CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP017300	Rhodococcus sp. YL-1 plasmid pYLC1, complete sequence	0 crisprs	DEDDh,PD-DExK	2
NZ_CP017303	Rhodococcus sp. YL-1 plasmid pYLL1 sequence	0 crisprs	PD-DExK,csa3	3
NZ_CP017304	Rhodococcus sp. YL-1 plasmid pYLL2 sequence	0 crisprs	csf1gr8,csf4gr11,csf2gr7,csf3gr5,PD-DExK,csa3	2
NZ_CP017299	Rhodococcus sp. YL-1 chromosome, complete genome	1 crisprs	WYL,cas3,csa3,cas4,DEDDh,DinG,RT	4
NZ_CP017302	Rhodococcus sp. YL-1 plasmid pYLC3, complete sequence	0 crisprs	NA	0
NZ_CP017301	Rhodococcus sp. YL-1 plasmid pYLC2, complete sequence	0 crisprs	NA	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

29792 : 82752

Mycobacterium_phage(30.0%)

integrase,transposase

attL 45370:45387|attR 87126:87143

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_030538069.1\|29792_31334_-\|transposase	IS21-like element IS1415 family transposase	NA	NA	NA	NA
WP_075835581.1\|31862_32783_-	hypothetical protein	NA	NA	NA	NA
WP_058228340.1\|32779_33646_-	hypothetical protein	NA	NA	NA	NA
WP_075835583.1\|33875_34850_-	hypothetical protein	NA	NA	NA	NA
WP_157127661.1\|34946_35984_-	hypothetical protein	NA	NA	NA	NA
WP_075835918.1\|37625_38906_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.5e-32	38.5
WP_064112145.1\|39690_40269_+	hypothetical protein	NA	NA	NA	NA
WP_047269193.1\|40819_41092_+	hypothetical protein	NA	NA	NA	NA
WP_047269192.1\|41148_41523_+	hypothetical protein	NA	NA	NA	NA
WP_047269191.1\|41700_42057_+	hypothetical protein	NA	NA	NA	NA
WP_064112147.1\|42321_42873_+	hypothetical protein	NA	NA	NA	NA
WP_058228469.1\|42982_43303_+	hypothetical protein	NA	NA	NA	NA
WP_075835587.1\|43581_44040_+	hypothetical protein	NA	NA	NA	NA
WP_075835589.1\|44027_44444_+	ASCH domain-containing protein	Q854T1	Mycobacterium_virus	1.3e-31	56.8
WP_075835591.1\|44440_44647_+	hypothetical protein	NA	NA	NA	NA
WP_143542510.1\|44784_45057_+	hypothetical protein	NA	NA	NA	NA
45370:45387	attL	NA	NA	NA	NA
WP_087503782.1\|45403_46447_+	DNA cytosine methyltransferase	A0A088FRI5	Mycobacterium_phage	1.4e-103	59.7
WP_143542511.1\|46543_47086_+	hypothetical protein	NA	NA	NA	NA
WP_087503783.1\|47078_47405_+	hypothetical protein	NA	NA	NA	NA
WP_075835601.1\|47714_48587_+	hypothetical protein	Q854T0	Mycobacterium_virus	2.1e-20	44.1
WP_047269183.1\|48583_49201_+	hypothetical protein	NA	NA	NA	NA
WP_143542512.1\|49419_49989_+	hypothetical protein	NA	NA	NA	NA
WP_141695865.1\|50267_50711_+	DUF3846 domain-containing protein	NA	NA	NA	NA
WP_143542513.1\|50964_51486_+	hypothetical protein	NA	NA	NA	NA
WP_082654963.1\|51568_52822_+	DUF4935 domain-containing protein	NA	NA	NA	NA
WP_047269179.1\|53042_53429_+	hypothetical protein	NA	NA	NA	NA
WP_058228460.1\|53548_54010_-	hypothetical protein	NA	NA	NA	NA
WP_064112228.1\|54241_54928_+	DUF2786 domain-containing protein	G1JV42	Mycobacterium_phage	3.8e-25	34.7
WP_125053106.1\|55002_55278_+	hypothetical protein	NA	NA	NA	NA
WP_075835609.1\|55877_56165_+	glutaredoxin-like protein NrdH	V5UN81	Mycobacterium_phage	9.0e-21	66.7
WP_075835920.1\|56289_57369_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_065353036.1\|57365_57683_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_075835613.1\|58694_59885_+	hypothetical protein	NA	NA	NA	NA
WP_075835922.1\|60206_60755_-	DUF5067 domain-containing protein	NA	NA	NA	NA
WP_087503787.1\|60875_62582_-	hypothetical protein	NA	NA	NA	NA
WP_075835619.1\|63551_64232_+	NUDIX hydrolase	NA	NA	NA	NA
WP_143542514.1\|64997_65177_+	hypothetical protein	NA	NA	NA	NA
WP_075835924.1\|65460_68889_+	DUF3883 domain-containing protein	A0A1B1IUI1	uncultured_Mediterranean_phage	1.5e-50	27.0
WP_075835623.1\|69010_71806_+	DUF1156 domain-containing protein	K9MDJ7	Sulfolobus_virus	2.1e-37	26.2
WP_075835625.1\|71815_75220_+	ATP-binding protein	NA	NA	NA	NA
WP_075835627.1\|75560_75947_+	hypothetical protein	NA	NA	NA	NA
WP_143542515.1\|76084_76738_-	hypothetical protein	NA	NA	NA	NA
WP_075835631.1\|76976_78140_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	6.7e-30	33.1
WP_075835926.1\|78178_78526_+	DUF3024 domain-containing protein	NA	NA	NA	NA
WP_082893248.1\|79153_80296_+\|integrase	tyrosine-type recombinase/integrase	A0A220NQQ9	Corynebacterium_phage	8.6e-06	25.6
WP_082893247.1\|80133_82752_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
87126:87143	attR	NA	NA	NA	NA

DBSCAN-SWA_2

160708 : 232807

Bacillus_phage(20.0%)

integrase,transposase

attL 228893:228912|attR 232110:232129

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_030538069.1\|160708_162250_-\|transposase	IS21-like element IS1415 family transposase	NA	NA	NA	NA
WP_047269255.1\|163976_164312_+	hypothetical protein	NA	NA	NA	NA
WP_125053040.1\|164832_166023_+	hypothetical protein	NA	NA	NA	NA
WP_047269107.1\|166148_166463_+	hypothetical protein	NA	NA	NA	NA
WP_052959772.1\|166600_167326_+	hypothetical protein	NA	NA	NA	NA
WP_064112191.1\|167411_169208_+	DNA primase	A0A1S5RG58	Helicobacter_phage	3.9e-29	30.1
WP_058228286.1\|169818_170016_+	hypothetical protein	NA	NA	NA	NA
WP_047269104.1\|170083_172390_-	cutinase family protein	NA	NA	NA	NA
WP_047269103.1\|172628_173714_+	hypothetical protein	NA	NA	NA	NA
WP_064112193.1\|173725_174595_-	hypothetical protein	NA	NA	NA	NA
WP_052959771.1\|174683_175895_-	hypothetical protein	NA	NA	NA	NA
WP_075835708.1\|176247_178434_+	ATP-binding protein	NA	NA	NA	NA
WP_047269100.1\|178518_178839_+	hypothetical protein	NA	NA	NA	NA
WP_047269099.1\|178897_179698_-	hypothetical protein	NA	NA	NA	NA
WP_075835710.1\|180339_181800_+	hypothetical protein	NA	NA	NA	NA
WP_064112196.1\|181913_184256_+	SMC family ATPase	NA	NA	NA	NA
WP_082900794.1\|184274_185492_+	DUF3068 domain-containing protein	NA	NA	NA	NA
WP_052959769.1\|185625_186465_+	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_047269096.1\|186477_187425_-	hypothetical protein	NA	NA	NA	NA
WP_047269095.1\|187421_187997_-	hypothetical protein	NA	NA	NA	NA
WP_058228294.1\|187999_188410_-	hypothetical protein	NA	NA	NA	NA
WP_052959768.1\|188415_189120_-	hypothetical protein	A0A142K8T1	Gordonia_phage	5.6e-16	56.6
WP_075835713.1\|189864_191112_-	AAA domain-containing protein	NA	NA	NA	NA
WP_157127662.1\|191220_192858_+	hypothetical protein	NA	NA	NA	NA
WP_064112199.1\|192956_193976_+	hypothetical protein	NA	NA	NA	NA
WP_075835716.1\|194167_196765_+	hypothetical protein	NA	NA	NA	NA
WP_064112200.1\|196777_197875_+	hypothetical protein	NA	NA	NA	NA
WP_064112201.1\|197921_198203_+	WhiB family transcriptional regulator	A0A159B6S6	Tsukamurella_phage	6.1e-06	47.1
WP_064112202.1\|198279_199065_-	metal-dependent hydrolase	I4AZJ8	Saccharomonospora_phage	3.1e-23	37.7
WP_156519167.1\|199273_199906_-	hypothetical protein	NA	NA	NA	NA
WP_064112213.1\|200176_200428_+	hypothetical protein	NA	NA	NA	NA
WP_075835718.1\|200473_200689_-	hypothetical protein	NA	NA	NA	NA
WP_075835720.1\|200973_203664_-	hypothetical protein	A0A0S2GLG9	Bacillus_phage	4.1e-06	23.2
WP_064112208.1\|203753_204281_-	single-stranded DNA-binding protein	A0A2H4JEL4	uncultured_Caudovirales_phage	1.6e-55	69.7
WP_075835722.1\|204388_206053_-	hypothetical protein	NA	NA	NA	NA
WP_064112210.1\|206295_207162_+	RusA family crossover junction endodeoxyribonuclease	NA	NA	NA	NA
WP_064112211.1\|207158_208547_+	AAA family ATPase	A0A2D1GPY7	Mycobacterium_phage	2.0e-25	29.3
WP_064112212.1\|208811_209558_-	hypothetical protein	NA	NA	NA	NA
WP_075835724.1\|209711_210248_+	hypothetical protein	NA	NA	NA	NA
WP_075835726.1\|210244_211081_+	hypothetical protein	NA	NA	NA	NA
WP_058228304.1\|211315_212287_+	DUF945 domain-containing protein	A0A223G0A1	Streptomyces_phage	3.5e-24	30.8
WP_064112215.1\|212459_213122_+	hypothetical protein	NA	NA	NA	NA
WP_157127663.1\|213262_213778_+	hypothetical protein	NA	NA	NA	NA
WP_099698417.1\|213831_214056_+	hypothetical protein	NA	NA	NA	NA
WP_064112217.1\|214052_214337_+	hypothetical protein	NA	NA	NA	NA
WP_064112218.1\|214623_216846_+	3'-5' exonuclease	NA	NA	NA	NA
WP_075835732.1\|216860_217502_+	hypothetical protein	NA	NA	NA	NA
WP_075835734.1\|217624_218311_+	hypothetical protein	NA	NA	NA	NA
WP_075835736.1\|218533_218755_-	hypothetical protein	NA	NA	NA	NA
WP_075835737.1\|219022_219691_+	hypothetical protein	NA	NA	NA	NA
WP_047269066.1\|221177_221897_+	HNH endonuclease	NA	NA	NA	NA
WP_047269065.1\|221940_222540_-	hypothetical protein	NA	NA	NA	NA
WP_058037609.1\|222536_224744_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_047269064.1\|224740_225847_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_021334716.1\|226208_226976_+	HNH endonuclease	NA	NA	NA	NA
WP_021334717.1\|227007_227406_-	hypothetical protein	NA	NA	NA	NA
WP_080656790.1\|227424_229584_-\|integrase	site-specific integrase	NA	NA	NA	NA
228893:228912	attL	NA	NA	NA	NA
WP_021334719.1\|229576_230752_-\|integrase	tyrosine-type recombinase/integrase	A0A0M5M609	Bacillus_phage	7.7e-10	27.9
WP_083954767.1\|230806_231217_+	HNH endonuclease	NA	NA	NA	NA
WP_075835742.1\|231523_232807_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	2.4e-36	37.9
232110:232129	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP017299

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP017299_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP017299_1

132962-133073

Orphan

Consensus_repeat	Method
TGAACGGGTTGTCGACGAGGGCGTTGGTGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP017299_1

>merge|NZ_CP017299|1|132962-133073|CRISPRCasFinder
TGAACGGGTTGTCGACGAGGGCGTTGGTGCCCACACCCTGCAGGGCGTGTGCGGACGTTGCCTCGGCAACCGGCTCGAAGGTGAACGGGTTGTCGACGAGAGCGTTGGTGCC

>NZ_CP017299|1|1|132962-133073|CRISPRCasFinder
TGAACGGGTTGTCGACGAGGGCGTTGGTGCC	CACACCCTGCAGGGCGTGTGCGGACGTTGCCTCGGCAACCGGCTCGAAGG
TGAACGGGTTGTCGACGAGAGCGTTGGTGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP017299.1\|WP_075831739.1\|130613_132044_-\|CocE/NonD-family-hydrolase	unknown	unknown	gnl\|CDD\|225487
NZ_CP017299.1\|WP_030535883.1\|127991_129284_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274674
NZ_CP017299.1\|WP_042920631.1\|133228_134488_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340863
NZ_CP017299.1\|WP_042920630.1\|134572_135640_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP017299.1\|WP_003943598.1\|125948_126389_+\|PAS-domain-S-box-protein	unknown	unknown	gnl\|CDD\|379177
NZ_CP017299.1\|WP_063892127.1\|140541_141465_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017299.1\|WP_007735909.1\|138089_138374_-\|SHOCT-domain-containing-protein	unknown	unknown	gnl\|CDD\|378276
NZ_CP017299.1\|WP_075831743.1\|136427_137408_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238568
NZ_CP017299.1\|WP_075831741.1\|132040_132853_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274832
NZ_CP017299.1\|WP_042453274.1\|135636_136431_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP017299.1\|WP_080552796.1\|127253_128045_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224662
NZ_CP017299.1\|WP_050657053.1\|138826_140473_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340879
NZ_CP017299.1\|WP_075831737.1\|129280_130621_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274674
NZ_CP017299.1\|WP_003944177.1\|141807_142395_+\|DinB-family-protein	unknown	unknown	gnl\|CDD\|368218
NZ_CP017299.1\|WP_007735911.1\|138370_138823_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017299.1\|WP_003943606.1\|126395_127022_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP017299.1\|WP_003943587.1\|122736_123939_-\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|226951
NZ_CP017299.1\|WP_007735884.1\|123978_125100_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223650
NZ_CP017299.1\|WP_003943539.1\|125096_125837_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213222
NZ_CP017299.1\|WP_075831745.1\|137404_138088_+\|SagB/ThcOx-family-dehydrogenase	unknown	unknown	gnl\|CDD\|188352

Protein	Function_ID	Function_description	E-value
NZ_CP017299.1\|WP_075831739.1\|130613_132044_-\|CocE/NonD-family-hydrolase	gnl\|CDD\|225487	COG2936, COG2936, Predicted acyl esterases [General function prediction only].	2.09868e-35
NZ_CP017299.1\|WP_030535883.1\|127991_129284_-\|hypothetical-protein	gnl\|CDD\|274674	TIGR03604, hypothetical_protein, thiazole/oxazole-forming peptide maturase, SagD family component. Members of this protein family include enzymes related to SagD, previously referred to as a scaffold or docking protein involved in the biosynthesis of streptolysin S in Streptococcus pyogenes from the protoxin polypeptide (product of the sagA gene). Newer evidence describes an enzymatic activity, an ATP-dependent cyclodehydration reaction, previously ascribed to the SagC component. This protein family serves as a marker for widely distributed prokaryotic systems for making a general class of heterocycle-containing bacteriocins.	8.72045e-67
NZ_CP017299.1\|WP_042920631.1\|133228_134488_+\|MFS-transporter	gnl\|CDD\|340863	cd06173, MFS_MefA_like, Macrolide efflux protein A and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Streptococcus pyogenes macrolide efflux protein A (MefA) and similar transporters, many of which remain uncharacterized. Some members may be multidrug resistance (MDR) transporters, which are drug/H+ antiporters (DHAs) that mediate the efflux of a variety of drugs and toxic compounds, conferring resistance to these compounds. MefA confers resistance to 14-membered macrolides including erythromycin and to 15-membered macrolides. It functions as an efflux pump to regulate intracellular macrolide levels. The MefA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.1977e-53
NZ_CP017299.1\|WP_042920630.1\|134572_135640_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	8.01281e-91
NZ_CP017299.1\|WP_003943598.1\|125948_126389_+\|PAS-domain-S-box-protein	gnl\|CDD\|379177	pfam13426, PAS_9, PAS domain.	3.26675e-11
NZ_CP017299.1\|WP_007735909.1\|138089_138374_-\|SHOCT-domain-containing-protein	gnl\|CDD\|378276	pfam09851, SHOCT, Short C-terminal domain.	2.92733e-06
NZ_CP017299.1\|WP_075831743.1\|136427_137408_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238568	cd01148, TroA_a, Metal binding protein TroA_a. These proteins are predicted to function as initial receptors in ABC transport of metal ions in eubacteria. They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains.	1.74033e-44
NZ_CP017299.1\|WP_075831741.1\|132040_132853_-\|hypothetical-protein	gnl\|CDD\|274832	TIGR03882, hypothetical_protein, bacteriocin biosynthesis cyclodehydratase domain. This model describes a ThiF-like domain of a fusion protein found in clusters associated with the production of TOMMs (thiazole/oxazole-modified microcins), small bacteriocins with characteristic heterocycle modifications. This domain is presumed to act as a cyclodehydratase, as do members of the SagC family modeled by TIGR03603.	0.000112301
NZ_CP017299.1\|WP_042453274.1\|135636_136431_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	1.47196e-101
NZ_CP017299.1\|WP_080552796.1\|127253_128045_+\|hypothetical-protein	gnl\|CDD\|224662	COG1748, LYS9, Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism].	0.00132843
NZ_CP017299.1\|WP_050657053.1\|138826_140473_-\|MFS-transporter	gnl\|CDD\|340879	cd17321, MFS_MMR_MDR_like, Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of bacterial, fungal, and archaeal multidrug resistance (MDR) transporters including several proteins from Bacilli such as methylenomycin A resistance protein (also called MMR peptide), tetracycline resistance protein (TetB), and lincomycin resistance protein LmrB, as well as fungal proteins such as vacuolar basic amino acid transporters, which are involved in the transport into vacuoles of the basic amino acids histidine, lysine, and arginine in Saccharomyces cerevisiae, and aminotriazole/azole resistance proteins. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. For example, MMR confers resistance to the epoxide antibiotic methylenomycin while TetB resistance to tetracycline by an active tetracycline efflux. MMR-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.38096e-22
NZ_CP017299.1\|WP_075831737.1\|129280_130621_-\|hypothetical-protein	gnl\|CDD\|274674	TIGR03604, hypothetical_protein, thiazole/oxazole-forming peptide maturase, SagD family component. Members of this protein family include enzymes related to SagD, previously referred to as a scaffold or docking protein involved in the biosynthesis of streptolysin S in Streptococcus pyogenes from the protoxin polypeptide (product of the sagA gene). Newer evidence describes an enzymatic activity, an ATP-dependent cyclodehydration reaction, previously ascribed to the SagC component. This protein family serves as a marker for widely distributed prokaryotic systems for making a general class of heterocycle-containing bacteriocins.	1.8849e-66
NZ_CP017299.1\|WP_003944177.1\|141807_142395_+\|DinB-family-protein	gnl\|CDD\|368218	pfam04978, DUF664, Protein of unknown function (DUF664). This family is commonly found in Streptomyces coelicolor and is of unknown function. These proteins contain several conserved histidines at their N-terminus that may form a metal binding site.	4.21422e-42
NZ_CP017299.1\|WP_003943606.1\|126395_127022_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.14936e-09
NZ_CP017299.1\|WP_003943587.1\|122736_123939_-\|sensor-histidine-kinase	gnl\|CDD\|226951	COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms].	2.95725e-52
NZ_CP017299.1\|WP_007735884.1\|123978_125100_+\|ABC-transporter-permease	gnl\|CDD\|223650	COG0577, SalY, ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms].	1.73425e-11
NZ_CP017299.1\|WP_003943539.1\|125096_125837_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213222	cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein. This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of lipoproteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyzes the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.	6.92183e-80
NZ_CP017299.1\|WP_075831745.1\|137404_138088_+\|SagB/ThcOx-family-dehydrogenase	gnl\|CDD\|188352	TIGR03605, antibiot_sagB, SagB-type dehydrogenase domain. SagB of Sterptococcus pyogenes participates in the maturation of streptolysin S from a ribosomally produced precursor polypeptide. Chemically similar systems operate on highly diverse sets of bacteriocin precursors in numerous other bacteria. This model describes a domain within SgaB and homologous regions from other proteins, many of which appear to be involved in biosynthesis of secondary metabolites. While some substrates may be intermediates in non-ribosomal peptide syntheses, others are involved in heterocycle-containing bacteriocin biosynthesis, and can be found near SgaC-like (see TIGR03603, cyclodehydratase) and SgaD-like (see TIGR03604, "docking") proteins. Members of this domain family are heterogeneous in length, as many have a partial second copy of the domain represented here. The incomplete second domain scores below the cutoffs to this model in most cases.	3.59297e-28

>NZ_CP017299.1|WP_075831741.1|132040_132853_-|hypothetical-protein
MYALADGRQLYPTPDGTWHYLTPDENAVTIGAPAEDLAELDNFLRRSGSVLGPGAIEIADALVSRGVLAVPGQVPEIPRPQRVLMDGIGPVADACIALLSKALPHLEVVSTTAPIEHDVASSDLVLSVAGAPPHDEWSELDTWCRRNQTPWQRVHAELGEICIGPFFDGIGSASYRDVCGRRLAASRVPDHLRALWNHLAGSELRPLELSPTAAAMASALACSDVVAGVHGAPPSHLHHQIRMNPRTLMMTRHPVLPLPGGVLEPSPTLR
>NZ_CP017299.1|WP_075831739.1|130613_132044_-|CocE/NonD-family-hydrolase
MISLGVKIPAADGSSLATDVLLPPDSSPRGLIVIRTPYGRGWHLAEGLEWRSRGIAFICQDVRGRHDSTGSWEPYFHEREDAAALAEWLQDQPWTPECVIASGASYAAGTAWAFAAETNSADRSFRVDGVVSKVPTIGSDRVKRDPSGILLLAEHLAWWGEHGDSSSSREGFIPELMRSDSALLEHLPVQSMIEKVGLTSDSPGWLTPILRARKREDFGGDDLVSADELSELDIAGLHIGGWDDAMIRETLRHFTSVGRGPQSLIVGPWAHDLRPGRVGETSFGRLQVEWMESVFAARPLTINRVFDRGVGEWSTEPFVTGANRVHLEPDRKDAAYSFLYDASRDRNDCVVWTFDMEVECVLSGMPSVELTVHSPEGEADWIVELSVVDSAGVTRSIARGAGVSLCSGTLTIDLDPVLHTVRAGDVLSLRIAGSDFPRLARNLGDGDRYRGTRSTALHQSFSGSLTLPILGGTDGG
>NZ_CP017299.1|WP_075831737.1|129280_130621_-|hypothetical-protein
MDDLLVDARSGVLTSLEPHIRSDMPTGWVGWAARVADTRNFGGSGSLFRADPYGFGASIRNDAAARGAATGEAVERYCGNVVPEDLVRSSASALELAGSRVVDPAKFALYSEDQYRLPGFPFVPFTSDLNIRWALGHTMDEKVPTYVPAALTYLGYYTGTRRCEPPIASLQYAGIAAGRSRDEAEMSALLELLERDATALWWCGDRSQPAIELSDWERLPAHRQLGDLESQTRSVRVLLLPSPFGIPVAAAWIRDDRRGLVALGTACRPTVEAAVSKALVEAYAVLAITIDLADPDGPTWRSVADGTLPAHLYKPFRADRRYRDEFDPQWKDIVDLPTVAQLYLDPVMALAAEEHLFDYTETLSVSEIPDEAPLDLASLVALLMSRGHQPISVDLTTGDISIAGLHVVRILTPGLYNNAPAAFPLLGGSRLTSASTTHLHLPVPLA
>NZ_CP017299.1|WP_030535883.1|127991_129284_-|hypothetical-protein
MTSSLVDRRTGIIRELVDAVVPQHFPPEFKLIHSYVSDSARFSPWSSDSAGAGYCFDLGNRARPTAAAIGEAVERYCGNIVAKPIVRGSADALIGASIDLSQLARFDAAQYARPQFPFVEPTDDLEMDWTRGADLITGSDIWVPAELVWGSYPHFVARTGPAISPVAQAGLAAGPSVKFAIDNALREIVERDAMTLSWTGRRGVRVVTGMPEALLRLGNHDSLSTRWISFESDFEIPVLGALVCDRLTGYSTMGTACHEDAQTAAFKSLGEALQLQLLSADYDNPQSGIGRAAASPTSPLAPWRADRSYAGAYRSDFADVMDYGCHLQLHLDPEIQARFESELVGAVVGEVGLDSLTSAAGTESALTAAGFRPAWVDLTTTDVLHAGLHVVRVVVPGCLTNAAAGLPFLGSPRLVDSLAGRSARTIPLPH
>NZ_CP017299.1|WP_080552796.1|127253_128045_+|hypothetical-protein
MVNASGFEDVRLADEAVRGGAAFVDITATSSYCEELEAVDGPVLMGVGLAPGLTSVLATEAHRLGDGPVDILIGLGGGELHGPAATAWTYGMLGTRFPDPDGRSVRNYTGMKTFRIPADATGYRTGPAVRADFSDQHALTRDLGVPVRTYLRLDTSTATLGLAAMTWAPALQKVVPKKLWGSDRWVAMARADTGPALWVSGRSQSVATAAIAARAVQVIRDAAISKPTWFHAVETTESLQAAVPELSVRQWDGASRSSGKTVH
>NZ_CP017299.1|WP_003943606.1|126395_127022_-|TetR/AcrR-family-transcriptional-regulator
MTEVLREDTSARRKIIEAAREVFVDPGYAAATIKQLAAAAGVSVQSVYFVFGNKPSVLSALLDVAVAGDEEKTATLDRPWVAAALGAPHPLGQLRIQVHHGRLILERTADILLALRAAASADEDAARLWQINRTQRRTVQEHLMVGIVEKAPTVDLETAVNVALTLLSPETYTDLVVGAGWTGQQYEEWVVNTLAATLGLDRTVKSRK
>NZ_CP017299.1|WP_003943598.1|125948_126389_+|PAS-domain-S-box-protein
MERRRNVAQPPQSPIADLEQMPALILLDRLPVPVMAVHRDGSIVFANPSFADMLGYPKKAVSALRLQDILYDKDADDVSAEQAHRELSSEPGSVKEFVHSDSTLVRATVSQSLLRRDDDTITLAVLHDLTERLWNNPRHIDDKPTK
>NZ_CP017299.1|WP_003943539.1|125096_125837_+|ABC-transporter-ATP-binding-protein
MTMTTGTTVLDIQNVDLTFPDGQSRVTALDDVSLRLHRGEIAAITGPSGSGKSSLLAVASTLIRPDSGHVYLRTPEGSTDIAALSRRAASELRRSSIGIVFQQSNLVSSLTALEQLEVMAHLGQSVFTSRARRKAVKSKAMDLLDAVGLADQSGKRPSQLSGGQRQRVNLARALMNDPQLLVVDEPTSALDQERGAAVMDLIIGVVREREAATLLVTHDRSHLSRMDTVYRVVDGSLAEDQEALAA
>NZ_CP017299.1|WP_007735884.1|123978_125100_+|ABC-transporter-permease
MSIRGAMERVCIRESVEASTGKEFTVFVAMRDLRAARGRFALISVVVLLVALLVSFLSGLTAGLRHQNVSAIEAMNADTVVFADTGAGASFDESALTQDQVNAWTSTSKDVDPIGIGRGKAGLADGNQKSVALFGADGGFGDVTPSASGTVVLSEGAARDLGAGAGDQVSVGTQQFTVSAVRGDDWYSHSPVVWMTLDDWQAANPRGGVATVLAVTGASDASATDKAAATTSTTVSGSLDAIGSYKSENGSLTLMTLMLFAISALVIGAFFTVWTIQRTPDIATLKALGATTGSLVRDALGQALIVLIAGVTVGIGLTAVAGSLIGDAMPFVLDASTTVVPAVALIGLGLLGAAFALRFLSTTDPLTALGSAR
>NZ_CP017299.1|WP_003943587.1|122736_123939_-|sensor-histidine-kinase
MDEPGPNLAKLGEMHRSPLTPVFAGLQLGLHVLVMALAGVVFLRALIDESDLTATIIALAVIFVAVYLFGVAKRLRGNAARWWLAVLTLVWIATMAVSADAAYLAFGLFFLYLHILRRPWSLLAVTAATAVAVVGTGLHRGWTIAGAVGPIIGAAVAVAIGLGYQALYREAAERGRLIDELMNTREELASTSRDAGKFAERERLAAEIHDTVAQGLSSIQMLLHAAERADPDSPAIRQISLARETAADSLAETRQLIAELTPAALDGQSLADALRRICERASSPELEARSVVEGEAVRLPMPLEATLVRIAQGAVSNVLRHADATRMAVTLTYSDDTVSLDVVDNGRGFDVAVLERGPAESFGLNAIRRRVELQGGTFSIESEPGHTAVAVTFPLEVGEP
>NZ_CP017299.1|WP_042920631.1|133228_134488_+|MFS-transporter
MSETPTTGSVEAQPHVFRDRSFRLFFTARTIAVAGAAVTGVAMPILVFDISRSPFLTSLAAAGTVLPYLVFGLFAGAVADRVNRRTVILCAQAVAALALASIPAAQALGVLTAWHAVGVSMCIGTCFVWFDAAAFGALPALVGRQRIPAANSALWTSSTLIDVVFPAIAGVLVASIGPAYALGADALAYVLAGLAMASIGASFSITPAAPKKSGTGIARDIREGLSFLWRSPLLRALTGVGFVNSLTQGAVTALLVVYASERLGISTSSPMIGAVWTAVSVGGVVGALVLPRLPAQWPVGAITVGALTIAPVVLFVVATTGNTGAAITALVVYSGCATVTILNGIGARQRLTPDRLQGRVNTTARMVAWGGSPVGALIAGAIAGRWDIGTAYLVACIFALVGALFAWASALRTDPYPHK
>NZ_CP017299.1|WP_042920630.1|134572_135640_+|iron-ABC-transporter-permease
MTLTSEAAPRVPSRPHPVGERGYVPFLLATAVVLVAVSTVAVWSGAASVSFADVFAVLYAHVGGPPVDPLLDRIVWGLRVPRILIAALAGAGLSLAGAVLQALVRNPIADPYILGVGSGASFGAVLIMTTGIGTGLSIGVPVAAFLGAMVSLIAVLVLGRREGMLVPLRMVLAGVAIGYLLSAATSFVQLRADPSQLSGVLFWLLGSVSGASWSDLGVPAAVITVCAAILLTQSRQLNALAMGDESAQSVGVDVRRTRLLLLVIASLLTAVVVSVAGGIGFVGLLVPHAVRLLVGSDHGKLLPATALVGATFLVIVDLAARMLDAPNELPLGIITAGLGAPFFLWLLRRDGGAQS
>NZ_CP017299.1|WP_042453274.1|135636_136431_+|ABC-transporter-ATP-binding-protein
MRLSASGIHVVRGGRLVVSGVDLEAPEGSVVGLVGPNGSGKSSLLRALYRSMKPRSGIVKVDEVNVWDDLSPRSAARIIGVVGQEHSSDFSFSVREVVATGRTPHHSAFSRLGEIDRDIVSAALVRTGMQGFGSRLFAELSGGEKQRVMLARAIAQQPSVLVLDEPTNHLDIRAQLELMELVAELGTTTIVAIHELALAAAYCDYVCLLSGGVVVATGPTAEVLTEDLLSEVFGVQVHLGTHPLTGRPLLSFAPPLLHTKEAVS
>NZ_CP017299.1|WP_075831743.1|136427_137408_+|ABC-transporter-substrate-binding-protein
MKSSIRTAALMCSAVTATAVLTACGNSTADSAASSSEKITVTNCDREVTVPKTAERIVSLYPSMTELLIQLGAADRIVGQSNTDLSPPSPELADQFAAVPVLSTGVPAKEALLDARPDLIVSDGEYWFDGDRLQTMDELRDLGIPIFVNSGYCHKAVTEGRIDDVWSDLDGLGALTGTSDAAATLLTDGKKSLAATEASVAGQEPVPTVMVQVSEGQSYALARGLYSSVLEAAGGSNLFENDLPDGKYFGQVATESVLAKSPKAVLVVYSTESARESTLDAARTAFAGTPAATSNAIFAVPEAWFAGELVSIDGAGEVSRLLHPGS
>NZ_CP017299.1|WP_075831745.1|137404_138088_+|SagB/ThcOx-family-dehydrogenase
MTALERIEAVVSLHAVLDRTVSPSELPFDEHALPPVTCESVELPAATPLPACGFADVLQARRSRYDPAQTALRAGELSNVLHHSVVSSPTAGGMRELTLSFVLSRPGDELGAGVYRYARGRAEAVRPGDVREHLRASLLQPEFVDVFPVLLFVVADVEAPLEKYAMRHYRTMHVDAGVLVQNLYLVTEAMGLVGCAIAGFTDARVASLLNLATTQLPVMAFALGRRS
>NZ_CP017299.1|WP_007735909.1|138089_138374_-|SHOCT-domain-containing-protein
MSFLRRAGRVAVASSIHGNVQRRQRTRWAAEDQARAAQAQPVPPIPDLPPLPPQAAPAASMDLKLEQLTKLGELKNAGVLTEAEFETQKARILA
>NZ_CP017299.1|WP_007735911.1|138370_138823_-|hypothetical-protein
MSNQDQFGPIEYVAVEFPGGAPTSAGFEQLLTLVDSGVIRILDLEFVTKAADGSVAVVPASTFELADFDLAQFDGAASGLLDAGDIAAVGDELATGSVAAVLVYEELAILPVIDAWTRSGAKIVTEGHLSLDELATALDNTAPGNTEKDA
>NZ_CP017299.1|WP_050657053.1|138826_140473_-|MFS-transporter
MSVKPGAAATTAAVSTASWLPLIVVVLTQIQASFAVNALTVSMAGITTDLDTPATSVGTAITAGTFAMAAFILLGAKIGARYGTRLVFQIAVAIHGLAMAAVALSQSPAMLFVAQAASGAVIALIAPALTVFIATNFSGDQQAKAIGYLAAAIPAAGVLALLIAGSFATTIGWRYSFALVVALAVVNLILSFRVKPVPPQKDITIDWAGAAIAAVAVILLSFGFSGLNSWGVILATDAAPFSVIGVSPAAILIVLGTICAQGFFQWTRSRKAQNKPQLFNLDVLKTGAERATTICMATMMFVGTAANFLIPLYMQIIQGRSSLQTSFSIIPYTLSIFIASTVVARLYKTYSPRLIARAGFVVVAAGLILLAFTIRGDWHQIFVVIGLITLGLGQGAIVALVFNTLLTAAPKELAGDVGAWRGLVHNMSGSVGIAVASVFAVGILGSLVSSQLIDNPTIPASLKVESGINLDQVNFVPNDQLVVTLENTSATQAQIDEAIRINTEARLRALRTSLLVLAGLSLLAIIPAGRMPDEVPALEEPQPTKGKK
>NZ_CP017299.1|WP_063892127.1|140541_141465_-|hypothetical-protein
MRAAHLAVLEARVAALDAGDTDTVAAAIRGYVPLNSGNPVVRHVQDLGSRIREEARHVVSGKPRSIAFRLGLSLGMGLAYLAFIRLFQWDTKEDRLPYLALYALSGVVGSVVCTNALSFDAGRVRAALSGGTRLWHVLVAKNAVMLLLVGSAGFLLSAVLAWRSGSSADLVKACGQVLTMILLWLGVANVMSVSLPLRAEPMTARRHDGTWKQFLLSFVISYGVGLIVNLMLYWRVWAKTTLLEQMGGPWIPVLLLLASAAATWLLLTVLAVLLAEQPRFRRALHREMVVYREETNHLQATIQHNSG
>NZ_CP017299.1|WP_003944177.1|141807_142395_+|DinB-family-protein
MTTNSEKEDLQRYLQAARDALVWKLDGLSEYDIRRPMTRTGTNLLGLVKHMIGVELGYFGPTFGRRVPDLPAWLRSEELNVDMWARADESTADIVETYRRTWAFADATIEEHDLDAPGFVKHWPEDRRDVTLHRILVHVVTEIHRHAGHADIVRELIDGAAGMKAGDNNLAPGDEAWWAEYTDRLETAAREAHHA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2424499 : 2432062

Lactobacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_030534957.1\|2424499_2425066_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	4.3e-06	33.9
WP_075832917.1\|2425121_2425949_-	siderophore-interacting protein	NA	NA	NA	NA
WP_003944717.1\|2426240_2426471_+	glutaredoxin-like protein NrdH	V5UN81	Mycobacterium_phage	1.1e-21	64.0
WP_003944767.1\|2426553_2427033_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A217ER62	Bacillus_phage	4.5e-09	30.1
WP_085989958.1\|2427014_2429174_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	V9VI16	Lactococcus_phage	1.5e-205	51.0
WP_003944723.1\|2429236_2429449_-	hypothetical protein	NA	NA	NA	NA
WP_085989609.1\|2429461_2430286_-	SPFH domain-containing protein	NA	NA	NA	NA
WP_003944744.1\|2430549_2431515_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A0N7CCA3	Skermania_phage	7.7e-157	86.8
WP_058038596.1\|2431588_2432062_-	NUDIX domain-containing protein	D0R7J3	Paenibacillus_phage	1.9e-12	31.2

DBSCAN-SWA_2

3781661 : 3792538

Gordonia_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_143542537.1\|3781661_3783290_-	hypothetical protein	A0A0K0N741	Gordonia_phage	6.4e-180	55.5
WP_075833500.1\|3783345_3784332_-	hypothetical protein	A0A0K0N752	Gordonia_phage	9.9e-59	40.0
WP_075833502.1\|3784347_3789177_-	hypothetical protein	A0A2H4PIX3	Corynebacterium_phage	1.8e-60	34.4
WP_143542538.1\|3789278_3789749_-	hypothetical protein	A0A0K0MWG1	Gordonia_phage	7.1e-15	37.6
WP_075833506.1\|3789851_3790373_-	hypothetical protein	NA	NA	NA	NA
WP_075833508.1\|3790382_3790847_-	HK97 gp10 family phage protein	A0A142K9T1	Gordonia_phage	4.1e-23	50.0
WP_143542539.1\|3790846_3791185_-	hypothetical protein	NA	NA	NA	NA
WP_075833512.1\|3791231_3791777_-	hypothetical protein	NA	NA	NA	NA
WP_087503819.1\|3791776_3792538_-	hypothetical protein	A0A0K0MWF9	Gordonia_phage	5.7e-46	40.7

DBSCAN-SWA_3

3798321 : 3814407

Gordonia_phage(81.82%)

capsid,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_075833522.1\|3798321_3800262_-	hypothetical protein	A0A1B0WKX6	Flavobacterium_phage	2.0e-15	54.7
WP_075833524.1\|3800264_3800672_-	hypothetical protein	A0A1C9EHX9	Gordonia_phage	3.9e-17	36.3
WP_075833526.1\|3800661_3801096_-	hypothetical protein	A0A1B3B048	Gordonia_phage	3.0e-20	33.3
WP_054780909.1\|3801095_3801452_-	hypothetical protein	NA	NA	NA	NA
WP_075833528.1\|3801462_3802251_-	hypothetical protein	A0A1B3B1N8	Gordonia_phage	7.4e-41	39.6
WP_143542542.1\|3802332_3804222_-\|capsid	major capsid protein	A0A166Y1T5	Gordonia_phage	1.3e-104	48.6
WP_075833533.1\|3804514_3804790_-	hypothetical protein	NA	NA	NA	NA
WP_143542544.1\|3804786_3807309_-	hypothetical protein	A0A161HSU2	Gordonia_phage	6.2e-57	54.9
WP_075833538.1\|3807395_3807623_-	hypothetical protein	NA	NA	NA	NA
WP_143542545.1\|3807625_3809737_-	hypothetical protein	A0A1B3B1L1	Gordonia_phage	4.1e-94	36.2
WP_054780919.1\|3809832_3810168_-	hypothetical protein	A0A0K0MWP5	Gordonia_phage	1.0e-07	39.8
WP_075833543.1\|3810164_3811769_-	hypothetical protein	A0A166Y1M2	Gordonia_phage	3.8e-108	41.8
WP_075833546.1\|3811768_3812071_-	hypothetical protein	A0A2L0HJI9	Gordonia_phage	1.4e-08	31.5
WP_075833549.1\|3812162_3813008_-	hypothetical protein	NA	NA	NA	NA
WP_075832375.1\|3813123_3814407_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	2.4e-36	38.5

DBSCAN-SWA_4

3817519 : 3837026

Rhodococcus_phage(31.58%)

integrase

attL 3814988:3815004|attR 3840440:3840456

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3814988:3815004	attL	NA	NA	NA	NA
WP_157127652.1\|3817519_3817675_-	hypothetical protein	A0A1I9SAR7	Rhodococcus_phage	5.4e-12	72.5
WP_157127653.1\|3817671_3817842_-	hypothetical protein	A0A1I9SAB1	Rhodococcus_phage	4.5e-20	76.8
WP_075833565.1\|3817987_3818257_-	hypothetical protein	NA	NA	NA	NA
WP_075833567.1\|3818253_3818454_-	hypothetical protein	NA	NA	NA	NA
WP_075833569.1\|3818593_3819544_-	DNA cytosine methyltransferase	A0A088FRI5	Mycobacterium_phage	1.7e-111	62.6
WP_143542552.1\|3819546_3819897_-	hypothetical protein	NA	NA	NA	NA
WP_075833573.1\|3820616_3822209_-	hypothetical protein	A0A161HST6	Gordonia_phage	1.0e-158	55.1
WP_075833576.1\|3822365_3822662_-	glutaredoxin family protein	A0A2D2W377	Mycobacterium_phage	7.1e-13	48.7
WP_075833578.1\|3822658_3823150_-	hypothetical protein	A0A0A7HAT3	Arthrobacter_phage	1.1e-05	44.8
WP_075833581.1\|3823193_3823676_-	DUF4326 domain-containing protein	A0A142K9N0	Gordonia_phage	1.8e-37	49.0
WP_075833584.1\|3823672_3824044_-	hypothetical protein	A0A1C9M1C1	Mycobacterium_phage	8.9e-37	67.2
WP_075833587.1\|3824040_3824865_-	hypothetical protein	A0A2D1GG94	Gordonia_phage	2.1e-14	50.5
WP_075833590.1\|3824869_3825703_-	HNH endonuclease	A0A2K9VH78	Gordonia_phage	1.4e-53	54.8
WP_075833591.1\|3825783_3826080_-	WhiB family transcriptional regulator	A0A023ZXD5	Mycobacterium_phage	3.2e-05	34.6
WP_075833593.1\|3826135_3826711_-	hypothetical protein	G9FH01	Rhodococcus_phage	2.7e-80	76.4
WP_075833595.1\|3826713_3827397_-	hypothetical protein	G9FH00	Rhodococcus_phage	3.6e-92	62.5
WP_157127654.1\|3827393_3827546_-	hypothetical protein	NA	NA	NA	NA
WP_075833598.1\|3827652_3827838_-	hypothetical protein	NA	NA	NA	NA
WP_075833600.1\|3828219_3828450_-	hypothetical protein	NA	NA	NA	NA
WP_157127655.1\|3828575_3828731_-	hypothetical protein	NA	NA	NA	NA
WP_087503834.1\|3828727_3829141_-	hypothetical protein	NA	NA	NA	NA
WP_075833605.1\|3829324_3830134_-	hypothetical protein	A0A1B3AYU1	Gordonia_phage	7.6e-49	46.4
WP_075833607.1\|3830195_3830384_-	helix-turn-helix domain-containing protein	G9FGY5	Rhodococcus_phage	4.1e-06	51.7
WP_075833611.1\|3830785_3831370_+	hypothetical protein	A0A1W6JQ81	Corynebacterium_phage	2.2e-13	39.0
WP_075833613.1\|3831370_3831847_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_075833615.1\|3831759_3832968_+\|integrase	site-specific integrase	G9FGY1	Rhodococcus_phage	7.2e-112	53.9
WP_003941570.1\|3833230_3833482_+	hypothetical protein	NA	NA	NA	NA
WP_030536590.1\|3833483_3835403_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	4.4e-55	32.2
WP_075833618.1\|3835475_3837026_+	serine/threonine protein kinase	M1HTZ5	Acanthocystis_turfacea_Chlorella_virus	9.5e-16	30.1
3840440:3840456	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP017303

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

59225 : 118273

Burkholderia_virus(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157127683.1\|59225_60499_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	7.5e-59	52.9
WP_075836106.1\|61426_63073_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_075836108.1\|63191_64397_+	serine hydrolase	A0A2P1JR59	Mycobacterium_phage	3.9e-09	30.1
WP_075836110.1\|64546_65317_+	glucose 1-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	4.0e-15	32.4
WP_143542640.1\|65408_65921_-	hypothetical protein	NA	NA	NA	NA
WP_083954814.1\|66159_67920_+	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_065493547.1\|68270_68585_+\|transposase	transposase	Q9ETV7	Enterobacteria_phage	1.0e-09	37.6
WP_157127684.1\|68641_69337_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	4.7e-31	53.8
WP_087503911.1\|71133_71889_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_075836116.1\|72346_73840_+	APC family permease	NA	NA	NA	NA
WP_075836118.1\|73853_74174_+	TIGR04076 family protein	NA	NA	NA	NA
WP_083954790.1\|74089_75199_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_075836120.1\|75191_76205_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_075836121.1\|76251_77628_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_075836123.1\|77684_78287_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_075836125.1\|78475_79759_+	amidase	NA	NA	NA	NA
WP_075836407.1\|79824_80103_+	hypothetical protein	NA	NA	NA	NA
WP_075836409.1\|80132_80798_+	response regulator transcription factor	NA	NA	NA	NA
WP_075836127.1\|80840_81791_-	oxidoreductase	NA	NA	NA	NA
WP_075836129.1\|81822_82581_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_075836131.1\|82676_83039_-	hypothetical protein	NA	NA	NA	NA
WP_075836132.1\|83107_84280_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_075836412.1\|84463_85927_+	PAS domain S-box protein	NA	NA	NA	NA
WP_075836134.1\|86141_87638_+	GMC family oxidoreductase	A0A1V0SI18	Klosneuvirus	5.9e-47	29.9
WP_075836137.1\|87669_89124_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_083954791.1\|89195_90941_-	amidohydrolase family protein	NA	NA	NA	NA
WP_075836139.1\|90968_92162_-	flavin reductase family protein	NA	NA	NA	NA
WP_083954792.1\|92260_92848_-	hypothetical protein	NA	NA	NA	NA
WP_075836419.1\|92840_94139_-	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
WP_075836421.1\|94333_94879_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_075836424.1\|95259_95511_+	DUF485 domain-containing protein	NA	NA	NA	NA
WP_075836141.1\|95507_97055_+	cation acetate symporter	NA	NA	NA	NA
WP_143542650.1\|98222_98414_+	hypothetical protein	NA	NA	NA	NA
WP_075836145.1\|98738_99227_+	hypothetical protein	NA	NA	NA	NA
WP_075832375.1\|100376_101660_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	2.4e-36	38.5
WP_075836147.1\|101990_102833_-	cell filamentation protein Fic	NA	NA	NA	NA
WP_075835818.1\|102829_103045_-	antitoxin VbhA family protein	NA	NA	NA	NA
WP_075836149.1\|103201_104977_-	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	1.6e-51	36.6
WP_051649789.1\|105117_107799_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	3.0e-150	33.6
WP_003943355.1\|108001_109195_+	alcohol dehydrogenase catalytic domain-containing protein	NA	NA	NA	NA
WP_075836151.1\|109404_110376_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_075836153.1\|111279_112605_+\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	5.7e-195	75.9
WP_075836155.1\|112709_114158_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_003941838.1\|114244_115111_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003941837.1\|115168_115573_-	hypothetical protein	NA	NA	NA	NA
WP_042926698.1\|115770_116745_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_075836157.1\|117214_118273_+\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

149933 : 209471

Mycobacterium_phage(10.0%)

protease,transposase,integrase

attL 150902:150918|attR 155838:155854

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_083954794.1\|149933_150203_+\|protease	PrsW family intramembrane metalloprotease	NA	NA	NA	NA
WP_143542594.1\|150394_151162_+\|transposase	TnsA-like heteromeric transposase endonuclease subunit	NA	NA	NA	NA
150902:150918	attL	NA	NA	NA	NA
WP_075836189.1\|151158_153297_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_075836191.1\|154391_156725_+	TniQ family protein	NA	NA	NA	NA
155838:155854	attR	NA	NA	NA	NA
WP_016885136.1\|156781_157738_-	recombinase family protein	G8I4U3	Mycobacterium_phage	7.9e-29	44.6
WP_016885137.1\|157929_158190_+	CopG family transcriptional regulator	NA	NA	NA	NA
WP_016885138.1\|158186_158423_+	hypothetical protein	NA	NA	NA	NA
WP_075836193.1\|159070_159313_+	hypothetical protein	NA	NA	NA	NA
WP_143542595.1\|159328_159844_-	serine/threonine protein kinase	NA	NA	NA	NA
WP_075836197.1\|161927_162377_-	DUF1931 family protein	NA	NA	NA	NA
WP_075836199.1\|162381_164103_-	cyclic nucleotide-binding domain-containing protein	A0A249XZT7	Enterococcus_phage	1.7e-18	27.6
WP_075836201.1\|164080_164347_-	UBP-type zinc finger domain-containing protein	NA	NA	NA	NA
WP_075836203.1\|164343_164796_-	thioredoxin	A0A1J0GW78	Streptomyces_phage	3.2e-12	41.4
WP_075836205.1\|164812_167446_-	ATP-dependent chaperone ClpB	K4FB40	Cronobacter_phage	1.2e-122	33.2
WP_030537135.1\|167427_167757_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_075836207.1\|167753_168692_-	J domain-containing protein	A0A2L0UZR4	Agrobacterium_phage	5.0e-20	27.2
WP_007735553.1\|168698_169223_-	nucleotide exchange factor GrpE	NA	NA	NA	NA
WP_042926712.1\|169231_171106_-	molecular chaperone DnaK	G8DDB7	Micromonas_pusilla_virus	2.2e-147	48.2
WP_075836209.1\|171109_171613_-	glycine zipper family protein	NA	NA	NA	NA
WP_075836212.1\|172241_173258_+	PDZ domain-containing protein	NA	NA	NA	NA
WP_075836214.1\|174241_175339_+	hypothetical protein	NA	NA	NA	NA
WP_064113782.1\|177238_177640_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_143542550.1\|179500_179698_+	hypothetical protein	NA	NA	NA	NA
WP_003944048.1\|180913_181846_+	DoxX family membrane protein	NA	NA	NA	NA
WP_075836219.1\|182434_182788_-	hypothetical protein	NA	NA	NA	NA
WP_064442799.1\|183124_183457_-	hypothetical protein	NA	NA	NA	NA
WP_075836220.1\|183960_185103_+	alkane 1-monooxygenase	NA	NA	NA	NA
WP_083954795.1\|185440_185734_+	BldC family transcriptional regulator	NA	NA	NA	NA
WP_075836171.1\|187230_188172_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_075836169.1\|188280_188592_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_157127686.1\|188837_189002_-	hypothetical protein	NA	NA	NA	NA
WP_143542633.1\|189802_190060_-	hypothetical protein	NA	NA	NA	NA
WP_075836228.1\|190577_191360_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	7.2e-12	29.4
WP_083954796.1\|191402_192692_+\|transposase	ISL3 family transposase	A9YX10	Burkholderia_phage	3.4e-11	21.9
WP_003943358.1\|195274_195547_-	DUF4235 domain-containing protein	NA	NA	NA	NA
WP_003943397.1\|195543_195765_-	DUF3618 domain-containing protein	NA	NA	NA	NA
WP_075836230.1\|195836_197387_-	YihY family inner membrane protein	NA	NA	NA	NA
WP_003943350.1\|197768_198332_-	hypothetical protein	NA	NA	NA	NA
WP_075836232.1\|198434_198701_-	hypothetical protein	NA	NA	NA	NA
WP_083954797.1\|199237_200032_-	hypothetical protein	NA	NA	NA	NA
WP_075836235.1\|199991_201083_-	hypothetical protein	NA	NA	NA	NA
WP_054827982.1\|201613_202408_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_019749850.1\|203118_204231_-	NDMA-dependent alcohol dehydrogenase	E3SJ82	Synechococcus_phage	1.7e-38	32.2
WP_075836237.1\|204346_205801_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_075836239.1\|206100_207735_+	Fis family transcriptional regulator	NA	NA	NA	NA
WP_075836241.1\|207864_208224_+	Lsr2 family protein	A0A160DEV0	Gordonia_phage	9.9e-17	42.9
WP_070160344.1\|208310_208559_-	hypothetical protein	NA	NA	NA	NA
WP_075836243.1\|208736_209471_+\|transposase	IS6 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

237525 : 276869

uncultured_virus(22.22%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_075832375.1\|237525_238809_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	2.4e-36	38.5
WP_075836265.1\|240029_240779_+	GAF and ANTAR domain-containing protein	NA	NA	NA	NA
WP_083954799.1\|240887_241910_-	GAF and ANTAR domain-containing protein	NA	NA	NA	NA
WP_075835087.1\|241924_242572_+	GAF and ANTAR domain-containing protein	NA	NA	NA	NA
WP_042445280.1\|242630_243329_+	GAF domain-containing protein	NA	NA	NA	NA
WP_042445278.1\|243523_243724_-	hypothetical protein	NA	NA	NA	NA
WP_054781737.1\|243751_244096_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_058036959.1\|244260_244719_+	Hsp20 family protein	NA	NA	NA	NA
WP_075836269.1\|244715_245102_+	hypothetical protein	NA	NA	NA	NA
WP_082920772.1\|245364_249381_+	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	2.8e-51	27.2
WP_021333640.1\|249384_249810_-	DUF1003 domain-containing protein	NA	NA	NA	NA
WP_064444988.1\|249893_250631_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_064444989.1\|250641_250893_-	hypothetical protein	NA	NA	NA	NA
WP_064444990.1\|250889_251822_-	universal stress protein	NA	NA	NA	NA
WP_064444991.1\|252574_252952_+	hypothetical protein	NA	NA	NA	NA
WP_064444992.1\|252964_256219_-	HAD-IA family hydrolase	M1H9H9	Acanthocystis_turfacea_Chlorella_virus	6.9e-08	27.4
WP_064445019.1\|256215_257214_-	zinc-binding alcohol dehydrogenase family protein	A0A2K9L339	Tupanvirus	3.6e-24	28.3
WP_064444993.1\|257249_258137_-	universal stress protein	NA	NA	NA	NA
WP_064444994.1\|258373_259345_+	hypothetical protein	NA	NA	NA	NA
WP_064445020.1\|259425_260073_+	response regulator transcription factor	NA	NA	NA	NA
WP_082920773.1\|260069_261761_+	GAF domain-containing sensor histidine kinase	NA	NA	NA	NA
WP_081559660.1\|261766_262357_+	hypothetical protein	NA	NA	NA	NA
WP_143542575.1\|262658_263474_+	hypothetical protein	NA	NA	NA	NA
WP_064444997.1\|263479_264385_-	AAA family ATPase	NA	NA	NA	NA
WP_143542577.1\|264445_265144_+\|transposase	IS6 family transposase	A0A0N9RU54	Staphylococcus_phage	2.4e-19	28.4
WP_075836275.1\|266378_267224_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_083745085.1\|267223_268357_-	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_125053637.1\|268574_269273_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	1.7e-25	38.6
WP_075836281.1\|269340_269895_-	hypothetical protein	NA	NA	NA	NA
WP_125053637.1\|270074_270773_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	1.7e-25	38.6
WP_075836285.1\|271008_272025_+	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_083954800.1\|272012_272822_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	6.7e-37	35.4
WP_075836287.1\|273082_274144_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_075836289.1\|274103_274430_-\|transposase	transposase	NA	NA	NA	NA
WP_054781240.1\|274890_275178_-	hypothetical protein	NA	NA	NA	NA
WP_075832375.1\|275585_276869_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	2.4e-36	38.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP017304

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

30786 : 135305

Mycobacterium_phage(18.75%)

integrase,transposase

attL 93063:93077|attR 135817:135831

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_075836670.1\|30786_32070_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	8.4e-34	41.7
WP_143542581.1\|33273_33573_+	hypothetical protein	NA	NA	NA	NA
WP_143542582.1\|33729_37275_+	DEAD/DEAH box helicase	A0A2H4UTW8	Bodo_saltans_virus	1.3e-31	25.1
WP_075836508.1\|37464_38745_+	zinc-ribbon domain-containing protein	V5UP53	Mycobacterium_phage	1.2e-19	47.0
WP_075836510.1\|38791_39337_+	hypothetical protein	NA	NA	NA	NA
WP_075836512.1\|39805_40714_+	hypothetical protein	NA	NA	NA	NA
WP_075836672.1\|40763_41426_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_075836514.1\|41504_42392_-	hypothetical protein	NA	NA	NA	NA
WP_143542583.1\|43563_43842_-	hypothetical protein	NA	NA	NA	NA
WP_075836519.1\|43927_44266_-	hypothetical protein	NA	NA	NA	NA
WP_075836675.1\|44262_45072_-	hypothetical protein	NA	NA	NA	NA
WP_075836520.1\|45172_45967_-	hypothetical protein	NA	NA	NA	NA
WP_075835702.1\|47364_48762_-\|transposase	IS1380 family transposase	NA	NA	NA	NA
WP_075836521.1\|50806_51562_-	glucose 1-dehydrogenase	F2NZ40	Diadromus_pulchellus_ascovirus	8.2e-13	30.0
WP_075836522.1\|51558_52941_-	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_075836523.1\|52972_54598_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_075836524.1\|54634_55567_-	alpha/beta hydrolase fold domain-containing protein	NA	NA	NA	NA
WP_075836525.1\|55791_56856_+	alcohol dehydrogenase catalytic domain-containing protein	A0A2K9V7Y5	Bandra_megavirus	1.6e-14	26.7
WP_083954823.1\|56800_58078_+	hypothetical protein	NA	NA	NA	NA
WP_075836528.1\|58255_59146_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_075836530.1\|59234_60413_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_075836532.1\|60409_61624_+	CoA transferase	NA	NA	NA	NA
WP_075836534.1\|61662_62391_+	3-oxoacyl-ACP reductase FabG	NA	NA	NA	NA
WP_075836536.1\|62442_63654_+	acetyl-CoA C-acetyltransferase	NA	NA	NA	NA
WP_075836538.1\|63678_64140_+	MaoC family dehydratase	NA	NA	NA	NA
WP_143542645.1\|64297_66364_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_075836540.1\|66627_67683_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_075835702.1\|70116_71514_-\|transposase	IS1380 family transposase	NA	NA	NA	NA
WP_075836542.1\|71592_71835_-	hypothetical protein	NA	NA	NA	NA
WP_075836544.1\|71831_72062_-	hypothetical protein	NA	NA	NA	NA
WP_075836546.1\|72058_72556_-	hypothetical protein	A0A1W6JTS9	Mycobacterium_phage	8.9e-24	41.3
WP_075836548.1\|72650_73016_-	hypothetical protein	NA	NA	NA	NA
WP_143542605.1\|73069_73450_-	hypothetical protein	NA	NA	NA	NA
WP_075836679.1\|73461_74508_-	hypothetical protein	NA	NA	NA	NA
WP_075836552.1\|74891_75191_-	hypothetical protein	NA	NA	NA	NA
WP_075836556.1\|76189_77017_+	C40 family peptidase	A0A1J0GW44	Streptomyces_phage	5.6e-15	46.1
WP_075836558.1\|77027_77558_+	hypothetical protein	A0A142K8V3	Gordonia_phage	8.6e-09	40.0
WP_157127688.1\|78002_78140_+	hypothetical protein	NA	NA	NA	NA
WP_075836560.1\|78136_78757_+	hypothetical protein	Q9ZX22	Mycobacterium_phage	2.2e-19	38.2
WP_075836562.1\|78753_79014_+	hypothetical protein	NA	NA	NA	NA
WP_075836564.1\|79036_79552_+	hypothetical protein	NA	NA	NA	NA
WP_143542604.1\|79548_80727_+	hypothetical protein	NA	NA	NA	NA
WP_075836568.1\|80824_82255_-	cutinase family protein	NA	NA	NA	NA
WP_075836570.1\|82294_83146_-	hypothetical protein	NA	NA	NA	NA
WP_075836572.1\|83477_83807_+	hypothetical protein	NA	NA	NA	NA
WP_075836574.1\|83803_84913_+	hypothetical protein	NA	NA	NA	NA
WP_075836576.1\|84933_85290_+	hypothetical protein	NA	NA	NA	NA
WP_075836578.1\|85349_85994_+	hypothetical protein	NA	NA	NA	NA
WP_075836580.1\|85993_88534_+	hypothetical protein	NA	NA	NA	NA
WP_052959880.1\|88530_90771_+	hypothetical protein	NA	NA	NA	NA
WP_087503872.1\|91710_92421_+	M23 family metallopeptidase	A0A1W6JQH9	Corynebacterium_phage	1.7e-15	42.8
WP_047269939.1\|92437_93046_+	hypothetical protein	NA	NA	NA	NA
93063:93077	attL	NA	NA	NA	NA
WP_064075584.1\|93478_94201_+\|transposase	TnsA-like heteromeric transposase endonuclease subunit	NA	NA	NA	NA
WP_064075566.1\|94197_96282_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_064233800.1\|96287_97328_+	AAA family ATPase	NA	NA	NA	NA
WP_064074700.1\|97324_98197_+	hypothetical protein	NA	NA	NA	NA
WP_064074699.1\|98346_98607_+	ArsR family transcriptional regulator	NA	NA	NA	NA
WP_075836586.1\|98822_99011_-	hypothetical protein	NA	NA	NA	NA
WP_003944771.1\|100734_101526_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	3.9e-13	26.6
WP_083954825.1\|101600_101984_-	hypothetical protein	NA	NA	NA	NA
WP_064074698.1\|102091_102655_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_064074697.1\|102651_103380_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_064074702.1\|103409_104636_-	MFS transporter	NA	NA	NA	NA
WP_064074696.1\|104733_105282_-	universal stress protein	NA	NA	NA	NA
WP_064074695.1\|105292_105658_-	fluoride efflux transporter CrcB	NA	NA	NA	NA
WP_064074694.1\|105654_106179_-	CrcB family protein	NA	NA	NA	NA
WP_064074693.1\|106551_107817_+	phosphopyruvate hydratase	W6LP63	Streptococcus_phage	3.9e-100	49.4
WP_064074692.1\|107813_109073_+	MFS transporter	NA	NA	NA	NA
WP_064074691.1\|109429_110125_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_064074690.1\|110207_111722_-	hypothetical protein	NA	NA	NA	NA
WP_064074701.1\|111718_113254_-	DNA mismatch repair protein MutS	NA	NA	NA	NA
WP_064074689.1\|113703_114579_-	hypothetical protein	A0A2D0ZMA7	Rhodococcus_phage	1.1e-56	44.7
WP_064074688.1\|114717_114963_-	hypothetical protein	NA	NA	NA	NA
WP_143542646.1\|115456_116089_+	hypothetical protein	NA	NA	NA	NA
WP_075836592.1\|116361_116580_+	hypothetical protein	NA	NA	NA	NA
WP_083954826.1\|116576_118802_+	AAA family ATPase	A0A1X9SGM3	Bacillus_phage	3.6e-08	23.2
WP_047269937.1\|118835_119165_+	hypothetical protein	NA	NA	NA	NA
WP_075836594.1\|119630_120314_+	hypothetical protein	G9FH02	Rhodococcus_phage	1.3e-12	32.6
WP_083954827.1\|120285_121098_+	prepilin peptidase	NA	NA	NA	NA
WP_087503901.1\|121550_124016_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_011133407.1\|124033_125293_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_047269066.1\|125730_126450_+	HNH endonuclease	NA	NA	NA	NA
WP_047269065.1\|126493_127093_-	hypothetical protein	NA	NA	NA	NA
WP_058037609.1\|127089_129297_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_047269064.1\|129293_130400_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_143542546.1\|130588_130777_+	hypothetical protein	NA	NA	NA	NA
WP_070160272.1\|130761_131664_+	HNH endonuclease	NA	NA	NA	NA
WP_047270891.1\|131560_131959_-	hypothetical protein	NA	NA	NA	NA
WP_083291452.1\|131977_134137_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_058037612.1\|134129_135305_-\|integrase	tyrosine-type recombinase/integrase	A0A0M5M609	Bacillus_phage	6.6e-09	26.6
135817:135831	attR	NA	NA	NA	NA

DBSCAN-SWA_2

169190 : 241884

Bacillus_phage(22.22%)

integrase,transposase

attL 168286:168345|attR 242730:245310

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
168286:168345	attL	NA	NA	NA	NA
WP_030538069.1\|169190_170732_-\|transposase	IS21-like element IS1415 family transposase	NA	NA	NA	NA
WP_155419132.1\|171916_172069_+	hypothetical protein	NA	NA	NA	NA
WP_080961020.1\|172128_172422_-	BldC family transcriptional regulator	NA	NA	NA	NA
WP_003944048.1\|173101_174034_-	DoxX family membrane protein	NA	NA	NA	NA
WP_143542554.1\|175039_175444_-	hypothetical protein	NA	NA	NA	NA
WP_047270445.1\|175667_176573_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_047270446.1\|177230_178016_-	membrane protein	NA	NA	NA	NA
WP_047270447.1\|178336_179251_-	DUF2510 domain-containing protein	NA	NA	NA	NA
WP_047270448.1\|179618_180374_+	hypothetical protein	NA	NA	NA	NA
WP_047270451.1\|182905_183304_+	hypothetical protein	NA	NA	NA	NA
WP_047270452.1\|183307_183613_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_155419208.1\|183937_184084_+	hypothetical protein	NA	NA	NA	NA
WP_143542612.1\|184073_184337_+	hypothetical protein	NA	NA	NA	NA
WP_047270454.1\|184497_185298_+	SigB/SigF/SigG family RNA polymerase sigma factor	A0A0Y0ATF9	Bacillus_phage	1.3e-19	35.5
WP_047270465.1\|185534_185972_+	DUF3349 domain-containing protein	NA	NA	NA	NA
WP_047270455.1\|185990_186248_-	hypothetical protein	NA	NA	NA	NA
WP_047270456.1\|187162_188563_+\|transposase	IS1380 family transposase	A0A222ZN33	Mycobacterium_phage	3.8e-88	43.0
WP_047270457.1\|189496_191023_+	sugar transferase	NA	NA	NA	NA
WP_047270458.1\|191150_192173_+	GDP-mannose 4,6-dehydratase	M4QRT5	Synechococcus_phage	2.2e-106	56.3
WP_047270459.1\|192178_193147_+	GDP-L-fucose synthase	D1LW79	Prochlorococcus_phage	9.3e-94	54.2
WP_047270460.1\|193277_194597_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	2.3e-66	34.3
WP_052959925.1\|195176_196457_+	glycosyltransferase	NA	NA	NA	NA
WP_080961170.1\|196456_197629_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_047270462.1\|197625_198981_+	MATE family efflux transporter	NA	NA	NA	NA
WP_075836637.1\|199058_199886_+	glycosyltransferase	NA	NA	NA	NA
WP_080961172.1\|199882_200920_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_143542613.1\|200943_202332_+	O-antigen ligase family protein	NA	NA	NA	NA
WP_080961173.1\|202413_202995_+	acyltransferase	M1HKK6	Paramecium_bursaria_Chlorella_virus	6.1e-08	50.8
WP_075836641.1\|203093_203636_+	putative colanic acid biosynthesis acetyltransferase	NA	NA	NA	NA
WP_080961094.1\|207046_207328_+\|transposase	transposase	NA	NA	NA	NA
WP_052959829.1\|207357_209208_-	DUF4012 domain-containing protein	NA	NA	NA	NA
WP_075836643.1\|209400_225492_+	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	3.1e-125	25.1
WP_083954829.1\|225608_227117_+	polysaccharide biosynthesis tyrosine autokinase	NA	NA	NA	NA
WP_075836645.1\|227617_228187_-	low molecular weight phosphatase family protein	NA	NA	NA	NA
WP_157127689.1\|229494_230268_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_087503882.1\|230257_231402_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.8e-32	35.5
WP_083954831.1\|231810_232476_+	response regulator transcription factor	NA	NA	NA	NA
WP_064113076.1\|233096_234242_+	alkane 1-monooxygenase	NA	NA	NA	NA
WP_082900877.1\|234498_234798_+	hypothetical protein	NA	NA	NA	NA
WP_075836657.1\|236071_236347_-	hypothetical protein	NA	NA	NA	NA
WP_075836693.1\|237493_237853_+	Lsr2 family protein	A0A160DEV0	Gordonia_phage	6.8e-18	44.5
WP_083954832.1\|238345_238480_+	hypothetical protein	NA	NA	NA	NA
WP_075836659.1\|238875_239178_+	hypothetical protein	NA	NA	NA	NA
WP_075836661.1\|239630_240041_+	hypothetical protein	NA	NA	NA	NA
WP_030538069.1\|240342_241884_+\|transposase	IS21-like element IS1415 family transposase	NA	NA	NA	NA
242730:245310	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP017300

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP017299

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP017303

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP017304

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection