CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP015943	Legionella pneumophila strain C9_S plasmid unamed2, complete sequence	0 crisprs	csa3	0
NZ_CP015942	Legionella pneumophila strain C9_S plasmid unnamed1, complete sequence	0 crisprs	NA	0
NZ_CP015941	Legionella pneumophila strain C9_S chromosome, complete genome	1 crisprs	RT,PD-DExK,DEDDh,DinG,cas3,WYL,csa3	5

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP015941_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015941_1

2688517-2688683

Orphan

Consensus_repeat	Method
AAATTTACCGCGATAACAGTAATTT	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP015941_1

>merge|NZ_CP015941|1|2688517-2688683|CRISPRCasFinder
AAATTTACCGCGATAACAGTAATTTTATGAGTTTAACATAAATAAATACACTGAAAATTAGAAAGCCGAGTAAATTTACCGCCATAACAGTAATTTATGGGGAATTAATGCAAAAAAATGCAATAATAACTTTATTTTAATCATTTTTACTGCTATAACAGTAATAT

>NZ_CP015941|1|1|2688517-2688683|CRISPRCasFinder
AAATTTACCGCGATAACAGTAATTT	TATGAGTTTAACATAAATAAATACACTGAAAATTAGAAAGCCGAGT
AAATTTACCGCCATAACAGTAATTT	ATGGGGAATTAATGCAAAAAAATGCAATAATAACTTTATTTTAATC
ATTTTTACTGCTATAACAGTAATAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015941.1\|WP_027224431.1\|2686692_2687166_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015941.1\|WP_027224426.1\|2692896_2693841_+\|flippase-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|377103
NZ_CP015941.1\|WP_042233675.1\|2683856_2684564_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|381179
NZ_CP015941.1\|WP_014842401.1\|2684614_2684812_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015941.1\|WP_106202151.1\|2694105_2695887_+\|heavy-metal-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319844
NZ_CP015941.1\|WP_014844541.1\|2699256_2700165_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP015941.1\|WP_027224433.1\|2682520_2683867_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015941.1\|WP_027224435.1\|2678813_2680022_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|340863
NZ_CP015941.1\|WP_027224432.1\|2684831_2686058_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340887
NZ_CP015941.1\|WP_027224429.1\|2688928_2689237_+\|HipA-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|274416
NZ_CP015941.1\|WP_014844539.1\|2696510_2697410_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015941.1\|WP_027224427.1\|2690294_2692862_+\|magnesium-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319772
NZ_CP015941.1\|WP_015961553.1\|2681716_2682352_-\|flavin-reductase-family-protein	unknown	unknown	gnl\|CDD\|224766
NZ_CP015941.1\|WP_027224430.1\|2687344_2688262_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176109
NZ_CP015941.1\|WP_027224434.1\|2680054_2680315_-\|Rieske-2Fe-2S-domain-containing-protein	unknown	unknown	gnl\|CDD\|239560
NZ_CP015941.1\|WP_014844538.1\|2696189_2696483_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|277194
NZ_CP015941.1\|WP_015961552.1\|2680317_2681712_-\|iron-containing-redox-enzyme-family-protein	unknown	unknown	gnl\|CDD\|379634
NZ_CP015941.1\|WP_014844540.1\|2697571_2699011_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015941.1\|WP_027224428.1\|2689233_2690166_+\|HipA-domain-containing-protein	unknown	unknown	gnl\|CDD\|377920
NZ_CP015941.1\|WP_013101792.1\|2688704_2688932_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|213767

Protein	Function_ID	Function_description	E-value
NZ_CP015941.1\|WP_027224426.1\|2692896_2693841_+\|flippase-like-domain-containing-protein	gnl\|CDD\|377103	pfam03706, LPG_synthase_TM, Lysylphosphatidylglycerol synthase TM region. LPG_synthase_TM is the N-terminal region of this family of bacterial phosphatidylglycerol lysyltransferases. The function of the family is to add lysyl groups to membrane lipids, and this region is the transmembrane domain of 7xTMs. In order to counteract attack by membrane-damaging external cationic antimicrobial molecules - from host immune systems, bacteriocins, defencins, etc - bacteria modify their anionic membrane phosphatidylglycerol with positively-charged L-lysine; this results in repulsion of the foreign cationic peptides.	6.70438e-18
NZ_CP015941.1\|WP_106202151.1\|2694105_2695887_+\|heavy-metal-translocating-P-type-ATPase	gnl\|CDD\|319844	cd07544, P-type_ATPase_HM, P-type heavy metal-transporting ATPase; uncharacterized subfamily. Uncharacterized subfamily of the heavy metal-transporting ATPases (Type IB ATPases) which transport heavy metal ions (Cu(+), Cu(2+), Zn(2+), Cd(2+), Co(2+), etc.) across biological membranes. The characteristic N-terminal heavy metal associated (HMA) domain of this group is essential for the binding of metal ions. This subclass of P-type ATPase is also referred to as CPx-type ATPases because their amino acid sequences contain a characteristic CPC or CPH motif associated with a stretch of hydrophobic amino acids and N-terminal ion-binding sequences. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP015941.1\|WP_042233675.1\|2683856_2684564_-\|hypothetical-protein	gnl\|CDD\|381179	cd19916, OphMA_like, tetrapyrrole methylase family protein similar to Omphalotus olearius omphalotin methyltransferase (OphMA) and Dendrothele bispora dbOphMA. OphMA, is the precursor protein of the fungal cyclic peptide Omphalotin A. Omphalotin A is a potent nematicide, having 9 out of 12 of its residues methylated at the backbone amide. Omphalotin A derives from the C-terminus of OphMA (also known as OphA). OphMA catalyzes the automethylation of its own C-terminus using S-adenosyl methionine (SAM); this C terminus is subsequently released and macrocyclized by the protease OphP to give Omphalotin A.	5.61241e-84
NZ_CP015941.1\|WP_014844541.1\|2699256_2700165_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.67439e-50
NZ_CP015941.1\|WP_027224428.1\|2689233_2690166_+\|HipA-domain-containing-protein	gnl\|CDD\|377920	pfam07804, HipA_C, HipA-like C-terminal domain. The members of this family are similar to a region close to the C-terminus of the HipA protein expressed by various bacterial species. This protein is known to be involved in high-frequency persistence to the lethal effects of inhibition of either DNA or peptidoglycan synthesis. When expressed alone, it is toxic to bacterial cells, but it is usually tightly associated with HipB, and the HipA-HipB complex may be involved in autoregulation of the hip operon. The hip proteins may be involved in cell division control and may interact with cell division genes or their products.	1.81154e-59
NZ_CP015941.1\|WP_027224435.1\|2678813_2680022_-\|hypothetical-protein	gnl\|CDD\|340863	cd06173, MFS_MefA_like, Macrolide efflux protein A and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Streptococcus pyogenes macrolide efflux protein A (MefA) and similar transporters, many of which remain uncharacterized. Some members may be multidrug resistance (MDR) transporters, which are drug/H+ antiporters (DHAs) that mediate the efflux of a variety of drugs and toxic compounds, conferring resistance to these compounds. MefA confers resistance to 14-membered macrolides including erythromycin and to 15-membered macrolides. It functions as an efflux pump to regulate intracellular macrolide levels. The MefA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.7029e-13
NZ_CP015941.1\|WP_027224432.1\|2684831_2686058_-\|MFS-transporter	gnl\|CDD\|340887	cd17329, MFS_MdtH_MDR_like, Multidrug resistance protein MdtH and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli MdtH and similar multidrug resistance (MDR) transporters from bacteria and archaea, many of which remain uncharacterized. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtH confers resistance to norfloxacin and enoxacin. MdtH-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	9.6053e-13
NZ_CP015941.1\|WP_027224429.1\|2688928_2689237_+\|HipA-N-terminal-domain-containing-protein	gnl\|CDD\|274416	TIGR03071, couple_hipA, HipA N-terminal domain. Although Pfam models pfam07805 and pfam07804 currently are called HipA-like N-terminal domain and HipA-like C-terminal domain, respectively, those models hit the central and C-terminal regions of E. coli HipA but not the N-terminal region. This model hits the N-terminal region of HipA and its homologs, and also identifies proteins that lack match regions for pfam07804 and pfam07805.	5.37248e-44
NZ_CP015941.1\|WP_027224427.1\|2690294_2692862_+\|magnesium-translocating-P-type-ATPase	gnl\|CDD\|319772	cd02077, P-type_ATPase_Mg, magnesium transporting ATPase (MgtA), similar to Escherichia coli MgtA and Salmonella typhimurium MgtA. MgtA is a membrane protein which actively transports Mg(2+) into the cytosol with its electro-chemical gradient rather than against the gradient as other cation transporters do. It may act both as a transporter and as a sensor for Mg(2+). In Salmonella typhimurium and Escherichia coli, the two-component system PhoQ/PhoP regulates the transcription of the mgtA gene by sensing Mg(2+) concentrations in the periplasm. MgtA is activated by cardiolipin and it highly sensitive to free magnesium in vitro. It consists of a transmembrane domain and three cytosolic domains: nucleotide-binding domain, phosphorylation domain and actuator domain, and belongs to the P-type ATPase type III subfamily. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP015941.1\|WP_015961553.1\|2681716_2682352_-\|flavin-reductase-family-protein	gnl\|CDD\|224766	COG1853, COG1853, Conserved protein/domain typically associated with flavoprotein oxygenases, DIM6/NTAB family [General function prediction only].	5.31538e-37
NZ_CP015941.1\|WP_027224430.1\|2687344_2688262_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176109	cd08417, PBP2_Nitroaromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators that involved in the catabolism of nitroaromatic/naphthalene compounds and that of related regulators; contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of dinitrotoluene and similar compounds, such as DntR, NahR, and LinR. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. Also included are related LysR-type regulators clustered together in phylogenetic trees, including NodD, ToxR, LeuO, SyrM, TdcA, and PnbR. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.68537e-55
NZ_CP015941.1\|WP_027224434.1\|2680054_2680315_-\|Rieske-2Fe-2S-domain-containing-protein	gnl\|CDD\|239560	cd03478, Rieske_AIFL_N, AIFL (apoptosis-inducing factor like) family, N-terminal Rieske domain; members of this family show similarity to human AIFL, containing an N-terminal Rieske domain and a C-terminal pyridine nucleotide-disulfide oxidoreductase domain (Pyr_redox). The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer. AIFL shares 35% homology with human AIF (apoptosis-inducing factor), mainly in the Pyr_redox domain. AIFL is predominantly localized to the mitochondria. AIFL induces apoptosis in a caspase-dependent manner.	1.28129e-10
NZ_CP015941.1\|WP_014844538.1\|2696189_2696483_-\|hypothetical-protein	gnl\|CDD\|277194	cd15841, SNARE_Qc, SNARE motif, subgroup Qc. SNARE (soluble N-ethylmaleimide-sensitive factor attachment protein receptor) proteins consist of coiled-coil helices (called SNARE motifs) which mediate the interactions between SNARE proteins, and a transmembrane domain. The SNARE complex mediates membrane fusion, important for trafficking of newly synthesized proteins, recycling of pre-existing proteins and organelle formation. SNARE proteins are classified into four groups, Qa-, Qb-, Qc- and R-SNAREs, depending on whether the residue in the hydrophilic center layer of the four-helical bundle is a glutamine (Q) or arginine (R). Qc-, as well as Qa- and Qb-SNAREs, are localized to target organelle membranes, while R-SNARE is localized to vesicle membranes. They form unique complexes consisting of one member of each subgroup, that mediate fusion between a specific type of vesicles and their target organelle. Their SNARE motifs form twisted and parallel heterotetrameric helix bundles. Examples for members of the Qc SNAREs are C-terminal domains of SNAP23 and SNAP25, syntaxin 8, syntaxin 6, and Bet1.	1.22334e-13
NZ_CP015941.1\|WP_015961552.1\|2680317_2681712_-\|iron-containing-redox-enzyme-family-protein	gnl\|CDD\|379634	pfam14518, Haem_oxygenas_2, Iron-containing redox enzyme. The CADD, Chlamydia protein associating with death domains, crystal structure reveals a dimer of seven-helical bundles. Each bundle contains a di-iron centre adjacent to an internal cavity that forms an active site similar to that of methane mono-oxygenase hydrolase.	1.15645e-28
NZ_CP015941.1\|WP_013101792.1\|2688704_2688932_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|213767	TIGR03070, couple_hipB, transcriptional regulator, y4mF family. Members of this family belong to a clade of helix-turn-helix DNA-binding proteins, among the larger family pfam01381 (HTH_3; Helix-turn-helix). Members are similar in sequence to the HipB protein of E. coli. Genes for members of the seed alignment for this protein family were found to be closely linked to genes encoding proteins related to HipA. The HibBA operon appears to have some features in common with toxin-antitoxin post-segregational killing systems. [Regulatory functions, DNA interactions].	1.63778e-24

>NZ_CP015941.1|WP_027224430.1|2687344_2688262_+|LysR-family-transcriptional-regulator
MDKLNLNLLRALYALLTCRHLTLASKKMGISQSSMSIYLKQLREHFHDDLLVRGQGNIMQLTPLANSLIGKARQALSLIETLFNTIETFNPLISERSFSIGMTDLMSILLTPSLIKRLEQEAPGVKLNIKHPSYLNTVEVFESGDIDLMIGMFERVPEGLKQQKLFQDEAVIVGGNNHPGIQKGKICIEELFKYPLIQFSLRETPFYNYFDRYLRQLGHDKRVSISLGQGIMPLFVLTDSHYLTLSIRKVAEKLSHLIPLSIASVPFEVDSFNCYQYWHQKDDADPGHRWLREMVLSIAKKSYLK
>NZ_CP015941.1|WP_027224431.1|2686692_2687166_+|hypothetical-protein
MRSRTEKLSSKRSIINHDHLITDEACMIGIYREGGDLSIYAESSEGIEHFSINRGNSLDMVILPHTLVGTWGHHQLLRTVEQAAQIRALRIRSHDYIEQSVTRKELEQFKEVFMLACKEEISNQPEIEDYLQTALGKLHGEPEMTYKPKFTEQCSIL
>NZ_CP015941.1|WP_027224432.1|2684831_2686058_-|MFS-transporter
MRNFFKNISALYLDVPKLTKTLLPIIILEHLVASFCLNISAYFKKVNYFQYEQIGEFISCYYWGCLFGSLIGGALTLYYKTSKISGWGLMLLGVCLFGLMNSISLWLIAISMFLVGFIGTITATANLTSLIRSVKDNEKLKLKVISLDLIIFNLCFSFVTFVLLDLSPLYILKYVQIMICLLVFVGIGSLIFYQDSIFNPPKLGSLGFKIILPERKQEFMLLMSMVLFFGLIFSMVKVVFAPTLIERFGSNMMSVIAASINPWVVFLIQPLIVGRIKNSNSIWFLGIGGLIVGLSYFMFGMVNSFELTAIVLVLLTFGEMMFGPLSKHFNIQLYRSGQEGVATGIWRAVFLGSGAIGPGLSGYVAEYYGTYVVWDCCALLGLLCFVFSLYLRKIQIKMPYSKLVLDNQ
>NZ_CP015941.1|WP_014842401.1|2684614_2684812_-|hypothetical-protein
MNTYEKLVYLATEPIDNKVVLCDKKGSKLKSSLAVQEELKDEFIHADLSIDIRRACETHLSFVLR
>NZ_CP015941.1|WP_042233675.1|2683856_2684564_-|hypothetical-protein
MTLEVQSVIQKCDCVIYLVNEPAIKRWIDENSKKAISLDAIYFSFQERKEAYQAICQEVINIVTKNQNTCFIIYGHPLILSNSAEQLIKEIKEESLDLEIEILPGISSIDTLLCDLCIDPGNGGLQAFEATEFINTNYKINTNSHLILWQIGVVGVKSIIQNDKDLVDSIERKIAIFQLQRKLLDWYNETHPIVLYVASIYPQIPCEKFDICLSNLDKVNIPRLATAYIKPDLIP
>NZ_CP015941.1|WP_027224433.1|2682520_2683867_+|hypothetical-protein
MFTTIDNNEGIVQTYWTEVRNKFEKADPYLSKLIDNVSPDKLPIYLLYFPYGMLKGDTKSSYMPLLDGGYIKLSDTGVDKKIVNDLGYGMYSSPLGMVLDKFIEYFIEFDDKIFTYYISGPGTIFNTGMLLKNKNSRNYSPNGVLKATAGARTAFMLPSINSHNGINKLSKLVNQDLTTPRNHNDHFELFKAINQHDNSNWKVCLAYFSEKWVKHLLTDPAWVEIKNYMLEAKNKNDSFSVNSAYYDIFYSKAQKDRNLRTSSPYLTNTAIHLIKIALGEHPGYVPATTANFLPIESIQKFISESFQLKRTPTIMVPHSLVYEKEKEPVYYSLQNPTTPHFLTKKNEKVTANQEIDIIYRILNKFIEEMSKQDSLLAGTVFSDISDHIRFNYFHNYPPKDSNLINNSRQLSKLDPRFNFSSYKNGESEFCFEGQFLRGCIQIQPNVKE
>NZ_CP015941.1|WP_015961553.1|2681716_2682352_-|flavin-reductase-family-protein
MFLQTSQKLPKGMFKACVVPRPIAWIGTKDSEGNHNLSPFSFFNIVCEEPPMVMFATTGAHNSGGAKDTLKNVEDTKEFTVNLVSYGSKEAMNITSLDFSRGISEFDMAEVDHLPSRLIQTPRVKESPISLECVYHESIQLPIPIHSNLINRMVIGKVVGIHLKPEILTKDKRIDTNKLNLIARVGYNSYTKVKAHFDLNRPCGCCNKLMD
>NZ_CP015941.1|WP_015961552.1|2680317_2681712_-|iron-containing-redox-enzyme-family-protein
MNKIINKLEANTPSKHIQQHFKELLNIYLHNPCFTDAAFLNPPNPYVRPLRTSDTLNINYDSAVALPEVYTNKNLIINKLLLNIYEQDLLFLANGNACEAKKDFANFYNPYYTAIGKALLPKLEQLAFNFLKDEIEIIGNWTKPKLLDYLINTILEQEKETSELCEAIVGSNNPIRAAKMLLIQMAPDFLSEASAMARALPGSFGIEQSELMKVFIDEYGYGVHETKHSTLFEATMLSANLNPTIHYYYNDYLATSLMLVNYFHCICKNKSDWFKYIGTLYYTEASIPHFNKQISKTLKNILPNINTKYFDEHVHIDKHHRRMVLEKIIATSIDKYGEEIIEDILFGFEAFKLLQNLADTDLAKQIQFSDQLDESYFPSNYTLLAESLTFNETELEITSAHLHADDELFQVTRGELIFYPNSLSPIILKANHRIVIPKGRLHSTVSQSANTQYVVQPIEISTGA
>NZ_CP015941.1|WP_027224434.1|2680054_2680315_-|Rieske-2Fe-2S-domain-containing-protein
MINKKHILNNRYFCKNDENYFIVKLNNKRFAIPDKCPHRGGPLSLGNICRESQRIQCPWHDGYFKISSLIKSAIPAVRVKDQIFYI
>NZ_CP015941.1|WP_027224435.1|2678813_2680022_-|hypothetical-protein
MVRHLKLIIILAFTLAGDILFGLALIWRVLALDGSAKTLGLFLCVITLVTFALQKSSVGFRRMLEKTPRRSFMWIRGVGVGFSIIFIPLLWHETTWLLYLVGAIATIINFLSILTLEAMMAHEVLEKRISSNKASRILQIAILTSSFLGASLLGTILALGNIVAVLLFCIATYLVGAICFSTQSDVGIQKISQVQTAKTASNQKMTYGNNLSVLRLAFIGLTLLMTQISAFNFLLPLIAQHEKFWTASQYGFIDAAAELGGLLATIIMFEKGIFSKLWIFAFLGIALVDILFFAVTDIYLISTATLFLGFCVSCFRIKQREYIYDSVSNTEEILEWTGRITAMTAIIKALTPLGLAFFISQPSFDLMIIGIVVGTVMLIVTSVLYFYTNKEFKQQIPSYSAV
>NZ_CP015941.1|WP_013101792.1|2688704_2688932_+|helix-turn-helix-transcriptional-regulator
MPTHEIANLVHYYRKQSGLSQQELAHLAGVGKTVIYDIEKGKESVRLNTLLKVLDVLNIQMKFETPFPQTTDNNS
>NZ_CP015941.1|WP_027224429.1|2688928_2689237_+|HipA-N-terminal-domain-containing-protein
MRKAYVSVNGIKAGILEELQSGKYQFSYFDDYHGAPVSLTMPLTNKVYDFDVFPPFFEGLLPEGIMLEALLRKYKIDKNDYFGQLIIVGQDVVGAVTIEEIR
>NZ_CP015941.1|WP_027224428.1|2689233_2690166_+|HipA-domain-containing-protein
MKRCPITYEKISDQENYSQRGLRLLSPQLKNLSPLDLSADEQRQEAIARVGKMSIQGVQKKLSAKLKIKEGSFEIVDQNGHYILKPQSDIYPELPENEAITMTLAKTIGLEVPVHGLVYSKDNSLTYFIKRFDRIGHNKKLALEDFAQLSGEDRHTKYKSSMEKVIAIIEQFCTFPKIEFVKLFKLTLFNFLVGNEDMHLKNFSLITRDRKISISPAYDLLNSTIAQKNTKEEIALPLKGKKNNLTKSDFLNYFAVEKLGLNQNVINGIAQEFHQAIPEWRELISFSFLSQPMQEKYLQLLDQRCKRLNF
>NZ_CP015941.1|WP_027224427.1|2690294_2692862_+|magnesium-translocating-P-type-ATPase
MKINLDLNDLSTYDQDLLLNELNSSLEGLNNFQAQKRLTQYGTNEILRKPYHLIIIEAISHSINPLVAILFFAALISAFTGNVVNAAIIISIIIISIGLDYFQSHRALVAIKMLQKKIATTVTVLRENQWLEIPAKELVPGDLFRLSAGDMVPADSILLKSKDLHIHQSALTGESMPVEKEAIPLKTKPKNPLDALNVVFSGSSVIGGSATALAINTGSNSLYGHIAESLKKKPPHTEFEQGMMRFSTFIMKMVFLLVIFVFSINIYMHRPLLDSLLFAVALAVGLTPELLPMITTVTLASGAVRMSKKKVIIKNLSAIQNFGSIDILCSDKTGTLTSGEMNLTKYLDFSGKQSEFVMLLAYLNSVYITEIKSPFNIAVLKKARLNPLDLAILKHDHPDIQPYHKVDEIPFDFERRRSSVIVSKNENHLFICKGAPENIMSVCSYYDFAGERELFTEKEQKQCELLFQSLSSEGYRVLAIAYKLMDRQLKYTQSDEKEMIFAGFLAFTDPLLEDIPKVIKDLRHEGINIKILSGDNLIVTQHICQKVGMDTSRILTGEEISKISDDALPPLAEQIDIYARINPMQKQRIISALKKRGHVVGYLGDGINDVPSLHQADVGISVASAVDIAREAADIVLLEHHLKVLLNGIIEGRKSFRNVMKYLMMGTSSNFGNMISMAIAVLFLPFLPMLPRQILLNNLLYDISQITIPTDHVDPSSIHRYKRLDINIIRQFMFYVGPISSVFDFLTFFVMLKIFSANEALFQTGWFVESLATQTLVIFIIRTAKKPWQSMPSLPLTTTVLLIVMVGIWLPFSPFSGLFGFVPLPPLYFLFLVTATFTYLFLVELIKKKIMRKLY
>NZ_CP015941.1|WP_027224426.1|2692896_2693841_+|flippase-like-domain-containing-protein
MIKWISGFIILVVLIIVIGHFSQLRVFLGLIEQMKFSWLFFAVIFQSGTYMSLAAVWRLALRWFGEQISFFQLFLLSFSQLFVNQTIPTSGLSGVTIMTKFLLGRLITPKAIALAIALNVFSRQVAYLTSFIASIVVFWFYNELNKTLISLSLIFILIMVAVLILAALLWQQALKLKIPKLLNKYTSIRILINEIKKLDPKIVLNFKLFFPAVVFSVAIFIFDSLTLWTILKSLNLDLNFRLIFAAQVIASSIASLSFFPGGLGIFEGSLTGLLTFLGLSIEQAFTATILFRGFTYWLPMLPGFLLTQKELLRI
>NZ_CP015941.1|WP_106202151.1|2694105_2695887_+|heavy-metal-translocating-P-type-ATPase
MKIINVPYINVPLILIIIIGGLPLFIQISIKLVQGDLGADTLAALSLITGVILHEYLAACLIILMLASGQTLEVYARRKASSVLQALISRMPSKVHIRKNEQITDIPLSETQIGDEIIIYPHETCPVDGEVIDGHGTMDESYLTGEPYLIAKAPGVTVLSGAINGEALLVVKASKRPSDSRYAAIVEVLKEAEQKKPTLRRLGDQIGAIFTPIALFFALLAWYFSGDPIRFLSVLVIATPCPLLIAIPITIISAVSMAAKQAIIIKDPTILERLPTCQTAIFDKTGTLTYGKPTLTKIITTETYSHSDILQYAASLERYSKHPLSNSILDAAKERGLTLLQASEVFEKPGQGLLGKINDHSVQVTSRKKFLAKHPEEVGFLPEHSSGLECLILIDEQFAAVLQFHDAPREESHSFIHHLAPSHQFKKIMLVSGDRESEVKYLGKLLELTEIYSSQSPEQKLKIVRDETRKAPTLYMGDGINDAPALTAATVGIAFGQYSNVTAEAAGAVIMENTLNKVDELMHLSINTRKIALQSAIGGMLLSIIGMSFAALGFINPVTGAILQELIDILAIINALQLTWGSRVKIDLPGYKA
>NZ_CP015941.1|WP_014844538.1|2696189_2696483_-|hypothetical-protein
MKKNSSTKKILSSLSDTELQEKQELMMSEQDEQLDILLKTVTRTHEIAEAIQEELTSQNKLIDGLNEHVEKTDGKVKNTTKKVEALIPEVRSSCFLM
>NZ_CP015941.1|WP_014844539.1|2696510_2697410_-|hypothetical-protein
MFSPLQDPWSELEELGFNPEYLKRLKERAATSIEMTKNIEMLADYYEQFKEVGFTDSDLARIVSLVSFTADNRLANIGSRMMITLVCGGLNLVKAPLHFKPHKLTNMMLSLNGLEKLRTLVEMSKESGFTPLKNQAEFKAIFEKRCKKFPMLRVLWCYSDANESYMEYRKQDAIYKDWLSEEELHQLNRLSRISKTRDLHYWKRDTVRPVLLGDNYYSREDFGQTREEFEKAQDNPDAVESWCDSWANPFDQNPDSALTQSQEKSNQRNASKIPFFTVYENNGKSGVVDEQQSSNAFSN
>NZ_CP015941.1|WP_014844540.1|2697571_2699011_+|hypothetical-protein
MENKTKALNFLNRIERCLVPQSNPQIMKQLLSALGLDKLTTGNEEYKFFIQTIKKKSIDLNPLISKVKSDILNNDPLWTLLDYIEANELIDDAEIENASSTIQLQINLLCLLEAITITMANSNDFAHDIYNHMMKQRGKGATGNPFYNFLFGIPSRATLFERLKLISIDPGLTSIIFHRQMGENPETQADLDDFVSQNSLSGWNADIELANFDVASTSTLPAMGVNILEAVWEDATGHNKNTGGILNAQAGLGLIRVMEEQEYTTSFKLAETTLPQGTTLHSDFGYSLIPELKVDNSPKKVSQFHIDKQWMNLYNSWNLLFVIGNIDSVFVPLKLLMPSVFSAEPSNYKETRVLTLFLVANLFLNQQTLNNPLFSNNFSFRNGTVIMKKWGEINKNHASELLQQCKELDDLYNHVLGKNPHLNFGLKLFSYFQDSHQFRLTKKAQPSTSIDYSFFSGNTPSENNSEKMGVALHSSLYTK
>NZ_CP015941.1|WP_014844541.1|2699256_2700165_+|LysR-family-transcriptional-regulator
MNILSCLKGFITTVDCKSFSKAAQKLYISPSKLSKQITWLEEELKVTLLIRSTTRLTVTDSGHRLYEKSLQLFEQLEAVKVIATPDQLELNGVIRLYLTVTPAIPYLTTLSIQFMRQYPKIEVDIIVGSDTKELYSSTFDLAISFDDVKHSKLVCKRLFSIQRKVFASPGYIAQHGLPQTLDELPKHNCLINTLYGLQNKWVFNKKIIHVSGNFKSNNAGVLKQAAVADVGILWAPYFSVYEEIKNETLIPVLPQESSPDINLYAICPKSTVDEQKINLLLNFFCEKALSENIATSFIDGNN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

845515 : 912907

Pseudomonas_phage(18.18%)

tRNA,protease,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010946555.1\|845515_846601_+\|transposase	IS4-like element ISLpn9 family transposase	NA	NA	NA	NA
WP_010946556.1\|846626_846920_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_013101184.1\|847675_849472_-	hypothetical protein	NA	NA	NA	NA
WP_011945902.1\|849474_850593_-	hypothetical protein	NA	NA	NA	NA
WP_011945903.1\|850603_851605_-	phosphotransferase	NA	NA	NA	NA
WP_040146700.1\|851594_852686_-	N-acetylneuraminate synthase family protein	NA	NA	NA	NA
WP_011945905.1\|853325_854012_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_011945906.1\|854350_855868_+	hypothetical protein	NA	NA	NA	NA
WP_013101185.1\|856100_857747_+	hypothetical protein	NA	NA	NA	NA
WP_010946509.1\|857712_858564_+	ABC transporter permease	NA	NA	NA	NA
WP_070071150.1\|858560_859985_+	ATP-binding cassette domain-containing protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	9.4e-10	25.3
WP_010946511.1\|859990_861139_+	hypothetical protein	NA	NA	NA	NA
WP_014843570.1\|861152_862046_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_010946516.1\|862039_863059_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_010946517.1\|863270_863978_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_011213314.1\|864536_864731_+	carbon storage regulator CsrA	A0A2I7RT00	Vibrio_phage	3.0e-12	70.6
WP_010946519.1\|864856_866839_-	acyltransferase	A0A1R3Y5Q6	Salmonella_virus	5.8e-50	32.1
WP_010946520.1\|867001_867997_-	biotin--[acetyl-CoA-carboxylase] ligase	NA	NA	NA	NA
WP_010946521.1\|868000_868738_-	4'-phosphopantetheinyl transferase superfamily protein	NA	NA	NA	NA
WP_010946522.1\|868819_869773_+	acetyl-CoA carboxylase carboxyltransferase subunit alpha	NA	NA	NA	NA
WP_011213315.1\|869765_871061_+\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_126297583.1\|871099_871315_+	hypothetical protein	NA	NA	NA	NA
WP_010946524.1\|871410_871947_+\|transposase	transposase	NA	NA	NA	NA
WP_011213316.1\|872285_873452_+	DUF1574 family protein	NA	NA	NA	NA
WP_010946526.1\|873448_874891_+	MBOAT family protein	A0A125RNP0	Pseudomonas_phage	3.9e-72	40.5
WP_010946527.1\|874989_876366_-	L-serine ammonia-lyase	NA	NA	NA	NA
WP_011213317.1\|876570_877272_+	FKBP-type peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_011213318.1\|877437_878697_+	MFS transporter	NA	NA	NA	NA
WP_011213319.1\|880551_881202_+	lpg0796 family Dot/Icm T4SS effector	NA	NA	NA	NA
WP_010946534.1\|881481_881868_+	DUF3757 domain-containing protein	NA	NA	NA	NA
WP_010946535.1\|881971_883315_-	quinolinate synthase NadA	NA	NA	NA	NA
WP_010946536.1\|883389_885039_-	L-aspartate oxidase	NA	NA	NA	NA
WP_010946537.1\|885035_886406_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	2.2e-112	49.7
WP_010946538.1\|886558_888262_+	sulfate permease	A0A2H4J153	uncultured_Caudovirales_phage	6.5e-42	26.5
WP_010946539.1\|888464_890168_-	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_010946540.1\|890397_891396_-	linear amide C-N hydrolase	NA	NA	NA	NA
WP_010946541.1\|891620_894008_+	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	7.0e-175	38.1
WP_010946542.1\|894249_895689_+	cation:proton antiporter	NA	NA	NA	NA
WP_010946543.1\|895685_896528_+	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
WP_010946544.1\|896524_897616_+	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	NA	NA	NA	NA
WP_010946545.1\|897590_899006_+	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_010946546.1\|899097_899415_+	helix-hairpin-helix domain-containing protein	NA	NA	NA	NA
WP_011213320.1\|899610_900648_+	rod shape-determining protein	NA	NA	NA	NA
WP_010946548.1\|900625_901534_+	rod shape-determining protein MreC	NA	NA	NA	NA
WP_010946549.1\|901530_902010_+	rod shape-determining protein MreD	NA	NA	NA	NA
WP_011213321.1\|901945_902548_-	pseudouridine synthase	NA	NA	NA	NA
WP_010946551.1\|902808_903507_+	hypothetical protein	NA	NA	NA	NA
WP_011213322.1\|903616_904873_+	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	1.9e-14	74.1
WP_010946553.1\|905274_905610_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A218MMY6	uncultured_virus	5.8e-11	36.5
WP_011213323.1\|905641_907909_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	8.7e-167	42.1
WP_010946555.1\|908209_909295_+\|transposase	IS4-like element ISLpn9 family transposase	NA	NA	NA	NA
WP_010946556.1\|909320_909614_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_010946557.1\|909769_910549_+	glycosyltransferase family 2 protein	S5WBE2	Pseudomonas_phage	6.9e-07	30.8
WP_010946558.1\|910551_911802_+	O-antigen ligase family protein	NA	NA	NA	NA
WP_011213324.1\|911802_912138_-	hypothetical protein	NA	NA	NA	NA
WP_010946560.1\|912307_912907_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA

DBSCAN-SWA_2

923235 : 930075

Acinetobacter_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010946569.1\|923235_924012_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	3.3e-57	48.2
WP_010946570.1\|924004_925039_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	3.5e-75	47.6
WP_010946571.1\|925016_925595_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	1.0e-55	53.2
WP_010946572.1\|925628_926354_-	LPS export ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.1e-17	28.3
WP_010946573.1\|926350_926860_-	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
WP_010946574.1\|926840_927410_-	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_011213328.1\|927406_927934_-	3-deoxy-manno-octulosonate-8-phosphatase KdsC	A0A140XBD6	Dickeya_phage	1.4e-27	47.7
WP_010946576.1\|927947_928910_-	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	4.2e-38	34.1
WP_010946577.1\|929277_930075_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.3e-21	33.8

DBSCAN-SWA_3

1312708 : 1318645

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010946911.1\|1312708_1313782_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	2.8e-30	27.8
WP_010946912.1\|1313766_1314381_+	riboflavin synthase	A0A2I2L4R9	Orpheovirus	3.5e-22	38.4
WP_010946913.1\|1314377_1315586_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	5.4e-99	48.7
WP_010946914.1\|1315593_1316061_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	9.2e-23	49.1
WP_010946915.1\|1316186_1317824_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	3.6e-154	52.3
WP_010946916.1\|1317820_1318645_+	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	1.8e-53	43.9

DBSCAN-SWA_4

2222206 : 2232330

Bacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_070071220.1\|2222206_2223895_-	S8 family serine peptidase	A0A1B0T6A2	Bacillus_phage	4.7e-16	30.4
WP_015444337.1\|2224026_2225034_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_010947737.1\|2225157_2226483_-	adenosylhomocysteinase	S4VPF6	Pandoravirus	1.4e-47	31.2
WP_010947738.1\|2226501_2227650_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	1.3e-126	58.5
WP_015444336.1\|2227858_2228971_-	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	2.9e-51	35.2
WP_010947740.1\|2229066_2230206_-	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	1.6e-23	26.9
WP_015444335.1\|2230395_2232330_-	molecular chaperone DnaK	G8DDB7	Micromonas_pusilla_virus	1.3e-147	49.6

DBSCAN-SWA_5

2274158 : 2329183

Wolbachia_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010947782.1\|2274158_2275610_+\|transposase	IS4-like element ISLpn5 family transposase	Q9JMP3	Wolbachia_phage	6.1e-158	56.8
WP_010947783.1\|2275680_2277201_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	7.9e-124	48.2
WP_010947785.1\|2278048_2278423_+	hypothetical protein	NA	NA	NA	NA
WP_010947786.1\|2278620_2280228_-	hypothetical protein	NA	NA	NA	NA
WP_015444248.1\|2280230_2280722_-	hypothetical protein	NA	NA	NA	NA
WP_010947788.1\|2280732_2281569_-	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A1S6L1V5	Vibrio_phage	4.9e-67	48.9
WP_010947789.1\|2282161_2283253_-	DUF4917 family protein	NA	NA	NA	NA
WP_010947790.1\|2283484_2289430_-	conjugative transfer relaxase/helicase TraI	NA	NA	NA	NA
WP_010947791.1\|2289450_2291343_-	type IV conjugative transfer system coupling protein TraD	NA	NA	NA	NA
WP_021437030.1\|2291407_2291872_+	hypothetical protein	NA	NA	NA	NA
WP_015444244.1\|2291875_2294596_-	conjugal transfer protein TraG N-terminal domain-containing protein	NA	NA	NA	NA
WP_010947793.1\|2294601_2295987_-	conjugal transfer protein TraH	NA	NA	NA	NA
WP_010947794.1\|2295983_2296406_-	type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB	NA	NA	NA	NA
WP_010947795.1\|2296395_2297178_-	type-F conjugative transfer system pilin assembly protein TraF	NA	NA	NA	NA
WP_010947796.1\|2297170_2298982_-	type-F conjugative transfer system mating-pair stabilization protein TraN	NA	NA	NA	NA
WP_015444243.1\|2298981_2299650_-	type-F conjugative transfer system pilin assembly protein TrbC	NA	NA	NA	NA
WP_010947798.1\|2299665_2300661_-	TraU family protein	NA	NA	NA	NA
WP_010947799.1\|2300657_2301266_-	type-F conjugative transfer system protein TraW	NA	NA	NA	NA
WP_015444242.1\|2301262_2301598_-	TrbI F-type domain-containing protein	NA	NA	NA	NA
WP_015444241.1\|2301590_2304143_-	type IV secretion system protein TraC	NA	NA	NA	NA
WP_010947801.1\|2304154_2304505_-	type IV conjugative transfer system lipoprotein TraV	NA	NA	NA	NA
WP_015444240.1\|2304518_2305805_-	TraB/VirB10 family protein	NA	NA	NA	NA
WP_010947803.1\|2305806_2306520_-	type-F conjugative transfer system secretin TraK	NA	NA	NA	NA
WP_010947804.1\|2306522_2307086_-	type IV conjugative transfer system protein TraE	NA	NA	NA	NA
WP_010947805.1\|2307089_2307383_-	type IV conjugative transfer system protein TraL	NA	NA	NA	NA
WP_010947806.1\|2307384_2307687_-	fimbrial protein	NA	NA	NA	NA
WP_010947807.1\|2307701_2307938_-	carbon storage regulator CsrA	A0A2I7RT00	Vibrio_phage	2.5e-08	52.9
WP_025520140.1\|2307951_2308329_-	hypothetical protein	NA	NA	NA	NA
WP_010947808.1\|2308276_2309161_-	hypothetical protein	NA	NA	NA	NA
WP_015444237.1\|2309333_2310014_+	helix-turn-helix domain-containing protein	A0A1I9KG86	Aeromonas_phage	1.6e-07	28.1
WP_016356978.1\|2310162_2310837_+\|transposase	transposase	NA	NA	NA	NA
WP_010947811.1\|2311285_2311858_+	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_015444236.1\|2311841_2312339_+	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_010947813.1\|2312331_2312919_-	CDP-alcohol phosphatidyltransferase family protein	NA	NA	NA	NA
WP_010947814.1\|2312923_2315059_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_010947815.1\|2315077_2315959_-	sterol desaturase family protein	NA	NA	NA	NA
WP_010947816.1\|2316065_2316212_-	hypothetical protein	NA	NA	NA	NA
WP_010947817.1\|2316403_2316580_+	MAPEG family protein	NA	NA	NA	NA
WP_010947818.1\|2316749_2317247_-	DoxX family protein	NA	NA	NA	NA
WP_010947819.1\|2317236_2318016_-	DUF2063 domain-containing protein	NA	NA	NA	NA
WP_010947820.1\|2318008_2318863_-	DUF692 domain-containing protein	NA	NA	NA	NA
WP_010947821.1\|2318877_2319171_-	DUF2282 domain-containing protein	NA	NA	NA	NA
WP_010947822.1\|2319360_2319882_-	hypothetical protein	NA	NA	NA	NA
WP_015444234.1\|2320186_2320645_-	hypothetical protein	NA	NA	NA	NA
WP_015444232.1\|2321218_2321446_-	hypothetical protein	NA	NA	NA	NA
WP_010947824.1\|2321603_2322125_-	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_010947825.1\|2322296_2322851_+	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_010947826.1\|2323284_2323485_+	ATP-dependent DNA helicase	NA	NA	NA	NA
WP_010947827.1\|2323578_2323962_+\|transposase	transposase	NA	NA	NA	NA
WP_010947828.1\|2324015_2324969_-	Abi family protein	A3QSC6	Clostridium_virus	4.8e-34	31.8
WP_015444229.1\|2325478_2326897_+\|transposase	IS4-like element ISLpn3 family transposase	Q9JMP3	Wolbachia_phage	2.3e-56	32.9
WP_010947829.1\|2326929_2328105_-\|transposase	ISL3 family transposase	A4PE56	Ralstonia_virus	5.2e-14	21.2
WP_010947830.1\|2328157_2329183_-\|transposase	IS481 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage