CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP015401	Bacteroides caecimuris strain I48 chromosome, complete genome	2 crisprs	PD-DExK,RT,PrimPol,cas3,WYL,DEDDh	3	1	14	3

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP015401_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015401_1

2094376-2094528

Orphan

Consensus_repeat	Method
TTTGTACACCCTCAGGGACTCGAACCCTGGACCCATTGATTAAGAGTCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015401_1

>merge|NZ_CP015401|1|2094376-2094528|CRISPRCasFinder
TTTGTACACCCTCAGGGACTCGAACCCTGGACCCATTGATTAAGAGTCAATTGCTCTACCAGCTGAGCTAAGAGTGCAACATGTTATTTTATTGCAACCTTGAATTTGTACACCCTCAGGGACTCGAACCCTGGACCCACTGATTAAGAGTCA

>NZ_CP015401|1|1|2094376-2094528|CRISPRCasFinder
TTTGTACACCCTCAGGGACTCGAACCCTGGACCCATTGATTAAGAGTCA	ATTGCTCTACCAGCTGAGCTAAGAGTGCAACATGTTATTTTATTGCAACCTTGAA
TTTGTACACCCTCAGGGACTCGAACCCTGGACCCACTGATTAAGAGTCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015401.2\|WP_065538630.1\|2087661_2088147_-\|DNA-binding-protein	unknown	unknown	gnl\|CDD\|375718
NZ_CP015401.2\|WP_065538642.1\|2102249_2102636_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015401.2\|WP_065538633.1\|2091344_2092751_+\|glucuronate-isomerase	unknown	unknown	gnl\|CDD\|235087
NZ_CP015401.2\|WP_065538639.1\|2098676_2099129_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015401.2\|WP_065538637.1\|2097487_2097943_+\|DoxX-family-protein	unknown	unknown	gnl\|CDD\|311556
NZ_CP015401.2\|WP_065538635.1\|2095531_2096920_-\|peptide-MFS-transporter	unknown	unknown	gnl\|CDD\|340904
NZ_CP015401.2\|WP_065538627.1\|2084400_2085084_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236581
NZ_CP015401.2\|WP_065538626.1\|2084032_2084368_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378276
NZ_CP015401.2\|WP_065538638.1\|2098030_2098582_+\|DUF3332-domain-containing-protein	unknown	unknown	gnl\|CDD\|371739
NZ_CP015401.2\|WP_065538559.1\|2092897_2093833_-\|transposase	unknown	unknown	gnl\|CDD\|376574
NZ_CP015401.2\|WP_065538636.1\|2097077_2097326_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015401.2\|WP_065538634.1\|2094645_2095449_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293819
NZ_CP015401.2\|WP_065538643.1\|2102641_2103718_-\|DUF4296-domain-containing-protein	unknown	unknown	gnl\|CDD\|379487
NZ_CP015401.2\|WP_065538628.1\|2085417_2086296_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015401.2\|WP_065537581.1\|2093873_2094245_-\|transposase-family-protein	unknown	unknown	gnl\|CDD\|379669
NZ_CP015401.2\|WP_065538625.1\|2082827_2084018_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015401.2\|WP_065538631.1\|2088612_2090052_-\|tagaturonate-reductase	unknown	unknown	gnl\|CDD\|235147
NZ_CP015401.2\|WP_065538640.1\|2099082_2101392_-\|BamA/TamA-family-outer-membrane-protein	unknown	unknown	gnl\|CDD\|227116
NZ_CP015401.2\|WP_065538641.1\|2101534_2102299_+\|RNA-methyltransferase	unknown	unknown	gnl\|CDD\|349982
NZ_CP015401.2\|WP_065538632.1\|2090078_2091146_-\|substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|380530

Protein	Function_ID	Function_description	E-value
NZ_CP015401.2\|WP_065538630.1\|2087661_2088147_-\|DNA-binding-protein	gnl\|CDD\|375718	pfam18291, HU-HIG, HU domain fused to wHTH, Ig, or Glycine-rich motif. Rapidly-diverging family of HU domains predominantly observed in the bacteroidetes lineage with a predicted role in recognition and possible interception of the DNA of parasitic elements, a counter-conflict strategy preventing incorporation of these elements into the host genome.	9.45664e-35
NZ_CP015401.2\|WP_065538633.1\|2091344_2092751_+\|glucuronate-isomerase	gnl\|CDD\|235087	PRK02925, PRK02925, glucuronate isomerase; Reviewed.	0
NZ_CP015401.2\|WP_065538643.1\|2102641_2103718_-\|DUF4296-domain-containing-protein	gnl\|CDD\|379487	pfam14129, DUF4296, Domain of unknown function (DUF4296). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, and is approximately 90 amino acids in length.	4.39207e-30
NZ_CP015401.2\|WP_065538637.1\|2097487_2097943_+\|DoxX-family-protein	gnl\|CDD\|311556	pfam07681, DoxX, DoxX. These proteins appear to have some sequence similarity with pfam04173 but their function is unknown.	2.05753e-12
NZ_CP015401.2\|WP_065538635.1\|2095531_2096920_-\|peptide-MFS-transporter	gnl\|CDD\|340904	cd17346, MFS_DtpA_like, Dipeptide and tripeptide permease A (DtpA)-like subfamily of the Major Facilitator Superfamily of transporters. The DtpA-like subfamily includes four Escherichia coli proteins: dipeptide and tripeptide permeases A (DtpA, TppB or YdgR), B (DtpB or YhiP), C (DtpC or YjdL), and D (DtpD or YbgH). They are proton-dependent permeases that transport di- and tripeptides. DtpA and DtpB display a preference for di- and tripeptides composed of L-amino acids. DtpC shows higher specificity for dipeptides compared to tripeptides, and prefers dipeptides containing a C-terminal lysine residue. The DtpA-like subfamily belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	8.11331e-80
NZ_CP015401.2\|WP_065538627.1\|2084400_2085084_-\|hypothetical-protein	gnl\|CDD\|236581	PRK09598, PRK09598, phosphoethanolamine--lipid A transferase EptA.	0.0033298
NZ_CP015401.2\|WP_065538626.1\|2084032_2084368_-\|hypothetical-protein	gnl\|CDD\|378276	pfam09851, SHOCT, Short C-terminal domain.	2.10246e-07
NZ_CP015401.2\|WP_065538638.1\|2098030_2098582_+\|DUF3332-domain-containing-protein	gnl\|CDD\|371739	pfam11810, DUF3332, Domain of unknown function (DUF3332). This family of proteins are functionally uncharacterized. This family is only found in bacteria.	7.76231e-72
NZ_CP015401.2\|WP_065538559.1\|2092897_2093833_-\|transposase	gnl\|CDD\|376574	pfam01610, DDE_Tnp_ISL3, Transposase. Transposase proteins are necessary for efficient DNA transposition. Contains transposases for IS204, IS1001, IS1096 and IS1165.	1.19351e-59
NZ_CP015401.2\|WP_065538634.1\|2094645_2095449_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293819	cd07733, YycJ-like_MBL-fold, uncharacterized subgroup which includes Bacillus subtilis YycJ and related proteins; MBL-fold metallo hydrolase domain. Includes the uncharacterized Bacillus subtilis YycJ protein. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) from which this fold was named are only a small fraction of the activities which are included in this superfamily. Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	2.88686e-63
NZ_CP015401.2\|WP_065537581.1\|2093873_2094245_-\|transposase-family-protein	gnl\|CDD\|379669	pfam14690, zf-ISL3, zinc-finger of transposase IS204/IS1001/IS1096/IS1165.	0.00235756
NZ_CP015401.2\|WP_065538631.1\|2088612_2090052_-\|tagaturonate-reductase	gnl\|CDD\|235147	PRK03643, PRK03643, tagaturonate reductase.	0
NZ_CP015401.2\|WP_065538640.1\|2099082_2101392_-\|BamA/TamA-family-outer-membrane-protein	gnl\|CDD\|227116	COG4775, COG4775, Outer membrane protein/protective antigen OMA87 [Cell envelope biogenesis, outer membrane].	2.47894e-25
NZ_CP015401.2\|WP_065538641.1\|2101534_2102299_+\|RNA-methyltransferase	gnl\|CDD\|349982	cd18109, SpoU-like_RNA-MTase, SAM-dependent RNA methylase related to SpoU-TrmH. RNA 2'-O ribose methyltransferase catalyzes the methyltransfer from S-adenosyl-L-methionine (AdoMet) to the 2'-OH group of ribose in tRNA or rRNA. It is part of the SpoU family of MTases, a subfamily of the SPOUT methyltransferase superfamily. The SPOUT methyltransferase superfamily is a large class of S-adenosyl-L-methionine (AdoMet or SAM)-dependent RNA MTases which are structurally characterized by a deep trefoil knot.	3.91266e-77
NZ_CP015401.2\|WP_065538632.1\|2090078_2091146_-\|substrate-binding-domain-containing-protein	gnl\|CDD\|380530	cd06307, PBP1_sugar_binding, periplasmic sugar-binding domain of uncharacterized transport systems. Periplasmic sugar-binding domain of uncharacterized transport systems that share homology with a family of pentose/hexose sugar-binding proteins of the type 1 periplasmic binding protein (PBP1) superfamily. The members of this group are predicted to be involved in the transport of sugar-containing molecules across cellular and organellar membranes.	5.0914e-55

>NZ_CP015401.2|WP_065537581.1|2093873_2094245_-|transposase-family-protein
MKTSSSQTIDPVASLSLFLPSGILDYFTLVNHVSQDTCFILYLEEKATIPSEYSDLHLHSKGFLPEIEVQDFPIRGKAVYLRIKRRRWEDPSTGQTYSRDWSLVATGTRITAEFGAFLKELLG
>NZ_CP015401.2|WP_065538559.1|2092897_2093833_-|transposase
MDGKQLQSQYKDHLSDFQNWDQRAHAQEYILYPKNMGYHLCIDETALSKGDLYTILINRDKRGRKGSIIAVIQGTKTDDIIAVLTKMPQELRNQVKEITLDMAGSMQKIAKTCFPRAMQVIDRFHVQKLVYEAVQELRITYRWQVIKEENKAMKAAKEKGEVYKAEELENGDTLRQLLARSRYLLFKSPDKWTKSQKIRAELLFKQFEDIKHVYYYSLELGKIFSTNYDKDVARAKLALWYNKIEEYGYDTFTTVANSIENHYERILNFFVNRSTNAAAEAFNAKIKAFRASFRGVVDMRFFLFRLAKVYA
>NZ_CP015401.2|WP_065538633.1|2091344_2092751_+|glucuronate-isomerase
MKNFMDENFLLQTETAQKLYHEHAAKMPIIDYHCHLIPQMVADDYKFKSLTEIWLGGDHYKWRAMRTNGVDERFCTGKDTTDWEKFEKWAETVPYTFRNPLYHWTHLELKTAFGINKILNPQTARKIYDECNEKLSQPEYSARGMMRRYHVEVVCTTDDPIDSLEYHIKTRESGFEIKMLPTWRPDKAMAVEVPADFRSYVEKLAEVSSVTISNFDDMIAALRKRHDFFAEQGCRLSDHGIEEFYAEDYTDAEIKAIFNKVYGGTELTKEEILKFKSAMLIIFGEMDWEKGWTQQFHYGAIRNNNTKMFKLLGADTGFDSIGEFTTAKAMAKFLDRLNTNGKLTKTILYNLNPCANEVIATMLGNFQDGSIPGKIQFGSGWWFLDQKDGMEKQMNALSVLGLLSRFVGMLTDSRSFLSYPRHEYFRRTLCNLVGRDIENGEIPASEMERVNQMIEDISYNNAKNFFKF
>NZ_CP015401.2|WP_065538632.1|2090078_2091146_-|substrate-binding-domain-containing-protein
MEDQNYTIKDIARMAGVSAGTVDRVLHNRGDVSPKSKAKVQKVLDEIHYQPNVFAIGLAAKKKYSFLCLIPYYIEHDYWHSVVEGIERARQELRPFNVSIDYLYYHHGDEKSYQKTCLSIKEKNVDAVLISPNFREETLALTAYLQENKIAYAFVDFNMEEAKALTYIGQNSYKSGYIAAKILMRNYSAGEGQELVLFLSNNKDNPAEIQMQRRLDGFMSYIAEEYNNLVIHEVILNKSDQESNQRTLDEFFRAHPKAALGVVFNSRVYQLGEYLRHAGRSMKGLIGYDLLKANVELLKSGDVHYLIGQRPGLQGYCGVKALCDHVVFKKSVEPVKYMPIDILIKENIDFYFEFV
>NZ_CP015401.2|WP_065538631.1|2088612_2090052_-|tagaturonate-reductase
MKALNKETAPKTQRPERIIQFGEGNFLRAFVDWIIYNMNQKTDFNSSVVVVQPIDKGMVDMLNAQDDLYHVNLQGLDKGEVVNSLTMIDVISRALNPYSQNDEFMKLAEQPEMRFVISNTTEAGIAFDPSCKLEDAPASSYPGKLTQLLYHRFKTFNGDKTKGLIIFPCELIFLNGHKLKETIYQYIELWNLGNGFKTWFEEACGVYATLVDRIVPGFPRKDIAAIKEKLQYDDNLVVQAEIFHLWVIEAPQEIAKEFPADKAGLNVLFVPSEAPYHERKVTLLNGPHTVLSPVAYLSGVNIVREACEHEVIGKYIHKVMFDELMETLNLPKDELEKFANDVLERFNNPFVDHAVTSIMLNSFPKYETRDLPGLKTYLERKGELPKGLVLGLAAIITYYKGGVRADGAEIVPNDAPEIMNLLKELWATGCTKKVAEGVLAADFIWGEDLNKIPGLTEAVKANLDSIQEKGMLETVKGIL
>NZ_CP015401.2|WP_065538630.1|2087661_2088147_-|DNA-binding-protein
MAIRYKKKKITLCFDKENKVEKYVAANVLVGSINYNKLCDEVNQRTGIHRAMVDVVLKGVQDTMVSFIEEGFSVKLGEFGSFRPAINAESQDKAEDVGANTIIRRKIVFTPGSAFKAMLGSANIELFGDNVTNSNGDNGGEPDEGGGSSGGDSGEAPDPAA
>NZ_CP015401.2|WP_065538628.1|2085417_2086296_-|hypothetical-protein
MRTKYHLLVISPTIFVVVVLLFACNGGHQQNKNTAKEIVENPLNNIFKNAYAKKRTLYDLIRTPEFKEQVVKYYSLEFYKKMYEVVEVVVPISYNSTEDIYVCSGFKAHNAGITEATVNYDAKTNGLDIKLIIDGTRIERSGEIDYGNWKKGYYKDDFGEDILKQPFIQTDIRGTVRSFDCELHIRFNFDEGIRLWITGEYCCYDPMKAFIKIRDNSTNETLSVPIDNIRKDSIFIYNEKGLLMLLAALKCGNTTISIKYNTALDNDYLYLFQIHGPTQIENAIKLIENEIM
>NZ_CP015401.2|WP_065538627.1|2084400_2085084_-|hypothetical-protein
MGSIFIAIIIGSIVGLCFVLVVRNRIQEIENVSFEKKTVERLLVISQLHIMYACIIYGYICSITPELMPEDQTVRSFFQDHELIGGIVEELTGANLNPDIDAIHDRVQMGKTYGLIFMIILIILASIEGIGLVNRRINRWVIEAIAIGTSIGCYFCFQYAVDLQKEVMSNSTILQLTDITAGFLGVGGFSSMFINMFEFAFWIILFALFINHLLYHRALNKYYTSNR
>NZ_CP015401.2|WP_065538626.1|2084032_2084368_-|hypothetical-protein
MESKTSKSMGEKVFIGALLGWAGAFILMCMIFGSFPKKLSDAQYPLFLSLAPGAIIGIIVTYVVNKSSDSNVPPVKQETLEDRLIKLKSLLDQGVLTKEEFEEQKKKILEN
>NZ_CP015401.2|WP_065538625.1|2082827_2084018_-|hypothetical-protein
MKKISILLFLCGFTLQVFAQFPPKNIATALLCQDAIGLLHIYNKEPKNRSQVEDAFLTGIDLSEYSYEQIDTLCLVVDKSSVLGDYLFKVREYRKNEIINELEKCTVEELVSHAVAYPTRKALINDFINTSILSVLDSLSYKELSYISSYLRDYDIYFSVENKKKDRTYEIQNILQQNVHKYCEEEMVLMESLLFNIEKSVWRYLFGGYKEVAKYYSQIGMIPDDVTTAAEQYRALVRTCIPTKDISKKLKIEVSQFCNSINKARANYAQYFGRKNPPKINFVIPELDFSYNVSSDMLVKVGKAREHFVDDRETTKKISNVASVFIGFWATIGKGALDMMAVSNLSDKEVHFREMYMQEVLKEIVIKVERQNLLIKKSIEKQLKQNQNGFINFITN
>NZ_CP015401.2|WP_065538634.1|2094645_2095449_-|MBL-fold-metallo-hydrolase
MKVRFISLASGSSGNCYYLGTETYGILIDAGIGIRTIKKTLKDYNILMDSIRAVFITHDHADHIKAVGNLGEKMNIPVYTTARIHAGINRSYCMTEKLSSSVRYLEKQEPMILEDFHIESFEVPHDGTDNVGYCIEIGGKVFSFLTDLGEITPTAAHYISKAHYLILEANYDEEMLKMGPYPQYLKERIASKTGHMSNSDTAEFLAENITEHLRYIWLCHLSKDNNHPELAYKTVEWKLKNKGILVGKDVQLLALKRNTPSELYVFE
>NZ_CP015401.2|WP_065538635.1|2095531_2096920_-|peptide-MFS-transporter
MNNSPQHAAKGFTRAFWVSNTVELFERMAYYAVFIVLTIYLSSILGFNDFEASMISGLFSGGLYLLPIFSGAYADKIGFRKSMIIAFSLLSVGYLGLGVFPTLLEAAGLVSYGVTTQFNGLPDSYTQWIIVPVLFVLMVGGSFIKSIISASVAKETTEATRARGYSIFYMMVNVGAFTGKTIIDPLRNVIGEQAYIYINYFSGAMTIIALLSVILLYKSTHTAGEGKSLREIGQGFMRIITNWRLLILILIVTGFWMVQQQLYATMPKYVIRLAGETAKPGWIANVNPFVVVCCVSFITRLMAKRSAITSMNVGMFLIPFSALLMACGNLLGNDLITDMSNITLMMIVGIVVQALAECFISPRYLEYFSLQAPKGEEGMYLGFSHLHSFLSSIFGFGLAGILLTKYCPDPALFETRAAWEAASANAHYIWYYFAAIGLIAAVALLLFAKITESIDKKKESSR
>NZ_CP015401.2|WP_065538636.1|2097077_2097326_-|hypothetical-protein
MAQHTYDNEAVQELLNWAKKMLETKNYPTERYQVNQCTTIIDGQSYLESLIAMISRNWENPTFYPTIEQLWEFREKWENKES
>NZ_CP015401.2|WP_065538637.1|2097487_2097943_+|DoxX-family-protein
MIYDFLFPTKSNTTKVSLLLLAVRIIFGILLMNHGIQKWSSFQELSTVFPDPLGIGNPLSLGLAIFGELVCSMAFIVGFLYRLAMIPMIFTMIVAFFVVHANDVFAVKELAFIYLVVFILMYITGPGKFSIDHIIGNELSRRKSRAYKNLK
>NZ_CP015401.2|WP_065538638.1|2098030_2098582_+|DUF3332-domain-containing-protein
MKRGKLTLVAVVLSGSLLFSSCVGSFSLFNRLSSWNQSVGNKFVNELVFLAFNIIPVYGVAYLADALVINSIEFWSGSNPMANVGDVKKVKGENGNYMVKTLENGYSITKEGETASMDLIYNKEANTWNVVANGESAELVKMNNDGTADLFLPNGEKMNVTLDAQGMLAARQATMSNLMFAAR
>NZ_CP015401.2|WP_065538639.1|2098676_2099129_+|hypothetical-protein
MNKLYTLIYSVLIFTCLSCQQQTPQTQIEQTTIDFCEAFYNFNYPAAKAWSTPSSLSYLSFLASNVRQTYLDQLKTRGAAKVSVISSEIDANSEEATVVCQIKNTFVINPVEGKIEYMSSLQDTLQFVRENNKWLVKKDIPQQNGKQSHD
>NZ_CP015401.2|WP_065538640.1|2099082_2101392_-|BamA/TamA-family-outer-membrane-protein
MRRNFLCLLASAAVLSLASCTTTKFVPDGSYLLDEVKIRTDQKNIRPSFLRMYVRQNPNAKWFSLIKTQLYVYNLSGRDSTKWGNKFLRRIGDAPVIYSEDEAQRSEEEITKAVYNMGYMAATVKRSTKVKKKKIKVYYDVTAGKPYVVQSIKYDIYDPKIAALLKQDSARSLLKEGMYFDVNVLDADRQRITNKLLRNGYYKFNKDYIGYTADTVRNTYNVDLTQHLQMYKAHANDSARAHRQYWINKINFITDYDVLQSSAMSSVDINDSVHYKGYPIYYKDKLYLRPKVLTDNLRFASGDLYNERDVQQTYSSFGRLSALKYTNIRFIETQIGDSTMLDCYVMLTKSKHKSVAFEVEGTNSAGDLGAAASVSFQNRNLFRGSETFMIKFRGAYEVISGLQAGYSNNNYTEYGVETSINFPNFLFPFISSDFKRKIRATTEFGLQYNYQLRPEFLRTMASANWSYKWTQRQKIQHRIDLINIAFLYLPRISDRFKEDYINKGQNHIFQYNYQNRLIVNMGYSYNYNSVGGSIINNTIASNSYSIRFNFESAGNIMYALSKATNIRKNNNGEYAILGIPYAQYLKGEFDFAKNIRIDHRNSFAFHAGVGIAVPYGNAKTIPFEKQYFSGGANSVRGWAVRDLGPGSFAGNGNLLDQSGDIKLDASIEYRSKLFWKFQGAAFIDAGNIWTIRSYANQPGGVFKFDKFYKQIAVAYGLGLRLDLDFFILRFDGGMKAVNPAYETKKEHFPIIYPKFSRDFAFHFAVGYPF
>NZ_CP015401.2|WP_065538641.1|2101534_2102299_+|RNA-methyltransferase
MASLSKNKIKYIHSLELKKIRKEERVFLAEGPKLVGDLLGHFPCRFLAATPFWFQEHPGIDASELVEVSQEDLSRASLLKTPQQVLAIFEQPQYTLDPEAVRSSLCLALDDVQDPGNLGTIIRLADWFGIEHIICSKNTVDVYNPKTIQATMGGIARVKVHYTSLPDFIRSLGDTPVFGTFLDGKNMYEQPLSANGLIVMGNEGNGIGKEVATLINRKLYIPNYPAGQETSESLNVAIATAVICAEFRRQAAWK
>NZ_CP015401.2|WP_065538642.1|2102249_2102636_-|hypothetical-protein
MKRFASHYLLIPAIGYMKQQVVEITDEGVVRNVFPLTEEIESVEWIPGVIVLLSESQVEEIKNTGMILKNIPVFQINLPSVSNQSSQCFNEYLQEAEKKGEALFPYLFYPFDFTSMQPVDGTRHRLLR
>NZ_CP015401.2|WP_065538643.1|2102641_2103718_-|DUF4296-domain-containing-protein
MKNKFRFHLCLVCMFVFAVAGCKVKRPGDVISESKMENLLYDYHVAKSMGDNLPYSENYKKALYIDAVFKKYGTTQAAFDSSMVWYTRNTEILSKIYDKVKKRLRDEQELVGDLIAKRDKKPKMTKQGDSIDVWPWQRMIRLTGEMMDNQYVFTLPTDSNYKDRDTLVWEVRYCFLEPMLADSLRGVTMAMQVIYEKDTINHWKTVTESGVQQIRLFADTLGAMKEIKGFIYYPMDSQEKGGAVLADRFMMTRYHCTDTLAFAVRDSLNKIEALKADSLKKIATKENADSLHKVIDKNKDDMQRLTPEEMNRRRTGTHREKKPEQIQVEQHIQKERIEQRKERQMNQRRKQQQRRSNN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP015401_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015401_2

2348934-2349071

Orphan

Consensus_repeat	Method
TCTTTTATACCTTCTTTT	CRT

3 spacers

PrimPol

The CRISPR arrays of NZ_CP015401_2

>merge|NZ_CP015401|2|2348934-2349071|CRT
TCTTTTATACCTTCTTTTATACCTTCTTTTATACCTTCTTTTATACCTTCTTTTTTGCCTTCCTTTATACCTTCCTTTATGCCTTCTTTTATACCTTCTTTTTTGCCTTCTTCCAAGCCTTTCTTCATACCTTCTTCC

>NZ_CP015401|2|1|2348934-2349071|CRT
TCTTTTATACCTTCTTTT	ATACCTTCTTTTATACCT
TCTTTTATACCTTCTTTT	TTGCCTTCCTTTATACCTTCCTTTATGCCT
TCTTTTATACCTTCTTTT	TTGCCTTCTTCCAAGCCT
TTCTTCATACCTTCTTCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015401.2\|WP_065538815.1\|2356327_2357410_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP015401.2\|WP_065538819.1\|2360408_2361875_-\|lipopolysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|240532
NZ_CP015401.2\|WP_065538802.1\|2339905_2340529_+\|virulence-protein-E	PrimPol	pfam08800_PrimPol_CAS-I:CAS-III	gnl\|CDD\|370131
NZ_CP015401.2\|WP_065538803.1\|2340549_2342412_+\|DUF3987-domain-containing-protein	unknown	unknown	gnl\|CDD\|379041
NZ_CP015401.2\|WP_065538810.1\|2350068_2350980_-\|Rpn-family-recombination-promoting-nuclease/putative-transposase	unknown	unknown	gnl\|CDD\|372314
NZ_CP015401.2\|WP_065538804.1\|2342539_2342758_-\|DUF4248-domain-containing-protein	unknown	unknown	gnl\|CDD\|372895
NZ_CP015401.2\|WP_065537976.1\|2344523_2346215_+\|DDE-transposase	unknown	unknown	gnl\|CDD\|226192
NZ_CP015401.2\|WP_065538818.1\|2359305_2360400_-\|CapA-family-protein	unknown	unknown	gnl\|CDD\|214858
NZ_CP015401.2\|WP_065538817.1\|2358521_2359304_-\|LicD-family-protein	unknown	unknown	gnl\|CDD\|368225
NZ_CP015401.2\|WP_065538811.1\|2351246_2352182_-\|Rpn-family-recombination-promoting-nuclease/putative-transposase	unknown	unknown	gnl\|CDD\|372314
NZ_CP015401.2\|WP_065538812.1\|2352556_2353645_-\|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase	unknown	unknown	gnl\|CDD\|133463
NZ_CP015401.2\|WP_157448000.1\|2343729_2343837_+\|smalltalk-protein	unknown	unknown	unknown
NZ_CP015401.2\|WP_167371340.1\|2339600_2339741_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015401.2\|WP_065538808.1\|2347676_2348564_-\|Rpn-family-recombination-promoting-nuclease/putative-transposase	unknown	unknown	gnl\|CDD\|372314
NZ_CP015401.2\|WP_065538806.1\|2343841_2344255_+\|N-acetylmuramoyl-L-alanine-amidase	unknown	unknown	gnl\|CDD\|177282
NZ_CP015401.2\|WP_065538816.1\|2357376_2358510_-\|glycosyltransferase-family-4-protein	unknown	unknown	gnl\|CDD\|340847
NZ_CP015401.2\|WP_065538814.1\|2355233_2356313_-\|glycosyltransferase-family-4-protein	unknown	unknown	gnl\|CDD\|340831
NZ_CP015401.2\|WP_065538805.1\|2342979_2343468_+\|DNA-binding-protein	unknown	unknown	gnl\|CDD\|375718
NZ_CP015401.2\|WP_065538807.1\|2346462_2347410_-\|Rpn-family-recombination-promoting-nuclease/putative-transposase	unknown	unknown	gnl\|CDD\|372314
NZ_CP015401.2\|WP_065538813.1\|2354146_2355214_-\|DUF1972-domain-containing-protein	unknown	unknown	gnl\|CDD\|340858

Protein	Function_ID	Function_description	E-value
NZ_CP015401.2\|WP_065538819.1\|2360408_2361875_-\|lipopolysaccharide-biosynthesis-protein	gnl\|CDD\|240532	cd13127, MATE_tuaB_like, Uncharacterized subfamily of the multidrug and toxic compound extrusion (MATE) proteins. This family might function as a translocase for lipopolysaccharides and participate in the biosynthesis of cell wall components such as teichuronic acid. The integral membrane proteins from the MATE family are involved in exporting metabolites across the cell membrane and are responsible for multidrug resistance (MDR) in many bacteria and animals. A number of family members are involved in the synthesis of peptidoglycan components in bacteria.	1.40096e-120
NZ_CP015401.2\|WP_065538802.1\|2339905_2340529_+\|virulence-protein-E	gnl\|CDD\|370131	pfam08800, VirE_N, VirE N-terminal domain. This presumed domain is found at the N-terminus of VirE proteins.	1.42484e-38
NZ_CP015401.2\|WP_065538803.1\|2340549_2342412_+\|DUF3987-domain-containing-protein	gnl\|CDD\|379041	pfam13148, DUF3987, Protein of unknown function (DUF3987). A family of uncharacterized proteins found by clustering human gut metagenomic sequences.	1.16314e-65
NZ_CP015401.2\|WP_065538804.1\|2342539_2342758_-\|DUF4248-domain-containing-protein	gnl\|CDD\|372895	pfam14053, DUF4248, Domain of unknown function (DUF4248). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 73 and 86 amino acids in length.	4.06305e-29
NZ_CP015401.2\|WP_065538810.1\|2350068_2350980_-\|Rpn-family-recombination-promoting-nuclease/putative-transposase	gnl\|CDD\|372314	pfam12784, PDDEXK_2, PD-(D/E)XK nuclease family transposase. Members of this family belong to the PD-(D/E)XK nuclease superfamily. These proteins are transposase proteins.	1.19176e-42
NZ_CP015401.2\|WP_065537976.1\|2344523_2346215_+\|DDE-transposase	gnl\|CDD\|226192	COG3666, COG3666, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.12934e-20
NZ_CP015401.2\|WP_065538818.1\|2359305_2360400_-\|CapA-family-protein	gnl\|CDD\|214858	smart00854, PGA_cap, Bacterial capsule synthesis protein PGA_cap. This protein is a putative poly-gamma-glutamate capsule biosynthesis protein found in bacteria. Poly-gamma-glutamate is a natural polymer that may be involved in virulence and may help bacteria survive in high salt concentrations. It is a surface-associated protein.	3.01299e-74
NZ_CP015401.2\|WP_065538817.1\|2358521_2359304_-\|LicD-family-protein	gnl\|CDD\|368225	pfam04991, LicD, LicD family. The LICD family of proteins show high sequence similarity and are involved in phosphorylcholine metabolism. There is evidence to show that LicD2 mutants have a reduced ability to take up choline, have decreased ability to adhere to host cells and are less virulent. These proteins are part of the nucleotidyltransferase superfamily.	1.85961e-45
NZ_CP015401.2\|WP_065538805.1\|2342979_2343468_+\|DNA-binding-protein	gnl\|CDD\|375718	pfam18291, HU-HIG, HU domain fused to wHTH, Ig, or Glycine-rich motif. Rapidly-diverging family of HU domains predominantly observed in the bacteroidetes lineage with a predicted role in recognition and possible interception of the DNA of parasitic elements, a counter-conflict strategy preventing incorporation of these elements into the host genome.	1.89361e-15
NZ_CP015401.2\|WP_065538815.1\|2356327_2357410_-\|hypothetical-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	0.00540795
NZ_CP015401.2\|WP_065538811.1\|2351246_2352182_-\|Rpn-family-recombination-promoting-nuclease/putative-transposase	gnl\|CDD\|372314	pfam12784, PDDEXK_2, PD-(D/E)XK nuclease family transposase. Members of this family belong to the PD-(D/E)XK nuclease superfamily. These proteins are transposase proteins.	3.6554e-42
NZ_CP015401.2\|WP_065538808.1\|2347676_2348564_-\|Rpn-family-recombination-promoting-nuclease/putative-transposase	gnl\|CDD\|372314	pfam12784, PDDEXK_2, PD-(D/E)XK nuclease family transposase. Members of this family belong to the PD-(D/E)XK nuclease superfamily. These proteins are transposase proteins.	8.78946e-43
NZ_CP015401.2\|WP_065538806.1\|2343841_2344255_+\|N-acetylmuramoyl-L-alanine-amidase	gnl\|CDD\|177282	PHA00447, PHA00447, lysozyme.	1.20785e-41
NZ_CP015401.2\|WP_065538816.1\|2357376_2358510_-\|glycosyltransferase-family-4-protein	gnl\|CDD\|340847	cd03820, GT4_AmsD-like, amylovoran biosynthesis glycosyltransferase AmsD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.	9.39515e-108
NZ_CP015401.2\|WP_065538814.1\|2355233_2356313_-\|glycosyltransferase-family-4-protein	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	2.24243e-33
NZ_CP015401.2\|WP_065538812.1\|2352556_2353645_-\|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase	gnl\|CDD\|133463	cd06853, GT_WecA_like, This subfamily contains Escherichia coli WecA, Bacillus subtilis TagO and related proteins. WecA is an UDP-N-acetylglucosamine (GlcNAc):undecaprenyl-phosphate (Und-P) GlcNAc-1-phosphate transferase that catalyzes the formation of a phosphodiester bond between a membrane-associated undecaprenyl-phosphate molecule and N-acetylglucosamine 1-phosphate, which is usually donated by a soluble UDP-N-acetylglucosamine precursor. WecA participates in the biosynthesis of O antigen LPS in many enteric bacteria and is also involved in the biosynthesis of enterobacterial common antigen. A conserved short sequence motif and a conserved arginine at a cytosolic loop of this integral membrane protein were shown to be critical in recognition of substrate UDP-N-acetylglucosamine.	5.71185e-69
NZ_CP015401.2\|WP_065538807.1\|2346462_2347410_-\|Rpn-family-recombination-promoting-nuclease/putative-transposase	gnl\|CDD\|372314	pfam12784, PDDEXK_2, PD-(D/E)XK nuclease family transposase. Members of this family belong to the PD-(D/E)XK nuclease superfamily. These proteins are transposase proteins.	7.1976e-42
NZ_CP015401.2\|WP_065538813.1\|2354146_2355214_-\|DUF1972-domain-containing-protein	gnl\|CDD\|340858	cd04955, GT4-like, glycosyltransferase family 4 proteins. This family is most closely related to the GT4 family of glycosyltransferases. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in certain bacteria and Archaea.	5.63587e-76

>NZ_CP015401.2|WP_065538808.1|2347676_2348564_-|Rpn-family-recombination-promoting-nuclease/putative-transposase
MRYLDPKADLTFKRVFGEHPDLVMSFLNALLPLSPGQEVTEIEYLPVELVPDNPLRKNSIVDVRCRDNQGRIFLVEMQMIWSSEFKQRVLFNASKAYVRQLDTGENYELLQPVYSLNLVNDIFELDLDDEFYHYYRLVHTEHTEKVIEGLHLVFVELPKFTPQNYSEKKMQVLWLRYLTEINERTREVPKEFLANPELKKAVKALEESAFTDAQLAGYEKFWDIISVEKTLFSSAERRGMRRGLEEGMKKGLEEGKKEGIKEGKKEVARSLKMAGIPTAIIMESTGLLENEIEDL
>NZ_CP015401.2|WP_065538807.1|2346462_2347410_-|Rpn-family-recombination-promoting-nuclease/putative-transposase
MRYLDPKADLTFKRVFGEHPDLVMSFLNALLPLSPGQEVTEIEYLPVELVPDNPLRKNSIVDVRCRDNQGRIFLVEMQMIWSSEFKQRVLFNASKAYVRQLDTGENYELLQPVYSLNLVNDIFELDLDDEFYHYYRLVHTEHTEKVIEGLHLVFVELPKFTPQNYSDKKMQVLWLRYLTEINERTREVPKEFLANPELKKAVKALEESAFTDAQLAGYEKFWDIISVEKTLFSSAERRGMRRGLEEGMKKGLEEGKKEGIKEGIKEGIKEGIKEGIKEGIKEGKKEVARSLKMAGIPTAIIMESTGLSEIEIEDL
>NZ_CP015401.2|WP_065537976.1|2344523_2346215_+|DDE-transposase
MAYKKGEERQQKVLFPDCIDDYVEEDAPVRLFDAFVDSLDMGKLEFIRNIPKATGSPGYDPRDLLKLYIYGYFYQVRSSRKLARECKCNVEVMWLLGKLYPDFRTISDFRKDNKDSITKVFKEFNKFCMGLKLFSKSYISIDGSKFKAVNAKDNNFTLNKLDDRIKRLDEHITLYMEELDSCDREEGRKLSREELEHKLNVCKERKARYEAYRTTLEESNEKQISLTDPDARLMKANEGFCVGYNMQTAVDADSHMIAGFRVTNSPTDHGQITNVATDVKKDYGIDILETTADKGYECPEDHTDALASGIVPNVIRRDGGCTEQVEFEYIGNTITDEQKVSTNPEDLKACLQAGVIPDVYNGILTDMEIVEVKKRTLPTSDSAVLDMTSEQMRAKALEGFFVRDAERNLVYCPQGEILRQKSIKRNGNIRYCNKLACKKCKCKCTISKFKEADFSKDDLIKVADTRRKQDAANDGNANLKPTRITVMKKVVRYVLHLDQKKMDNRKCLSEHPFGTIKRTLGYYYFLLKGFAKVGAEMGLLCLSYNLRRAISLKGVPALLAALR
>NZ_CP015401.2|WP_065538806.1|2343841_2344255_+|N-acetylmuramoyl-L-alanine-amidase
MRTITLIIIHCSATPEGKSLSAEACRQDHILHRGFRDIGYHFYITRDGEIHRGRALEKVGAHCRNHNSHSIGVCYEGGLNADGKPKDTRTMEQRGSLLALLRELRRQFPKALIVGHRDLNPMKGCPCFDCVKEYRDV
>NZ_CP015401.2|WP_157448000.1|2343729_2343837_+|smalltalk-protein
MSKSSSSRSVWSFIIKVIITVATAVGGLLGVQSCI
>NZ_CP015401.2|WP_065538805.1|2342979_2343468_+|DNA-binding-protein
MIRYKIYQNQQKKGLNAGKWFARAVSDETFDLAKLAEHMSKHNSPYSGGVIKGVLSDMVDCIKELLLDGKCVKIDDLAIFGVGIRSKAADTLEEFSLEKNVTGMRLKARATGNLSTTNLKLDSQLKQLAEYQKPTTTGSGSDSGDNPDPKPDGGGEAPDPAA
>NZ_CP015401.2|WP_065538804.1|2342539_2342758_-|DUF4248-domain-containing-protein
MNEFRIRAYGRMELAQLYSPELTDIAAYRKMKKWIERCPGLLQRLYDLGYQPEHRSYTPLEVRVIVDALGEP
>NZ_CP015401.2|WP_065538803.1|2340549_2342412_+|DUF3987-domain-containing-protein
MNNIESLRRLTETVETAGADIAPTYIEYIQLAFAIATDCGEAGRNYFHRLCRLSAKYQREHTERVFSNALATKHGDVHLGTAFHLAGIAGVELHQDSVMNKPKGTKGTEDSGATFSTHTCARYKVDNDENTGKEENTQEEEREEEELLSGSEPKQQLPTFPKADWPTLLQRIIAYGKSDALKDVMLLGALTALGATIAPHLRCSYSGKFLHPCLQYFAIAPSASGKSILSYIRLLATPIHDEIRAEVAAKMKIYKKEKAAYEALGKERAKVDAPEMPANKMFIISGNNTGTGILQNIMDSDGIGFICESEADTLSTAINADHGHWSDTLRKAFDHDCLSYNRRTDQEYREVKKSYISLNISGTPSQVKSFIPTTEDGAFSRQLFYYLYGIDQWINQFLEDDLDLEEIFTNLGLEWKKEVEQIKAHGIHTLCLTEEQKKEFNTQFSHLFQRSSIANGREMYSSIARLAVNLCRIMSIVALLRALENPHPYQVKNAPSSGLTPDKGIPEDNIKDNIITRWKLAITPDDFHAVLRLAEPLYRHATHILSFLPSTEISRRSNADRDFLFSQLGDRFTRAQMIEIAESIGIKKNTAITWLKRLTKRGILVKGDSTGVYERACVRV
>NZ_CP015401.2|WP_065538802.1|2339905_2340529_+|virulence-protein-E
MPNDYRMSYFMPPIAPIKDKQGQILTPPTLSPFCEVCIEQVFQMITSNEDLRLLTEQVRNAPDIRIAKTRLLPYVTPCGTFSRRSGKYFLSPSGLVIVDLDHFRSYRETEEMRRVLHDDPLLRPVLTFISPSGLGVKAFVPTYHLSTATGGKQITECMSWAMQYVETAYNTETSVSSETKTKVDFSGKDLVRSCFLSHDPEALFRNI
>NZ_CP015401.2|WP_167371340.1|2339600_2339741_-|hypothetical-protein
MKKEKDYYAALGASVSELLKRTCLTNKNVCKALGIGHDPLNELKKG
>NZ_CP015401.2|WP_065538810.1|2350068_2350980_-|Rpn-family-recombination-promoting-nuclease/putative-transposase
MRYLDPKADLTFKRVFGEHPDLVMSFLNALLPLSPGQEVTEIEYLPVELVPDNPLRKNSIVDVRCRDNQGRIFLVEMQMIWSSEFKQRVLFNASKAYVRQLDTGENYELLQPVYSLNLVNDIFELDLDDEFYHYYRLVHTEHTEKVIEGLHLVFVELPKFTPQNYSDKKMQVLWLRYLTEINERTREVPKEFLANPELKKAVKALEESAFTDAQLAGYEKFWDIISVEKTLFSSAERRGMRRGLEEGMKKGLEEGKKEGIKEGIKEGIKEGKKEVARSLKMAGIPTAIIMESTGLSEVEIEDL
>NZ_CP015401.2|WP_065538811.1|2351246_2352182_-|Rpn-family-recombination-promoting-nuclease/putative-transposase
MRYLDPKADLTFKRVFGEHPDLVMSFLNALLPLSPGQEVTEIEYLPVELVPDNPLRKNSIVDVRCRDNQGRIFLVEMQMIWSSEFKQRVLFNASKAYVRQLDTGENYELLQPVYSLNLVNDIFELDLDDEFYHYYRLVHTEHTEKVIEGLHLVFVELPKFTPQNYSDKKMQVLWLRYLTEINERTREVPKEFLANPELKKAVKALEESAFTDAQLAGYEKFWDIISVEKTLFSSAERRGMRRGLEEGMKKGLEEGKKEGIKEGKKEGIKEGIKEGIKEGKKEVARSLKMAGIPTAIIMESTGLSEVEIEDL
>NZ_CP015401.2|WP_065538812.1|2352556_2353645_-|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase
MKYLLMALAFLISVFIARMIIPRILLISYRKKLFDSQEERKVHKGAIPRLGGVSFFPTILFSCCGVLAFYNLFGYYVSTLHDDRILSEMLLLVCGLVLLYLTGIADDLIGVRYGNKMAVQLVSACLFPLSGLWINDLYGLFGLGMIPQFWGGLLTVLVVILITNAINLIDGIDGLASGLSSVSLVVLGALFLEREMWSCSLIAFSSFGVLVPFFYYNVFGKAERARKIFMGDTGSLTLGYILSFLAIKYSQNLDGIPKEHGPLVIAFSTLLVPVFDAIRVAIVRMYKGRNPFEPDKTHIHHLFLKMGFTVRQALLMILLLSCILSGLNIWLIPYVENTVMLLLDMLVWIGLNIWWMKRIKMV
>NZ_CP015401.2|WP_065538813.1|2354146_2355214_-|DUF1972-domain-containing-protein
MKNITIVGTQGVPANYGGFESLVENIIGENKSPNMNYTVFCSSKDLPQQINEYKSAKLKYIPLSANGIQSIPYDMLSLLKVPKETDVILVLGVSGSLIFPFFRLFSKKKLVMNIDGLEHRRNKWSKAAKWYLKISEKMAVKYADVIIADNKGIQDYVKEEYGKDSVLIAYGGDHVIRDIEPRFEDDILRKFALIPNDYAITVCRIEPENNCHNTLEAFSKTDKKLIFIGNWNRSEYGRNLKEKYSKFPNIIIQDPIYDIDILYALRKNAEMYIHGHSAGGTNPSLVEAMFFGCPILCYDVVYNRASTQNEAYYWKDVCELVDLLKRTDLCGDAMRSIAQKEYTWKMIASQYEALY
>NZ_CP015401.2|WP_065538814.1|2355233_2356313_-|glycosyltransferase-family-4-protein
MNITCFHLYNDYSGSPKVLRNIVEGLLDKKHKVTIVTSKTNGVLNDLFEVDNLNYEYFNYHPSSNKFLWICHFIYAQVSLFLKALKYQDSSVFYINTIMPVGAAIAGRLLNKKVVYHYHENAFIKSSFYRVLYRIMLIIADEIICVSKYQRSFLPQSNNISVVYNALPESFICKLVPNMNKAFNKKNILMVSSLVLYKSPIEFITLAQKLPLYKFTLVLNDTQTAIENFISKYNIKVPNNIKIYPRQSDISRFYNEASILLNLSNRKKFIETFGMTALEGMSAGIPVIVPTVGGIAELVDDDINGYKIDVQQLDIIADRIKYMLSDIDIYSELAKGALTTAALYSNKYMCEGIETILVQ
>NZ_CP015401.2|WP_065538815.1|2356327_2357410_-|hypothetical-protein
MDKFVQKYYSVATDKYAILLVYFIHFKFFLQIVLDIESVIMNVLLYVFLLLGIDYKRVKYSFLILIPILGVCILNVAARNIFVILLSTYIVSQLSLKTILFHNLSAQLIIFFLSSICLFFGITTSELFQQTVLDMRIRYDYGMGNPNTFALFIYSFIINLYLYKGIYYKKYLFIIGMIAWMVFSYTGSRTFFMSVLILLIFRVLGKLWARYPLILKFLLITTPILIFSAVFYFSQNYISYPEVNLLFSGRLDLYNKLLSLVGYFDYLIGTDLINTETIDSSFLHLLFEGGVIPFSLFVLLYFNFIRKADKNQLSAIVPLMASVFTVALTESVLTFVLIFGNMIIWILLYKTYLNKRIPLY
>NZ_CP015401.2|WP_065538816.1|2357376_2358510_-|glycosyltransferase-family-4-protein
MRLLYCIPSLTNCGGTERVLTTRLNYLAERTSYELYIVTTEDQIRKPFFDLNSKISIINLNINFNEEKTFLSKLLNYKSKLKLYKAKLWSVIQEIKPDIVTSLLSHEIDFLSDLNDGSIKIGENHFNRNFRYSFVKNNSKNILRHTIAKYRDFELGHNVKKLDVLVTLTQEDASLWSDGVKKHIIPNPLSFVKEYKSEGNTKRVVAAGRLTKEKGFDLLLHAWELIFPLFPDWSLAIYGEGEEYSNLQSIIEGKKLKNVQINPFDENISEQFVNSDFYVLSSRFEGFGLVIIEAMECGLPVVSFDCKSGPKEIISDGEDGILVNNGDISALADAMTHLMKNSHIRSSMSKSAIEKAAKFNLDNIMGKWISLYKSTIQ
>NZ_CP015401.2|WP_065538817.1|2358521_2359304_-|LicD-family-protein
MIDEKLQNDLRAKYNPEGSQLRQHQLRTLEILKIVDIICREHDINYWLSSGTLLGAVRHKGFIPWDDDVDIEMLRDDFKKFNEIIPQYLPENFKLQNHKTDKCYYWPFSKVRDERYPIKEVCNTDIRYKYHGVYIDVFCIEKGSLFFSKISKWLHYRLCLGRSCYKSTPKLYLSLVYNTLTHLVYPFFRLCMFFRPDSKLFQTYGSGFHRYRTMEDIFPLTKIEFEGYKFNAPKDSHAYLQKIFGDYMKMPNENNIVSHI
>NZ_CP015401.2|WP_065538818.1|2359305_2360400_-|CapA-family-protein
MKDLHISFVGDIMPGGVLAYQDRFYTDSIKEYLSGFDLRVATLEVAIGDNISFDEIKMKGRCNIIYSKNESIAKIVELNINIVSLANNHIFDLGFEGFENTIKLLGENKICYCGAGRNIEEARRPVLIEMHGKTIAFLAYCDYDFPTIGYVPIATENSYGINPLNIDSAVADIKKYKEKCDFVVILPHWGVEYNRFPTKKMKDYGKMMIDAGADLIIGSHAHIVQPSIRYKKKHIFYGLGNFLFPDFYMYPPRPIWYPSVVGDNHSMNITYDYPFPIKNPLKRVWREASRVGLMVEVVISKDFNISSRLSILRRDNIVELYTNKKLDRKLSLLSIIVSSPLYNGGTLIGKLMAKVNSLLFLIKK
>NZ_CP015401.2|WP_065538819.1|2360408_2361875_-|lipopolysaccharide-biosynthesis-protein
MAISLKQQTISGMIWSFLQRFGSMGVSFISNIIFARLLTPDDYGCIGMLTIFIALSNTFIDGGFGSALIQKKRPTQEDYSTIFYWNVFLSIVLYAILFLCAPLIADFYNIEILSKILQVEGIILIINALGIIQNNQLRKQLKFKSIAHITLTASIVSVIVAIVMAYMGYGVWSLVAQQIVLSFVSTLLYWIHGSWRPSRTFSARSFKELFGFGSFILLSSLLNAFCNNLNGLLIGKFFNASSMGYFTQAKKLEDVFSSSIETVVGQVTYPVLVEVKDKNDELKKMLSQFNSLLLYVVTPLMLLLNLFAKPIISLLLGVEWLPAVPYLEILAFQGIAISIQNVNYNAVASIGRSKNLFVSTVIKRSVSVASLIVGLKVGGIEGLLWGMVVSSFFICLYNSIMVHQYIGYKLLEQLTDLLSIILINGVTYICVYAIKCYVSINGFVWYLIMLVAYISIYLLLSYVSNIRTLTLISNITKDLLHRVVNKRL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP015401_2	2.1\|2348952\|18\|NZ_CP015401\|CRT	2348952-2348969	18	NZ_CP015401.2	2346620-2346637	0	1.0
NZ_CP015401_2	2.1\|2348952\|18\|NZ_CP015401\|CRT	2348952-2348969	18	NZ_CP015401.2	2350190-2350207	0	1.0
NZ_CP015401_2	2.1\|2348952\|18\|NZ_CP015401\|CRT	2348952-2348969	18	NZ_CP015401.2	2351368-2351385	0	1.0
NZ_CP015401_2	2.3\|2349036\|18\|NZ_CP015401\|CRT	2349036-2349053	18	NZ_CP015401.2	2346644-2346661	0	1.0
NZ_CP015401_2	2.3\|2349036\|18\|NZ_CP015401\|CRT	2349036-2349053	18	NZ_CP015401.2	2347798-2347815	0	1.0
NZ_CP015401_2	2.3\|2349036\|18\|NZ_CP015401\|CRT	2349036-2349053	18	NZ_CP015401.2	2350214-2350231	0	1.0
NZ_CP015401_2	2.3\|2349036\|18\|NZ_CP015401\|CRT	2349036-2349053	18	NZ_CP015401.2	2351416-2351433	0	1.0
NZ_CP015401_2	2.1\|2348952\|18\|NZ_CP015401\|CRT	2348952-2348969	18	NZ_CP015401.2	2351356-2351373	1	0.944
NZ_CP015401_2	2.2\|2348988\|30\|NZ_CP015401\|CRT	2348988-2349017	30	NZ_CP015401.2	2346560-2346589	1	0.967
NZ_CP015401_2	2.2\|2348988\|30\|NZ_CP015401\|CRT	2348988-2349017	30	NZ_CP015401.2	2350166-2350195	2	0.933
NZ_CP015401_2	2.2\|2348988\|30\|NZ_CP015401\|CRT	2348988-2349017	30	NZ_CP015401.2	2351392-2351421	2	0.933

1. spacer 2.1|2348952|18|NZ_CP015401|CRT matches to position: 2346620-2346637, mismatch: 0, identity: 1.0

ataccttcttttatacct	CRISPR spacer
ataccttcttttatacct	Protospacer
******************

2. spacer 2.1|2348952|18|NZ_CP015401|CRT matches to position: 2350190-2350207, mismatch: 0, identity: 1.0

ataccttcttttatacct	CRISPR spacer
ataccttcttttatacct	Protospacer
******************

3. spacer 2.1|2348952|18|NZ_CP015401|CRT matches to position: 2351368-2351385, mismatch: 0, identity: 1.0

ataccttcttttatacct	CRISPR spacer
ataccttcttttatacct	Protospacer
******************

4. spacer 2.3|2349036|18|NZ_CP015401|CRT matches to position: 2346644-2346661, mismatch: 0, identity: 1.0

ttgccttcttccaagcct	CRISPR spacer
ttgccttcttccaagcct	Protospacer
******************

5. spacer 2.3|2349036|18|NZ_CP015401|CRT matches to position: 2347798-2347815, mismatch: 0, identity: 1.0

ttgccttcttccaagcct	CRISPR spacer
ttgccttcttccaagcct	Protospacer
******************

6. spacer 2.3|2349036|18|NZ_CP015401|CRT matches to position: 2350214-2350231, mismatch: 0, identity: 1.0

ttgccttcttccaagcct	CRISPR spacer
ttgccttcttccaagcct	Protospacer
******************

7. spacer 2.3|2349036|18|NZ_CP015401|CRT matches to position: 2351416-2351433, mismatch: 0, identity: 1.0

ttgccttcttccaagcct	CRISPR spacer
ttgccttcttccaagcct	Protospacer
******************

8. spacer 2.1|2348952|18|NZ_CP015401|CRT matches to position: 2351356-2351373, mismatch: 1, identity: 0.944

ataccttcttttatacct	CRISPR spacer
atgccttcttttatacct	Protospacer
**.***************

9. spacer 2.2|2348988|30|NZ_CP015401|CRT matches to position: 2346560-2346589, mismatch: 1, identity: 0.967

ttgccttcctttataccttcctttatgcct	CRISPR spacer
ttgccttcctttatgccttcctttatgcct	Protospacer
**************.***************

10. spacer 2.2|2348988|30|NZ_CP015401|CRT matches to position: 2350166-2350195, mismatch: 2, identity: 0.933

ttgccttcctttataccttcctttatgcct	CRISPR spacer
ttgccttcctttatgccttcctttatacct	Protospacer
**************.***********.***

11. spacer 2.2|2348988|30|NZ_CP015401|CRT matches to position: 2351392-2351421, mismatch: 2, identity: 0.933

ttgccttcctttataccttcctttatgcct	CRISPR spacer
ttgccttcctttataccttcttttttgcct	Protospacer
********************.*** *****

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP015401_2	2.2\|2348988\|30\|NZ_CP015401\|CRT	2348988-2349017	30	NZ_CP042928	Bacillus cereus strain G1-1 plasmid unnamed, complete sequence	139923-139952	6	0.8
NZ_CP015401_2	2.2\|2348988\|30\|NZ_CP015401\|CRT	2348988-2349017	30	NZ_CP040343	Bacillus cereus strain DLOU-Weihai plasmid unnamed1, complete sequence	139342-139371	6	0.8
NZ_CP015401_2	2.2\|2348988\|30\|NZ_CP015401\|CRT	2348988-2349017	30	NZ_CP040341	Bacillus cereus strain DLOU-Tangshan plasmid unnamed1, complete sequence	163328-163357	6	0.8
NZ_CP015401_2	2.2\|2348988\|30\|NZ_CP015401\|CRT	2348988-2349017	30	NZ_CP027420	Staphylococcus cohnii strain FDAARGOS_334 plasmid unnamed1, complete sequence	25563-25592	7	0.767

1. spacer 2.2|2348988|30|NZ_CP015401|CRT matches to NZ_CP042928 (Bacillus cereus strain G1-1 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

ttgccttcctttataccttcctttatgcct	CRISPR spacer
tggtctgcctttataccttcctttataatt	Protospacer
* *.** *******************. .*

2. spacer 2.2|2348988|30|NZ_CP015401|CRT matches to NZ_CP040343 (Bacillus cereus strain DLOU-Weihai plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

ttgccttcctttataccttcctttatgcct	CRISPR spacer
tggtctgcctttataccttcctttataatt	Protospacer
* *.** *******************. .*

3. spacer 2.2|2348988|30|NZ_CP015401|CRT matches to NZ_CP040341 (Bacillus cereus strain DLOU-Tangshan plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

ttgccttcctttataccttcctttatgcct	CRISPR spacer
tggtctgcctttataccttcctttataatt	Protospacer
* *.** *******************. .*

4. spacer 2.2|2348988|30|NZ_CP015401|CRT matches to NZ_CP027420 (Staphylococcus cohnii strain FDAARGOS_334 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttgccttcctttataccttcctttatgcct	CRISPR spacer
ttgcatttctttataccttccttattgaac	Protospacer
**** **.***************  **  .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

497162 : 505858

Arthrobacter_phage(16.67%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065537738.1\|497162_498131_+	M23 family metallopeptidase	V5R8R0	Arthrobacter_phage	5.8e-19	53.0
WP_065537739.1\|498157_498502_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_065537740.1\|498538_500776_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2I2L310	Orpheovirus	1.2e-11	37.0
WP_065537741.1\|500848_502144_-	lytic transglycosylase domain-containing protein	A0A0S2SXN2	Bacillus_phage	5.7e-14	42.5
WP_065537742.1\|502177_503065_-	hypothetical protein	NA	NA	NA	NA
WP_004301392.1\|503065_503956_-	ParB/RepB/Spo0J family partition protein	S5VSZ7	Leptospira_phage	3.3e-13	36.3
WP_004310990.1\|503971_504736_-	ParA family protein	Q8JL10	Natrialba_phage	5.7e-22	34.8
WP_065537743.1\|505090_505858_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	8.0e-32	33.5

DBSCAN-SWA_2

967330 : 1007200

Leptospira_phage(11.11%)

integrase

attL 962157:962172|attR 1008391:1008406

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
962157:962172	attL	NA	NA	NA	NA
WP_065538037.1\|967330_968437_-\|integrase	site-specific integrase	S5W9T9	Leptospira_phage	3.1e-29	33.6
WP_065540271.1\|968562_969174_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_065540273.1\|969321_970602_-	DNA methylase	H2DE57	Erwinia_phage	1.4e-17	26.8
WP_065540272.1\|970603_972289_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.1e-133	48.9
WP_008640397.1\|974108_975320_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_008640396.1\|975316_976273_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_055256750.1\|976256_977270_+\|integrase	tyrosine-type recombinase/integrase	G1D5R6	Mycobacterium_phage	5.3e-07	25.1
WP_065538039.1\|977661_979701_+	phosphotransferase	NA	NA	NA	NA
WP_008640392.1\|979681_979975_+	hypothetical protein	NA	NA	NA	NA
WP_084081109.1\|980175_983928_-	N-6 DNA methylase	A0A240F4T3	Ochrobactrum_phage	4.1e-36	34.4
WP_065538040.1\|983917_984370_-	DUF1896 domain-containing protein	NA	NA	NA	NA
WP_065538041.1\|984534_986625_-	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	3.6e-42	30.9
WP_065538042.1\|986684_988259_-	DUF4099 domain-containing protein	NA	NA	NA	NA
WP_065538043.1\|988289_988640_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_024988120.1\|988661_989021_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_065540274.1\|989234_989519_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_071807633.1\|989515_989812_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_024988123.1\|989900_990272_-	hypothetical protein	NA	NA	NA	NA
WP_065538044.1\|990283_991519_-\|integrase	site-specific integrase	H7BUI8	unidentified_phage	1.1e-27	30.4
WP_065538045.1\|991901_993275_+	MATE family efflux transporter	NA	NA	NA	NA
WP_065538046.1\|993314_995057_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_004308264.1\|995577_996042_+	MaoC family dehydratase	NA	NA	NA	NA
WP_065538047.1\|996160_996685_-	hypothetical protein	NA	NA	NA	NA
WP_065538048.1\|996703_998143_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_065538049.1\|998219_999101_-	class A beta-lactamase, subclass A2	NA	NA	NA	NA
WP_065538050.1\|999388_1000585_+	hypothetical protein	NA	NA	NA	NA
WP_065540275.1\|1003227_1005318_+	DUF3874 domain-containing protein	I6R9Q6	Nonlabens_phage	1.8e-25	28.3
WP_065538052.1\|1005419_1005854_-	hypothetical protein	NA	NA	NA	NA
WP_065538053.1\|1006273_1007200_-\|integrase	site-specific integrase	A0A0U4JNS1	Bacillus_phage	1.3e-20	28.1
1008391:1008406	attR	NA	NA	NA	NA

DBSCAN-SWA_3

1122502 : 1244373

unidentified_phage(13.33%)

integrase,transposase

attL 1206405:1206422|attR 1230707:1230724

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_101602535.1\|1122502_1123657_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_065538120.1\|1123818_1124046_-	hypothetical protein	NA	NA	NA	NA
WP_141243559.1\|1124049_1124418_-	hypothetical protein	NA	NA	NA	NA
WP_141243558.1\|1124458_1124710_+	hypothetical protein	NA	NA	NA	NA
WP_141243557.1\|1124796_1125867_-	prolyl oligopeptidase family serine peptidase	NA	NA	NA	NA
WP_065538123.1\|1127454_1127880_-	hypothetical protein	NA	NA	NA	NA
WP_065540286.1\|1128673_1128985_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_024988824.1\|1129038_1129344_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_065538124.1\|1129692_1130067_-	hypothetical protein	NA	NA	NA	NA
WP_065538125.1\|1130088_1131309_-\|integrase	site-specific integrase	H7BUI8	unidentified_phage	2.4e-14	27.1
WP_065538126.1\|1131324_1132554_-\|integrase	site-specific integrase	H7BUI8	unidentified_phage	5.4e-22	29.4
WP_089280703.1\|1132656_1133019_+\|integrase	tyrosine-type recombinase/integrase	Q4ZB10	Staphylococcus_virus	2.3e-05	43.4
WP_065538128.1\|1133333_1133687_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_065538129.1\|1133683_1134283_+	virulence protein E	S0A0F1	Cellulophaga_phage	2.4e-07	27.4
WP_065538130.1\|1134233_1136039_+	DUF3987 domain-containing protein	M1PL02	Cellulophaga_phage	2.7e-14	44.0
WP_005816342.1\|1136140_1136509_+	MobC family plasmid mobilization relaxosome protein	NA	NA	NA	NA
WP_065538131.1\|1136492_1137392_+	relaxase/mobilization nuclease domain-containing protein	NA	NA	NA	NA
WP_065538132.1\|1137391_1138045_+	hypothetical protein	NA	NA	NA	NA
WP_065538133.1\|1138072_1138591_-	DNA mismatch endonuclease Vsr	E5E3X5	Burkholderia_phage	4.6e-31	47.2
WP_065538134.1\|1138667_1142798_-	hypothetical protein	A0A2H4PQV1	Staphylococcus_phage	1.4e-34	31.7
WP_065538135.1\|1142838_1145082_-	DUF2357 domain-containing protein	NA	NA	NA	NA
WP_065538136.1\|1146961_1148161_-	DNA cytosine methyltransferase	A7XXH6	Thermus_virus	2.1e-39	31.5
WP_065538137.1\|1148175_1148385_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_065538138.1\|1148522_1149233_-	hypothetical protein	NA	NA	NA	NA
WP_065540287.1\|1149249_1150791_-	HTH domain-containing protein	NA	NA	NA	NA
WP_065538139.1\|1150972_1152175_+\|transposase	IS110 family transposase	Q9JMN8	Wolbachia_phage	7.4e-32	26.5
WP_024988655.1\|1152832_1153009_+	DUF4250 domain-containing protein	NA	NA	NA	NA
WP_157447987.1\|1153028_1153169_-	hypothetical protein	NA	NA	NA	NA
WP_065538140.1\|1153211_1153751_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_024988653.1\|1153755_1154112_+	hypothetical protein	NA	NA	NA	NA
WP_065540288.1\|1154144_1154705_+	hypothetical protein	NA	NA	NA	NA
WP_065538141.1\|1154941_1155775_-	deoxyribonuclease IV	A0A1V0SBL9	Catovirus	9.3e-26	31.8
WP_065540289.1\|1156774_1159390_-	DUF4962 domain-containing protein	NA	NA	NA	NA
WP_065538142.1\|1159404_1160376_-	ROK family protein	NA	NA	NA	NA
WP_065538143.1\|1160424_1162053_-	Tat pathway signal sequence	NA	NA	NA	NA
WP_065538144.1\|1162077_1163688_-	sulfatase	A0A2P0VMN7	Tetraselmis_virus	2.4e-14	23.5
WP_065538145.1\|1163852_1165853_-	heparinase	NA	NA	NA	NA
WP_065538146.1\|1165912_1167217_-	glucuronyl hydrolase	NA	NA	NA	NA
WP_055235959.1\|1167420_1169103_-	RagB/SusD family nutrient uptake outer membrane protein	NA	NA	NA	NA
WP_065538147.1\|1169120_1172276_-	TonB-dependent receptor	NA	NA	NA	NA
WP_065538148.1\|1172302_1174498_-	DUF4958 family protein	NA	NA	NA	NA
WP_065538149.1\|1174516_1176694_-	heparinase	NA	NA	NA	NA
WP_065538150.1\|1177469_1181531_-	response regulator	W8CYF6	Bacillus_phage	8.0e-22	31.7
WP_065540290.1\|1181740_1183111_-	TrpB-like pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_065540291.1\|1183243_1185073_+	potassium transporter	NA	NA	NA	NA
WP_065538151.1\|1185077_1185764_+	TrkA family potassium uptake protein	NA	NA	NA	NA
WP_065540292.1\|1185895_1188337_-	glycoside hydrolase family 2 protein	NA	NA	NA	NA
WP_065538152.1\|1188455_1189004_+	DUF4738 domain-containing protein	NA	NA	NA	NA
WP_065538153.1\|1189126_1190323_+	heparitin sulfate lyase	NA	NA	NA	NA
WP_084081114.1\|1191973_1192816_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_065538155.1\|1192797_1194351_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_065538156.1\|1195177_1195546_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_158213959.1\|1195623_1197189_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	7.5e-53	30.9
WP_065538158.1\|1197571_1198648_-	hypothetical protein	NA	NA	NA	NA
WP_065538159.1\|1198652_1199990_-	hypothetical protein	NA	NA	NA	NA
WP_065538160.1\|1199991_1200954_-	hypothetical protein	NA	NA	NA	NA
WP_065538161.1\|1200953_1202213_-	methyltransferase	NA	NA	NA	NA
WP_065538162.1\|1203932_1205084_+\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_016272192.1\|1205719_1205977_+	hypothetical protein	NA	NA	NA	NA
WP_157447988.1\|1206224_1206824_-	hypothetical protein	NA	NA	NA	NA
1206405:1206422	attL	NA	NA	NA	NA
WP_065538164.1\|1206827_1208159_-	AAA family ATPase	NA	NA	NA	NA
WP_065538166.1\|1210902_1211283_+	single-stranded DNA-binding protein	NA	NA	NA	NA
WP_157447989.1\|1211377_1211545_-	hypothetical protein	NA	NA	NA	NA
WP_004319494.1\|1211690_1211933_+	hypothetical protein	NA	NA	NA	NA
WP_004319491.1\|1211943_1212246_+	hypothetical protein	NA	NA	NA	NA
WP_004319490.1\|1212295_1212490_+	hypothetical protein	NA	NA	NA	NA
WP_081354200.1\|1212793_1213255_+	DUF1273 family protein	NA	NA	NA	NA
WP_084081197.1\|1213700_1216817_+	N-6 DNA methylase	NA	NA	NA	NA
WP_008640397.1\|1216873_1218085_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_008640396.1\|1218081_1219038_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_065538169.1\|1219251_1220229_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_065538039.1\|1221461_1223501_+	phosphotransferase	NA	NA	NA	NA
WP_008640392.1\|1223481_1223775_+	hypothetical protein	NA	NA	NA	NA
WP_065540272.1\|1225710_1227396_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.1e-133	48.9
WP_065540293.1\|1227379_1228465_+	DNA methylase	NA	NA	NA	NA
WP_167371349.1\|1229222_1230947_+	ParB/RepB/Spo0J family partition protein	I3NLC2	Bifidobacterium_phage	2.1e-19	35.6
1230707:1230724	attR	NA	NA	NA	NA
WP_034523143.1\|1231073_1231418_-	hypothetical protein	NA	NA	NA	NA
WP_065538172.1\|1231603_1231861_-	hypothetical protein	NA	NA	NA	NA
WP_004319482.1\|1231877_1232162_+	hypothetical protein	NA	NA	NA	NA
WP_005836232.1\|1232175_1232418_+	hypothetical protein	NA	NA	NA	NA
WP_005836231.1\|1232414_1232720_+	hypothetical protein	NA	NA	NA	NA
WP_065538173.1\|1232814_1233402_-	recombinase family protein	NA	NA	NA	NA
WP_065538174.1\|1233769_1234885_+	hypothetical protein	NA	NA	NA	NA
WP_005836226.1\|1234901_1235348_+	hypothetical protein	NA	NA	NA	NA
WP_004319471.1\|1235348_1235699_+	hypothetical protein	NA	NA	NA	NA
WP_005836224.1\|1235712_1236228_+	hypothetical protein	NA	NA	NA	NA
WP_065538175.1\|1236283_1237108_+	hypothetical protein	NA	NA	NA	NA
WP_065538176.1\|1237333_1238794_+	recombinase	NA	NA	NA	NA
WP_065538177.1\|1240458_1241478_-	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_084081115.1\|1241455_1242100_-	hypothetical protein	NA	NA	NA	NA
WP_065538178.1\|1242462_1242987_+	hypothetical protein	NA	NA	NA	NA
WP_065538179.1\|1243021_1243372_+	hypothetical protein	NA	NA	NA	NA
WP_065538169.1\|1243395_1244373_+\|transposase	IS982 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

1269238 : 1327172

Lactococcus_phage(13.33%)

integrase,transposase

attL 1268343:1268379|attR 1332108:1332144

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1268343:1268379	attL	NA	NA	NA	NA
WP_065538200.1\|1269238_1270804_-\|transposase	IS21 family transposase	A0A059NT83	Lactococcus_phage	6.5e-12	26.3
WP_008667781.1\|1271326_1272685_-\|transposase	transposase	NA	NA	NA	NA
WP_028728885.1\|1273044_1273539_-	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_032532248.1\|1273571_1274522_-	hypothetical protein	NA	NA	NA	NA
WP_065540299.1\|1274586_1274811_-	hypothetical protein	NA	NA	NA	NA
WP_007558978.1\|1274934_1275447_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_065538201.1\|1275505_1276126_-	hypothetical protein	NA	NA	NA	NA
WP_065538202.1\|1276199_1276817_-	hypothetical protein	NA	NA	NA	NA
WP_065538203.1\|1276896_1278657_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	3.6e-27	28.6
WP_065538204.1\|1278744_1279089_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_065538205.1\|1279090_1279459_-	hypothetical protein	NA	NA	NA	NA
WP_065538206.1\|1279634_1280354_-	hypothetical protein	NA	NA	NA	NA
WP_065540300.1\|1280432_1280759_-	hypothetical protein	NA	NA	NA	NA
WP_004295476.1\|1280837_1281368_-	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_065538207.1\|1281458_1281887_-	hypothetical protein	NA	NA	NA	NA
WP_065538208.1\|1281978_1282383_-	1,3-beta-glucan synthase regulator	NA	NA	NA	NA
WP_141243568.1\|1282445_1282970_-	hypothetical protein	NA	NA	NA	NA
WP_065538210.1\|1283034_1283337_-	hypothetical protein	NA	NA	NA	NA
WP_065538211.1\|1283416_1283821_-	hypothetical protein	NA	NA	NA	NA
WP_065540301.1\|1283902_1285027_-\|integrase	tyrosine-type recombinase/integrase	A0A1P8DJJ6	Virus_Rctr41k	7.1e-29	29.2
WP_005842515.1\|1285289_1285823_-	hypothetical protein	NA	NA	NA	NA
WP_005842513.1\|1285827_1286523_-	DUF3800 domain-containing protein	I3NLD4	Bifidobacterium_phage	7.5e-29	36.7
WP_065538212.1\|1286709_1288230_+	DUF3945 domain-containing protein	NA	NA	NA	NA
WP_065538213.1\|1288516_1289746_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_065538214.1\|1289738_1290746_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_065538215.1\|1290750_1291776_+\|integrase	site-specific integrase	A0A0E3M2X0	Bacillus_phage	1.8e-07	22.7
WP_065538216.1\|1293958_1294435_+	hypothetical protein	NA	NA	NA	NA
WP_004327332.1\|1294667_1295717_+	hypothetical protein	NA	NA	NA	NA
WP_004327330.1\|1295721_1296108_+	type II toxin-antitoxin system RnlB family antitoxin	NA	NA	NA	NA
WP_158213962.1\|1296349_1296688_+	hypothetical protein	NA	NA	NA	NA
WP_065538218.1\|1297113_1297722_+	master DNA invertase Mpi family serine-type recombinase	H2A0H0	Bacteroides_phage	3.6e-67	70.6
WP_065538219.1\|1297733_1298648_+	type II restriction endonuclease subunit M	NA	NA	NA	NA
WP_065538220.1\|1298649_1302462_-	class I SAM-dependent DNA methyltransferase	A0A1B1IUC6	uncultured_Mediterranean_phage	1.3e-10	27.0
WP_065538221.1\|1302627_1303830_+\|transposase	IS110 family transposase	Q9JMN8	Wolbachia_phage	7.4e-32	26.5
WP_065538222.1\|1304219_1304615_-	hypothetical protein	NA	NA	NA	NA
WP_065538223.1\|1304648_1305605_-	relaxase/mobilization nuclease domain-containing protein	NA	NA	NA	NA
WP_065538224.1\|1305594_1305903_-	plasmid mobilization relaxosome protein MobC	NA	NA	NA	NA
WP_084081198.1\|1306062_1306410_-	hypothetical protein	NA	NA	NA	NA
WP_065538200.1\|1306680_1308246_+\|transposase	IS21 family transposase	A0A059NT83	Lactococcus_phage	6.5e-12	26.3
WP_065538226.1\|1308235_1309009_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	1.3e-37	37.0
WP_065538227.1\|1309270_1310926_-\|transposase	IS1182 family transposase	A0A146ICT8	Staphylococcus_phage	7.4e-67	38.7
WP_065540302.1\|1311573_1312782_-	L-serine ammonia-lyase	NA	NA	NA	NA
WP_065538228.1\|1312937_1315439_-	endonuclease MutS2	NA	NA	NA	NA
WP_065538229.1\|1315857_1316997_-	DNA alkylation repair protein	NA	NA	NA	NA
WP_065538230.1\|1317411_1318815_-	mobilization protein	NA	NA	NA	NA
WP_065538231.1\|1319025_1319982_-	DNA primase	NA	NA	NA	NA
WP_065540303.1\|1320194_1321271_-	AAA family ATPase	Q5ZGH5	Flavobacterium_phage	2.6e-28	30.3
WP_071807639.1\|1321285_1321594_-	DUF3853 family protein	NA	NA	NA	NA
WP_065538232.1\|1321817_1322843_-	hypothetical protein	NA	NA	NA	NA
WP_065538233.1\|1322854_1324144_-	DUF1016 family protein	Q9JMP5	Wolbachia_phage	2.2e-66	48.0
WP_065540305.1\|1324209_1325493_-\|integrase	site-specific integrase	S0A3I4	Cellulophaga_phage	1.0e-18	24.7
WP_065538234.1\|1325936_1327172_+\|integrase	site-specific integrase	H7BUI8	unidentified_phage	4.4e-40	34.6
1332108:1332144	attR	NA	NA	NA	NA

DBSCAN-SWA_5

1772171 : 1819274

Stx2-converting_phage(25.0%)

integrase,transposase

attL 1806640:1806654|attR 1820832:1820846

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065538470.1\|1772171_1773953_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	4.7e-27	28.6
WP_065538471.1\|1774114_1774483_+	hypothetical protein	NA	NA	NA	NA
WP_065538472.1\|1774484_1774832_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_065538473.1\|1774914_1776675_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	3.6e-27	28.9
WP_065538474.1\|1776986_1779836_-	aminomethyl-transferring glycine dehydrogenase	E3SN07	Prochlorococcus_phage	2.1e-250	50.2
WP_065540337.1\|1779974_1780613_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_049702941.1\|1780656_1781277_-	16S rRNA (guanine(527)-N(7))-methyltransferase RsmG	NA	NA	NA	NA
WP_065540338.1\|1781390_1782242_-	DUF3298 and DUF4163 domain-containing protein	NA	NA	NA	NA
WP_065538475.1\|1782576_1782975_+	hypothetical protein	NA	NA	NA	NA
WP_065538476.1\|1783099_1785322_+	TonB-dependent receptor	NA	NA	NA	NA
WP_065538477.1\|1785391_1785715_+	cation transporter	NA	NA	NA	NA
WP_065538478.1\|1785815_1788026_+	cadmium-translocating P-type ATPase	A0A218MNH6	uncultured_virus	3.1e-100	34.5
WP_065538479.1\|1788205_1789045_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_065538480.1\|1789110_1789794_+	lipoyl(octanoyl) transferase LipB	NA	NA	NA	NA
WP_065540339.1\|1789750_1790668_-	PorV/PorQ family protein	NA	NA	NA	NA
WP_065538481.1\|1790670_1792227_-	DUF1460 domain-containing protein	NA	NA	NA	NA
WP_065538482.1\|1792233_1794222_-	oligopeptide transporter, OPT family	NA	NA	NA	NA
WP_065538483.1\|1794327_1794723_-	DUF1573 domain-containing protein	NA	NA	NA	NA
WP_044918143.1\|1794820_1795420_-	DUF4923 family protein	NA	NA	NA	NA
WP_065538484.1\|1795433_1796039_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_065538485.1\|1797309_1797927_+	recombination protein RecR	NA	NA	NA	NA
WP_065538486.1\|1797953_1798412_+	hypothetical protein	NA	NA	NA	NA
WP_065538487.1\|1798408_1798945_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_065540340.1\|1798949_1799540_-	YqgE/AlgH family protein	NA	NA	NA	NA
WP_065538488.1\|1799635_1800955_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_065537976.1\|1801533_1803225_+\|transposase	DDE transposase	NA	NA	NA	NA
WP_065538489.1\|1803524_1804124_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_138291934.1\|1804474_1805353_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_065538491.1\|1805379_1806504_+	hypothetical protein	NA	NA	NA	NA
WP_065538492.1\|1806526_1807192_+	hypothetical protein	NA	NA	NA	NA
1806640:1806654	attL	NA	NA	NA	NA
WP_065538493.1\|1807321_1808143_+	RteC domain-containing protein	NA	NA	NA	NA
WP_065538494.1\|1808377_1808788_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_065538495.1\|1808750_1810853_+	AAA family ATPase	A0A1B0WKT7	Flavobacterium_phage	1.6e-10	29.8
WP_065538496.1\|1810827_1811130_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_065540341.1\|1811478_1811964_+	deaminase	NA	NA	NA	NA
WP_065538497.1\|1812059_1813190_-	DUF1016 family protein	A0A0U2BZN7	Salmonella_phage	5.3e-24	38.0
WP_065538498.1\|1813325_1813793_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_065538499.1\|1813789_1815844_-	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	3.1e-46	31.8
WP_065538213.1\|1816014_1817244_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_065538214.1\|1817236_1818244_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_065538215.1\|1818248_1819274_+\|integrase	site-specific integrase	A0A0E3M2X0	Bacillus_phage	1.8e-07	22.7
1820832:1820846	attR	NA	NA	NA	NA

DBSCAN-SWA_6

1955923 : 2079437

102

Bacillus_phage(10.34%)

integrase,protease,transposase,tRNA

attL 1941836:1941851|attR 1993235:1993250

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1941836:1941851	attL	NA	NA	NA	NA
WP_065538546.1\|1955923_1957132_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_065540350.1\|1957594_1958215_+	RNA polymerase sigma-70 factor	NA	NA	NA	NA
WP_065538547.1\|1958222_1959215_+	DUF4974 domain-containing protein	NA	NA	NA	NA
WP_065538548.1\|1959431_1962932_+	TonB-dependent receptor	NA	NA	NA	NA
WP_065538549.1\|1962958_1964704_+	RagB/SusD family nutrient uptake outer membrane protein	NA	NA	NA	NA
WP_065538550.1\|1964733_1965627_+	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_065540351.1\|1965643_1967815_+	hypothetical protein	NA	NA	NA	NA
WP_065538551.1\|1967838_1968717_+	endonuclease/exonuclease/phosphatase family protein	A0A0G2Y8J2	Acanthamoeba_polyphaga_mimivirus	4.9e-09	27.7
WP_065538552.1\|1968929_1969697_+	threonine/serine exporter family protein	NA	NA	NA	NA
WP_065538553.1\|1969698_1970184_+	threonine/serine exporter family protein	NA	NA	NA	NA
WP_065538554.1\|1970195_1970924_+	hypothetical protein	NA	NA	NA	NA
WP_065538555.1\|1971446_1972955_+	4Fe-4S dicluster domain-containing protein	NA	NA	NA	NA
WP_065538556.1\|1972972_1974376_+	aldo/keto reductase	NA	NA	NA	NA
WP_065538557.1\|1974384_1974804_+	DUF1893 domain-containing protein	NA	NA	NA	NA
WP_065538558.1\|1974951_1978938_-	hybrid sensor histidine kinase/response regulator transcription factor	W8CYM9	Bacillus_phage	5.0e-08	31.0
WP_065537581.1\|1979827_1980199_+\|transposase	transposase family protein	NA	NA	NA	NA
WP_065538559.1\|1980239_1981175_+\|transposase	transposase	NA	NA	NA	NA
WP_024988208.1\|1981565_1983059_+\|tRNA	proline--tRNA ligase	A0A2K9L3R9	Tupanvirus	1.5e-95	37.4
WP_065538560.1\|1983197_1983875_+	response regulator transcription factor	W8CYM9	Bacillus_phage	4.6e-31	35.4
WP_065538561.1\|1983891_1985166_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_024988206.1\|1985380_1985818_+	PepSY-like domain-containing protein	NA	NA	NA	NA
WP_024988205.1\|1985839_1986700_+	PepSY-like domain-containing protein	NA	NA	NA	NA
WP_065538562.1\|1986922_1991368_-	translocation/assembly module TamB	NA	NA	NA	NA
WP_065538563.1\|1991568_1992588_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	9.5e-65	42.0
WP_065538564.1\|1992633_1993866_+	competence/damage-inducible protein A	B5TK85	Pseudomonas_phage	4.3e-19	48.4
1993235:1993250	attR	NA	NA	NA	NA
WP_004314359.1\|1993988_1994249_+	50S ribosomal protein L28	NA	NA	NA	NA
WP_002560155.1\|1994270_1994459_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_004295982.1\|1994476_1994635_+	DUF4295 domain-containing protein	NA	NA	NA	NA
WP_065538565.1\|1994773_1995733_+	signal recognition particle-docking protein FtsY	D6PHS7	uncultured_phage	1.7e-18	40.4
WP_065538566.1\|1995729_1997040_+	30S ribosomal protein S12 methylthiotransferase RimO	NA	NA	NA	NA
WP_065538567.1\|1997032_1997305_+	HU family DNA-binding protein	A3E2K9	Sodalis_phage	1.0e-05	32.2
WP_065538568.1\|1997318_1998653_+	HU family DNA-binding protein	NA	NA	NA	NA
WP_065538569.1\|1998891_1999887_+	AAA family ATPase	NA	NA	NA	NA
WP_065538570.1\|1999969_2000839_+	DUF58 domain-containing protein	NA	NA	NA	NA
WP_065538571.1\|2000838_2001927_+	hypothetical protein	NA	NA	NA	NA
WP_065538572.1\|2001976_2002960_+	VWA domain-containing protein	NA	NA	NA	NA
WP_065538573.1\|2003005_2004034_+	VWA domain-containing protein	NA	NA	NA	NA
WP_065538574.1\|2004036_2004765_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_065538575.1\|2004796_2006626_+	protein BatD	NA	NA	NA	NA
WP_065538576.1\|2006644_2007478_+	SH3 domain-containing protein	NA	NA	NA	NA
WP_004295969.1\|2007606_2007897_+	hypothetical protein	NA	NA	NA	NA
WP_016272333.1\|2008209_2008578_+	hypothetical protein	NA	NA	NA	NA
WP_065538204.1\|2008579_2008924_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_065538577.1\|2009010_2010792_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	8.1e-27	27.3
WP_008022355.1\|2011449_2012664_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_065538578.1\|2012696_2015273_-	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	1.6e-113	33.1
WP_065538579.1\|2015628_2018160_+\|protease	ATP-dependent Clp protease ATP-binding subunit	K4FB40	Cronobacter_phage	3.1e-125	40.9
WP_065540352.1\|2018293_2020339_+	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	1.9e-48	28.0
WP_065538580.1\|2020510_2022811_+	patatin	A0A1V0SCG0	Catovirus	1.0e-13	26.0
WP_065538559.1\|2023270_2024206_-\|transposase	transposase	NA	NA	NA	NA
WP_065537581.1\|2024246_2024618_-\|transposase	transposase family protein	NA	NA	NA	NA
WP_065538581.1\|2025142_2026798_-\|transposase	IS1182 family transposase	A0A146ICT8	Staphylococcus_phage	7.4e-67	38.7
WP_065538582.1\|2026967_2027861_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_065538583.1\|2027920_2029921_-	NAD-dependent DNA ligase LigA	A0A0A8J9A9	Ralstonia_phage	7.0e-104	35.2
WP_004312919.1\|2029996_2030674_+\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_065538584.1\|2030890_2031802_-	dihydroorotate dehydrogenase	NA	NA	NA	NA
WP_004312917.1\|2031789_2032566_-	dihydroorotate dehydrogenase electron transfer subunit	NA	NA	NA	NA
WP_065538585.1\|2032642_2033113_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_065538586.1\|2034333_2035353_-	DNA polymerase III subunit delta	NA	NA	NA	NA
WP_065538587.1\|2035377_2036154_-	AMP nucleosidase	NA	NA	NA	NA
WP_065538588.1\|2036217_2036667_+	type I restriction enzyme HsdR N-terminal domain-containing protein	NA	NA	NA	NA
WP_065538589.1\|2036851_2037682_-	hypothetical protein	NA	NA	NA	NA
WP_065538590.1\|2037687_2038782_-	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
WP_065538591.1\|2038890_2039304_+	DUF4891 domain-containing protein	NA	NA	NA	NA
WP_065538227.1\|2039558_2041214_-\|transposase	IS1182 family transposase	A0A146ICT8	Staphylococcus_phage	7.4e-67	38.7
WP_065538592.1\|2041501_2041783_-	hypothetical protein	NA	NA	NA	NA
WP_065538593.1\|2041779_2042574_-	ABC transporter permease	NA	NA	NA	NA
WP_065538594.1\|2042607_2043228_-	ABC transporter ATP-binding protein	A0A2H4UU96	Bodo_saltans_virus	2.9e-08	24.5
WP_065538595.1\|2043393_2044305_+	WYL domain-containing protein	NA	NA	NA	NA
WP_065538596.1\|2044329_2044704_+	hypothetical protein	NA	NA	NA	NA
WP_065538597.1\|2045079_2045568_+	hypothetical protein	NA	NA	NA	NA
WP_065538598.1\|2045571_2046690_+	DUF4339 domain-containing protein	NA	NA	NA	NA
WP_065538599.1\|2046686_2047793_+	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_065538600.1\|2047834_2048197_+	hypothetical protein	NA	NA	NA	NA
WP_065538601.1\|2048363_2048906_+	ferredoxin	NA	NA	NA	NA
WP_065538602.1\|2048995_2050111_+	agmatine deiminase family protein	M1ICB7	Acanthocystis_turfacea_Chlorella_virus	1.9e-42	31.0
WP_065538603.1\|2050140_2051025_+	carbon-nitrogen hydrolase	M1I3K9	Paramecium_bursaria_Chlorella_virus	1.9e-53	40.8
WP_065538604.1\|2051324_2051714_-	GtrA family protein	NA	NA	NA	NA
WP_065540353.1\|2051710_2053474_-\|tRNA	aspartate--tRNA ligase	A0A1V0SAC0	Catovirus	2.3e-13	25.2
WP_065538605.1\|2053582_2054608_-	diacylglycerol kinase family lipid kinase	A0A1V0SBJ0	Catovirus	2.0e-14	26.7
WP_065538606.1\|2054828_2056013_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	V5LQ39	Emiliania_huxleyi_virus	1.3e-49	34.3
WP_065537976.1\|2056298_2057990_-\|transposase	DDE transposase	NA	NA	NA	NA
WP_065538607.1\|2058842_2059826_-\|transposase	transposase	NA	NA	NA	NA
WP_024988949.1\|2059791_2060178_-	hypothetical protein	NA	NA	NA	NA
WP_065540354.1\|2060810_2061005_+	hypothetical protein	NA	NA	NA	NA
WP_065538608.1\|2061120_2061831_-	methyltransferase	M1HKL6	Paramecium_bursaria_Chlorella_virus	2.0e-05	29.8
WP_065538609.1\|2062047_2064513_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	3.4e-156	41.1
WP_065538610.1\|2064509_2065640_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.2e-79	43.0
WP_065538611.1\|2065643_2066741_+	YjgP/YjgQ family permease	NA	NA	NA	NA
WP_065538612.1\|2066961_2068521_-\|transposase	IS1634 family transposase	NA	NA	NA	NA
WP_065538613.1\|2068780_2069284_-	redoxin domain-containing protein	NA	NA	NA	NA
WP_065538615.1\|2069553_2070783_+	phosphoserine phosphatase SerB	NA	NA	NA	NA
WP_065538616.1\|2070829_2072092_+	DEAD/DEAH box helicase	A0A1B1IS59	uncultured_Mediterranean_phage	1.7e-50	30.7
WP_065538617.1\|2072173_2072971_-	DUF4738 domain-containing protein	NA	NA	NA	NA
WP_065538618.1\|2073006_2074320_-	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	1.0e-79	38.7
WP_065538619.1\|2074346_2074895_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A1D8EQH2	Escherichia_phage	7.0e-38	44.2
WP_065538620.1\|2074985_2076077_+	HU-CCDC81 and SPOR domain-containing protein	NA	NA	NA	NA
WP_065538621.1\|2076095_2076623_+	FHA domain-containing protein	NA	NA	NA	NA
WP_084081130.1\|2076650_2076845_+	DUF3791 domain-containing protein	NA	NA	NA	NA
WP_065538622.1\|2076853_2077222_+	hypothetical protein	NA	NA	NA	NA
WP_009131421.1\|2077223_2077568_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_065538623.1\|2077655_2079437_+\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	1.2e-27	29.1

DBSCAN-SWA_7

2286498 : 2350980

Wolbachia_phage(36.36%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065538760.1\|2286498_2288259_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	4.7e-27	28.6
WP_084081204.1\|2288342_2289206_-	AAA domain-containing protein	A0A2H4PB07	Aphanizomenon_phage	7.2e-21	30.3
WP_065538761.1\|2289308_2289512_-	SEL1-like repeat protein	NA	NA	NA	NA
WP_065538763.1\|2290384_2290639_-	hypothetical protein	NA	NA	NA	NA
WP_065538764.1\|2290703_2292200_-	sel1 repeat family protein	NA	NA	NA	NA
WP_065538766.1\|2292873_2293263_-	DUF1232 domain-containing protein	NA	NA	NA	NA
WP_141243586.1\|2293268_2293502_-	hypothetical protein	NA	NA	NA	NA
WP_065538767.1\|2293504_2293729_-	hypothetical protein	NA	NA	NA	NA
WP_065538768.1\|2293739_2294018_-	hypothetical protein	NA	NA	NA	NA
WP_065538769.1\|2294022_2295498_-	hypothetical protein	NA	NA	NA	NA
WP_065538770.1\|2295499_2298142_-	ATP-binding protein	NA	NA	NA	NA
WP_065538771.1\|2298155_2300069_-	hypothetical protein	NA	NA	NA	NA
WP_065538772.1\|2300073_2300868_-	hypothetical protein	NA	NA	NA	NA
WP_065538773.1\|2300905_2301325_-	hypothetical protein	NA	NA	NA	NA
WP_065540367.1\|2301360_2301876_-	phospholipase	NA	NA	NA	NA
WP_065538775.1\|2302368_2303838_+	hypothetical protein	NA	NA	NA	NA
WP_024987244.1\|2304243_2305098_+	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_065538776.1\|2305097_2306336_+	DNA recombination protein RmuC	NA	NA	NA	NA
WP_065538777.1\|2306336_2307656_-	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	7.2e-65	42.3
WP_065538778.1\|2307771_2309553_-	elongation factor 4	A0A2K9L6L3	Tupanvirus	4.2e-23	40.0
WP_065538779.1\|2309680_2309881_-	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_065538780.1\|2310036_2310495_-	hypothetical protein	NA	NA	NA	NA
WP_071807666.1\|2310594_2311002_+	YjbQ family protein	NA	NA	NA	NA
WP_065538782.1\|2311054_2312308_-	Nramp family divalent metal transporter	NA	NA	NA	NA
WP_065538783.1\|2312565_2312811_-	TIGR03905 family TSCPD domain-containing protein	NA	NA	NA	NA
WP_065538784.1\|2312820_2313558_-	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_065538785.1\|2313591_2316054_-\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_065538786.1\|2316319_2317879_-	replicative DNA helicase	A0A0F7L6J1	uncultured_marine_virus	9.1e-99	44.2
WP_065538787.1\|2318114_2318939_+	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
WP_065538788.1\|2319194_2320229_-	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	5.5e-76	43.2
WP_004303570.1\|2320452_2321025_-	electron transport complex subunit RsxA	NA	NA	NA	NA
WP_065538789.1\|2321047_2321632_-	electron transport complex subunit E	NA	NA	NA	NA
WP_065538790.1\|2321646_2322378_-	RnfABCDGE type electron transport complex subunit G	NA	NA	NA	NA
WP_065538791.1\|2322374_2323382_-	RnfABCDGE type electron transport complex subunit D	NA	NA	NA	NA
WP_065538792.1\|2323387_2324725_-	electron transport complex subunit RsxC	NA	NA	NA	NA
WP_065538793.1\|2324749_2325616_-	Fe-S cluster domain-containing protein	NA	NA	NA	NA
WP_065538794.1\|2325623_2326049_-	SoxR reducing system RseC family protein	NA	NA	NA	NA
WP_065538795.1\|2326284_2327838_-	ATP-binding protein	NA	NA	NA	NA
WP_065540368.1\|2327876_2329451_-	ATP-binding protein	NA	NA	NA	NA
WP_065538796.1\|2329579_2332795_-	DUF4906 domain-containing protein	NA	NA	NA	NA
WP_065538797.1\|2332839_2333934_-	hypothetical protein	NA	NA	NA	NA
WP_065538798.1\|2333930_2334947_-	FimB/Mfa2 family fimbrial subunit	NA	NA	NA	NA
WP_065538799.1\|2334957_2336943_-	Mfa1 family fimbria major subunit	NA	NA	NA	NA
WP_065538800.1\|2336997_2338431_-	DUF3868 domain-containing protein	NA	NA	NA	NA
WP_065538801.1\|2338445_2339033_-	DUF3575 domain-containing protein	NA	NA	NA	NA
WP_167371340.1\|2339600_2339741_-	hypothetical protein	NA	NA	NA	NA
WP_065538802.1\|2339905_2340529_+	virulence protein E	NA	NA	NA	NA
WP_065538803.1\|2340549_2342412_+	DUF3987 domain-containing protein	NA	NA	NA	NA
WP_065538804.1\|2342539_2342758_-	DUF4248 domain-containing protein	NA	NA	NA	NA
WP_065538805.1\|2342979_2343468_+	DNA-binding protein	NA	NA	NA	NA
WP_157448000.1\|2343729_2343837_+	smalltalk protein	NA	NA	NA	NA
WP_065538806.1\|2343841_2344255_+	N-acetylmuramoyl-L-alanine amidase	A0A0F7LBB1	uncultured_marine_virus	1.2e-34	50.0
WP_065537976.1\|2344523_2346215_+\|transposase	DDE transposase	NA	NA	NA	NA
WP_065538807.1\|2346462_2347410_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	5.4e-22	29.8
WP_065538808.1\|2347676_2348564_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	2.5e-21	29.4
WP_065538809.1\|2348830_2349802_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	2.8e-21	29.4
WP_065538810.1\|2350068_2350980_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	5.2e-22	29.8

DBSCAN-SWA_8

2784580 : 2812291

uncultured_marine_virus(12.5%)

integrase,transposase

attL 2798585:2798599|attR 2814587:2814601

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065537581.1\|2784580_2784952_+\|transposase	transposase family protein	NA	NA	NA	NA
WP_065539072.1\|2784992_2785928_+\|transposase	transposase	NA	NA	NA	NA
WP_065539073.1\|2786235_2787561_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_141243592.1\|2787720_2788437_+	hypothetical protein	NA	NA	NA	NA
WP_065539075.1\|2788656_2788956_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_065540406.1\|2788958_2789264_+	AbrB family transcriptional regulator	NA	NA	NA	NA
WP_065539076.1\|2789256_2789478_+	hypothetical protein	NA	NA	NA	NA
WP_065539077.1\|2789479_2790199_+	hypothetical protein	NA	NA	NA	NA
WP_065539078.1\|2790164_2791565_+	replicative DNA helicase	A0A0F7L6J1	uncultured_marine_virus	2.5e-71	37.3
WP_065539079.1\|2791609_2792146_+	hypothetical protein	NA	NA	NA	NA
WP_065539080.1\|2792142_2793363_+	DEAD/DEAH box helicase family protein	NA	NA	NA	NA
WP_024988075.1\|2793343_2793586_+	VRR-NUC domain-containing protein	NA	NA	NA	NA
WP_065539081.1\|2793777_2794197_+	hypothetical protein	NA	NA	NA	NA
WP_024988073.1\|2794222_2794456_+	hypothetical protein	NA	NA	NA	NA
WP_065539082.1\|2794800_2795079_+	hypothetical protein	NA	NA	NA	NA
WP_065539083.1\|2795334_2795934_+	hypothetical protein	NA	NA	NA	NA
WP_065539084.1\|2795983_2797042_+	ImmA/IrrE family metallo-endopeptidase	A0A0A7RTT7	Clostridium_phage	2.7e-30	27.9
WP_005652458.1\|2798310_2798496_+	type II toxin-antitoxin system HicA family toxin	NA	NA	NA	NA
WP_065539085.1\|2798535_2798988_+	pilus assembly protein HicB	NA	NA	NA	NA
2798585:2798599	attL	NA	NA	NA	NA
WP_141243593.1\|2799180_2800119_-	hypothetical protein	NA	NA	NA	NA
WP_065539087.1\|2800509_2801061_-	cell filamentation protein Fic	NA	NA	NA	NA
WP_065539088.1\|2801064_2801826_-	Fic family protein	A0A1V0E025	Clostridioides_phage	3.6e-08	31.3
WP_065539089.1\|2801833_2802835_-	cell filamentation protein Fic	Q9JMN3	Wolbachia_phage	3.4e-75	47.9
WP_050428031.1\|2802853_2803153_-	helix-turn-helix domain-containing protein	F5A3H2	Riemerella_phage	8.8e-11	41.1
WP_065539090.1\|2803291_2803720_+	hypothetical protein	NA	NA	NA	NA
WP_065539091.1\|2803773_2803968_+	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	NA	NA	NA	NA
WP_065539092.1\|2804040_2804289_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_065538200.1\|2804746_2806312_+\|transposase	IS21 family transposase	A0A059NT83	Lactococcus_phage	6.5e-12	26.3
WP_065539093.1\|2806301_2807075_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	8.0e-40	37.8
WP_065540407.1\|2807260_2807569_+	DNA methylase	NA	NA	NA	NA
WP_065540408.1\|2807716_2808328_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_084081121.1\|2808416_2810018_-\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_065538284.1\|2810096_2810453_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_065538285.1\|2810439_2811009_-	hypothetical protein	NA	NA	NA	NA
WP_065539094.1\|2811184_2812291_+\|integrase	site-specific integrase	S5W9T9	Leptospira_phage	4.1e-29	33.6
2814587:2814601	attR	NA	NA	NA	NA

DBSCAN-SWA_9

2822137 : 2879064

Lactococcus_phage(14.29%)

integrase,transposase,tRNA

attL 2839024:2839040|attR 2885802:2885818

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065539103.1\|2822137_2823703_-\|transposase	IS21 family transposase	A0A059NT83	Lactococcus_phage	6.5e-12	26.3
WP_065539105.1\|2824436_2824652_-	hypothetical protein	NA	NA	NA	NA
WP_065539106.1\|2824648_2827135_-	ferrous iron transport protein B	NA	NA	NA	NA
WP_065539107.1\|2827280_2828561_+\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_065539108.1\|2828545_2829382_-	4Fe-4S dicluster domain-containing protein	NA	NA	NA	NA
WP_065539109.1\|2829620_2831840_+	transcription termination factor Rho	NA	NA	NA	NA
WP_065539110.1\|2832125_2833592_+	sulfatase-like hydrolase/transferase	NA	NA	NA	NA
WP_065539111.1\|2833799_2835122_+	MATE family efflux transporter	NA	NA	NA	NA
WP_065539112.1\|2835226_2836549_+	signal recognition particle protein	NA	NA	NA	NA
WP_004312924.1\|2836820_2837702_+	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	2.1e-28	31.7
WP_065539113.1\|2837698_2838880_+	CapA family protein	A0A2H4JG01	uncultured_Caudovirales_phage	2.1e-39	28.9
2839024:2839040	attL	NA	NA	NA	NA
WP_065537581.1\|2839132_2839504_+\|transposase	transposase family protein	NA	NA	NA	NA
WP_065539072.1\|2839544_2840480_+\|transposase	transposase	NA	NA	NA	NA
WP_065540410.1\|2841295_2843161_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.0e-48	43.7
WP_065539114.1\|2843321_2843618_+	septum formation initiator family protein	NA	NA	NA	NA
WP_065539115.1\|2843621_2843963_+	hypothetical protein	NA	NA	NA	NA
WP_008771479.1\|2844075_2844678_-	OmpH family outer membrane protein	NA	NA	NA	NA
WP_008026083.1\|2844705_2844939_-	hypothetical protein	NA	NA	NA	NA
WP_065539116.1\|2845072_2846533_+	aminoacyl-histidine dipeptidase	NA	NA	NA	NA
WP_065539117.1\|2846513_2847728_+	endonuclease	NA	NA	NA	NA
WP_065539118.1\|2847990_2849601_-	ATP-binding protein	NA	NA	NA	NA
WP_065539119.1\|2849708_2850884_-	mechanosensitive ion channel family protein	NA	NA	NA	NA
WP_065540411.1\|2850950_2851700_-	nucleotidyltransferase family protein	NA	NA	NA	NA
WP_065539120.1\|2851735_2853166_-	phosphotransferase	NA	NA	NA	NA
WP_065539123.1\|2854158_2855919_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	3.6e-27	28.9
WP_065538204.1\|2856006_2856351_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_065538241.1\|2856352_2856721_-	hypothetical protein	NA	NA	NA	NA
WP_008026044.1\|2857086_2857602_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_065539125.1\|2857697_2859164_-	ATP-binding cassette domain-containing protein	F2Y2R6	Organic_Lake_phycodnavirus	1.6e-09	23.9
WP_065539126.1\|2859294_2861436_-	alpha-glucuronidase	NA	NA	NA	NA
WP_065539127.1\|2861479_2862457_-	glycoside hydrolase family 43 protein	NA	NA	NA	NA
WP_065539128.1\|2862681_2863818_-	endo-1,4-beta-xylanase	NA	NA	NA	NA
WP_065539129.1\|2863847_2865332_-	MFS transporter	NA	NA	NA	NA
WP_065539130.1\|2865365_2867000_-	9-O-acetylesterase	NA	NA	NA	NA
WP_065539131.1\|2867386_2869393_-	type I pullulanase	NA	NA	NA	NA
WP_004312686.1\|2869447_2870014_-	crossover junction endodeoxyribonuclease RuvC	NA	NA	NA	NA
WP_065539132.1\|2870010_2870313_-	DUF4286 family protein	NA	NA	NA	NA
WP_065539133.1\|2870555_2871446_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_065539134.1\|2872047_2872536_+	hypothetical protein	NA	NA	NA	NA
WP_084081121.1\|2872640_2874242_-\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_065538284.1\|2874320_2874677_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_065538285.1\|2874663_2875233_-	hypothetical protein	NA	NA	NA	NA
WP_065540412.1\|2875428_2875641_-	hypothetical protein	NA	NA	NA	NA
WP_065539135.1\|2876451_2877468_-	energy transducer TonB	NA	NA	NA	NA
WP_065539136.1\|2877828_2879064_+\|integrase	site-specific integrase	H7BUI8	unidentified_phage	2.4e-25	32.7
2885802:2885818	attR	NA	NA	NA	NA

DBSCAN-SWA_10

3063347 : 3092315

Wolbachia_phage(50.0%)

protease,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065538162.1\|3063347_3064499_-\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_065539243.1\|3064992_3065889_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_065539244.1\|3065944_3067009_+	metallophosphoesterase	NA	NA	NA	NA
WP_065539245.1\|3067255_3067846_-	nicotinate-nucleotide adenylyltransferase	NA	NA	NA	NA
WP_065539246.1\|3067832_3068048_-	hypothetical protein	NA	NA	NA	NA
WP_065539247.1\|3068057_3068627_-	guanylate kinase	NA	NA	NA	NA
WP_065539248.1\|3068813_3069692_-	YicC family protein	NA	NA	NA	NA
WP_065539249.1\|3069781_3070471_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_065539250.1\|3070501_3071113_+	DUF4290 domain-containing protein	NA	NA	NA	NA
WP_065539251.1\|3071206_3072511_+	UDP-N-acetylglucosamine 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_065539252.1\|3072507_3073047_+	16S rRNA processing protein RimM	NA	NA	NA	NA
WP_065539253.1\|3073121_3073982_+	M23 family metallopeptidase	NA	NA	NA	NA
WP_065539254.1\|3074011_3075196_+	1-deoxy-D-xylulose-5-phosphate reductoisomerase	NA	NA	NA	NA
WP_065539255.1\|3075241_3076597_+\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_065539256.1\|3076787_3077246_-	anaerobic ribonucleoside-triphosphate reductase activating protein	K4F5U2	Cronobacter_phage	4.2e-28	42.8
WP_065540424.1\|3077248_3079642_-	anaerobic ribonucleoside triphosphate reductase	A0A0A8WEK0	Clostridium_phage	3.3e-185	46.0
WP_065539259.1\|3081584_3081926_+\|transposase	DDE transposase family protein	NA	NA	NA	NA
WP_065539260.1\|3082161_3084453_+	NADP-dependent malic enzyme	NA	NA	NA	NA
WP_089280722.1\|3084449_3084626_+	hypothetical protein	NA	NA	NA	NA
WP_024987856.1\|3084873_3086208_+	NADP-specific glutamate dehydrogenase	NA	NA	NA	NA
WP_065539261.1\|3086383_3086602_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_065539262.1\|3086598_3086925_+	phosphatidylinositol kinase	NA	NA	NA	NA
WP_065540425.1\|3086927_3087863_+	HipA domain-containing protein	NA	NA	NA	NA
WP_065539263.1\|3088261_3089401_+	PCMD domain-containing protein	NA	NA	NA	NA
WP_065539264.1\|3089428_3090223_+	PorT family protein	NA	NA	NA	NA
WP_065539265.1\|3090485_3091346_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	9.6e-26	32.9
WP_065539266.1\|3091442_3092315_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	1.1e-24	31.9

DBSCAN-SWA_11

3470525 : 3580260

Bacillus_phage(25.0%)

integrase,protease,transposase

attL 3508855:3508869|attR 3582085:3582099

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065539500.1\|3470525_3473111_+\|protease	zinc-dependent metalloprotease	NA	NA	NA	NA
WP_065539501.1\|3473125_3475669_+	DUF5117 domain-containing protein	NA	NA	NA	NA
WP_065539502.1\|3475954_3478738_+	outer membrane beta-barrel protein	NA	NA	NA	NA
WP_065539504.1\|3485508_3487503_-	glycoside hydrolase family 97 protein	NA	NA	NA	NA
WP_065540454.1\|3487731_3489735_-	hypothetical protein	NA	NA	NA	NA
WP_065540455.1\|3489768_3490743_-	family 43 glycosylhydrolase	NA	NA	NA	NA
WP_065539505.1\|3490766_3493010_-	beta-glucosidase BglX	NA	NA	NA	NA
WP_084081161.1\|3493115_3495179_-	DUF5125 domain-containing protein	NA	NA	NA	NA
WP_065539506.1\|3495192_3496185_-	family 43 glycosylhydrolase	NA	NA	NA	NA
WP_065540457.1\|3496221_3497868_-	RagB/SusD family nutrient uptake outer membrane protein	NA	NA	NA	NA
WP_065539507.1\|3497891_3501257_-	SusC/RagA family TonB-linked outer membrane protein	NA	NA	NA	NA
WP_065539509.1\|3501529_3502543_-	DUF4974 domain-containing protein	NA	NA	NA	NA
WP_065539510.1\|3502614_3503205_-	RNA polymerase sigma-70 factor	NA	NA	NA	NA
WP_065539511.1\|3503393_3504908_+	SLC13/DASS family transporter	NA	NA	NA	NA
WP_065539512.1\|3504969_3508998_-	hybrid sensor histidine kinase/response regulator transcription factor	W8CYM9	Bacillus_phage	2.7e-09	34.5
3508855:3508869	attL	NA	NA	NA	NA
WP_065539513.1\|3509363_3511562_-	glycoside hydrolase family 92 protein	NA	NA	NA	NA
WP_065539514.1\|3511834_3513613_+	signal peptide peptidase SppA	A0A2I7QTH6	Vibrio_phage	1.0e-05	25.3
WP_065539515.1\|3513623_3514754_+	tetraacyldisaccharide 4'-kinase	NA	NA	NA	NA
WP_004316831.1\|3514710_3515520_+	purine-nucleoside phosphorylase	Q5YBA4	Grouper_iridovirus	5.4e-55	41.3
WP_065539516.1\|3515536_3516574_+	thiamine-phosphate kinase	NA	NA	NA	NA
WP_065537581.1\|3516988_3517360_+\|transposase	transposase family protein	NA	NA	NA	NA
WP_065539072.1\|3517400_3518336_+\|transposase	transposase	NA	NA	NA	NA
WP_157448005.1\|3518692_3518845_-	hypothetical protein	NA	NA	NA	NA
WP_089280781.1\|3518870_3521156_-	glycosyl hydrolase	NA	NA	NA	NA
WP_065539519.1\|3521478_3522930_-	fimbrillin family protein	NA	NA	NA	NA
WP_065539520.1\|3522969_3523803_-	fimbrillin family protein	NA	NA	NA	NA
WP_084081162.1\|3523950_3525375_-	DUF1735 domain-containing protein	NA	NA	NA	NA
WP_065540458.1\|3525393_3527394_-	RagB/SusD family nutrient uptake outer membrane protein	NA	NA	NA	NA
WP_065539522.1\|3527422_3530611_-	TonB-dependent receptor	NA	NA	NA	NA
WP_008026447.1\|3530723_3532679_-	glycoside hydrolase family 97 protein	NA	NA	NA	NA
WP_008026451.1\|3532961_3534185_+	hypothetical protein	NA	NA	NA	NA
WP_158213967.1\|3534198_3536259_+	Retaining alpha-galactosidase	NA	NA	NA	NA
WP_065539523.1\|3536292_3537816_+	alpha/beta hydrolase fold domain-containing protein	NA	NA	NA	NA
WP_065539524.1\|3537832_3540133_+	glycoside hydrolase family 3 protein	NA	NA	NA	NA
WP_084081164.1\|3540374_3541475_-	family 43 glycosylhydrolase	NA	NA	NA	NA
WP_065540461.1\|3541699_3543544_+	beta-galactosidase	NA	NA	NA	NA
WP_065539525.1\|3543574_3546421_+	family 10 glycosylhydrolase	NA	NA	NA	NA
WP_065539526.1\|3546650_3547199_+	RNA polymerase sigma-70 factor	NA	NA	NA	NA
WP_065539527.1\|3547378_3548323_+	FecR family protein	NA	NA	NA	NA
WP_158213969.1\|3548730_3551727_+	SusC/RagA family TonB-linked outer membrane protein	NA	NA	NA	NA
WP_065539528.1\|3551740_3553522_+	RagB/SusD family nutrient uptake outer membrane protein	NA	NA	NA	NA
WP_065539529.1\|3553533_3554694_+	PKD domain-containing protein	NA	NA	NA	NA
WP_141243584.1\|3554724_3556389_+	BACON domain-containing protein	NA	NA	NA	NA
WP_065539531.1\|3556533_3557421_+	fimbrillin family protein	NA	NA	NA	NA
WP_084081166.1\|3557446_3559558_+	fimbrillin family protein	NA	NA	NA	NA
WP_065539533.1\|3559695_3562203_+	family 20 glycosylhydrolase	NA	NA	NA	NA
WP_065539534.1\|3562377_3566340_+	hybrid sensor histidine kinase/response regulator transcription factor	Q6XM27	Feldmannia_irregularis_virus	8.7e-13	24.6
WP_084081167.1\|3566693_3567260_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_065539535.1\|3567326_3568481_+	FecR family protein	NA	NA	NA	NA
WP_065539536.1\|3568488_3572025_+	TonB-dependent receptor	NA	NA	NA	NA
WP_065539537.1\|3572037_3573504_+	RagB/SusD family nutrient uptake outer membrane protein	NA	NA	NA	NA
WP_065539538.1\|3573511_3574417_+	hypothetical protein	NA	NA	NA	NA
WP_065539539.1\|3574434_3576975_+\|protease	zinc-dependent metalloprotease	NA	NA	NA	NA
WP_065538162.1\|3577455_3578607_-\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_065539540.1\|3579036_3580260_+\|integrase	site-specific integrase	NA	NA	NA	NA
3582085:3582099	attR	NA	NA	NA	NA

DBSCAN-SWA_12

3728039 : 3777395

Klosneuvirus(33.33%)

integrase,protease,transposase

attL 3724315:3724330|attR 3791639:3791654

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3724315:3724330	attL	NA	NA	NA	NA
WP_065539616.1\|3728039_3728831_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_008644950.1\|3728902_3729325_-	SufE family protein	NA	NA	NA	NA
WP_065539617.1\|3729347_3730343_-	M28 family peptidase	NA	NA	NA	NA
WP_065539618.1\|3730413_3731322_-	LD-carboxypeptidase	NA	NA	NA	NA
WP_065539619.1\|3731539_3732499_+	phosphate butyryltransferase	NA	NA	NA	NA
WP_065539620.1\|3732524_3733586_+	butyrate kinase	NA	NA	NA	NA
WP_065539621.1\|3734180_3736307_-	polyribonucleotide nucleotidyltransferase	NA	NA	NA	NA
WP_065539622.1\|3736503_3737655_+	AhpC/TSA family protein	NA	NA	NA	NA
WP_065540470.1\|3737836_3738301_+	transcription elongation factor GreA	NA	NA	NA	NA
WP_008026146.1\|3738352_3738745_+	HIT family protein	NA	NA	NA	NA
WP_065539624.1\|3741339_3742305_+	glutaminase A	NA	NA	NA	NA
WP_065539625.1\|3742517_3743297_-	two pore domain potassium channel family protein	NA	NA	NA	NA
WP_065537582.1\|3746254_3747190_-\|transposase	transposase	NA	NA	NA	NA
WP_065537581.1\|3747230_3747602_-\|transposase	transposase family protein	NA	NA	NA	NA
WP_065539626.1\|3748529_3749852_-	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_084081212.1\|3752145_3753522_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_084081172.1\|3753532_3754333_-	META domain-containing protein	NA	NA	NA	NA
WP_084081213.1\|3754334_3754679_-	DUF3795 domain-containing protein	NA	NA	NA	NA
WP_065539629.1\|3754683_3755088_-	DUF3795 domain-containing protein	NA	NA	NA	NA
WP_065539630.1\|3755265_3756606_-	TonB family protein	NA	NA	NA	NA
WP_065540471.1\|3756608_3756974_-	BlaI/MecI/CopY family transcriptional regulator	NA	NA	NA	NA
WP_084081173.1\|3757139_3757505_-	VOC family protein	NA	NA	NA	NA
WP_065539631.1\|3757597_3758404_-	4Fe-4S dicluster domain-containing protein	NA	NA	NA	NA
WP_065539632.1\|3758400_3759030_-	hypothetical protein	NA	NA	NA	NA
WP_065539633.1\|3759026_3759629_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_065539634.1\|3759711_3760512_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_065540473.1\|3760660_3761341_-	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_084081214.1\|3761382_3761826_-	hypothetical protein	NA	NA	NA	NA
WP_065539636.1\|3761834_3762437_-	uracil-DNA glycosylase	NA	NA	NA	NA
WP_065539637.1\|3762460_3763093_-	hypothetical protein	NA	NA	NA	NA
WP_065539638.1\|3763102_3764887_-	DUF4303 domain-containing protein	NA	NA	NA	NA
WP_065539639.1\|3764876_3765665_-	hypothetical protein	NA	NA	NA	NA
WP_065540474.1\|3765731_3766052_-	hypothetical protein	NA	NA	NA	NA
WP_065540475.1\|3766375_3766666_-	GTP cyclohydrolase	NA	NA	NA	NA
WP_084081174.1\|3766951_3767848_-	class A beta-lactamase	NA	NA	NA	NA
WP_065539640.1\|3767867_3768503_-	CatB-related O-acetyltransferase	A0A1V0SJ47	Klosneuvirus	1.6e-22	43.3
WP_065540477.1\|3768632_3769004_-	BlaI/MecI/CopY family transcriptional regulator	NA	NA	NA	NA
WP_065539641.1\|3769304_3769724_-	hypothetical protein	NA	NA	NA	NA
WP_065539642.1\|3770003_3770471_-	DUF3408 domain-containing protein	NA	NA	NA	NA
WP_065540478.1\|3770880_3771192_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_065539643.1\|3771245_3771551_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_065539644.1\|3771594_3771906_-	hypothetical protein	NA	NA	NA	NA
WP_065539645.1\|3771902_3772277_-	hypothetical protein	NA	NA	NA	NA
WP_071807732.1\|3773625_3774105_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_065539646.1\|3774345_3775911_+\|transposase	IS21 family transposase	A0A059NT83	Lactococcus_phage	6.5e-12	26.3
WP_065539093.1\|3775900_3776674_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	8.0e-40	37.8
WP_065539647.1\|3776780_3777395_-\|transposase	ISAs1 family transposase	NA	NA	NA	NA
3791639:3791654	attR	NA	NA	NA	NA

DBSCAN-SWA_13

3894741 : 3960582

Staphylococcus_phage(28.57%)

integrase,transposase

attL 3887935:3887957|attR 3898631:3898653

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3887935:3887957	attL	NA	NA	NA	NA
WP_015546403.1\|3894741_3895965_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_015546402.1\|3895990_3897145_+	DUF1016 family protein	A0A0U2BZN7	Salmonella_phage	1.9e-29	43.6
WP_015546401.1\|3897376_3897949_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_065539704.1\|3897958_3898522_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_065537559.1\|3898954_3899932_-\|transposase	IS982 family transposase	NA	NA	NA	NA
3898631:3898653	attR	NA	NA	NA	NA
WP_167371345.1\|3900118_3900280_+	hypothetical protein	NA	NA	NA	NA
WP_024988423.1\|3900301_3900970_+	hypothetical protein	NA	NA	NA	NA
WP_055221615.1\|3900999_3903291_+	TonB-dependent receptor	NA	NA	NA	NA
WP_024988420.1\|3903575_3903815_+	hypothetical protein	NA	NA	NA	NA
WP_024988419.1\|3903768_3904188_+	hypothetical protein	NA	NA	NA	NA
WP_024988418.1\|3904318_3904651_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_065539705.1\|3904706_3905426_-	hypothetical protein	NA	NA	NA	NA
WP_055221611.1\|3905430_3906357_-	relaxase/mobilization nuclease domain-containing protein	NA	NA	NA	NA
WP_055221609.1\|3906322_3906706_-	MobC family plasmid mobilization relaxosome protein	NA	NA	NA	NA
WP_065540485.1\|3906852_3907818_-	DNA primase	NA	NA	NA	NA
WP_057098942.1\|3907981_3909055_-	AAA family ATPase	NA	NA	NA	NA
WP_005944327.1\|3909060_3909348_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_065537559.1\|3910326_3911304_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_065539707.1\|3911900_3912983_+	mannose-1-phosphate guanylyltransferase	NA	NA	NA	NA
WP_065539708.1\|3913147_3914797_-	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	3.4e-27	25.4
WP_065539709.1\|3914860_3915436_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_004296393.1\|3915621_3915891_-	30S ribosomal protein S15	NA	NA	NA	NA
WP_004317549.1\|3916046_3917846_+	translational GTPase TypA	A0A1S5SF82	Streptococcus_phage	6.7e-21	41.4
WP_004317547.1\|3917936_3918461_-	chromate transporter	NA	NA	NA	NA
WP_065539710.1\|3918457_3918655_-	hypothetical protein	NA	NA	NA	NA
WP_065539711.1\|3918929_3920537_-	phosphoenolpyruvate carboxykinase (ATP)	A0A2H4PQN1	Staphylococcus_phage	1.1e-126	50.1
WP_024987958.1\|3920823_3921477_+	uracil phosphoribosyltransferase	NA	NA	NA	NA
WP_065540486.1\|3921481_3922357_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_065539712.1\|3922395_3924033_-	MFS transporter	NA	NA	NA	NA
WP_065539713.1\|3924082_3925174_-	HlyD family secretion protein	NA	NA	NA	NA
WP_024987955.1\|3925196_3926528_-	TolC family protein	NA	NA	NA	NA
WP_065538285.1\|3926815_3927385_+	hypothetical protein	NA	NA	NA	NA
WP_065538284.1\|3927371_3927728_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_084081121.1\|3927806_3929408_+\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_065539714.1\|3929542_3932056_-	YfhO family protein	NA	NA	NA	NA
WP_024987950.1\|3932224_3933643_-	adenosylhomocysteinase	S4W1G4	Pandoravirus	2.0e-52	31.5
WP_065539715.1\|3933806_3935495_-	S41 family peptidase	A0A0R6PIZ1	Moraxella_phage	5.7e-22	28.7
WP_065539716.1\|3935540_3936530_-	adenosine kinase	NA	NA	NA	NA
WP_065539717.1\|3937037_3937745_-	ComF family protein	NA	NA	NA	NA
WP_065539718.1\|3937788_3938592_-	inositol monophosphatase	NA	NA	NA	NA
WP_065539719.1\|3938832_3940362_-	hypothetical protein	NA	NA	NA	NA
WP_065539720.1\|3940375_3941155_-	hypothetical protein	NA	NA	NA	NA
WP_065539721.1\|3941162_3941936_-	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_065539722.1\|3941967_3942924_-	DUF4974 domain-containing protein	NA	NA	NA	NA
WP_004317492.1\|3943032_3943614_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_065539723.1\|3943732_3945916_-	alpha-N-acetylglucosaminidase	NA	NA	NA	NA
WP_065539724.1\|3945922_3947008_-	DUF5009 domain-containing protein	NA	NA	NA	NA
WP_065539725.1\|3947022_3948279_-	GntP family permease	NA	NA	NA	NA
WP_065539726.1\|3948285_3949428_-	glycerate kinase	W6LM47	Streptococcus_phage	3.7e-41	36.6
WP_065539727.1\|3949436_3951593_-	alpha-N-acetylglucosaminidase	NA	NA	NA	NA
WP_065539728.1\|3951621_3952404_-	endonuclease	NA	NA	NA	NA
WP_009038936.1\|3952432_3954166_-	RagB/SusD family nutrient uptake outer membrane protein	NA	NA	NA	NA
WP_065539729.1\|3954186_3957606_-	TonB-dependent receptor	NA	NA	NA	NA
WP_065538162.1\|3958099_3959251_+\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_065538162.1\|3959430_3960582_+\|transposase	ISAs1 family transposase	NA	NA	NA	NA

DBSCAN-SWA_14

3985187 : 4034604

unidentified_phage(15.38%)

protease,tRNA,transposase,portal,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065538612.1\|3985187_3986747_+\|transposase	IS1634 family transposase	NA	NA	NA	NA
WP_065539744.1\|3986840_3988658_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	5.9e-49	29.6
WP_004296482.1\|3988741_3989014_-	HU family DNA-binding protein	A7KV42	Bacillus_phage	1.2e-14	52.2
WP_065539745.1\|3989232_3989913_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_065539746.1\|3989893_3990799_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_065539747.1\|3990803_3991889_+	endonuclease	NA	NA	NA	NA
WP_065539748.1\|3991917_3994005_+	M3 family metallopeptidase	A0A1V0SD92	Indivirus	7.2e-43	25.0
WP_065539749.1\|3994170_3997182_+	protein translocase subunit SecDF	A0A1B1IVP7	uncultured_Mediterranean_phage	3.3e-28	32.5
WP_084081216.1\|3997658_3998258_-	hypothetical protein	NA	NA	NA	NA
WP_005650556.1\|3998265_3998862_-	N-acetylmuramoyl-L-alanine amidase	A0A1Q1PVL9	Phage_DP-2017a	9.6e-25	35.8
WP_005650557.1\|3998858_3999455_-	hypothetical protein	NA	NA	NA	NA
WP_005650559.1\|3999454_3999835_-	hypothetical protein	NA	NA	NA	NA
WP_005650561.1\|3999831_4000260_-	hypothetical protein	NA	NA	NA	NA
WP_008642534.1\|4000222_4001410_-	reverse transcriptase	H7BVW2	unidentified_phage	3.4e-239	99.7
WP_065539751.1\|4001742_4003104_-	hypothetical protein	H7BVW1	unidentified_phage	6.4e-266	97.1
WP_065540488.1\|4003106_4003391_-	hypothetical protein	NA	NA	NA	NA
WP_008642527.1\|4008951_4010136_-	hypothetical protein	F5A3A0	Riemerella_phage	2.4e-19	36.5
WP_005655404.1\|4010137_4010647_-	hypothetical protein	NA	NA	NA	NA
WP_065539752.1\|4010649_4016061_-\|tail	phage tail tape measure protein	F5A3A4	Riemerella_phage	2.4e-58	36.0
WP_032592241.1\|4016293_4016950_-	hypothetical protein	NA	NA	NA	NA
WP_024986349.1\|4017018_4017528_-	hypothetical protein	NA	NA	NA	NA
WP_024986350.1\|4017539_4017968_-	hypothetical protein	NA	NA	NA	NA
WP_005655410.1\|4017964_4018435_-	hypothetical protein	NA	NA	NA	NA
WP_005655412.1\|4018425_4018758_-	hypothetical protein	NA	NA	NA	NA
WP_005655413.1\|4018759_4019095_-	hypothetical protein	NA	NA	NA	NA
WP_024986351.1\|4019100_4019427_-	hypothetical protein	NA	NA	NA	NA
WP_065539753.1\|4019438_4020674_-	hypothetical protein	NA	NA	NA	NA
WP_065539754.1\|4020693_4021341_-	hypothetical protein	NA	NA	NA	NA
WP_005655418.1\|4021349_4021955_-	hypothetical protein	NA	NA	NA	NA
WP_065540489.1\|4022431_4022683_+	hypothetical protein	NA	NA	NA	NA
WP_065539755.1\|4022694_4023060_+	hypothetical protein	NA	NA	NA	NA
WP_024986355.1\|4023103_4023283_+	hypothetical protein	NA	NA	NA	NA
WP_162223847.1\|4023325_4023466_+	hypothetical protein	H2A0D9	Bacteroides_phage	5.3e-11	65.2
WP_024986356.1\|4023477_4023657_+	hypothetical protein	NA	NA	NA	NA
WP_008642513.1\|4023668_4023881_+	hypothetical protein	NA	NA	NA	NA
WP_024986357.1\|4024045_4024321_+	DUF3846 domain-containing protein	NA	NA	NA	NA
WP_084081179.1\|4024577_4025381_+	DNA cytosine methyltransferase	R9ZYX6	Cellulophaga_phage	1.5e-73	51.7
WP_128824230.1\|4025386_4025620_+	hypothetical protein	NA	NA	NA	NA
WP_024986359.1\|4025616_4025850_+	hypothetical protein	NA	NA	NA	NA
WP_024986361.1\|4026028_4026283_+	hypothetical protein	NA	NA	NA	NA
WP_024986362.1\|4026294_4026579_+	hypothetical protein	NA	NA	NA	NA
WP_024986363.1\|4026584_4026914_+	hypothetical protein	NA	NA	NA	NA
WP_024986364.1\|4027009_4027261_+	hypothetical protein	NA	NA	NA	NA
WP_024986365.1\|4027253_4027529_+	hypothetical protein	NA	NA	NA	NA
WP_024986366.1\|4027530_4028304_+	ADP-ribosylglycohydrolase	NA	NA	NA	NA
WP_024986367.1\|4028296_4028620_+	hypothetical protein	NA	NA	NA	NA
WP_065539757.1\|4028660_4031270_-	hypothetical protein	A0A1B3B0Z8	Gordonia_phage	9.8e-05	30.6
WP_024986368.1\|4031404_4031734_-	hypothetical protein	NA	NA	NA	NA
WP_005655441.1\|4031733_4033158_-\|portal	phage portal protein	NA	NA	NA	NA
WP_008642503.1\|4033173_4034604_-\|portal	phage portal protein	A0A0F7IJY8	Polaribacter_phage	3.6e-126	50.2

Anti-CRISPR protein detection

Acr_ID: NZ_CP015401.2|WP_065537999.1|919774_920185_+|PcfK-like-protein

Click the colored protein region to show detailed information

Acr_ID: NZ_CP015401.2|WP_004291533.1|1501759_1502176_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: NZ_CP015401.2|WP_065538780.1|2310036_2310495_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP015401.2|WP_065537999.1|919774_920185_+|PcfK-like-protein

919774_920185_+

136 aa aa

hit_Aca_id	identity	query_coverage	hit_coverage
gnl\|BL_ORD_ID\|40	0.5815602836879432	1	1.0

NZ_CP015401.2|WP_004291533.1|1501759_1502176_-|hypothetical-protein

1501759_1502176_-

138 aa aa

hit_Aca_id	identity	query_coverage	hit_coverage
gnl\|BL_ORD_ID\|40	0.5571428571428572	0.9855072463768116	0.9929078014184397

NZ_CP015401.2|WP_065538780.1|2310036_2310495_-|hypothetical-protein

2310036_2310495_-

152 aa aa

2286498-2350980

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP015401_2	Orphan	2.1\|2348952\|18\|NZ_CP015401\|CRT	2348952-2348969	18	2346620-2346637	0
NZ_CP015401_2	Orphan	2.1\|2348952\|18\|NZ_CP015401\|CRT	2348952-2348969	18	2350190-2350207	0
NZ_CP015401_2	Orphan	2.2\|2348988\|30\|NZ_CP015401\|CRT	2348988-2349017	30	2346560-2346589	1
NZ_CP015401_2	Orphan	2.2\|2348988\|30\|NZ_CP015401\|CRT	2348988-2349017	30	2350166-2350195	2
NZ_CP015401_2	Orphan	2.3\|2349036\|18\|NZ_CP015401\|CRT	2349036-2349053	18	2346644-2346661	0
NZ_CP015401_2	Orphan	2.3\|2349036\|18\|NZ_CP015401\|CRT	2349036-2349053	18	2347798-2347815	0
NZ_CP015401_2	Orphan	2.3\|2349036\|18\|NZ_CP015401\|CRT	2349036-2349053	18	2350214-2350231	0

1. spacer 2.1|2348952|18|NZ_CP015401|CRT matches to NZ_CP015401 position: 2346620-2346637, mismatch: 0

ataccttcttttatacct	CRISPR spacer
ataccttcttttatacct	Protospacer
******************

2. spacer 2.1|2348952|18|NZ_CP015401|CRT matches to NZ_CP015401 position: 2350190-2350207, mismatch: 0

ataccttcttttatacct	CRISPR spacer
ataccttcttttatacct	Protospacer
******************

3. spacer 2.2|2348988|30|NZ_CP015401|CRT matches to NZ_CP015401 position: 2346560-2346589, mismatch: 1

ttgccttcctttataccttcctttatgcct	CRISPR spacer
ttgccttcctttatgccttcctttatgcct	Protospacer
**************.***************

4. spacer 2.2|2348988|30|NZ_CP015401|CRT matches to NZ_CP015401 position: 2350166-2350195, mismatch: 2

ttgccttcctttataccttcctttatgcct	CRISPR spacer
ttgccttcctttatgccttcctttatacct	Protospacer
**************.***********.***

5. spacer 2.3|2349036|18|NZ_CP015401|CRT matches to NZ_CP015401 position: 2346644-2346661, mismatch: 0

ttgccttcttccaagcct	CRISPR spacer
ttgccttcttccaagcct	Protospacer
******************

6. spacer 2.3|2349036|18|NZ_CP015401|CRT matches to NZ_CP015401 position: 2347798-2347815, mismatch: 0

ttgccttcttccaagcct	CRISPR spacer
ttgccttcttccaagcct	Protospacer
******************

7. spacer 2.3|2349036|18|NZ_CP015401|CRT matches to NZ_CP015401 position: 2350214-2350231, mismatch: 0

ttgccttcttccaagcct	CRISPR spacer
ttgccttcttccaagcct	Protospacer
******************

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP015401

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information