CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP015757	Clostridium estertheticum subsp. estertheticum strain DSM 8809 plasmid pDSM8809, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP015756	Clostridium estertheticum subsp. estertheticum strain DSM 8809 chromosome, complete genome	1 crisprs	cas3,DEDDh,c2c9_V-U4,PD-DExK,WYL,RT,DinG,csa3,PrimPol	0	1	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP015756_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015756_1

803654-803763

Orphan

Consensus_repeat	Method
ATTGCTAAGTACAGACAGCACTTTTTCATCTGTCTGTTTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015756_1

>merge|NZ_CP015756|1|803654-803763|CRISPRCasFinder
ATTGCTAAGTACAGACAGCACTTTTTCATCTGTCTGTTTTTTACTCCATTGTTTTTTACTCCAGCTACCATTGCTAAGTACAGACAGCACTTTTTCATCTGTTTGTTTTT

>NZ_CP015756|1|1|803654-803763|CRISPRCasFinder
ATTGCTAAGTACAGACAGCACTTTTTCATCTGTCTGTTTTT	TACTCCATTGTTTTTTACTCCAGCTACC
ATTGCTAAGTACAGACAGCACTTTTTCATCTGTTTGTTTTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015756.1\|WP_071611531.1\|792662_793493_+\|malonyl-ACP-O-methyltransferase-BioC	unknown	unknown	gnl\|CDD\|273953
NZ_CP015756.1\|WP_071611545.1\|812041_812284_-\|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin	unknown	unknown	gnl\|CDD\|376852
NZ_CP015756.1\|WP_071614858.1\|806188_807043_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187578
NZ_CP015756.1\|WP_071611544.1\|811661_812045_-\|type-II-toxin-antitoxin-system-death-on-curing-family-toxin	unknown	unknown	gnl\|CDD\|226180
NZ_CP015756.1\|WP_071611534.1\|796065_797310_+\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_CP015756.1\|WP_071611536.1\|801315_801828_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP015756.1\|WP_071611537.1\|801963_803328_+\|MATE-family-efflux-transporter	unknown	unknown	gnl\|CDD\|240548
NZ_CP015756.1\|WP_151553651.1\|797440_798124_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213222
NZ_CP015756.1\|WP_071611533.1\|795369_796056_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NZ_CP015756.1\|WP_071611539.1\|807042_807459_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP015756.1\|WP_071611540.1\|807844_808405_-\|nitroreductase	unknown	unknown	gnl\|CDD\|380313
NZ_CP015756.1\|WP_071611543.1\|809909_810434_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015756.1\|WP_071611535.1\|798120_800526_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|226957
NZ_CP015756.1\|WP_071611529.1\|790733_791909_+\|8-amino-7-oxononanoate-synthase	unknown	unknown	gnl\|CDD\|235655
NZ_CP015756.1\|WP_071611538.1\|804398_805223_+\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|380352
NZ_CP015756.1\|WP_071611541.1\|809129_809354_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224393
NZ_CP015756.1\|WP_071611530.1\|791905_792649_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP015756.1\|WP_071611542.1\|809340_809754_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015756.1\|WP_071614857.1\|805286_806012_-\|ferritin-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|153097
NZ_CP015756.1\|WP_071611532.1\|793930_795100_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP015756.1\|WP_071611531.1\|792662_793493_+\|malonyl-ACP-O-methyltransferase-BioC	gnl\|CDD\|273953	TIGR02072, Malonyl-_O-methyltransferase, malonyl-acyl carrier protein O-methyltransferase BioC. This enzyme, which is found in biotin biosynthetic gene clusters in proteobacteria, firmicutes, green-sulfur bacteria, fusobacterium and bacteroides, carries out an enzymatic step prior to the formation of pimeloyl-CoA, namely O-methylation of the malonyl group preferentially while on acyl carrier protein. The enzyme is recognizable as a methyltransferase by homology. [Biosynthesis of cofactors, prosthetic groups, and carriers, Biotin].	1.17538e-59
NZ_CP015756.1\|WP_071611545.1\|812041_812284_-\|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin	gnl\|CDD\|376852	pfam02604, PhdYeFM_antitox, Antitoxin Phd_YefM, type II toxin-antitoxin system. Members of this family act as antitoxins in type II toxin-antitoxin systems. When bound to their toxin partners, they can bind DNA via the N-terminus and repress the expression of operons containing genes encoding the toxin and the antitoxin. This domain complexes with Txe toxins containing pfam06769, Fic/DOC toxins containing pfam02661 and YafO toxins containing pfam13957.	0.000106331
NZ_CP015756.1\|WP_071614858.1\|806188_807043_-\|SDR-family-oxidoreductase	gnl\|CDD\|187578	cd05269, TMR_SDR_a, triphenylmethane reductase (TMR)-like proteins, NMRa-like, atypical (a) SDRs. TMR is an atypical NADP-binding protein of the SDR family. It lacks the active site residues of the SDRs but has a glycine rich NAD(P)-binding motif that matches the extended SDRs. Proteins in this subgroup however, are more similar in length to the classical SDRs. TMR was identified as a reducer of triphenylmethane dyes, important environmental pollutants. This subgroup also includes Escherichia coli NADPH-dependent quinine oxidoreductase (QOR2), which catalyzes two-electron reduction of quinone; but is unlikely to play a major role in protecting against quinone cytotoxicity. Atypical SDRs are distinct from classical SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.90526e-77
NZ_CP015756.1\|WP_071611544.1\|811661_812045_-\|type-II-toxin-antitoxin-system-death-on-curing-family-toxin	gnl\|CDD\|226180	COG3654, Doc, Prophage maintenance system killer protein [General function prediction only].	2.559e-24
NZ_CP015756.1\|WP_071611534.1\|796065_797310_+\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	1.95797e-48
NZ_CP015756.1\|WP_071611536.1\|801315_801828_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	7.8566e-18
NZ_CP015756.1\|WP_071611537.1\|801963_803328_+\|MATE-family-efflux-transporter	gnl\|CDD\|240548	cd13143, MATE_MepA_like, Subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins similar to Streptococcus aureus MepA. The integral membrane proteins from the MATE family are involved in exporting metabolites across the cell membrane and are responsible for multidrug resistance (MDR) in many bacteria and animals. This subfamily includes Streptococcus aureus MepA and Vibrio vulnificus VmrA and functions most likely as a multidrug efflux pump.	2.55018e-108
NZ_CP015756.1\|WP_151553651.1\|797440_798124_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213222	cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein. This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of lipoproteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyzes the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.	1.84161e-109
NZ_CP015756.1\|WP_071611533.1\|795369_796056_+\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	7.78139e-69
NZ_CP015756.1\|WP_071611539.1\|807042_807459_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	2.11876e-18
NZ_CP015756.1\|WP_071611540.1\|807844_808405_-\|nitroreductase	gnl\|CDD\|380313	cd02136, PnbA_NfnB-like, nitroreductase similar to Mycobacterium smegmatis NfnB. Members of this family utilize FMN as a cofactor and catalyze reduction of a variety of nitroaromatic compounds, including nitrofurans, nitrobenzens, nitrophenol, nitrobenzoate and quinones by using either NADH or NADPH as a source of reducing equivalents in an obligatory two-election transfer mechanism. The enzyme is typically a homodimer. Mycobacterium smegmatis nitroreductase NfnB plays a role in resistance to benzothiazinone.	4.74935e-34
NZ_CP015756.1\|WP_071611535.1\|798120_800526_+\|ABC-transporter-permease	gnl\|CDD\|226957	COG4591, LolE, ABC-type transport system, involved in lipoprotein release, permease component [Cell envelope biogenesis, outer membrane].	2.12671e-15
NZ_CP015756.1\|WP_071611529.1\|790733_791909_+\|8-amino-7-oxononanoate-synthase	gnl\|CDD\|235655	PRK05958, PRK05958, 8-amino-7-oxononanoate synthase; Reviewed.	3.40665e-180
NZ_CP015756.1\|WP_071611538.1\|804398_805223_+\|cupin-domain-containing-protein	gnl\|CDD\|380352	cd02223, cupin_Bh2720-like, Bacillus halodurans Bh2720 and related proteins, cupin domain. This family includes bacterial, archaeal, and eukaryotic proteins similar to Bh2720, a Bacillus halodurans protein of unknown function with a cupin beta-barrel fold.	7.83658e-58
NZ_CP015756.1\|WP_071611541.1\|809129_809354_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224393	COG1476, COG1476, Predicted transcriptional regulators [Transcription].	1.28853e-23
NZ_CP015756.1\|WP_071611530.1\|791905_792649_+\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	2.31915e-19
NZ_CP015756.1\|WP_071614857.1\|805286_806012_-\|ferritin-like-domain-containing-protein	gnl\|CDD\|153097	cd00657, Ferritin_like, Ferritin-like superfamily of diiron-containing four-helix-bundle proteins. Ferritin-like, diiron-carboxylate proteins participate in a range of functions including iron regulation, mono-oxygenation, and reactive radical production. These proteins are characterized by the fact that they catalyze dioxygen-dependent oxidation-hydroxylation reactions within diiron centers; one exception is manganese catalase, which catalyzes peroxide-dependent oxidation-reduction within a dimanganese center. Diiron-carboxylate proteins are further characterized by the presence of duplicate metal ligands, glutamates and histidines (ExxH) and two additional glutamates within a four-helix bundle. Outside of these conserved residues there is little obvious homology. Members include bacterioferritin, ferritin, rubrerythrin, aromatic and alkene monooxygenase hydroxylases (AAMH), ribonucleotide reductase R2 (RNRR2), acyl-ACP-desaturases (Acyl_ACP_Desat), manganese (Mn) catalases, demethoxyubiquinone hydroxylases (DMQH), DNA protecting proteins (DPS), and ubiquinol oxidases (AOX), and the aerobic cyclase system, Fe-containing subunit (ACSF).	3.54486e-20

>NZ_CP015756.1|WP_071611537.1|801963_803328_+|MATE-family-efflux-transporter
MEQNKDSYSYYFEDAPIPKAIVHMAVPMMLGMSINMLYSIIDAFFIGKLNNTAMMTAVTLALPFTTILMAIGNVFGTGGGTYISRLLGEKDLGDAKKISSVSFYLSLLSGFIFMLLAIPLLHPILQILGARGDTVSFTQSYIMVFIIGSPFVIANFTLEQIVRAEGASTISMNGMILSVIINVILDPILIFTCNLGIAGAALGTIIGNLGAVLYYVYYLRNKSATLTISLKTFKPTITICSNIFKIGITAFLLDGFLMVSSLLLNNFSARYGDYAVAGFGISLRLVQLSEFIGMGLYMGVVPLIAYAYTAKNIKRMKKVINTTTTYILILTIFISLIIFIFRNPIYHLFSRDVNVINTGIYILMAMLISSLFAAITGIITAIFQAIGRAKEATIMSIAQGILLIPIMVSGNYIFGLHGLIWSMTVTEVLTCLLGLCLWIKFNRDTTKIDSDLDN
>NZ_CP015756.1|WP_071611536.1|801315_801828_+|MarR-family-transcriptional-regulator
MHNSISEKLLQQFHYFTNLIHRGRQQQSFGAHEINLGRGQGHLLGVLITNDGLTQKELSTQLRIRPTSLGELVSKLEQSNYVERRVNENDKRVSNVYITEEGRKIVNEIMKERQVVVNNMFISLSEDEKQQLLALMGKLITTMEENMDDNDNEEYENNKDQRIDRGNDSI
>NZ_CP015756.1|WP_071611535.1|798120_800526_+|ABC-transporter-permease
MKNYLELAPKYLSAHKRKTRLTITSVAMAVALVVGIFSMVDALVKFEKAQVLKDQGNYHILIRNPSPREIQAIGSRIDVQNAGTWKDLGEGTINGENCALTSLDENFAKNINFNLNKGRYPTSKNEIMLEKWFMEKSKPAHKIGDTMTITLPGKIIKKFTISGIYNNWGATKAAAIPAVFVSTKMSEQLKPKSSQYFVLFKDGVNIIKVEGEIKKTLNIVDARIGHNEGLLALMMQTKNNNVLKMYAVGGVLFFLVLITGVVMIYNTFNISVMERVRQFGILRCIGASEIQIKRLVKREGLSISWRAIPIGVFAGILITFICTAILKFYNTKLYGGIPLINFSVFGIGAGIVIGFLTVFIASLLPAKKAAKVSPVSALSGSMDSKISRKTKQGLLMKIFHAEIVIGISNSVYKKKTLFLISSSIALSIIMFMCFSVFVNPTFLGIKAPEVYTPDVSITSSQGIGENIYKKLSTLGNVKRVYGRMSNYVDATFDVTRLTGTYKKEMGPIKTESNGLMVAKEKSWIVSYDSMQMQWAKKSLMAGGMDENELNTQNGIVAVVKNYRKGELAADASMKVGDAVYIKTATWTKEYKVMGILSSVPYESEKQTLTTFITTQKQFAKITGDITSNYKTIDIQLNKKNQEQTINEIKALAKNSVTLHDSRQLNAEASSSFMTIAVFIYGFVGIITFISILNIINTMNTNITSKTKYLGIMRAIGMSDRQLTRMALAEAVVYTASGCVFGCAIGVLLQKNLTSFLISNWHFPVLQVVLIFIISILTAAFSIISPLRRIKARGISEVIGSL
>NZ_CP015756.1|WP_151553651.1|797440_798124_+|ABC-transporter-ATP-binding-protein
MDILIAKNLSKTYGKGEVKVDALKEVSFSVAKGEFISIVGPSGSGKSTLLNLLGALDSPTSGNVLLDGKDISTMKEKNLSVFRRRNIGFIFQAFNLIPELNVEENILLPLLLDYKKPDMQYIGELLDILGLSSRKHHLPNQLSGGQQQRVAIGRALSTRPAIMLADEPTGNLDTKNSKEVINLLKLSVKRYNQTLIMITHNSSFASFSDRVLNVEDGIVSELGRVKK
>NZ_CP015756.1|WP_071611534.1|796065_797310_+|HAMP-domain-containing-histidine-kinase
MRIFINHNIRKLFSMVSIILLCSILIAQVMVYFMTNQYKKEIITHDYAIAGYLYQQDITTDHIVPAFTSKKSIEDYTIGRKLLQPTGYTESINNKLLPEIQSFHEKFEILALILSFVVSLLLLTTLFIFFVWQDRKFEKASEDILSFMYGNKDIRFSDNEEGIVSQLFSSINVMATSLTAHITKEKQTKEFLKNTISDISHQLKTPLTALKMYNEIVQEENTNNVVVDSFNIKSCNQLERMEYLIQNLLKLSRLDADAIELAKSNCLMKDLLEGVVIGFSTRAKSENKSIMLMCNSHIMLNCDGDWILEAISNIIKNALDHTVSRNEVQILCDETPVLICITIKDNGSGIHPEDIHYIFKRFYRSRFSKEKDGTGIGLTLAKAIVEKHGGSITVESTLNQGTTFYLTFPKLTNL
>NZ_CP015756.1|WP_071611533.1|795369_796056_+|response-regulator-transcription-factor
MNTILLVEDDLSIIDGLEFSLRRNGFHIALARTVREGFLMLSDKKYDLLLLDLTLPDGSGFDICKKVRQSSDVPIIFLTASDEEVNIVMGLDIGGDDYITKPFKLNELISRIKALLRRYHIPSQEPIDLQSNDITIKLLESRVFKDSKEIELTSLEYRLLCLLMQNPNIVLTRNIILDRLWDSNGNFIDDNTLSVYVRRLRSKIEDNAENPKFLLTLRRLGYKWNVLK
>NZ_CP015756.1|WP_071611532.1|793930_795100_+|hypothetical-protein
MNNIKKILAMSLIVAQLSIPALAVNFTVPEFSILIGSSVYELQYANDSKNASAISEALANSEGDIYIQTSKGTWISNSTGLAVAKSLIDNITITSFNGKAIESTDFEDKAAMLMGSIKYKVNDANSIAFIGLIQSESKINNVKAENALLLAKGILNDDIFKKSYLEVKSDKAATLIADKKYKQAAEAYATCVKYGINIVNNTGYINALSKYADSELVKKTNLNEEDITNYYSVGDIDNDGTLEVAVFERNFSSEKYIPSNIQLFKYTNGEYSLFSKVQTKAERCNSINISKAKDDINGVFVSGIMGMHSGVQSLYIIKDGKLTPAIDDIYSLYPSKIKDIDGDGLLELSSLERDPKDPDSSDATSSKILTWYKWNGASGLTTVESGKAK
>NZ_CP015756.1|WP_071611531.1|792662_793493_+|malonyl-ACP-O-methyltransferase-BioC
MIDKKQLKLHFSKNASNYDEYAHVQKDMKNSLVKFMMQNNKNNTEVKNILEIGCGTGYLTSTLIDLFPHSHITAVDIAPGMITEIKSKIKNDSVDFICGDLEEMNFNNTYDIIISNATFQWFNHIHATIEKLYALLNPKGILCFSTFGKHTFCELNECFKKVREELSIKESVYSGQSFYSLNELSTLCKEATKNQRIDDVLVEGKEKFEYEYFNNCNDFFTSIKKTGANNSNKDNKCTSLTFIKKVIKYYNENFSENNKVKATYHCLFLKITSITL
>NZ_CP015756.1|WP_071611530.1|791905_792649_+|alpha/beta-hydrolase
MNRPYLIMLPGFGMNSCVWKRISEFLWKDFELIFIEWDNIDLLDGFKQKVINIIEEKQLSSFSLLGWSLGSLVAEEIVLDNLWNINNLILIGGTSSFIQHKEEGYNLGWNKRIVERMKSQLYKNPKATLFNFYDSLFSDEEKKKGYNTQFLKIMEDNIKIQSVDSLALELDYLIQKDLRNKLVDVNIPLLMIHGEEDRICPIEATLYIKNILTHSNIEVIKSGGHIPFFTNPHDCYYFISKFIKKHL
>NZ_CP015756.1|WP_071611529.1|790733_791909_+|8-amino-7-oxononanoate-synthase
MNYITDKLIKIKDKGLYRELRYIDTAQSPRVKIEGKDFILLGSNNYLGLCDDFRLKKAAIDAINKYGVGSGGSRLTTGSYDLHKQLEEKIASFKGTEASLVFNTGYMANVGIISALCDGGWVIFSDKLNHASIIDGYRLSGAKLIRYKHCDMNDLLNKINKYKGSNNLIVTDGVFSMDGDIAPLPEIVKIAKKFNMMTMVDDAHATGILGKNGSGTASYFGLDNEIDIIMGTLSKAVASEGGYVAGKKDLINYLINSARSFIYSTALSPSTIAVSIKALEIIEEDEERRVKLLKTSNWFQNQLKVAGFNVMETRTPIIPILIGEVDKAVEFSKILLSQGVYVPAIRPPSVPRGTSRLRISLMATHSKEDLEEALVKIKEIGKELKIIGGLL
>NZ_CP015756.1|WP_071611538.1|804398_805223_+|cupin-domain-containing-protein
MYNIYRPYPCPYYINAAMYTSTTDEMEYDSRFDSLPSSNTYIDGLIKLEDYGPEPFVVNIKEVTKQNNNYRTALWTGSHLQVTLMSINVGEDIGLEVHPGLDQFIRIEQGQGIVKMGDRKDMLDFQETVYDDFAFVIPAGKWHNLINTGYEPLKLYSIYAPPQHPRGTVHITKSDAQAAQEHRGDYYQNGQRAPRQTKEFTLSELAQYDGAMGRPAYVAVNGIVYDVSDISKWSGATHFGLTAGKDLSSQFESCHGVASKLDKLPRVGVLKGQL
>NZ_CP015756.1|WP_071614857.1|805286_806012_-|ferritin-like-domain-containing-protein
MSRVENPMMYNPQLQEALVGVKEAVQGEREDELFYDYLISVAPTREEKAIIISIRDDERKHNSLFRKIYKDFTGMEVSTAGENTFEKPNSYIDGIKKALFGELRAVEKYRAIRRALPMGPYRDVLFDIITDEIKHSSKYNYLFTLNNSLNIPSMNRRLVQDTSKFTPDDWVRYITPLVTRALAEAKEGINPEHLYQEFILSGVLVGLGKTPQEAIEQVEQWEKDGTSQLLAKSKMARGYNY
>NZ_CP015756.1|WP_071614858.1|806188_807043_-|SDR-family-oxidoreductase
MDNKILLTGITGNVGSAVVKYLKSIKIDFIAGVRDIERGKQQDDSIQYIHFDFQDTVTYETALHGVKKVFLVRPPQLTDVRGIFIPFIQKCKEVGVNQIVFLSLLGAEKNPFPPHHKIEKAIVESEIPYTFIRPSFFMQNLSTTHAEDIKERDDLFISSGKAKVSFIDTRDIGEIIGRTITEQGHKNKAYTITGSQAITYYKVADIMTRVLGRKITYSNPSLFKFRKDMIKRGIKKDFATIMMILYLTTKLGMANHVTNTAELLLKRKPRTIEDFIKDYIDIWQ
>NZ_CP015756.1|WP_071611539.1|807042_807459_-|MarR-family-transcriptional-regulator
MQNLSYLIIKASRHLKNKLDKALKEFDITAAQFSVIIQIHSSDHPITAAEIAQNLGSDRPTISGVIHRLEKKGIVLKIDNPDDKRSSYLEIYKESNKLINKIKVISDELTINIFSIYSKEETKLFTEMIFKLIEGTEE
>NZ_CP015756.1|WP_071611540.1|807844_808405_-|nitroreductase
MNICDCINNRRSIRMFTDQEVKSDVIDELIALGTKAATGSGNEAWGFVVITDKNEMKKISDETKKYLLKNFEKHPYFKQYESWLNNEKFNTFYNAPCLILIYGDTDSHWNVYDCTLAAGNIMNAAMEYKLGTCWIGFAEHVCGTEEFKLKYKIPANYNLVSSLIVGYPKVQLPSPSRKPAKIFFKR
>NZ_CP015756.1|WP_071611541.1|809129_809354_+|helix-turn-helix-transcriptional-regulator
MENKIKEYRKETNMTQQQLANTVSVSSRTIISLEKGQYNPSILLAYKIACVFNTTIEELYYLNKYSKENINENI
>NZ_CP015756.1|WP_071611542.1|809340_809754_+|hypothetical-protein
MKIYNKKGLILGVLSLLFAIGEVVMYFVDSSKSSIILLIILTVTGIEEITRSLNKKSSIEDKDSEDEREKFIFLKSGNITCIITFCLCTLFLLILSVQGVKWWGAQLVGPIVTTLSIVSATMVLVWFISYFFYNKKN
>NZ_CP015756.1|WP_071611543.1|809909_810434_-|hypothetical-protein
MNKKAKLKLCALTLATTLGALTALTSVQEVQAAVVSNGISSTATANTENIKIINEDTFEVDGATYSISTIANSIKDNSANEDTIQPMSIPTAAAKVAMKKGVKWLLKNKTLIMSKLPVGLRKYINIDKFVKAADKFIGISSGFEDLLHKVFRSWGMPEGVNKIITNIIMIAGPL
>NZ_CP015756.1|WP_071611544.1|811661_812045_-|type-II-toxin-antitoxin-system-death-on-curing-family-toxin
MKYISVEYILKLHEKLISTTGGSDGVRDIELLKSSIENSKVTFDGEDLYKSIEEKCSNICYCIINNHTFIDGNKRSGIYVMLLLLEYNEIKLSFTQNELIDLGLGIAKGELKQKNIYEWIKSHKNVS
>NZ_CP015756.1|WP_071611545.1|812041_812284_-|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin
MLLNSQKMVSISEANQNFSKIAKLVDEDKSVVIMKNNKPKYILLDFDEFSKVSISEEEKLETIADRILFENLDAFKELAK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP015756_1	1.1\|803695\|28\|NZ_CP015756\|CRISPRCasFinder	803695-803722	28	MN692959	Marine virus AFVG_117M52, complete genome	6320-6347	6	0.786
NZ_CP015756_1	1.1\|803695\|28\|NZ_CP015756\|CRISPRCasFinder	803695-803722	28	MF988720	Pseudoalteromonas phage J2-1, complete genome	73500-73527	6	0.786
NZ_CP015756_1	1.1\|803695\|28\|NZ_CP015756\|CRISPRCasFinder	803695-803722	28	CP034708	Salmonella enterica subsp. enterica serovar Waycross strain RSE24 plasmid pRSE24, complete sequence	9822-9849	7	0.75
NZ_CP015756_1	1.1\|803695\|28\|NZ_CP015756\|CRISPRCasFinder	803695-803722	28	NZ_CP022141	Salmonella enterica subsp. salamae serovar 55:k:z39 str. 1315K plasmid unnamed2, complete sequence	32453-32480	7	0.75
NZ_CP015756_1	1.1\|803695\|28\|NZ_CP015756\|CRISPRCasFinder	803695-803722	28	NZ_CP022136	Salmonella enterica subsp. diarizonae serovar 65:c:z str. SA20044251 plasmid unnamed1, complete sequence	23156-23183	7	0.75
NZ_CP015756_1	1.1\|803695\|28\|NZ_CP015756\|CRISPRCasFinder	803695-803722	28	NZ_CP029996	Salmonella enterica subsp. salamae strain SA20053897 plasmid pSA20053897.1, complete sequence	69607-69634	7	0.75
NZ_CP015756_1	1.1\|803695\|28\|NZ_CP015756\|CRISPRCasFinder	803695-803722	28	NZ_LS997975	Salmonella enterica subsp. enterica serovar Typhimurium strain D23580 isolate D23580_liv plasmid D23580_liv_pBT1	37331-37358	7	0.75
NZ_CP015756_1	1.1\|803695\|28\|NZ_CP015756\|CRISPRCasFinder	803695-803722	28	NZ_CP022036	Salmonella enterica subsp. enterica serovar Onderstepoort str. SA20060086 plasmid punamed1, complete sequence	6387-6414	7	0.75
NZ_CP015756_1	1.1\|803695\|28\|NZ_CP015756\|CRISPRCasFinder	803695-803722	28	CP053317	Salmonella enterica subsp. salamae serovar 6,8:a:z52 strain 62-3163 plasmid unnamed, complete sequence	81252-81279	7	0.75
NZ_CP015756_1	1.1\|803695\|28\|NZ_CP015756\|CRISPRCasFinder	803695-803722	28	NC_019335	Salmonella sp. 14 plasmid p14-95A, complete sequence	84724-84751	7	0.75
NZ_CP015756_1	1.1\|803695\|28\|NZ_CP015756\|CRISPRCasFinder	803695-803722	28	NC_019336	Salmonella sp. 40 plasmid p40-95A, complete sequence	69465-69492	7	0.75

1. spacer 1.1|803695|28|NZ_CP015756|CRISPRCasFinder matches to MN692959 (Marine virus AFVG_117M52, complete genome) position: , mismatch: 6, identity: 0.786

tactccattgttttttactccagctacc	CRISPR spacer
tttcccattgttttctactccagctatt	Protospacer
* ..**********.***********..

2. spacer 1.1|803695|28|NZ_CP015756|CRISPRCasFinder matches to MF988720 (Pseudoalteromonas phage J2-1, complete genome) position: , mismatch: 6, identity: 0.786

tactccattgttttttactccagctacc	CRISPR spacer
ttacgcattgttttttactccagttatc	Protospacer
*  . ******************.**.*

3. spacer 1.1|803695|28|NZ_CP015756|CRISPRCasFinder matches to CP034708 (Salmonella enterica subsp. enterica serovar Waycross strain RSE24 plasmid pRSE24, complete sequence) position: , mismatch: 7, identity: 0.75

tactccattgttttttactccagctacc	CRISPR spacer
acgtccattattttttactccagcgttc	Protospacer
   ******.**************  .*

4. spacer 1.1|803695|28|NZ_CP015756|CRISPRCasFinder matches to NZ_CP022141 (Salmonella enterica subsp. salamae serovar 55:k:z39 str. 1315K plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.75

tactccattgttttttactccagctacc	CRISPR spacer
acgtccattattttttactccagcgttc	Protospacer
   ******.**************  .*

5. spacer 1.1|803695|28|NZ_CP015756|CRISPRCasFinder matches to NZ_CP022136 (Salmonella enterica subsp. diarizonae serovar 65:c:z str. SA20044251 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.75

tactccattgttttttactccagctacc	CRISPR spacer
acgtccattattttttactccagcgttc	Protospacer
   ******.**************  .*

6. spacer 1.1|803695|28|NZ_CP015756|CRISPRCasFinder matches to NZ_CP029996 (Salmonella enterica subsp. salamae strain SA20053897 plasmid pSA20053897.1, complete sequence) position: , mismatch: 7, identity: 0.75

tactccattgttttttactccagctacc	CRISPR spacer
acgtccattattttttactccagcgttc	Protospacer
   ******.**************  .*

7. spacer 1.1|803695|28|NZ_CP015756|CRISPRCasFinder matches to NZ_LS997975 (Salmonella enterica subsp. enterica serovar Typhimurium strain D23580 isolate D23580_liv plasmid D23580_liv_pBT1) position: , mismatch: 7, identity: 0.75

tactccattgttttttactccagctacc	CRISPR spacer
acgtccattattttttactccagcgttc	Protospacer
   ******.**************  .*

8. spacer 1.1|803695|28|NZ_CP015756|CRISPRCasFinder matches to NZ_CP022036 (Salmonella enterica subsp. enterica serovar Onderstepoort str. SA20060086 plasmid punamed1, complete sequence) position: , mismatch: 7, identity: 0.75

tactccattgttttttactccagctacc	CRISPR spacer
acgtccattattttttactccagcgttc	Protospacer
   ******.**************  .*

9. spacer 1.1|803695|28|NZ_CP015756|CRISPRCasFinder matches to CP053317 (Salmonella enterica subsp. salamae serovar 6,8:a:z52 strain 62-3163 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.75

tactccattgttttttactccagctacc	CRISPR spacer
acgtccattattttttactccagcgttc	Protospacer
   ******.**************  .*

10. spacer 1.1|803695|28|NZ_CP015756|CRISPRCasFinder matches to NC_019335 (Salmonella sp. 14 plasmid p14-95A, complete sequence) position: , mismatch: 7, identity: 0.75

tactccattgttttttactccagctacc	CRISPR spacer
acgtccattattttttactccagcgttc	Protospacer
   ******.**************  .*

11. spacer 1.1|803695|28|NZ_CP015756|CRISPRCasFinder matches to NC_019336 (Salmonella sp. 40 plasmid p40-95A, complete sequence) position: , mismatch: 7, identity: 0.75

tactccattgttttttactccagctacc	CRISPR spacer
acgtccattattttttactccagcgttc	Protospacer
   ******.**************  .*

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3000408 : 3031979

Clostridium_phage(73.08%)

capsid,holin,tail,portal

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084647595.1\|3000408_3001620_-	MBL fold metallo-hydrolase	Q332B9	Clostridium_botulinum_C_phage	8.9e-102	51.5
WP_071613333.1\|3001873_3002404_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_071613334.1\|3002408_3003749_-	AAA family ATPase	Q2P9X8	Enterobacteria_phage	5.2e-10	28.1
WP_071613335.1\|3003983_3004220_-	helix-turn-helix domain-containing protein	A0A2H4JBQ8	uncultured_Caudovirales_phage	9.7e-05	37.7
WP_169829599.1\|3004397_3004535_-	hypothetical protein	NA	NA	NA	NA
WP_071613336.1\|3004680_3005226_-	hypothetical protein	NA	NA	NA	NA
WP_071613337.1\|3005295_3006180_-	N-acetylmuramoyl-L-alanine amidase	S5M947	Bacillus_phage	6.9e-11	34.2
WP_071614981.1\|3006282_3007044_-	DNA adenine methylase	A0A2H4J7L8	uncultured_Caudovirales_phage	6.8e-116	78.9
WP_084647467.1\|3007161_3007620_-\|holin	phage holin family protein	A0A0A7S099	Clostridium_phage	6.0e-35	57.9
WP_071613338.1\|3007691_3008345_-	hypothetical protein	NA	NA	NA	NA
WP_071613339.1\|3008365_3009442_-	signal peptidase II	A0A0A7RU66	Clostridium_phage	1.0e-101	53.8
WP_071613340.1\|3009453_3010449_-	hypothetical protein	A0A0A7RW91	Clostridium_phage	1.8e-121	64.5
WP_071613341.1\|3010460_3010715_-	hypothetical protein	A0A0A7S0T0	Clostridium_phage	2.0e-32	73.8
WP_071613342.1\|3010720_3012553_-	hypothetical protein	A0A0A7RU09	Clostridium_phage	4.3e-108	53.6
WP_071613343.1\|3012564_3013806_-	hypothetical protein	A0A0A7RU28	Clostridium_phage	5.2e-182	75.6
WP_071613344.1\|3013818_3015021_-	hypothetical protein	A0A0A7RU61	Clostridium_phage	1.7e-41	48.4
WP_071613346.1\|3015966_3016296_-	hypothetical protein	NA	NA	NA	NA
WP_071613347.1\|3016308_3017394_-	hypothetical protein	NA	NA	NA	NA
WP_071613348.1\|3017383_3017794_-	hypothetical protein	NA	NA	NA	NA
WP_071613349.1\|3017806_3019975_-\|tail	phage tail tape measure protein	Q9G097	Lactococcus_phage	6.4e-111	47.4
WP_071613350.1\|3020020_3020347_-	hypothetical protein	NA	NA	NA	NA
WP_071613351.1\|3020374_3020608_-	hypothetical protein	A0A0A7RW80	Clostridium_phage	4.0e-11	48.6
WP_071614983.1\|3020561_3020993_-	esterase	A0A0A7S0S0	Clostridium_phage	2.1e-42	64.6
WP_071613352.1\|3021103_3021985_-	hypothetical protein	A0A0A7RTZ9	Clostridium_phage	1.3e-73	51.0
WP_071613353.1\|3021986_3022409_-	hypothetical protein	A0A0A7RU17	Clostridium_phage	5.2e-49	64.0
WP_071613354.1\|3022416_3022761_-	hypothetical protein	A0A0A7RU51	Clostridium_phage	7.0e-36	63.6
WP_071613355.1\|3022765_3023131_-	hypothetical protein	A0A0A7RW73	Clostridium_phage	9.3e-39	65.8
WP_071613356.1\|3023130_3023421_-	hypothetical protein	A0A0A7S0R4	Clostridium_phage	6.9e-29	64.9
WP_152025094.1\|3023423_3023630_-	hypothetical protein	NA	NA	NA	NA
WP_071613358.1\|3023713_3024742_-\|capsid	major capsid protein	A0A1J1GG50	Clostridium_phage	2.8e-149	75.4
WP_152025082.1\|3024760_3025102_-	hypothetical protein	A0A2H4J872	uncultured_Caudovirales_phage	5.5e-33	66.4
WP_071613360.1\|3025110_3025752_-	phage scaffold protein	A0A0A7RW68	Clostridium_phage	3.7e-46	52.2
WP_084647468.1\|3025798_3026017_-	hypothetical protein	NA	NA	NA	NA
WP_071613361.1\|3026152_3026581_-	hypothetical protein	NA	NA	NA	NA
WP_071613362.1\|3026652_3027588_-	hypothetical protein	A0A0A7RU06	Clostridium_phage	2.0e-125	67.6
WP_071613363.1\|3027613_3029071_-\|portal	phage portal protein	A0A0A7RW62	Clostridium_phage	3.4e-180	64.9
WP_071613365.1\|3030955_3031162_-	hypothetical protein	NA	NA	NA	NA
WP_071613366.1\|3031418_3031979_-	recombinase family protein	M9Q1K0	Clostridium_phage	2.5e-59	61.6

DBSCAN-SWA_2

3040147 : 3046797

Clostridium_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071613376.1\|3040147_3040738_-	molybdopterin-guanine dinucleotide biosynthesis protein A	A0A2D1GQA7	Lysinibacillus_phage	3.4e-30	42.4
WP_071613377.1\|3040740_3041169_-	hypothetical protein	NA	NA	NA	NA
WP_071613378.1\|3041261_3041870_-	hypothetical protein	A0A0A8WEV5	Clostridium_phage	7.5e-41	42.0
WP_071614985.1\|3041900_3042326_-	single-stranded DNA-binding protein	Q8SBL5	Clostridium_phage	2.9e-23	42.0
WP_169829603.1\|3042352_3042505_-	hypothetical protein	NA	NA	NA	NA
WP_071613379.1\|3042507_3043221_-	MBL fold metallo-hydrolase	D7RWG0	Brochothrix_phage	2.9e-44	42.4
WP_071613380.1\|3043221_3043986_-	phage recombination protein Bet	A8ATK8	Listeria_phage	7.9e-48	45.1
WP_071613381.1\|3043986_3044259_-	hypothetical protein	NA	NA	NA	NA
WP_071613382.1\|3044279_3044582_-	hypothetical protein	NA	NA	NA	NA
WP_071613384.1\|3046542_3046797_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A0K2CZ86	Paenibacillus_phage	6.7e-20	60.3

DBSCAN-SWA_3

3230617 : 3240676

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071613570.1\|3230617_3232120_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	2.2e-62	45.4
WP_071613571.1\|3232134_3232743_-	phosphoribosylglycinamide formyltransferase	NA	NA	NA	NA
WP_071613572.1\|3232730_3233729_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.0e-66	45.1
WP_084647599.1\|3233738_3235139_-	amidophosphoribosyltransferase	A0A1B1ISH6	uncultured_Mediterranean_phage	5.0e-56	33.4
WP_071613574.1\|3235260_3235965_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3FUQ7	Synechococcus_phage	2.7e-42	41.2
WP_071613575.1\|3236012_3236492_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	1.7e-27	47.4
WP_071613576.1\|3236851_3240676_-	phosphoribosylformylglycinamidine synthase	A6N228	Microbacterium_phage	2.7e-27	25.0

DBSCAN-SWA_4

3508504 : 3550689

Clostridium_phage(44.44%)

terminase,portal,integrase,protease,holin,capsid,tail

attL 3514174:3514194|attR 3553311:3553331

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071613803.1\|3508504_3510697_-	serine hydrolase	A0A2P1JQM9	Mycobacterium_phage	2.2e-05	24.2
WP_071615020.1\|3510841_3513343_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_071613804.1\|3513361_3514048_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.4e-35	38.0
3514174:3514194	attL	NA	NA	NA	NA
WP_169829614.1\|3514367_3514541_-	hypothetical protein	NA	NA	NA	NA
WP_071613805.1\|3514804_3514957_-	ribbon-helix-helix domain-containing protein	A0A0A7RUX5	Clostridium_phage	5.2e-12	76.0
WP_169829615.1\|3515111_3515279_+	helix-turn-helix transcriptional regulator	A0A0A7RWZ4	Clostridium_phage	1.9e-07	52.9
WP_152025096.1\|3515328_3515970_-	DUF3862 domain-containing protein	U5J9H5	Bacillus_phage	2.3e-16	53.2
WP_071613806.1\|3516118_3516670_-	hypothetical protein	D9ZNF4	Clostridium_phage	5.6e-11	35.4
WP_071613807.1\|3516710_3517697_-	N-acetylmuramoyl-L-alanine amidase	Q8SBN4	Clostridium_phage	1.1e-36	50.3
WP_071613808.1\|3517696_3518101_-\|holin	phage holin family protein	A0A0A7S099	Clostridium_phage	3.6e-31	50.7
WP_071613809.1\|3518389_3518788_-	hypothetical protein	NA	NA	NA	NA
WP_169829547.1\|3518759_3518906_-	hypothetical protein	NA	NA	NA	NA
WP_071613810.1\|3518958_3519471_-	hypothetical protein	NA	NA	NA	NA
WP_071613811.1\|3519827_3520829_-	acyltransferase family protein	S5FNR8	Shigella_phage	1.7e-05	34.1
WP_071613812.1\|3520930_3523663_-	hypothetical protein	NA	NA	NA	NA
WP_071613813.1\|3523690_3523939_-	hypothetical protein	NA	NA	NA	NA
WP_071613814.1\|3523954_3525679_-\|tail	phage tail protein	A0A1B2APX2	Phage_Wrath	3.2e-36	29.7
WP_071613815.1\|3525678_3526383_-\|tail	phage tail family protein	C5IUK4	Streptococcus_phage	4.9e-12	27.1
WP_071613816.1\|3526383_3530385_-	hypothetical protein	A8ATH6	Listeria_phage	6.2e-35	42.3
WP_071613817.1\|3530658_3531006_-	hypothetical protein	NA	NA	NA	NA
WP_169829616.1\|3531042_3531879_-	hypothetical protein	F6K8R6	Clostridium_phage	2.0e-15	56.5
WP_071613818.1\|3531892_3532207_-	hypothetical protein	NA	NA	NA	NA
WP_071613819.1\|3532193_3532592_-	hypothetical protein	A0A1S5SFC4	Streptococcus_phage	2.9e-09	36.1
WP_071613820.1\|3532588_3532918_-	hypothetical protein	NA	NA	NA	NA
WP_071613821.1\|3532914_3533226_-	hypothetical protein	NA	NA	NA	NA
WP_071615022.1\|3533241_3534432_-\|capsid	phage major capsid protein	E2ELI5	Clostridium_phage	7.2e-72	40.3
WP_071613822.1\|3534437_3535184_-\|protease	Clp protease ClpP	A0A0B5A796	Paenibacillus_phage	1.0e-36	44.6
WP_152025097.1\|3535202_3536372_-\|portal	phage portal protein	E2ELI3	Clostridium_phage	1.1e-61	37.5
WP_071613824.1\|3536449_3536935_-	hypothetical protein	A0A0K2CP90	Brevibacillus_phage	9.0e-05	31.4
WP_071613825.1\|3536983_3538654_-\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	1.1e-107	40.5
WP_071613826.1\|3538637_3538943_-\|terminase	P27 family phage terminase small subunit	NA	NA	NA	NA
WP_071613827.1\|3539138_3539510_-	hypothetical protein	NA	NA	NA	NA
WP_071613828.1\|3539514_3539826_-	HNH endonuclease	D2XR61	Bacillus_phage	7.7e-10	35.6
WP_071613829.1\|3539825_3540350_-	hypothetical protein	NA	NA	NA	NA
WP_071613830.1\|3540519_3541002_-	Xaa-His dipeptidase	NA	NA	NA	NA
WP_071613831.1\|3541275_3541914_-\|integrase	tyrosine-type recombinase/integrase	F6K8Q2	Clostridium_phage	3.8e-27	41.9
WP_071613832.1\|3542125_3542572_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_071613833.1\|3542706_3542937_-	hypothetical protein	NA	NA	NA	NA
WP_071613834.1\|3542973_3543216_-	hypothetical protein	NA	NA	NA	NA
WP_071613835.1\|3543251_3543539_-	hypothetical protein	NA	NA	NA	NA
WP_071613836.1\|3543572_3543800_-	hypothetical protein	NA	NA	NA	NA
WP_071613837.1\|3543885_3544287_-	single-stranded DNA-binding protein	A0A0A8WIG9	Clostridium_phage	2.4e-27	46.8
WP_071613838.1\|3544283_3544469_-	hypothetical protein	NA	NA	NA	NA
WP_071613839.1\|3544468_3544825_-	hypothetical protein	A0A2K9V381	Faecalibacterium_phage	3.0e-34	65.4
WP_071613840.1\|3544818_3544998_-	hypothetical protein	NA	NA	NA	NA
WP_071615023.1\|3545171_3545924_-	ATP-binding protein	M9Q1J4	Clostridium_phage	8.3e-50	46.2
WP_071613841.1\|3545874_3546669_-	phage replisome organizer N-terminal domain-containing protein	A0A1S5SAV1	Streptococcus_phage	3.4e-33	49.6
WP_071613842.1\|3546702_3547266_-	hypothetical protein	Q332D2	Clostridium_botulinum_C_phage	1.0e-44	51.4
WP_071613843.1\|3547342_3547567_-	hypothetical protein	NA	NA	NA	NA
WP_071613844.1\|3547566_3547752_-	hypothetical protein	NA	NA	NA	NA
WP_071613845.1\|3547741_3547957_-	hypothetical protein	NA	NA	NA	NA
WP_071613846.1\|3547958_3549119_-	hypothetical protein	NA	NA	NA	NA
WP_071613847.1\|3549347_3549536_-	hypothetical protein	NA	NA	NA	NA
WP_071613848.1\|3549706_3550210_-	hypothetical protein	NA	NA	NA	NA
WP_152025098.1\|3550209_3550689_-	hypothetical protein	A0A0A7RVQ9	Clostridium_phage	3.4e-41	58.4
3553311:3553331	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage