-20	35.9
WP_010946482.1\|841085_842075_+	lipoyl synthase	NA	NA	NA	NA
WP_011945886.1\|842228_842510_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_014841180.1\|842909_844418_-	peptide MFS transporter	NA	NA	NA	NA
WP_010946484.1\|844456_845275_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_072401764.1\|845434_846817_+	N-acetyl sugar amidotransferase	NA	NA	NA	NA
WP_072401765.1\|846813_847578_+	glycosyl amidation-associated protein WbuZ	NA	NA	NA	NA
WP_038837788.1\|847574_848216_+	imidazole glycerol phosphate synthase subunit HisH	NA	NA	NA	NA
WP_011945890.1\|848228_848927_+	acylneuraminate cytidylyltransferase family protein	A0A1B1IVD3	uncultured_Mediterranean_phage	2.0e-05	32.0
WP_016356750.1\|848923_849946_+	N,N'-diacetyllegionaminate synthase	A0A1B1IVE2	uncultured_Mediterranean_phage	3.5e-35	38.1
WP_038837791.1\|849945_851079_+	UDP-N-acetylglucosamine 2-epimerase (hydrolyzing)	NA	NA	NA	NA
WP_038837794.1\|851068_851677_+	acetyltransferase	NA	NA	NA	NA
WP_010946492.1\|851687_853190_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_010946493.1\|853279_853843_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	8.7e-52	57.5
WP_038837795.1\|853843_854728_+	dTDP-4-dehydrorhamnose reductase	I7HXC9	Enterobacteria_phage	1.2e-31	33.7
WP_038837798.1\|854687_855767_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	2.2e-83	48.2
WP_072401766.1\|855802_857305_+	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_010946497.1\|857417_858335_+	glucose-1-phosphate thymidylyltransferase RfbA	A0A291LA53	Escherichia_phage	2.2e-92	58.0
WP_027265849.1\|858355_859312_+	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_072401767.1\|859295_860297_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_038837803.1\|860820_861696_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_080453730.1\|862050_862764_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_077383491.1\|862736_863759_+\|transposase	IS21-like element ISLpn12 family transposase	A0A2L1IVA1	Escherichia_phage	2.0e-83	48.0
WP_014844325.1\|863755_864550_+	AAA family ATPase	A0A2L1IVB6	Escherichia_phage	1.6e-75	53.9
WP_062721672.1\|864575_864944_-	hypothetical protein	NA	NA	NA	NA
WP_038837815.1\|865991_867020_+	radical SAM protein	NA	NA	NA	NA
WP_100917199.1\|867204_868279_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	7.7e-57	46.5
WP_040148105.1\|868625_870146_-	hypothetical protein	NA	NA	NA	NA
WP_038837832.1\|870400_871120_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_038837834.1\|871132_872218_+\|coat	spore coat protein	NA	NA	NA	NA

DBSCAN-SWA_2

890098 : 936378

Pseudomonas_phage(18.18%)

protease,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_076612807.1\|890098_891400_+\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_013101194.1\|891503_892475_+\|transposase	transposase	NA	NA	NA	NA
WP_079996937.1\|892471_892957_+	hypothetical protein	NA	NA	NA	NA
WP_040184988.1\|893044_894487_-	MBOAT family protein	A0A125RNP0	Pseudomonas_phage	6.7e-72	40.5
WP_076612808.1\|894483_895659_-	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_013101194.1\|895859_896831_+\|transposase	transposase	NA	NA	NA	NA
WP_079996937.1\|896827_897313_+	hypothetical protein	NA	NA	NA	NA
WP_062721717.1\|897533_897914_+	hypothetical protein	NA	NA	NA	NA
WP_077383491.1\|897992_899015_+\|transposase	IS21-like element ISLpn12 family transposase	A0A2L1IVA1	Escherichia_phage	2.0e-83	48.0
WP_011946826.1\|899011_899806_+	AAA family ATPase	A0A2L1IVB6	Escherichia_phage	9.3e-76	54.3
WP_154699283.1\|899798_900710_+\|transposase	IS4 family transposase	A0A0F7LAS3	uncultured_marine_virus	8.0e-47	37.3
WP_014841203.1\|900743_902120_-	L-serine ammonia-lyase	NA	NA	NA	NA
WP_010946528.1\|902318_903026_+	FKBP-type peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_014326781.1\|903179_904439_+	MFS transporter	NA	NA	NA	NA
WP_062721665.1\|904824_905208_+	DUF3757 domain-containing protein	NA	NA	NA	NA
WP_080453717.1\|905458_905998_-	hypothetical protein	NA	NA	NA	NA
WP_064319109.1\|905936_906911_-\|transposase	transposase	NA	NA	NA	NA
WP_062721339.1\|907080_908424_-	quinolinate synthase NadA	NA	NA	NA	NA
WP_010946536.1\|908498_910148_-	L-aspartate oxidase	NA	NA	NA	NA
WP_010946537.1\|910144_911515_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	2.2e-112	49.7
WP_061401195.1\|911667_913371_+	sulfate permease	A0A2H4J153	uncultured_Caudovirales_phage	6.5e-42	26.5
WP_061401196.1\|913573_915277_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_014326783.1\|915505_916504_-	linear amide C-N hydrolase	NA	NA	NA	NA
WP_061401197.1\|916728_919116_+	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	4.1e-175	38.2
WP_010946542.1\|919357_920797_+	cation:proton antiporter	NA	NA	NA	NA
WP_013101201.1\|920793_921636_+	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
WP_013101202.1\|921632_922724_+	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	NA	NA	NA	NA
WP_010946545.1\|922698_924114_+	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_011945930.1\|924205_924523_+	helix-hairpin-helix domain-containing protein	NA	NA	NA	NA
WP_011213320.1\|924718_925756_+	rod shape-determining protein	NA	NA	NA	NA
WP_010946548.1\|925733_926642_+	rod shape-determining protein MreC	NA	NA	NA	NA
WP_011945932.1\|926638_927118_+	rod shape-determining protein MreD	NA	NA	NA	NA
WP_072401778.1\|927053_927722_-	pseudouridine synthase	NA	NA	NA	NA
WP_011945934.1\|927916_928615_+	hypothetical protein	NA	NA	NA	NA
WP_011945935.1\|928727_929984_+	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	1.9e-14	74.1
WP_011215007.1\|930385_930721_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A218MMY6	uncultured_virus	5.8e-11	36.5
WP_014326786.1\|930746_933020_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.9e-166	42.1
WP_011945937.1\|933243_934023_+	glycosyltransferase family 2 protein	S5WBE2	Pseudomonas_phage	1.2e-06	30.1
WP_013101205.1\|934025_935276_+	O-antigen ligase family protein	NA	NA	NA	NA
WP_014326787.1\|935276_935651_-	hypothetical protein	NA	NA	NA	NA
WP_011945940.1\|935781_936378_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA

DBSCAN-SWA_3

946734 : 953573

Acinetobacter_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027225204.1\|946734_947511_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	2.5e-57	48.2
WP_027225203.1\|947503_948538_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	1.2e-75	47.6
WP_011945952.1\|948515_949094_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	1.3e-55	53.2
WP_010946572.1\|949127_949853_-	LPS export ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.1e-17	28.3
WP_011215024.1\|949849_950359_-	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
WP_011945954.1\|950339_950909_-	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_014326808.1\|950905_951457_-	3-deoxy-manno-octulosonate-8-phosphatase KdsC	A0A140XBD6	Dickeya_phage	1.5e-27	47.7
WP_010946576.1\|951446_952409_-	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	4.2e-38	34.1
WP_010946577.1\|952775_953573_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.3e-21	33.8

DBSCAN-SWA_4

1328843 : 1334780

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027224128.1\|1328843_1329917_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	3.6e-30	28.6
WP_027224127.1\|1329901_1330516_+	riboflavin synthase	A0A2I2L4R9	Orpheovirus	1.3e-21	38.4
WP_027224126.1\|1330512_1331721_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	4.5e-98	48.5
WP_010946914.1\|1331728_1332196_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	9.2e-23	49.1
WP_027224125.1\|1332321_1333959_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	2.7e-154	52.5
WP_010946916.1\|1333955_1334780_+	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	1.8e-53	43.9

DBSCAN-SWA_5

2259663 : 2269791

Bacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027224474.1\|2259663_2261352_-	S8 family serine peptidase	A0A1B0T6A2	Bacillus_phage	6.1e-16	30.4
WP_076612981.1\|2261483_2262497_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_011214268.1\|2262614_2263940_-	adenosylhomocysteinase	S4VPF6	Pandoravirus	1.8e-47	31.2
WP_027224472.1\|2263958_2265107_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	1.2e-127	58.7
WP_076612982.1\|2265320_2266445_-	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	3.9e-51	35.2
WP_010947740.1\|2266528_2267668_-	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	1.6e-23	26.9
WP_011946925.1\|2267856_2269791_-	molecular chaperone DnaK	G8DDB7	Micromonas_pusilla_virus	1.3e-147	49.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP014760

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection