CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP015357	Bacillus thuringiensis strain MYBT18246 plasmid p55166, complete sequence	0 crisprs	csa3	0	0	0
NZ_CP015361	Bacillus thuringiensis strain MYBT18246 plasmid p6330, complete sequence	0 crisprs	NA	0	0	0
NZ_CP015359	Bacillus thuringiensis strain MYBT18246 plasmid p17175, complete sequence	0 crisprs	NA	0	0	0
NZ_CP015353	Bacillus thuringiensis strain MYBT18246 plasmid p120510, complete sequence	0 crisprs	csa3	0	0	1
NZ_CP015358	Bacillus thuringiensis strain MYBT18246 plasmid p46701, complete sequence	0 crisprs	csa3	0	0	1
NZ_CP015350	Bacillus thuringiensis strain MYBT18246 chromosome, complete genome	3 crisprs	cas3,csa3,WYL,c2c9_V-U4,RT,DinG,cas14k,DEDDh	7	9	25
NZ_CP015355	Bacillus thuringiensis strain MYBT18246 plasmid p109822, complete sequence	0 crisprs	NA	0	0	1
NZ_CP015356	Bacillus thuringiensis strain MYBT18246 plasmid p101287, complete sequence	0 crisprs	NA	0	0	1
NZ_CP015352	Bacillus thuringiensis strain MYBT18246 plasmid p142098, complete sequence	0 crisprs	csa3,PrimPol	0	0	2
NZ_CP015354	Bacillus thuringiensis strain MYBT18246 plasmid p120416, complete sequence	0 crisprs	RT	0	0	1
NZ_CP015351	Bacillus thuringiensis strain MYBT18246 plasmid p150790, complete sequence	0 crisprs	PrimPol,RT	0	0	1
NZ_CP015360	Bacillus thuringiensis strain MYBT18246 plasmid p14456, complete sequence	0 crisprs	csa3	0	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

10523 : 39287

Bacillus_phage(52.17%)

capsid,protease,tail,terminase,portal,plate,head,transposase,integrase

attL 21151:21191|attR 25353:25393

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065487212.1\|10523_11297_+	ParA family protein	A0A0K2FLP4	Brevibacillus_phage	1.6e-16	28.5
WP_065487214.1\|11297_11663_+	hypothetical protein	NA	NA	NA	NA
WP_065487216.1\|11739_11931_+	hypothetical protein	NA	NA	NA	NA
WP_065487218.1\|11944_12211_+	hypothetical protein	NA	NA	NA	NA
WP_065487219.1\|12250_12796_+	hypothetical protein	NA	NA	NA	NA
WP_065487220.1\|13373_13631_+	hypothetical protein	NA	NA	NA	NA
WP_065487221.1\|13648_14680_-	N-acetylmuramoyl-L-alanine amidase	A0A0A7AQV3	Bacillus_phage	6.5e-146	72.9
WP_065487222.1\|14739_14943_-	hypothetical protein	D2XR32	Bacillus_phage	1.7e-18	59.1
WP_065485214.1\|14945_15227_-	hypothetical protein	D2XR31	Bacillus_phage	4.5e-33	78.0
WP_065487224.1\|15352_16435_-\|plate	BppU family phage baseplate upper protein	A0A1B1P768	Bacillus_phage	9.3e-135	66.5
WP_065487226.1\|16449_18792_-	endopeptidase	A0A1C8E983	Bacillus_phage	0.0e+00	87.3
WP_065487228.1\|18788_19472_-\|tail	phage tail protein	A0A1C8EA72	Bacillus_phage	2.0e-87	67.7
WP_065487230.1\|19473_21078_-	hypothetical protein	A0A1B1P764	Bacillus_phage	8.4e-07	39.8
21151:21191	attL	NA	NA	NA	NA
WP_065485081.1\|21293_24278_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	5.1e-66	23.2
WP_065485082.1\|24450_25323_+\|integrase	tyrosine-type recombinase/integrase	S5M9V8	Brevibacillus_phage	8.5e-22	27.5
WP_065487232.1\|25364_27479_-	hypothetical protein	A0A2H4J957	uncultured_Caudovirales_phage	4.1e-70	46.3
25353:25393	attR	NA	NA	NA	NA
WP_065485227.1\|27661_28030_-	hypothetical protein	A0A1S7FZ84	Listeria_phage	1.3e-08	34.6
WP_065487234.1\|28088_28658_-\|tail	phage tail protein	Q8W5Z9	Listeria_phage	8.8e-36	42.9
WP_065487236.1\|28658_29069_-	hypothetical protein	R4IBU7	Listeria_phage	1.4e-11	35.9
WP_065487238.1\|29058_29439_-	hypothetical protein	NA	NA	NA	NA
WP_065487240.1\|29425_29782_-\|head,tail	phage head-tail adapter protein	NA	NA	NA	NA
WP_065487242.1\|29781_30093_-	hypothetical protein	A0A1B1P751	Bacillus_phage	9.8e-13	40.5
WP_065487245.1\|30106_31228_-\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	1.8e-96	51.4
WP_065487246.1\|31241_31940_-\|protease	Clp protease ClpP	D2XR17	Bacillus_phage	7.3e-40	46.3
WP_065487248.1\|31881_33123_-\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	1.0e-73	38.2
WP_065487250.1\|33138_34806_-\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	1.6e-178	56.6
WP_065487252.1\|34789_35239_-	hypothetical protein	E2ELI1	Clostridium_phage	4.4e-22	43.5
WP_065487254.1\|35415_35727_-	hypothetical protein	NA	NA	NA	NA
WP_065487256.1\|35729_36056_-	HNH endonuclease	Q8W5V3	Listeria_phage	4.2e-14	44.3
WP_065487258.1\|36140_36380_-	hypothetical protein	NA	NA	NA	NA
WP_065487262.1\|37223_37508_-	hypothetical protein	NA	NA	NA	NA
WP_065487264.1\|38321_38756_-	transcriptional regulator	E5DV97	Deep-sea_thermophilic_phage	9.4e-38	54.4
WP_065487266.1\|38780_39287_-	zinc-finger domain-containing protein	A0A2H4JAV2	uncultured_Caudovirales_phage	1.8e-11	31.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP015350

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP015350_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015350_1

752176-752251

Orphan

Consensus_repeat	Method
ATCATCATCATGGAGGACACAATCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015350_1

>merge|NZ_CP015350|1|752176-752251|CRISPRCasFinder
ATCATCATCATGGAGGACACAATCATGGTGGGCACAATCATAACGGCGGACATCATCACCATGGAGGACACAATCA

>NZ_CP015350|1|1|752176-752251|CRISPRCasFinder
ATCATCATCATGGAGGACACAATCA	TGGTGGGCACAATCATAACGGCGGAC
ATCATCACCATGGAGGACACAATCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015350.1\|WP_065482135.1\|752975_754679_+\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|236645
NZ_CP015350.1\|WP_065482138.1\|754710_756108_-\|amino-acid-permease	unknown	unknown	gnl\|CDD\|129983
NZ_CP015350.1\|WP_065482141.1\|757409_758837_+\|PTS-system-trehalose-specific-EIIBC-component	unknown	unknown	gnl\|CDD\|273916
NZ_CP015350.1\|WP_001248842.1\|747486_749370_-\|VWA-domain-containing-protein	unknown	unknown	gnl\|CDD\|226921
NZ_CP015350.1\|WP_065482129.1\|741900_742959_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP015350.1\|WP_065482150.1\|762735_764238_-\|spore-germination-protein-GerKA	unknown	unknown	gnl\|CDD\|377020
NZ_CP015350.1\|WP_000095906.1\|744766_745957_+\|glycine-C-acetyltransferase	unknown	unknown	gnl\|CDD\|235893
NZ_CP015350.1\|WP_065482131.1\|742971_743793_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP015350.1\|WP_065482144.1\|758850_760512_+\|alpha,alpha-phosphotrehalase	unknown	unknown	gnl\|CDD\|274115
NZ_CP015350.1\|WP_000925211.1\|740899_741904_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP015350.1\|WP_000987242.1\|756557_757268_+\|trehalose-operon-repressor	unknown	unknown	gnl\|CDD\|274116
NZ_CP015350.1\|WP_000401638.1\|764428_765400_+\|phosphotransferase	unknown	unknown	gnl\|CDD\|225213
NZ_CP015350.1\|WP_065482153.1\|765560_767021_+\|alanine:cation-symporter-family-protein	unknown	unknown	gnl\|CDD\|376500
NZ_CP015350.1\|WP_065482133.1\|750394_751924_-\|cardiolipin-synthase	unknown	unknown	gnl\|CDD\|171510
NZ_CP015350.1\|WP_000892988.1\|749373_750267_-\|MoxR-family-ATPase	unknown	unknown	gnl\|CDD\|223786
NZ_CP015350.1\|WP_000723149.1\|746001_746967_+\|L-threonine-3-dehydrogenase	unknown	unknown	gnl\|CDD\|187580
NZ_CP015350.1\|WP_001189938.1\|747026_747449_+\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|239217
NZ_CP015350.1\|WP_021036116.1\|761648_762755_-\|GerAB/ArcD/ProY-family-transporter	unknown	unknown	gnl\|CDD\|281794
NZ_CP015350.1\|WP_000885974.1\|743821_744553_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP015350.1\|WP_065482146.1\|760543_761668_-\|spore-germination-protein-GerKC	unknown	unknown	gnl\|CDD\|274338

Protein	Function_ID	Function_description	E-value
NZ_CP015350.1\|WP_065482135.1\|752975_754679_+\|EAL-domain-containing-protein	gnl\|CDD\|236645	PRK10060, PRK10060, cyclic di-GMP phosphodiesterase.	6.06673e-109
NZ_CP015350.1\|WP_065482138.1\|754710_756108_-\|amino-acid-permease	gnl\|CDD\|129983	TIGR00905, Arginine/ornithine_antiporter, transporter, basic amino acid/polyamine antiporter (APA) family. This family includes several families of antiporters that, rather commonly, are encoded next to decarboxylases that convert one of the antiporter substrates into the other. This arrangement allows a cycle that can remove proteins from the cytoplasm and thereby protect against acidic conditions. [Transport and binding proteins, Amino acids, peptides and amines].	3.73974e-97
NZ_CP015350.1\|WP_065482141.1\|757409_758837_+\|PTS-system-trehalose-specific-EIIBC-component	gnl\|CDD\|273916	TIGR01992, phosphotransferase_system_trehalose_permease, PTS system, trehalose-specific IIBC component. This model represents the fused enzyme II B and C components of the trehalose-specific PTS sugar transporter system. Trehalose is converted to trehalose-6-phosphate in the process of translocation into the cell. These transporters lack their own IIA domains and instead use the glucose IIA protein (IIAglc or Crr). The exceptions to this rule are Staphylococci and Streptococci which contain their own A domain as a C-terminal fusion. This family is closely related to the sucrose transporting PTS IIBC enzymes and the B and C domains of each are described by subfamily-domain level TIGRFAMs models (TIGR00826 and TIGR00852, respectively). In E. coli, B. subtilis and P. fluorescens the presence of this gene is associated with the presence of trehalase which degrades T6P to glucose and glucose-6-P. Trehalose may also be transported (in Salmonella) via the mannose PTS or galactose permease systems, or (in Sinorhizobium, Thermococcus and Sulfolobus, for instance) by ABC transporters.	0
NZ_CP015350.1\|WP_001248842.1\|747486_749370_-\|VWA-domain-containing-protein	gnl\|CDD\|226921	COG4548, NorD, Nitric oxide reductase activation protein [Inorganic ion transport and metabolism].	1.90378e-98
NZ_CP015350.1\|WP_065482129.1\|741900_742959_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	5.548e-88
NZ_CP015350.1\|WP_065482150.1\|762735_764238_-\|spore-germination-protein-GerKA	gnl\|CDD\|377020	pfam03323, GerA, Bacillus/Clostridium GerA spore germination protein.	0
NZ_CP015350.1\|WP_000095906.1\|744766_745957_+\|glycine-C-acetyltransferase	gnl\|CDD\|235893	PRK06939, PRK06939, 2-amino-3-ketobutyrate coenzyme A ligase; Provisional.	0
NZ_CP015350.1\|WP_065482131.1\|742971_743793_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	3.06699e-133
NZ_CP015350.1\|WP_065482144.1\|758850_760512_+\|alpha,alpha-phosphotrehalase	gnl\|CDD\|274115	TIGR02403, Trehalose-6-phosphate_hydrolase, alpha,alpha-phosphotrehalase. Trehalose is a glucose disaccharide that serves in many biological systems as a compatible solute for protection against hyperosmotic and thermal stress. This family describes trehalose-6-phosphate hydrolase, product of the treC (or treA) gene, which is often found together with a trehalose uptake transporter and a trehalose operon repressor.	0
NZ_CP015350.1\|WP_000925211.1\|740899_741904_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	1.60688e-87
NZ_CP015350.1\|WP_000987242.1\|756557_757268_+\|trehalose-operon-repressor	gnl\|CDD\|274116	TIGR02404, Trehalose_operon_transcriptional_repressor, trehalose operon repressor, B. subtilis-type. This family consists of repressors of the GntR family typically associated with trehalose utilization operons. Trehalose is imported as trehalose-6-phosphate and then hydrolyzed by alpha,alpha-phosphotrehalase to glucose and glucose-6-P. This family includes repressors mostly from Gram-positive lineages and does not include the TreR from E. coli. [Regulatory functions, DNA interactions].	1.60325e-130
NZ_CP015350.1\|WP_000401638.1\|764428_765400_+\|phosphotransferase	gnl\|CDD\|225213	COG2334, COG2334, Putative homoserine kinase type II (protein kinase fold) [General function prediction only].	1.99893e-35
NZ_CP015350.1\|WP_065482153.1\|765560_767021_+\|alanine:cation-symporter-family-protein	gnl\|CDD\|376500	pfam01235, Na_Ala_symp, Sodium:alanine symporter family.	0
NZ_CP015350.1\|WP_065482133.1\|750394_751924_-\|cardiolipin-synthase	gnl\|CDD\|171510	PRK12452, PRK12452, cardiolipin synthase.	0
NZ_CP015350.1\|WP_000892988.1\|749373_750267_-\|MoxR-family-ATPase	gnl\|CDD\|223786	COG0714, COG0714, MoxR-like ATPases [General function prediction only].	4.21294e-37
NZ_CP015350.1\|WP_000723149.1\|746001_746967_+\|L-threonine-3-dehydrogenase	gnl\|CDD\|187580	cd05272, TDH_SDR_e, L-threonine dehydrogenase, extended (e) SDRs. This subgroup contains members identified as L-threonine dehydrogenase (TDH). TDH catalyzes the zinc-dependent formation of 2-amino-3-ketobutyrate from L-threonine via NAD(H)-dependent oxidation. This group is distinct from TDHs that are members of the medium chain dehydrogenase/reductase family. This group has the NAD-binding motif and active site tetrad of the extended SDRs. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	0
NZ_CP015350.1\|WP_001189938.1\|747026_747449_+\|NUDIX-hydrolase	gnl\|CDD\|239217	cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+ for their activity. Members of this family are recognized by a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which forms a structural motif that functions as a metal binding and catalytic site. Substrates of nudix hydrolase include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance and "house-cleaning" enzymes. Substrate specificity is used to define child families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required. This superfamily consists of at least nine families: IPP (isopentenyl diphosphate) isomerase, ADP ribose pyrophosphatase, mutT pyrophosphohydrolase, coenzyme-A pyrophosphatase, MTH1-7,8-dihydro-8-oxoguanine-triphosphatase, diadenosine tetraphosphate hydrolase, NADH pyrophosphatase, GDP-mannose hydrolase and the c-terminal portion of the mutY adenine glycosylase.	2.16108e-24
NZ_CP015350.1\|WP_021036116.1\|761648_762755_-\|GerAB/ArcD/ProY-family-transporter	gnl\|CDD\|281794	pfam03845, Spore_permease, Spore germination protein.	2.48601e-40
NZ_CP015350.1\|WP_000885974.1\|743821_744553_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	3.476e-19
NZ_CP015350.1\|WP_065482146.1\|760543_761668_-\|spore-germination-protein-GerKC	gnl\|CDD\|274338	TIGR02887, Spore_germination_protein_B3, germination protein, Ger(x)C family. Members of this protein family are restricted to endospore-forming members of the Firmicutes lineage of bacteria, including the genera Bacillus, Clostridium, Thermoanaerobacter, Carboxydothermus, etc. Members are nearly all predicted lipoproteins and belong to probable transport operons, some of which have been characterized as crucial to germination in response to alanine. Members typically have been gene symbols gerKC, gerAC, gerYC, etc. [Transport and binding proteins, Amino acids, peptides and amines, Cellular processes, Sporulation and germination].	9.3839e-96

>NZ_CP015350.1|WP_065482133.1|750394_751924_-|cardiolipin-synthase
MKKPIVQLLLIFTIVSIVLFLLNTSYISLYTFVGALWSITIVGISFVIFIENRSPQSTLAWFLVLALLPIIGVLLYAIFGRSRWRRKKHLHRSEEQRKLFREILERRRLELLLTVPLNERSLHLTEVIQKFGGGPAADKTTTKLLTNGDQTFSEILRAIEQAKHHIHIQYYIYKSDEIGTKVRDALIQKAKDGVIVRFLYDGLGSNTLRRRFLQPMKEAGIEIVEFDPIFSAWLLETVNYRNHRKIVIVDGEIGFTGGLNVGDEYLGRSKKFPVWRDSHLKIEGKALYKLQAIFLEDWLYASSGLNTYSWDQFMNRQYFPGKEISNAEGAVQIVASGPSSDDKSIRNTLLAVMGSAKKSIWIATPYFIPDQETLTLLRLSAIAGIDVRILYPGKSDSIISDQASQSYFTPLLKAGASIYSYKDGFMHAKIVLVDDIIATIGTANMDVRSFELNYEIISVLYESKTVHDIKRDFEEDFKHSTEIKWNSFQKRSIKKRILESFMRLISPLL
>NZ_CP015350.1|WP_000892988.1|749373_750267_-|MoxR-family-ATPase
MLEQFHIHSDLKQQLSTIHEKNKQEAGENAHLIGTKIYKASDNSIIEDAITALLLGKNILLKGPTGSGKTVLAETLSSLFQKPMHSINCSVDLDVEGILGYNTLQTKDGASEVSFVNGPLMKAMKNGHFLYIDEINMAKPETLPLLHGALDYRKMITNPFTQEVVYGDDEYRVIAAINEGYVGTSELNEALKNRFVIIEVPYIQGDTLKELLLAESKLNDVATIEKFVAFASDLMPLARDGRVSEEAASIRGIIDACDLGVYIPVMRAIERSIIAKLNDETEQMTVRELAESYFFEG
>NZ_CP015350.1|WP_001248842.1|747486_749370_-|VWA-domain-containing-protein
MRQIFSDKKIDASLFLQMENLMYALLKEDDAYLEYGYKAYYDEIEKKVVISHFWDDRKEEDTVIGLKSEVFLKALGNKHYSDMTLIRSYAIELQESPLKKFLTQLFVLLEDLRVEEIVKNLRPGTKHIFKRRKEMYRNYFGSQNEINRVRNYHGDRLFCLCYLSLTSDKYEMFNNEYFEQIEAILHEAFQARNTEDIMYIVEKIRYRLEALLESDMLNNYFGHAPLYLSVLADEKNCRVEDLANDDTQLIDDDENKNKMDESFSTWHRENKNNENENFLRFELESGTKTNMMGDTARESEDGDQALGSVQGTSQKSTQSNFDGADTEEARASHASSQHDGAYGKYNVGASHTFKEARKVNIDEKKDYQAIKSVVNKDVKELKKIIEKTIENKTNANSDKYYGRLRKKFLRIYTEKQPRMFYKKGQESQELDVAFQLLVDCSGSMYNKMEETKKSVVLFHEALKSLKIPHAISGFWEDASSAKPEDKPNVIHEVVNYKNSTLPNVGPEIMQLREEEDNRDGYIIRIVSEKLAKRPEKHKFLLVFTDGEPSALDYQQDGILDTHEAVKLARKSGMEVIGIFIEEGEAKEATYQLMKNIYNHHFLVANHAEDLRLKIKPLLKKLLLKTIE
>NZ_CP015350.1|WP_001189938.1|747026_747449_+|NUDIX-hydrolase
MQRVDVVYALIHDEETDKILMVHNVEQNVWSLPGGAVEKGEILEEALIREVKEETGLTAALGGLVAINEKFFEESGNHALFFTFRANVVKGELIAEDEGEISAIEWVDRTIANERFPYYDGGFESLLEVAIPYKFQPETK
>NZ_CP015350.1|WP_000723149.1|746001_746967_+|L-threonine-3-dehydrogenase
MKKILVTGSLGQIGSELVMKLRDVYGASNVIATDIRETDSEVVTSGPFETLDVTDGQKLHDIAKRNEVDTIIHLAALLSATAEKNPLFAWNLNMGGLVNALEAARELNCKFFTPSSIGAFGPSTPKDNTPQDTIQRPTTMYGVNKVAGELLCDYYYQKFGVDTRGVRFPGLISYVAPPGGGTTDYAVEIYYEAIKKGAYTSYIAEGTYMDMMYMPDALQAIISLMEADPSKLVHRNAFNITAMSFEPEQIAASIRKHIPTFTMDYAVDPARQTIADSWPNSIDATAAMKEWGFKAEYDLDKMTTDMLAKLKKKLTAELVMN
>NZ_CP015350.1|WP_000095906.1|744766_745957_+|glycine-C-acetyltransferase
MSSKTLAKFLEENLEDLKSKGLYNVIDPLESSNGPIITIGGKEYINLSSNNYLGLATDSRLQEAAIGAIHKYGVGAGAVRTINGTLDLHIKLEETIAKFKHTEAAIAYQSGFNCNMAAISAVMDKNDAILSDELNHASIIDGSRLSKAKIIVYKHSDMEDLRQKAIAAKESGLYNKLMVITDGVFSMDGDVAKLPEIVEIAEELDLMTYVDDAHGSGVLGKGAGTVKHFGLSDKVDFQIGTLSKAIGVIGGYVAGKQNLIDWLKVRSRPFLFSTALTPADAAACMRSIEILMESTELHDRLWENGRYLKQGLKELGFNIGESETPITPCIIGDEVLTQEFSKRLNEEGVYAKSIVFPTVAKGTGRVRNMPTAAHTKEMLDEAIRKYEKVGKEMGII
>NZ_CP015350.1|WP_000885974.1|743821_744553_-|class-I-SAM-dependent-methyltransferase
MAFTESDVYNNTAFFEQYMKRRYRENSPNESIEKPVFFQLIGHVQGKQILDLGCGDAKFGAELLEKGCYSYTGIEGSELMYGKAKKQLENKNGSVHFLNLKDYTYPSSTFDLVTSRLALHYIEHLDIIFQNVFQTLKTNGTFTFSVQHPVITSSFESLQTSGKRTSWLVDDYFKLGKRVEPWIDQEVIKYHRTTEEYFTLLQQAGFTITSLKEATPNPTYFQDEEEYKRRLRIPLFLLFSCTK
>NZ_CP015350.1|WP_065482131.1|742971_743793_+|ABC-transporter-ATP-binding-protein
MQKALETKSLTLSYGETIIIDELNLEIPKGEITIFIGSNGCGKSTLLRSLARLLKPTNGDILLDNQAIQSMQTKQIARQMAILPQGPQAPEGLTVLQLVKQGRYPYQTWLKQWSEKDEEMVQKALAATGMTEFAERDVHALSGGQRQRAWIAMTLAQDTDIILLDEPTTYLDMTHQIEVLDLLFELNETEQRTIVMVLHDLNLACRYADNIVAIQDKQIYAQGKPEEVVDEKLVRDVFRMECQISTDPLFGTPLCIPHGRGRRVVKEVAQAMR
>NZ_CP015350.1|WP_065482129.1|741900_742959_+|iron-ABC-transporter-permease
MKKYIPFRIGKGELSFLMYKRACLVLLSLLVVLIGLFFASAGMGDMKIAPYDVWQAITGNGDAMSNMVVNKFRMPRILIAILVGIALAVAGCILQGLVRNPLASPDIIGITGGASVAVVLFLALFSDKNNALTVSIHYMPLAAFAGATIVAVFVYLFAWQNDGLSPISLVLIGVGFWALTKAATTLFMLLAPIYQASQANVWITGTVYGSSWQNVIVLAPWVLILTVISFIAARHLNAQELGDDIAVGLGVPLTKSRVFMLLLSTALIGGAVAFAGGIGFVGLMAPHISRRLVGSLYGALLPVAAIVGAILVLAADLIGRTIFTPLEIPAGVFTSAIGAPYFIYLLYKSRNS
>NZ_CP015350.1|WP_000925211.1|740899_741904_+|iron-ABC-transporter-permease
MLLKTNQAKWIGLFVGIIAVVICIWGSIIFGYTNTSWKLALDAFFHFNGSNEHIIIQNVRLPRALIAASVGASLAIAGCLMQTLTKNPLASPDFIGLNSGAAFFIVVAIVIFSVTSLSAFTWIAFLGAAVAAVLVFASSSLGKEGTTPLKLTLAGVAISALFSSLTQGLLVLNEKALEEVLFWLAGSVQGRKLEILQSVFPYLLIGWIASLMMAGKVNTLMMGEDVAKGLGQRTILMKSFVLLIIVLLSGGSVAVAGPIGFIGIITPHFARFLVGVDHRWRVPYSGLLGAILLILADIAARYVIMPQEVPVGVMTAFIGAPFFIYIARKRGLSK
>NZ_CP015350.1|WP_065482135.1|752975_754679_+|EAL-domain-containing-protein
MLEQRGHALYDSSLRDLKLALDESSIVAITDRKGLIKYVNDKFCEISKYKREELIGKDHRILNSGHHPKTFFQDLWKRILNGKVWTGEIRNRAKDGTYYWVKTTIVPFLNEKGEPYQFIAIRNDISSRKEAEHRLRLSESRYRELAYHDALTSLPNRLQLITTVNKLIADKKEFGMIYFDLDRFKLVNDTLGHMIGDLLLSEVASRLHYVLGEKDVLARLGGDEFVLLTKNHRQDDMSQLATSVLSCFQAPFILEGHEVYISASLGLCSYPQDGQDVETLLKNSDLAMYSAKEQGRNAACFFTDELRAKINRRMKVEFALQKAIRDEELDVALQPIIDLKTKRYSGIEALVRCMTEDGPISPSEFIPVAEESGLIIKLGDWVLEKSCRLFKTLPNYQEGLKLSVNLSIQQLMQKRFILSVRSILKRTGFPPNRLILEITESIAVRHFDYIIATLQELRNMGVLIALDDFGTGYSSLYYLKQLPLDIVKIDRNFIREFHYDHAQPERTIVKSVIEIAHSLNLAVVAEGVETVEQESLLQSMSCDYVQGFYYAKPLSVGELKEKLITDF
>NZ_CP015350.1|WP_065482138.1|754710_756108_-|amino-acid-permease
METKKWGLWVLTAFVIGNMVGGGVFMLPANLAQVSGPMGSTLAWSITGLGVFMIALVFGNLAIRKPELKAGPQSYAQAMFPSKKAGKVAGYSMAWGYWAANWAATASVIISFAGYLSTFFPVLQSKQILFSINGFSLELGKGLTFLVCSLMLWGILYILSQNIDRAGNMNLLATIAKIIGFTMFIVITLFIFNASNFGDGQTFMNEAGQSISLGGQINSAAIATLWAFIGIESAVMLSNRAKSQRDVKKATIFGLIIALLIYMSITLLTMGALPQDALKESQKPLVDALNLAIGNKGAYIMALLALISLFGSTVGWIVVSSEVPYQAAKNGLFPKFFGKTNKKGSPSKSLLITNVMTQIFLFSTISGTVSEAYSFAIVVATLAYLIPYLVSTLYQFKLVITGETYDIMPGSRIKDGIITTLAFVYSIWVIKTGTADLKTFFLGIGLFVLGLILYPVLMKDSQKTD
>NZ_CP015350.1|WP_000987242.1|756557_757268_+|trehalose-operon-repressor
MMSKYEQIYTEISKSIDNKQLKEGCKIPSETELMKQYEASRGTVRKAVDLLQERGYVQKIHGKGVFVLKRKNIEFNFGGIVSFQEENERLGRHCITEVVEMDKEKATKEIAKLLNVKEKTEIDHIKRVRNIDGEKVILDINHFVSEFIPGLTKEIATASIYKYIEKELGLHISYSQRVIEVQPCTEDDRKYLDLNGTDYVVVVKNFTHLYDGSQFEYTESRHRLDIFHFSDVARRK
>NZ_CP015350.1|WP_065482141.1|757409_758837_+|PTS-system-trehalose-specific-EIIBC-component
MGKDYRKTAEEVLQYIGGKENIEQAAHCVTRLRIALKDESKIDNDKLQSVSLVKGAFHNAGIFQVVIGPGDVDRVYAELITLAGMKESTVADVKDSGNQKLNPAQKFVKIFSDVFMPILPAIVTAGLLMGINNLLGAKDLFFDGRNLLDVYPNLGGLWDLINMMANTAFVFLPALVGWSATKRFGGSPILGIVMGLMLVHPALLNAWDYGKAATGLEGQKIEYFNILGLFQIEKVGYQGQILPVLVAAFVLSKVEIFLKKHVPNAIQLLVVPITTIVVTGVLALGIIGPVTRHIGDLLTVGLVGVYETVPVVGAVLFGALYAPLVITGMHHMFIAIDLQLIAQHGGTFIWPMIALSNIAQGSAALAMFWISKNQNDKSMASTSAISAYFGITEPAMFGVNLRNKFPFYAAIIGSAIAAIFITLNGVLAPAIGIGGLPAFISIIPKSIPMFIVGMIIAVVIPFTLTWLFAKRVKQK
>NZ_CP015350.1|WP_065482144.1|758850_760512_+|alpha,alpha-phosphotrehalase
MKDWHKSVVYQIYPKSFNSYYNRETGDIKGVTEKLDYLKELGVDYIWLTPIYQSPQNDNGYDVSDYYSVDPSYGTMEEFEELLEEAKVRNIEIMLDIVVNHSSTEHKWFKEAKEDKNSPYRNYYIWRDEKNNWQSKFGGSAWKYDEKTEQYYLHLFDETQADLNWENEKLREEVYDMMRFWLDKGVTGFRLDVINLISKDQRFLNDEGSTATSDGRKYYTDGPRVHEYLQEMSRNVFAGKDVITVGEMSSTTIDNCIKYSNPERNELSMTFSFHHLKVDYANGDKWTKADFDFIKLKEIMSNWQIEMQKGGGWNALFWCNHDQPRIVSRFGDDGKYRNESAKMLATAMHMLQGTPYIYQGEEIGMTNPKFESIEQYRDVESLNIYDIKLKEGLSKEEIIGILKQKSRDNSRTPMQWNEEMNSGFTTSTPWISAAENFKEINVEKALEDKESVFYHYKKLIELRKTYDVITEGEYAILDKNDPKIWAYTRTTESEVLLVINNFYEEEITYSIPAHVQLDGMKQEVLLSNYKDASKDIAKLNLRPYESIVYRYTK
>NZ_CP015350.1|WP_065482146.1|760543_761668_-|spore-germination-protein-GerKC
MFTRKVKLLSILCASSLLSGCWDQEPLREARLAYSIGSDITEENKLQQTIELVKSSSGEQSSFENEIHSATGHNIRDTSDALKKNVTGNIRYFKYGVQLLGTKILKKGILPYLDVSFRDPTNPTALVKLIAVDGETSEILEKKKVGNLLIGDFLKKKVKSLEDMSVFPKETLETAATKMLDPGKDFTLPSIKIKGKEVITNGLALFNNDKLTGHLPLKQSVLFVLLTGKMGTSARITQKLTSGESEKTSDYLTMEISNRKLKRDLKITTDKKGNVYAHIKLQLKVIALEAPRDNLYKMDERKKLNKELSKQLTKEAKKITKKLQKANCDAFGIGRHLIAYHPDLWKKKNWNKDYAKVKFKPEVEVNILYSGVLK
>NZ_CP015350.1|WP_021036116.1|761648_762755_-|GerAB/ArcD/ProY-family-transporter
MTNTQSKISLVQFTFFVIQCQIGVGILSLPNRLHPIAKGGGWISALIAGLAIQLIILLMWLFLKRFPDADMYESVCMLFGNKFGKLLGFAYVFYFTLIGMTVMLNACNVIKVWILQATPWSAILMLFTIACCYVAYNTFKVIVRFYVMASILIIPMALLIALGLSRADFSYIFPITEAGWWNIIQASKETITAMYGFEIILIAFPKVNGSSVAKLKAISIANGFVTLFYTFTVWICFIVFSPKQIELIPEPVAYLLRSLHIGIIDRTDLLFIPIWMITVAASIASYYCAASIGVGHIFNLANHKKAVPIIGIIAFSVALFIDTPEELKVISTFTDKFTYIFIVVLPLLFLLYSVIRNKKGEQYVHKKS
>NZ_CP015350.1|WP_065482150.1|762735_764238_-|spore-germination-protein-GerKA
MTERKEQQESKKQKHMFPSLPENINYIENKLSHSDDIKKLDLPFQNGKGIIIYIESLADPNLIHQLALEPLLTRSDLSLDKAFSTLNMKKETNLNYGVQLLLQGKSLYFHEHVESFCIFETALSLKRDITEPDNEGIVRGPHTGFVEDLATNLASIRKLIKSPNVVVKYFTLGEEMHTKVAIAYMQNIANDDLVTEVKRRLQTIKTDALMPPGYIQEFIEDTSFSPFPQQLNTERPDRVAANLMEGRVAILSDGDPTALIVPVTLFAFYQSPDDYNNRWIVGSFVRMIRLVSFLIAFLLPAIYIATVAFHPDVLPLELVYTIKASLEKVPLPPIFEALLMELIFELLREAGIRLPSRVGQTIGIVGGLVIGDAIVKAGLVSYTMIIVVALTAISSFLVPSNDMSSAVRILRFPLMLLAAIFGYVGISFGLIITFVHLCQLHSFHTPYLSPVAPMRIKDMKDSFVRLPIWSFWERPHDPKPKKMQRQHVTREDEDGDKHAK
>NZ_CP015350.1|WP_000401638.1|764428_765400_+|phosphotransferase
MEIAVERVFTKEILKRAAGLFHVTVEEKPLGDFENYIFKAKGDNDEDYVLRLTHSSHRSKQEVEAELDFLRYVAENGAKVAGPLHSKSQNLVEEIRAEDGTFFFASLFTYAKGEQVKGEESPYWGEPLFEAWGKAIGQLHRLTMDYPKTDYRDTWEEDESGIANELEDEKVKEVAAVLMGEIKTLPIGRETFGLMHGDIHPGNFHYDGKELTIFDFDDAAYNYFIHDLAMVLYYSVLFTPWTVEEKTTFARKQLQVLRKGYEYEHRLADSWYESLPLFLRLRDIGLYGTLQKKFKGKDMPDNFLKLSEELYGRIIEKEAIVNI
>NZ_CP015350.1|WP_065482153.1|765560_767021_+|alanine:cation-symporter-family-protein
MEAIVSWINNIVWSPALVYLCLGAGLYFSIRTRFLQVRHVGEMVKLTFQGEKSDAGVSSFQALALSLSGRVGTGNIAGVATAVAFGGPGAVFWMWAVAFLGAGSAYVESTLAQIYKTKHQGQFRGGPAYYIEKGLGVKWYALVFVAATILATGMLLPGVQANSIAVSLETAFGINTSVSGAVLVAALALIIFGGVKRIVNVAQVVVPFMALGYILVACVIVAMNIEKLPDAFMLILKSAFALEAAFGGIIGLAISWGVKRGIYSNEAGQGTGAHAAAAAEVSHPAKQGLVQAFSVYIDTLFVCSATAFMMIITGMYNVFDASGKNFIVNKLNGAQPGPGYTQAAVESVFPGFGNGFVAISLLFFAFTTIMAYYYIAETNIAYLNRDKDRPWMSIVLKFVFLGVVFYGCVKTAATAWALGDIGVGIMAWVNIIAILLLQKPALIALKDYEKQKKEGKDPVFDPQELGIKNADFWEHEYGKNKKEEVS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP015350_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015350_2

2470859-2470952

Unclear

Consensus_repeat	Method
TGAATTAATGCAACAAATTGCTCAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015350_2

>merge|NZ_CP015350|2|2470859-2470952|CRISPRCasFinder
TGAATTAATGCAACAAATTGCTCAGCGTAATCAGAATGCATTAAAACAGAGTACATATAAAACTAATTTTGAATTAATGCAACAAATTGCTCAG

>NZ_CP015350|2|2|2470859-2470952|CRISPRCasFinder
TGAATTAATGCAACAAATTGCTCAG	CGTAATCAGAATGCATTAAAACAGAGTACATATAAAACTAATTT
TGAATTAATGCAACAAATTGCTCAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015350.1\|WP_006923995.1\|2462050_2462437_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015350.1\|WP_049107805.1\|2468814_2469669_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP015350.1\|WP_065486066.1\|2471476_2471689_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015350.1\|WP_016122509.1\|2462944_2463409_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015350.1\|WP_065483603.1\|2472425_2473136_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP015350.1\|WP_094194456.1\|2459850_2460895_-\|IS630-family-transposase	unknown	unknown	gnl\|CDD\|315923
NZ_CP015350.1\|WP_053564492.1\|2477385_2478123_+\|2,3-diphosphoglycerate-dependent-phosphoglycerate-mutase	unknown	unknown	gnl\|CDD\|184516
NZ_CP015350.1\|WP_065483612.1\|2478361_2479099_+\|stage-II-sporulation-protein-SB	unknown	unknown	gnl\|CDD\|372944
NZ_CP015350.1\|WP_000191889.1\|2476736_2477219_+\|winged-helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224759
NZ_CP015350.1\|WP_065481512.1\|2465599_2466856_-\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|376773
NZ_CP015350.1\|WP_000858032.1\|2469842_2470043_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015350.1\|WP_094194517.1\|2472213_2472372_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226647
NZ_CP015350.1\|WP_065483591.1\|2467262_2467745_+\|ArpU-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|273725
NZ_CP015350.1\|WP_006923989.1\|2458856_2459108_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015350.1\|WP_000072495.1\|2473254_2473662_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319899
NZ_CP015350.1\|WP_065483606.1\|2474003_2474786_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369777
NZ_CP015350.1\|WP_065483594.1\|2467744_2468287_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271192
NZ_CP015350.1\|WP_000237818.1\|2479211_2479340_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015350.1\|WP_141550274.1\|2474943_2476620_-\|alpha-keto-acid-decarboxylase-family-protein	unknown	unknown	gnl\|CDD\|226470
NZ_CP015350.1\|WP_139359406.1\|2466982_2467075_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP015350.1\|WP_049107805.1\|2468814_2469669_+\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	1.23363e-33
NZ_CP015350.1\|WP_065483603.1\|2472425_2473136_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	1.6648e-25
NZ_CP015350.1\|WP_094194456.1\|2459850_2460895_-\|IS630-family-transposase	gnl\|CDD\|315923	pfam13358, DDE_3, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	2.49943e-46
NZ_CP015350.1\|WP_053564492.1\|2477385_2478123_+\|2,3-diphosphoglycerate-dependent-phosphoglycerate-mutase	gnl\|CDD\|184516	PRK14115, gpmA, 2,3-diphosphoglycerate-dependent phosphoglycerate mutase.	1.34425e-175
NZ_CP015350.1\|WP_065483612.1\|2478361_2479099_+\|stage-II-sporulation-protein-SB	gnl\|CDD\|372944	pfam14171, SpoIISA_toxin, Toxin SpoIISA, type II toxin-antitoxin system. SpoIISA is a toxin which causes lysis of vegetatively growing cells. It forms part of a type II toxin-antitoxin system, where the SpoIISB protein, pfam14185, acts as an antitoxin. It is a transmembrane protein, with a cytoplasmic domain accounting for approximately two-thirds of the protein. The structure of the cytoplasmic domain resembles that of the GAF domains, pfam01590. SpoIISB binds to the cytoplasmic domain of SpoIISA with high affinity.	1.50804e-81
NZ_CP015350.1\|WP_000191889.1\|2476736_2477219_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224759	COG1846, MarR, Transcriptional regulators [Transcription].	6.75683e-17
NZ_CP015350.1\|WP_065481512.1\|2465599_2466856_-\|IS110-family-transposase	gnl\|CDD\|376773	pfam02371, Transposase_20, Transposase IS116/IS110/IS902 family. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS116, IS110 and IS902. This region is often found with pfam01548. The exact function of this region is uncertain. This family contains a HHH motif suggesting a DNA-binding function.	5.98428e-29
NZ_CP015350.1\|WP_094194517.1\|2472213_2472372_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226647	COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism].	0.00994023
NZ_CP015350.1\|WP_065483591.1\|2467262_2467745_+\|ArpU-family-transcriptional-regulator	gnl\|CDD\|273725	TIGR01637, Putative_autolysin_regulatory_protein_ArpU, phage transcriptional regulator, ArpU family. This model represents a family of phage proteins, including ArpU, called a putative autolysin regulatory protein. ArpU was described as a regulator of cellular muramidase-2 of Enterococcus hirae but appears to have been cloned from a prophage. This family appears related to the RinA family of bacteriophage transcriptional activators and to some sporulation-specific sigma factors. We propose that this is a phage transcriptional activator family. [Mobile and extrachromosomal element functions, Prophage functions, Regulatory functions, DNA interactions].	1.31352e-15
NZ_CP015350.1\|WP_065483606.1\|2474003_2474786_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	2.18537e-20
NZ_CP015350.1\|WP_065483594.1\|2467744_2468287_+\|site-specific-integrase	gnl\|CDD\|271192	cd01192, INT_C_like_3, Uncharacterized site-specific tyrosine recombinase, C-terminal catalytic domain. Tyrosine recombinase (integrase) belongs to a DNA breaking-rejoining enzyme superfamily. The catalytic domain contains six conserved active site residues. The recombination reaction involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	1.91426e-61
NZ_CP015350.1\|WP_000072495.1\|2473254_2473662_+\|VOC-family-protein	gnl\|CDD\|319899	cd06588, PhnB_like, Escherichia coli PhnB and similar proteins. The Escherichia coli phnB gene is found next to an operon of fourteen genes (phnC-to-phnP) related to the cleavage of carbon-phosphorus (C-P) bonds in unactivated alkylphosphonates, supporting bacterial growth on alkylphosphonates as the sole phosphorus source. It was originally considered part of that operon. PhnB appears to play no direct catalytic role in the usage of alkylphosphonate. Although many of the proteins in this family have been annotated as 3-demethylubiquinone-9 3-methyltransferase enzymes by automatic annotation programs, the experimental evidence for this assignment is lacking. In Escherichia coli, the gene coding 3-demethylubiquinone-9 3-methyltransferase enzyme is ubiG, which belongs to the AdoMet-MTase protein family. PhnB-like proteins adopt a structural fold similar to bleomycin resistance proteins, glyoxalase I, and type I extradiol dioxygenases.	6.96414e-57
NZ_CP015350.1\|WP_141550274.1\|2474943_2476620_-\|alpha-keto-acid-decarboxylase-family-protein	gnl\|CDD\|226470	COG3961, COG3961, Pyruvate decarboxylase and related thiamine pyrophosphate-requiring enzymes [Carbohydrate transport and metabolism / Coenzyme metabolism / General function prediction only].	0

>NZ_CP015350.1|WP_000858032.1|2469842_2470043_-|hypothetical-protein
MKTSEETHWQRFKRKSKSPKEWLKKVYEFFINEHVWDAIFKVFLKLVWAVKGMGKSLKRVIENIFN
>NZ_CP015350.1|WP_049107805.1|2468814_2469669_+|alpha/beta-hydrolase
MTEKIIKINEIDICTESFGDSADPAVLLIMGAMCSMVYWDEEFCQQLADTGRYVIRYDNRDVGRSTTYKPGSSHYTVVDMADDAIGVLDAYHIDEAHIVGMSLGGMIAQIVALRNPQRVLSITLIASGIFGSEDNNRNLPPIDEKILAYHANAAKLNWSDEESVANYLVAGSALLCGSNHKFDEKRVYKQVEKEIKRANNLLSMFNHSLLKGDDSYEGKLKGINIPTLVIHGTEDIVLPYEHGLALVDEIPHALLLTLEGSGHEIHCDDWNHIINAISNHTSVL
>NZ_CP015350.1|WP_065483594.1|2467744_2468287_+|site-specific-integrase
MNFVQPIRDPEQIQQLKEYFKEKSLRNYILFIMGINTGLRISDILKLKVGDAKGSHISMREKKTGKQKRIQITAALKRELKWFIEEREDNEYLLQSRQGKNRPIGRSMAYKILSGAASEFGLDEIGTHTLRKTYGYHMYMQTKNIALLMEIFNHSSEKVTLRYIRVNQDAMDKAMTRFKI
>NZ_CP015350.1|WP_065483591.1|2467262_2467745_+|ArpU-family-transcriptional-regulator
MTKQLSFLPKIDITATHEELEGVLESVRIHRQFGMMRKEMKVTPSYEIREHGPTHAVGKPLEDVAIVNIQQSKREEWLEIMSVRIDQFLNRLGNERAGSIQRDIIYKRYLEDEDVCDYMVYNEIGMSERTYRRWKSKAFYKLAFALGLEVYETEETGGNE
>NZ_CP015350.1|WP_139359406.1|2466982_2467075_+|hypothetical-protein
MNYYSKAQSAIETASVLVVITMARVTDLVS
>NZ_CP015350.1|WP_065481512.1|2465599_2466856_-|IS110-family-transposase
MKLFVGLDVSSEKLDVCFLSDDDQLTILLEDSLGNDIEGASQIKQKILAFQKVYSFSQIVIGMESTSMYSFHPATFFNEDRELQRINTVVTIENPFRIKQFSRIFDEDKTDKNDAMRIADFLRIQRYTTSPIKEEKYMALQRLTRTRYQLIGQLVETKQHFLENLTYKCNALTRELKNSDTNSSVFGATLLSLMTEDYGLDELAHMPLTDFISLLQEKGNGRFKNPEGLAKTIQRAITMSYRLGEVAQESINIILSVLAREIRALEASIKDLDKAIEQLVIVLPEYQCLTSIPGVGKVYAAGLLAEIGQIQRFEDQTKLAKYAGLSWKIKQSGNYQSENTPLTKQGNRYLRYYLVEAANSVRRYLPEYQAFYQKKYKETPKHQHKRAIVLTARKFVRLVDTLLRNHQLYTPPRSVIEK
>NZ_CP015350.1|WP_016122509.1|2462944_2463409_-|hypothetical-protein
MADYFYKDGKKYYKNQAHSDPQKNNCFVETHTIGGSGVNLNGNIPISIDLLDTTPQTVFEDFTNNHNKTLIQLFVVGMSAPVQVTILTRRSSLPITTTLQPVQTKIFQVEDFQSLTFTKQEGPASVVSLFIQKTFCICCNDNNDSCNEYYHECN
>NZ_CP015350.1|WP_006923995.1|2462050_2462437_-|hypothetical-protein
MASFEIGARSLFNFRNERFFLLVEDEITIPDKGVEIDPVNIYEIDQQTFNFIRDEGDTPVIEPVDTLPTVPPGFKLERKCIFTVDNSYFVIYDLEDGTDNNVLLRISAALFNSLRNSGVRECFPQNFI
>NZ_CP015350.1|WP_094194456.1|2459850_2460895_-|IS630-family-transposase
MTNAHQNEKENLLVAMKTTKNKRMYERYQTIYFYVQGYSIKEIMNMIGRSEKTIYNYVNAYKEKGLDGLIMGQSTGAPRKLSPEQEQELVQVIASKLPVDVGFLAKYSWTLSIIASFIKREWNASYTLRGVSRLLHDLGLSYTKPTYTLAKADPVKQQEFREVTFPPIKKLLNEEIDHLLFQDESMIRDYQALQHTWFLKGKQRRIPTYGKHQGVKLIGTLNYETGELFCVEKERYDADTFLRFLQKVLERYPNGKIAMILDNARIHHAKLIQPFLSRHLHRLELVFLPPYSPDLNLIEGLWKWLKSDVIHNVFYSSVYEIQKNVQAFIQELNRTPEKVINRLCVQL
>NZ_CP015350.1|WP_006923989.1|2458856_2459108_+|hypothetical-protein
MSVARNHEAMKESRLKVYIALEEANFIWDERDVIRFREMWSQGMSLPKMAKALRRHQAEVAILVIDQADKYLIKNRPIGLGIC
>NZ_CP015350.1|WP_065486066.1|2471476_2471689_+|hypothetical-protein
MQAKKILKIIKPTKANVLAIPFGAKIAKTIEIGIKIKKGPAKYRLKNKNPVKNIEMKPKYSLIVLSLLKK
>NZ_CP015350.1|WP_094194517.1|2472213_2472372_+|ABC-transporter-ATP-binding-protein
MTHDVKVAVKTERVLFLADGELVSEIWMGKYEHDYLKVREEKLLKWQDVLGF
>NZ_CP015350.1|WP_065483603.1|2472425_2473136_+|class-I-SAM-dependent-methyltransferase
MKTETLHTQEDILKMLDSLLRPAEPFWNEFYENREKDVPFFENVPDENLVSYIQKERVLKGKILELGCGPGRNAIYLANEGFDVTAVDLSVEGINWAKERALAKGVAIHFICDSIFNLEVQNEFDFVYDSGCLHHIPPHRRINYVDLIKNSLKSGGYFGLTCFAAGDLDERNGSEITDWDVYREWSLQGGLAYSEEKLREIFKEFEVIEIRRMKQIKQLNEMFGESFLWTALFKKK
>NZ_CP015350.1|WP_000072495.1|2473254_2473662_+|VOC-family-protein
MSNTNQKITTFLMFEGKAEEAMNFYTSLFDQSEIVSISRYDENGPGKEGTVIHATFTLNGQEFMCIDSYVNHNFTFTPAMSLYVTCETEEEIETVFHKLAQDGAILMPLGSYPFSKKFGWLNDKYGVSWQLTLAE
>NZ_CP015350.1|WP_065483606.1|2474003_2474786_+|class-I-SAM-dependent-methyltransferase
MDITQQNSNAWDKKVEEGSRYTQPVSSEIIEKSKSGEWEITVTTEKSVPREWFPKSLDGLKILCLASGGGQQAPVLAAAGADVTVTDISKKQLEQDEKVAKRDGLTLKTVQGDMSDLGDFEDEYFDIVINPVSNLFVKDVHLVWNEVSRVLKNKGILIAGFTNPLLWIFDDNQEQKGILDVKHSIPSSTLDYLPEDEVQDYIDSNQTIEYAHTLEDQIQGQIEAGFAITGFYEDDFGGTRILDKHIKTFIATKAIKLKMD
>NZ_CP015350.1|WP_141550274.1|2474943_2476620_-|alpha-keto-acid-decarboxylase-family-protein
MKKQYTVSTYLLDRLHELGIEHIFGVPGDYNLAFLDDVVAHENLKWIGNCNELNAAYAADGYARIKRIAALITTFGVGELSAINGIAGSYAENVPVIKITGTPPTKVMENGAIVHHTLGDGKFDHFSNMYREITVAQTNVKPEHAAEEIDRVLRACWNEKRPVHINLPIDVYNKPINKPTEPILYKPILSNKEALDKMLLHATSIINNAKKPVILADFEVDRFHAKENLHQFVEKTGFPIATLSMGKGIFPEKHPQFIGIYTGDVSSPYLRKRIDESDCIISIGVKLTDTITGGFTQGFTKEQVIEIHPYTVKIIDKKYGPVVMQDVLQHLSDSIAHRNKDTLEIKPFISAPSPFTEEFNPKAQMVTQKRFWQQMYHFLQENDILIVEQGTPFFGSAAIPLPNNTAYVGQPLWGSIGYTLPALLGTQLANLSRRNILIIGDGSFQVTAQELSTILRQNLKPIIFLINNNGYTVERAIHGQNQPYNDIQMWDYNKLSMVFGSEEKSLTFKVENEAELAEVLTNITFNKNQLIFIEVIMSQSDQPELLAKLGKRFGQQNS
>NZ_CP015350.1|WP_000191889.1|2476736_2477219_+|winged-helix-turn-helix-transcriptional-regulator
MTQHKEEQMNEALALFYFAYKTFTEKPDEIIKEYGIQRVHHRILFFIARFPGISVNELLSLLEISKQALHGPLRQLVEKGLIESNEAMHDRRVKQLSLTEKGTDLEKKLSDVQRQQMGAIFSKFGESCEDNWHQVMNEMANSRSGFDAWITKRELPVDQK
>NZ_CP015350.1|WP_053564492.1|2477385_2478123_+|2,3-diphosphoglycerate-dependent-phosphoglycerate-mutase
MIKLVLIRHGQSLWNLENRFTGWTDVDLSENGLSEAREAGAILKKNGYTFDVAYTSVLKRAIRTLWIVLHEMDLTWVPIHKSWKLNERHYGALQGLNKDETAQKYGEEQVHIWRRSVDVRPPALTEDDPRYEANDPRYKTLKKGEFPLTECLEDTEKRVLTYWHSEIAPTLKSGNKVIISSHGNTIRSLVKYLDNLSSDGVVSLNIPTSIPLVYELDENLRPIRHYYLSMDGEVPEGEIPKHISF
>NZ_CP015350.1|WP_065483612.1|2478361_2479099_+|stage-II-sporulation-protein-SB
MISNIRIGLFVLAIVFVVLVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAFILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPSVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKIVVFEAAKELNTNFRGIRSQFSIIVPLEHIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKTNLQDRDFENVYNLTIHHSYFSK
>NZ_CP015350.1|WP_000237818.1|2479211_2479340_+|hypothetical-protein
MVKDYDNDFFKEDNEDTTDFSLIKGDTLQQVEELEEELKRKS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP015350_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015350_3

3936213-3936743

Orphan

Consensus_repeat	Method
NGCTACTGGACCTCAAGG	CRT

11 spacers

The CRISPR arrays of NZ_CP015350_3

>merge|NZ_CP015350|3|3936213-3936743|CRT
ACCTACTGGACCTCAGGGACCTCAAGGTAACACAGGTGCTACTGGTGCTACCGGACCTCAAGGTGCTCAAGGTAACACAGGTGCTACTGGTGCTACCGGCGCTACCGGACCTCAAGGTGCTCAAGGTAACACAGGTGCTACTGGTGCTACCGGCGCTACTGGACCTCAAGGTGCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCAAGGCGTTCAAGGTAACACAGGTGCTACCGGCGCTACTGGACCTCAAGGTGTTCAAGGTAACACAGGTGCTACTGGTGCTACTGGACCTCAAGGCGTTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCAAGGTGCTCAAGGTAACACAGGTGCTACTGGACCTCAAGGTGTTCAAGGCAACACAGGTGCTACCGGCGCTACTGGACCTCAAGGCGTTCAAGGTAACACGGGTGCTACTGGCGCTACTGGTATAGGAGTTACTGGACCTACTGGACCTTCTGGTGGACCTACCGGACCTACTGGGCCAACTGG

>NZ_CP015350|3|1|3936213-3936743|CRT
ACCTACTGGACCTCAGGG	ACCTCAAGGTAACACAGGTGCTACTGG
TGCTACCGGACCTCAAGG	TGCTCAAGGTAACACAGGTGCTACTGGTGCTACCGG
CGCTACCGGACCTCAAGG	TGCTCAAGGTAACACAGGTGCTACTGGTGCTACCGG
CGCTACTGGACCTCAAGG	TGCTCAAGGTAACACAGGTGCTACTGG
TGCCACTGGACCTCAAGG	CGTTCAAGGTAACACAGGTGCTACCGG
CGCTACTGGACCTCAAGG	TGTTCAAGGTAACACAGGTGCTACTGG
TGCTACTGGACCTCAAGG	CGTTCAAGGTAACACAGGTGCTACTGG
TGCCACTGGACCTCAAGG	TGCTCAAGGTAACACAGG
TGCTACTGGACCTCAAGG	TGTTCAAGGCAACACAGGTGCTACCGG
CGCTACTGGACCTCAAGG	CGTTCAAGGTAACACGGGTGCTACTGGCGCTACTGGTATAGG
AGTTACTGGACCTACTGG	ACCTTCTGGTGGACCTACCGG
ACCTACTGGGCCAACTGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015350.1\|WP_065484997.1\|3937489_3938443_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
NZ_CP015350.1\|WP_000957288.1\|3942991_3943744_-\|DeoR/GlpR-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268
NZ_CP015350.1\|WP_000092763.1\|3927556_3928891_-\|type-I-glutamate--ammonia-ligase	unknown	unknown	gnl\|CDD\|273198
NZ_CP015350.1\|WP_000450330.1\|3934246_3935212_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271175
NZ_CP015350.1\|WP_000393491.1\|3946043_3946355_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015350.1\|WP_023522800.1\|3942083_3942995_-\|1-phosphofructokinase	unknown	unknown	gnl\|CDD\|238570
NZ_CP015350.1\|WP_000656783.1\|3928939_3929329_-\|transcriptional-repressor-GlnR	unknown	unknown	gnl\|CDD\|133380
NZ_CP015350.1\|WP_000438177.1\|3933025_3933982_-\|stage-V-sporulation-protein-K	unknown	unknown	gnl\|CDD\|163057
NZ_CP015350.1\|WP_000814431.1\|3938623_3938869_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015350.1\|WP_000312267.1\|3932133_3932757_+\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NZ_CP015350.1\|WP_001102628.1\|3926615_3926939_-\|PadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224609
NZ_CP015350.1\|WP_001179068.1\|3943903_3945067_-\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341466
NZ_CP015350.1\|WP_000413738.1\|3924713_3925334_+\|transcriptional-repressor-LexA	unknown	unknown	gnl\|CDD\|234688
NZ_CP015350.1\|WP_000460282.1\|3929502_3930774_-\|methionine-gamma-lyase-family-protein	unknown	unknown	gnl\|CDD\|311036
NZ_CP015350.1\|WP_000813896.1\|3937243_3937468_-\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|179001
NZ_CP015350.1\|WP_023522791.1\|3926080_3926623_-\|DUF1700-domain-containing-protein	unknown	unknown	gnl\|CDD\|285278
NZ_CP015350.1\|WP_063548405.1\|3940213_3942070_-\|PTS-transporter-subunit-EIIA	unknown	unknown	gnl\|CDD\|236740
NZ_CP015350.1\|WP_043924696.1\|3930766_3932041_-\|GTPase-HflX	unknown	unknown	gnl\|CDD\|274455
NZ_CP015350.1\|WP_023522798.1\|3938931_3939864_-\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|226112
NZ_CP015350.1\|WP_000228315.1\|3945182_3945725_-\|DUF420-domain-containing-protein	unknown	unknown	gnl\|CDD\|225204

Protein	Function_ID	Function_description	E-value
NZ_CP015350.1\|WP_065484997.1\|3937489_3938443_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	1.6988e-163
NZ_CP015350.1\|WP_000957288.1\|3942991_3943744_-\|DeoR/GlpR-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	2.43302e-81
NZ_CP015350.1\|WP_000092763.1\|3927556_3928891_-\|type-I-glutamate--ammonia-ligase	gnl\|CDD\|273198	TIGR00653, Glutamine_synthetase, glutamine synthetase, type I. Alternate name: glutamate--ammonia ligase. This model represents the dodecameric form, which can be subdivided into 1-alpha and 1-beta forms. The phylogeny of the 1-alpha and 1-beta forms appears polyphyletic. E. coli, Synechocystis PCC6803, Aquifex aeolicus, and the crenarcheon Sulfolobus acidocaldarius have form 1-beta, while Bacillus subtilis, Thermotoga maritima, and various euryarchaea has form 1-alpha. The 1-beta dodecamer from the crenarcheon Sulfolobus acidocaldarius differs from that in E. coli in that it is not regulated by adenylylation. [Amino acid biosynthesis, Glutamate family].	0
NZ_CP015350.1\|WP_000450330.1\|3934246_3935212_+\|site-specific-integrase	gnl\|CDD\|271175	cd00397, DNA_BRE_C, DNA breaking-rejoining enzymes, C-terminal catalytic domain. The DNA breaking-rejoining enzyme superfamily includes type IB topoisomerases and tyrosine based site-specific recombinases (integrases) that share the same fold in their catalytic domain containing conserved active site residues. The best-studied members of this diverse superfamily include Human topoisomerase I, the bacteriophage lambda integrase, the bacteriophage P1 Cre recombinase, the yeast Flp recombinase, and the bacterial XerD/C recombinases. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. The enzymes differ in that topoisomerases cleave and then rejoin the same 5' and 3' termini, whereas a site-specific recombinase transfers a 5' hydroxyl generated by recombinase cleavage to a new 3' phosphate partner located in a different duplex region. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	1.54948e-12
NZ_CP015350.1\|WP_023522800.1\|3942083_3942995_-\|1-phosphofructokinase	gnl\|CDD\|238570	cd01164, FruK_PfkB_like, 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases. FruK plays an important role in the predominant pathway for fructose utilisation.This group also contains tagatose-6-phophate kinase, an enzyme of the tagatose 6-phosphate pathway, which responsible for breakdown of the galactose moiety during lactose metabolism by bacteria such as L. lactis.	3.71729e-143
NZ_CP015350.1\|WP_000656783.1\|3928939_3929329_-\|transcriptional-repressor-GlnR	gnl\|CDD\|133380	cd01105, HTH_GlnR-like, Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators. Helix-turn-helix (HTH) transcription regulator GlnR and related proteins, N-terminal domain. The GlnR and TnrA (also known as ScgR) proteins have been shown to regulate expression of glutamine synthetase as well as several genes involved in nitrogen metabolism. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	1.14369e-23
NZ_CP015350.1\|WP_000438177.1\|3933025_3933982_-\|stage-V-sporulation-protein-K	gnl\|CDD\|163057	TIGR02881, Stage_V_sporulation_protein_K, stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group. [Cellular processes, Sporulation and germination].	1.36822e-156
NZ_CP015350.1\|WP_001179068.1\|3943903_3945067_-\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341466	cd08187, BDH, Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. The butanol dehydrogenase (BDH) is involved in the final step of the butanol formation pathway in anaerobic micro-organism. Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. Activity in the reverse direction is 50-fold lower than that in the forward direction. The NADH-BDH has higher activity with longer chained aldehydes and is inhibited by metabolites containing an adenine moiety. This protein family belongs to the so-called iron-containing alcohol dehydrogenase superfamily. Since members of this superfamily use different divalent ions, preferentially iron or zinc, it has been suggested to be renamed to family III metal-dependent polyol dehydrogenases. This family also includes E. coli YqhD enzyme, an NADP-dependent dehydrogenase whose activity measurements with several alcohols demonstrate preference for alcohols longer than C3. The active site of YqhD contains a Zn metal, and a modified NADPH cofactor bearing OH groups on the saturated C5 and C6 atoms, possibly due to oxygen stress on the enzyme, which would functionally work under anaerobic conditions.	0
NZ_CP015350.1\|WP_000312267.1\|3932133_3932757_+\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	1.8015e-60
NZ_CP015350.1\|WP_001102628.1\|3926615_3926939_-\|PadR-family-transcriptional-regulator	gnl\|CDD\|224609	COG1695, COG1695, Predicted transcriptional regulators [Transcription].	1.79312e-24
NZ_CP015350.1\|WP_000413738.1\|3924713_3925334_+\|transcriptional-repressor-LexA	gnl\|CDD\|234688	PRK00215, PRK00215, transcriptional repressor LexA.	9.98492e-112
NZ_CP015350.1\|WP_000460282.1\|3929502_3930774_-\|methionine-gamma-lyase-family-protein	gnl\|CDD\|311036	pfam06838, Met_gamma_lyase, Methionine gamma-lyase. This is a putative pyridoxal 5'-phosphate-dependent methionine gamma-lyase enzyme involved in methionine catabolism.	0
NZ_CP015350.1\|WP_000813896.1\|3937243_3937468_-\|RNA-chaperone-Hfq	gnl\|CDD\|179001	PRK00395, hfq, RNA-binding protein Hfq; Provisional.	3.4363e-41
NZ_CP015350.1\|WP_023522791.1\|3926080_3926623_-\|DUF1700-domain-containing-protein	gnl\|CDD\|285278	pfam08006, DUF1700, Protein of unknown function (DUF1700). This family contains many hypothetical bacterial proteins and putative membrane proteins.	6.5772e-80
NZ_CP015350.1\|WP_063548405.1\|3940213_3942070_-\|PTS-transporter-subunit-EIIA	gnl\|CDD\|236740	PRK10712, PRK10712, PTS system fructose-specific transporter subunits IIBC; Provisional.	4.3039e-143
NZ_CP015350.1\|WP_043924696.1\|3930766_3932041_-\|GTPase-HflX	gnl\|CDD\|274455	TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). [Unknown function, General].	0
NZ_CP015350.1\|WP_023522798.1\|3938931_3939864_-\|SH3-domain-containing-protein	gnl\|CDD\|226112	COG3584, COG3584, Uncharacterized protein conserved in bacteria [Function unknown].	9.44524e-37
NZ_CP015350.1\|WP_000228315.1\|3945182_3945725_-\|DUF420-domain-containing-protein	gnl\|CDD\|225204	COG2322, COG2322, Predicted membrane protein [Function unknown].	9.14687e-57

>NZ_CP015350.1|WP_000450330.1|3934246_3935212_+|site-specific-integrase
METTEFHDTIQAFSIFLLNKGRKPSTIKRYVYDVEDFGHWLEKNKKLPSSNIWATLCTKDYEDYFSDLKTNRHYSEKTMHRVFTVLNRMHHFLNIPNPLKNMEISIQPDRTLRNEDFISPDEEKRLKYIVTSLEGLSEKQLPVRPLLMDRNIAILNLLIDYGLSLQELTALTMHHVHFETNTLSIPATAGVERTITLAKEDKKQLYNYYKSIPEPVRPKYHSDDSLFVAFDFNRGTYRWVYENDAPKALTEIAIQKMIRLEVARANLRKGISGQHFRNTYILNLIKKETPESEIIKLAGFKSKISLKRYYQYAENRKNALL
>NZ_CP015350.1|WP_000438177.1|3933025_3933982_-|stage-V-sporulation-protein-K
MEQSMRKKNNNQINIVLNHRKKISLPAAENKTVISNETTIKHEMLQRIEEEMGKLVGMDDIKKIIKEIYAWIYVNKKRQEKGLKSEKQVLHMLFKGNPGTGKTTVARMIGKLLFEMNILSKGHLVEAERADLVGEYIGHTAQKTRDLIKKAMGGILFIDEAYSLARGGEKDFGKEAIDTLVKHMEDKQHGFVLILAGYSREMNHFLSLNPGLQSRFPFIIEFADYSVNQLLEIGKRMYEDREYQLSKEAEWKFRDHLHAVKYSSQITSFSNGRYVRNIVEKSIRTQAMRLLQEDTYDKNDLIGISSMDLMLEEETHST
>NZ_CP015350.1|WP_000312267.1|3932133_3932757_+|trimeric-intracellular-cation-channel-family-protein
MAWEIFSIIGTIAFALSGAIVAMEEDYDIFGVYILGMATAFGGGALRNLLIGYPIVAFWQQDMLFQIALLSMTIIFLFPNKLIRHWKKWENITDAIGLSAFAVQGALYAQKLNLPISATIVAAVLTGIGGGIIRDLLARRKPLVLRAEVYAFWTILAGFLIGAQIIVSDWALYILFILIVCFRMVSIHYKWHLPHRRIETKERSMHK
>NZ_CP015350.1|WP_043924696.1|3930766_3932041_-|GTPase-HflX
MEEKEKVILVGCQLPQDDDEKFMHSMKELASLAKTARAEVLVSTTQKRPKFHPATYIGKGKLEELTMLTEELEPDVIIFNNELTPSQIRNLSSVLDARVIDRTQLILDIFAQRAKSREGKLQVELAQLQYTMPRLMGQGLSLSRLGGGIGTRGPGETKLETDRRHIRSRIDEIKKQLAVVVEHRKRYRERRKDNKVFQISLIGYTNAGKSTLFNRLTEANTFEENLLFATLDPTTRKMPLPSGYTVLLTDTVGFIQDLPTSLIAAFRSTLEEAGEADVILHVVDSADPNYIGHEKTVKRLLSELEINHIPIITLYNKKDELHQNFIPFPKSDFLMTSAFEESDLLRIKEAIEMKMKKEMDRYRVEIPPSEGKLLTLLKTETLLAKMEFLEDKFVYDCAGYIFTHSSLNVQLKRFLVEEGENKNV
>NZ_CP015350.1|WP_000460282.1|3929502_3930774_-|methionine-gamma-lyase-family-protein
MFDRLKNGEKIAPIVKEVENQITEVHKRADEVIESNQFRVLESFRKHKISDSHFIPTTGYGYDDIGRDTLEKVYADVFGAEAGLVRPQIISGTHAISTALFGILRPGDELLYITGKPYDTLEEIVGVRGKGVGSFKEYNIGYNAVPLTEGGLVDFEAVAAAIHSNTKMIGIQRSKGYATRPSFTISQIKEMIAFVKEIKPDVVVFVDNCYGEFIEEQEPCHVGADLMAGSLIKNPGGGIVKTGGYIVGKEQYVEACAYRLTSPGIGAEAGASLYSLQEMYQGFFLAPHVAGQALKGAIFTAAFLEKLGMNTSPAWNAPRTDLIQSVQFDDKDRMVAFCQAIQYASPINSHFTPYANYMPGYEDDVIMAAGTFIQGASIELSADGPIRPPYVAYVQGGLTYSHVKIAICSAIDELIEKNLLTIS
>NZ_CP015350.1|WP_000656783.1|3928939_3929329_-|transcriptional-repressor-GlnR
MKEDRRSAPLFPIGIVMDLTQLSARQIRYYEEHNLVSPTRTKGNRRLFSFNDVDKLLEIKDLLDQGLNMAGIKQVLLMKENQTEAVKVKEETKEISKTELRKILRDELQHTGRFNRTSLRQGDISRFFH
>NZ_CP015350.1|WP_000092763.1|3927556_3928891_-|type-I-glutamate--ammonia-ligase
MSRYTKEDIFRLAKEENVKYIRLQFTDLLGVIKNVEIPVRQLTKALDNKMMFDGSSIEGFVRIEESDMYLYPDLDTWVIFPWTAEKGKVARLICDIYNADGTPFDGDPRNNLKRVLKEMEALGFSDFNLGPEPEFFLFKVDEKGNPTLELNDNGGYFDLAPMDLGENCRRDIVLELEEMGFEIEASHHEVAPGQHEIDFKYANAIRSCDDIQTFKLVVKTIARKHGLHATFMPKPLYGVNGSGMHCNLSLFKNGENVFFDANGDLQLSDDARHFIAGILKHAPAFTAIANPTVNSYKRLVPGYEAPCYVAWSAQNRSPLVRIPASRGISTRVEVRSVDPAANPYLVMATLLAAGLDGIKNKLTPPAAVDRNIYVMTKEEREEAGIVDLPATLAQALVTLQSNEVVCGALGEHLLEHFIEAKEIEWDIFRTQVHQWERDQYMSLY
>NZ_CP015350.1|WP_001102628.1|3926615_3926939_-|PadR-family-transcriptional-regulator
MNVQFKKGVLELCVLALVKRKDSYGYELVQQISNKFLISEGSVYPLLRRLTKEGYFQTYLKESTEGPPRKYYQLTEQGETQFHLLVTEWRDFAKGVQEIIEGVEWDE
>NZ_CP015350.1|WP_023522791.1|3926080_3926623_-|DUF1700-domain-containing-protein
MSKEGFLKELLSYLRKLPEEERQDILLDYEEHFQFGLEEGKTESEIIQGLGSPKVIAKELLAMYRFDEMKKNPSTSNVTRAVMAAIGLSLFNFIIVLGPLVAIVAFIFSFWIGGIASVVTPFFVIGKVFMGTFIWLDLFVSITFVGVGLLLCIIAFYSTKWFKRLCVRYVIWNFKMIKGE
>NZ_CP015350.1|WP_000413738.1|3924713_3925334_+|transcriptional-repressor-LexA
MEKLTKRQQDILDFIKLKVQEKGYPPSVREIGQAVGLASSSTVHGHLSRLEEKGYIRRDPTKPRAIEILGEDRMDTETQSVIQVPIVGKVTAGLPITAVESVEEHFPLPASIVAGADQVFMLRISGDSMIEAGIFDGDLVVVRQQQSAYNGEIVVALTEDNEATVKRFYKEKDHFRLQPENSSLEPIILKQVSVIGKVIGVYRDLH
>NZ_CP015350.1|WP_000813896.1|3937243_3937468_-|RNA-chaperone-Hfq
MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEGKQQLIYKHAISTFVPQKNVSIELE
>NZ_CP015350.1|WP_065484997.1|3937489_3938443_-|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MGEVQREKVAVIIGPTAVGKTKLSIDLAKALNGEIISGDSMQIYRTMDIGTAKVTQAEMDGIPHYMVDIKNPEDSFSVAEFQERVRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDVIYREQMEKLALERGVEYVHKKLQEIDPESAERIHANNVRRVIRALEIFHTTGEKMSDQIEKQEKELLYDVSLIGLTMDREMLYDRINLRVDLMMEQGLLEEVEGLYNRGIRDCQSIQAIGYKEIYDYFENRAPLEDAVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEKTSEILRYIEGKLQVKSNNSK
>NZ_CP015350.1|WP_000814431.1|3938623_3938869_+|hypothetical-protein
MKQSTINFSSLTKDLILATSTKEQNCSQEELYFALNCLLRAFHSTLHETTSHPENKNTEYIQTQFCSAYKIITGKTIYPFQ
>NZ_CP015350.1|WP_023522798.1|3938931_3939864_-|SH3-domain-containing-protein
MKKLLSIATAAVFGLGIFAGSAKAETIVTTDVLNVRENPNVESKLVGKVLSGNTLDVINTENGWTKIKLNGKEAFVSADFTKSTYYVTAGVLNVRAGANTDSEILGKLNKNDVIETTNQVQNEWLQFDYNGKVGYVHVPFLTGTAPVIEKKEVVAQEEAPVKNNTAVKNKESVKSNDSIKNVESSKPVVKEKPAAKPVAKSTETSAPTGGREITVEATAYTADPSENGSYGGRVLTAMGHDLTANPNMKVIAVDPKVIPLGSKVWVEGYGEAIAGDTGGAIKGNRIDVLVGSDGSANSWGRKSVKVKVIQ
>NZ_CP015350.1|WP_063548405.1|3940213_3942070_-|PTS-transporter-subunit-EIIA
MKITELLKRDTVIMDLTASNKEAVIDELVEKLNGANRLNSKTEFKEAILKRESQSTTGIGEGIAIPHAKTKAVKQPSICFGRSVSGINYESLDGQPAYLFFMIAASEGANNTHLETLSRLSTLLMDEGFRKQLLEAKDESELLQLFDEKENEKEEEIEVAKPEGNEPYVLAVTACPTGIAHTYMAADSLKAKAAELGIAIKVETNGSTGIKNGLTKEDIERATAIIVAADKQVEMNRFAGKHVIQVPVADGIRKTENLLKRAVKQDAPIFKGVKEDGKTESIEREKGLGIYKHLMSGVSNMLPFVVGGGILIALAFSFGGIKAEGPLAELFMSIGGGKTGAFLFLVPILAGFIASSIADRPGFMPGVVGGFLAANANAGFLGGLIAGFLAGYVVLGLKRLFSGLPVQLEGIKPVLLYPVFGLLITGVVMQKVVIPPVVALNEMLTGWLNGLNGTNAILLGLILGGMMAIDMGGPINKAAFTFGIAAIEAQNFGVHSAVMAGGMVPPLAIAFATTFFKSKFTEAERKSGLTNYIMGASFITEGAIPFAAADPVRVIVSCVVGSSIAGALSMLFQITLPAPHGGLFVIALVNKPLLYIFSILIGTIVSAIMLGVWKKKVQ
>NZ_CP015350.1|WP_023522800.1|3942083_3942995_-|1-phosphofructokinase
MIYTVTLNPSIDYVVQVPSFDLGTINRAEKDMKFPGGKGINVSRVLQRLGVKNIALGFTGGFTGQFIKEVLHDEGVTTNFVQVDEDTRINVKIKGKEETELNGQGPIVTKEQFEQLMKKIESMQPGDCVVLAGSVPVSIPSTFYESIAAFGAEKGIRVVVDASGSALQHVIKNKPFLIKPNHHELGELFGVELSTVEDILPYGRKLIEQGVKHVIVSMAGEGALLFTAEGIYEATVPKGVVINSVGAGDSLVAGFVGKYEQTKDIEKAFQYGVATGSATAFSADLCKKEKVEELLSQVIVAKR
>NZ_CP015350.1|WP_000957288.1|3942991_3943744_-|DeoR/GlpR-transcriptional-regulator
MLTPERHQMILQLVKEQKVVKLQQLVERTESSESTIRRDLAQLEKQRLLKRVHGGAAVLTGKGQEPTMVEKSSKNIQIKQQIANYAASVVEQGDCIYLDAGSTTFEMIPFLINKDVTVVTNGLMHIEALVENNIRAYLLGGMMKSRTKALIGAMAQESMQKYRFDKCFLGANGVHEQLGFTTPDPEEALLKQMALTLANEGYFLIDESKFSEVAFAKIANVEDANIITNHLEIDLEKYKKQTNVIEADKQ
>NZ_CP015350.1|WP_001179068.1|3943903_3945067_-|iron-containing-alcohol-dehydrogenase
MQNFVFRNPTKLIFGKDQLEQLKTEIPQFGKKVLLVYGGGSIKRNGIYDNVISILKDINAEVFELTGVEPNPRVSTVKKGIQICKDNGVEFILAVGGGSVIDCTKAIAAGSKYDGDVWDIVTKKAFASEALPFGTVLTLAATGSEMNAGSVITNWETNEKYGWGSPVTFPQFSILDPVHTASVPRDQTIYGMVDIMSHVLEQYFHHGTNTELQDRYCESVLKTVIETAPKLLSDLENYEHRETILYCGTMALNGILAMGVRGDWATHNIEHAVSAVHDIPHGGGLAILFPNWMKHVVDENVSRFKQFAIRVFEIETDGKTDKEVALEGIEALRQFWTSIEAPATLADYGIGENEIDIMANKAMAYGEFGNFKKLNKDDVLSIYKASL
>NZ_CP015350.1|WP_000228315.1|3945182_3945725_-|DUF420-domain-containing-protein
MVDQSTNQKSYAPIVITLSVIVNAIILFLFFGPVGYEGEVHFDVTILPMLNAIFNSFTFVFLLAALFSIIKKNVKMHRGFILAAFTTTLLFCVSYLSYHYLAPATHFGGEGFIKYVYFIILITHIILAAIIVPLALFALVFGFTNQLTRHRKIVRWTMPIWLYVSLSGVIVYLMISPYYQ
>NZ_CP015350.1|WP_000393491.1|3946043_3946355_-|hypothetical-protein
MEEYVLELYNLLYTTEWQDIVSFLGIVFCMKIVIVYMEEQGMFYSFSSPFDVQREPLLNYANVNYEQFPFVVFFMIRFITAIVKKKESDDEECHATCKVANVF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP015350_3	3.4\|3936384\|27\|NZ_CP015350\|CRT	3936384-3936410	27	NZ_CP015350.1	3936087-3936113	0	1.0
NZ_CP015350_3	3.8\|3936564\|18\|NZ_CP015350\|CRT	3936564-3936581	18	NZ_CP015350.1	3936087-3936104	0	1.0
NZ_CP015350_3	3.1\|3936231\|27\|NZ_CP015350\|CRT	3936231-3936257	27	NZ_CP015350.1	3935988-3936014	1	0.963
NZ_CP015350_3	3.6\|3936474\|27\|NZ_CP015350\|CRT	3936474-3936500	27	NZ_CP015350.1	3936087-3936113	1	0.963
NZ_CP015350_3	3.6\|3936474\|27\|NZ_CP015350\|CRT	3936474-3936500	27	NZ_CP015350.1	3936123-3936149	1	0.963
NZ_CP015350_3	3.7\|3936519\|27\|NZ_CP015350\|CRT	3936519-3936545	27	NZ_CP015350.1	3936042-3936068	1	0.963
NZ_CP015350_3	3.8\|3936564\|18\|NZ_CP015350\|CRT	3936564-3936581	18	NZ_CP015350.1	3936123-3936140	1	0.944
NZ_CP015350_3	3.9\|3936600\|27\|NZ_CP015350\|CRT	3936600-3936626	27	NZ_CP015350.1	3936123-3936149	1	0.963
NZ_CP015350_3	3.1\|3936231\|27\|NZ_CP015350\|CRT	3936231-3936257	27	NZ_CP015350.1	3935916-3935942	2	0.926
NZ_CP015350_3	3.4\|3936384\|27\|NZ_CP015350\|CRT	3936384-3936410	27	NZ_CP015350.1	3936123-3936149	2	0.926
NZ_CP015350_3	3.5\|3936429\|27\|NZ_CP015350\|CRT	3936429-3936455	27	NZ_CP015350.1	3936042-3936068	2	0.926

1. spacer 3.4|3936384|27|NZ_CP015350|CRT matches to position: 3936087-3936113, mismatch: 0, identity: 1.0

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgctcaaggtaacacaggtgctactgg	Protospacer
***************************

2. spacer 3.8|3936564|18|NZ_CP015350|CRT matches to position: 3936087-3936104, mismatch: 0, identity: 1.0

tgctcaaggtaacacagg	CRISPR spacer
tgctcaaggtaacacagg	Protospacer
******************

3. spacer 3.1|3936231|27|NZ_CP015350|CRT matches to position: 3935988-3936014, mismatch: 1, identity: 0.963

acctcaaggtaacacaggtgctactgg	CRISPR spacer
acctcaaggtaacacgggtgctactgg	Protospacer
***************.***********

4. spacer 3.6|3936474|27|NZ_CP015350|CRT matches to position: 3936087-3936113, mismatch: 1, identity: 0.963

tgttcaaggtaacacaggtgctactgg	CRISPR spacer
tgctcaaggtaacacaggtgctactgg	Protospacer
**.************************

5. spacer 3.6|3936474|27|NZ_CP015350|CRT matches to position: 3936123-3936149, mismatch: 1, identity: 0.963

tgttcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacaggtgctaccgg	Protospacer
************************.**

6. spacer 3.7|3936519|27|NZ_CP015350|CRT matches to position: 3936042-3936068, mismatch: 1, identity: 0.963

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
cgttcaaggtaacactggtgctactgg	Protospacer
*************** ***********

7. spacer 3.8|3936564|18|NZ_CP015350|CRT matches to position: 3936123-3936140, mismatch: 1, identity: 0.944

tgctcaaggtaacacagg	CRISPR spacer
tgttcaaggtaacacagg	Protospacer
**.***************

8. spacer 3.9|3936600|27|NZ_CP015350|CRT matches to position: 3936123-3936149, mismatch: 1, identity: 0.963

tgttcaaggcaacacaggtgctaccgg	CRISPR spacer
tgttcaaggtaacacaggtgctaccgg	Protospacer
*********.*****************

9. spacer 3.1|3936231|27|NZ_CP015350|CRT matches to position: 3935916-3935942, mismatch: 2, identity: 0.926

acctcaaggtaacacaggtgctactgg	CRISPR spacer
acctcaaggtaacacgggtgctaccgg	Protospacer
***************.********.**

10. spacer 3.4|3936384|27|NZ_CP015350|CRT matches to position: 3936123-3936149, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacaggtgctaccgg	Protospacer
**.*********************.**

11. spacer 3.5|3936429|27|NZ_CP015350|CRT matches to position: 3936042-3936068, mismatch: 2, identity: 0.926

cgttcaaggtaacacaggtgctaccgg	CRISPR spacer
cgttcaaggtaacactggtgctactgg	Protospacer
*************** ********.**

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP015350_3	3.1\|3936231\|27\|NZ_CP015350\|CRT	3936231-3936257	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81955-81981	3	0.889
NZ_CP015350_3	3.1\|3936231\|27\|NZ_CP015350\|CRT	3936231-3936257	27	MN163280	Klebsiella phage KpGranit, complete genome	83373-83399	3	0.889
NZ_CP015350_3	3.1\|3936231\|27\|NZ_CP015350\|CRT	3936231-3936257	27	MN163280	Klebsiella phage KpGranit, complete genome	84576-84602	3	0.889
NZ_CP015350_3	3.1\|3936231\|27\|NZ_CP015350\|CRT	3936231-3936257	27	JQ691611	Cronobacter phage CR9, complete genome	9702-9728	3	0.889
NZ_CP015350_3	3.1\|3936231\|27\|NZ_CP015350\|CRT	3936231-3936257	27	MN101228	Klebsiella phage KPN4, complete genome	27720-27746	3	0.889
NZ_CP015350_3	3.4\|3936384\|27\|NZ_CP015350\|CRT	3936384-3936410	27	JQ691611	Cronobacter phage CR9, complete genome	9702-9728	3	0.889
NZ_CP015350_3	3.4\|3936384\|27\|NZ_CP015350\|CRT	3936384-3936410	27	MN101228	Klebsiella phage KPN4, complete genome	27720-27746	3	0.889
NZ_CP015350_3	3.4\|3936384\|27\|NZ_CP015350\|CRT	3936384-3936410	27	MN163280	Klebsiella phage KpGranit, complete genome	83373-83399	3	0.889
NZ_CP015350_3	3.4\|3936384\|27\|NZ_CP015350\|CRT	3936384-3936410	27	MN163280	Klebsiella phage KpGranit, complete genome	84576-84602	3	0.889
NZ_CP015350_3	3.4\|3936384\|27\|NZ_CP015350\|CRT	3936384-3936410	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81955-81981	4	0.852
NZ_CP015350_3	3.4\|3936384\|27\|NZ_CP015350\|CRT	3936384-3936410	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	85222-85248	4	0.852
NZ_CP015350_3	3.4\|3936384\|27\|NZ_CP015350\|CRT	3936384-3936410	27	MN163280	Klebsiella phage KpGranit, complete genome	81270-81296	4	0.852
NZ_CP015350_3	3.4\|3936384\|27\|NZ_CP015350\|CRT	3936384-3936410	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	76467-76493	4	0.852
NZ_CP015350_3	3.4\|3936384\|27\|NZ_CP015350\|CRT	3936384-3936410	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78603-78629	4	0.852
NZ_CP015350_3	3.4\|3936384\|27\|NZ_CP015350\|CRT	3936384-3936410	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79815-79841	4	0.852
NZ_CP015350_3	3.4\|3936384\|27\|NZ_CP015350\|CRT	3936384-3936410	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	80972-80998	4	0.852
NZ_CP015350_3	3.4\|3936384\|27\|NZ_CP015350\|CRT	3936384-3936410	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83108-83134	4	0.852
NZ_CP015350_3	3.4\|3936384\|27\|NZ_CP015350\|CRT	3936384-3936410	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84320-84346	4	0.852
NZ_CP015350_3	3.5\|3936429\|27\|NZ_CP015350\|CRT	3936429-3936455	27	JQ691611	Cronobacter phage CR9, complete genome	9702-9728	4	0.852
NZ_CP015350_3	3.6\|3936474\|27\|NZ_CP015350\|CRT	3936474-3936500	27	MN163280	Klebsiella phage KpGranit, complete genome	83373-83399	4	0.852
NZ_CP015350_3	3.6\|3936474\|27\|NZ_CP015350\|CRT	3936474-3936500	27	MN163280	Klebsiella phage KpGranit, complete genome	84576-84602	4	0.852
NZ_CP015350_3	3.6\|3936474\|27\|NZ_CP015350\|CRT	3936474-3936500	27	JQ691611	Cronobacter phage CR9, complete genome	9702-9728	4	0.852
NZ_CP015350_3	3.6\|3936474\|27\|NZ_CP015350\|CRT	3936474-3936500	27	MN101228	Klebsiella phage KPN4, complete genome	27720-27746	4	0.852
NZ_CP015350_3	3.7\|3936519\|27\|NZ_CP015350\|CRT	3936519-3936545	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81955-81981	4	0.852
NZ_CP015350_3	3.9\|3936600\|27\|NZ_CP015350\|CRT	3936600-3936626	27	JQ691611	Cronobacter phage CR9, complete genome	9702-9728	4	0.852
NZ_CP015350_1	1.1\|752201\|26\|NZ_CP015350\|CRISPRCasFinder	752201-752226	26	NZ_CP045855	Agrobacterium sp. MA01 plasmid punnamed1, complete sequence	103187-103212	5	0.808
NZ_CP015350_3	3.4\|3936384\|27\|NZ_CP015350\|CRT	3936384-3936410	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3951-3977	5	0.815
NZ_CP015350_3	3.4\|3936384\|27\|NZ_CP015350\|CRT	3936384-3936410	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29528-29554	5	0.815
NZ_CP015350_3	3.6\|3936474\|27\|NZ_CP015350\|CRT	3936474-3936500	27	MN163280	Klebsiella phage KpGranit, complete genome	81270-81296	5	0.815
NZ_CP015350_3	3.6\|3936474\|27\|NZ_CP015350\|CRT	3936474-3936500	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81955-81981	5	0.815
NZ_CP015350_3	3.6\|3936474\|27\|NZ_CP015350\|CRT	3936474-3936500	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	85222-85248	5	0.815
NZ_CP015350_3	3.6\|3936474\|27\|NZ_CP015350\|CRT	3936474-3936500	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	76467-76493	5	0.815
NZ_CP015350_3	3.6\|3936474\|27\|NZ_CP015350\|CRT	3936474-3936500	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78603-78629	5	0.815
NZ_CP015350_3	3.6\|3936474\|27\|NZ_CP015350\|CRT	3936474-3936500	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79815-79841	5	0.815
NZ_CP015350_3	3.6\|3936474\|27\|NZ_CP015350\|CRT	3936474-3936500	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	80972-80998	5	0.815
NZ_CP015350_3	3.6\|3936474\|27\|NZ_CP015350\|CRT	3936474-3936500	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83108-83134	5	0.815
NZ_CP015350_3	3.6\|3936474\|27\|NZ_CP015350\|CRT	3936474-3936500	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84320-84346	5	0.815
NZ_CP015350_3	3.7\|3936519\|27\|NZ_CP015350\|CRT	3936519-3936545	27	MN163280	Klebsiella phage KpGranit, complete genome	83373-83399	5	0.815
NZ_CP015350_3	3.7\|3936519\|27\|NZ_CP015350\|CRT	3936519-3936545	27	MN163280	Klebsiella phage KpGranit, complete genome	84576-84602	5	0.815
NZ_CP015350_3	3.7\|3936519\|27\|NZ_CP015350\|CRT	3936519-3936545	27	JQ691611	Cronobacter phage CR9, complete genome	9702-9728	5	0.815
NZ_CP015350_3	3.7\|3936519\|27\|NZ_CP015350\|CRT	3936519-3936545	27	MN101228	Klebsiella phage KPN4, complete genome	27720-27746	5	0.815
NZ_CP015350_3	3.5\|3936429\|27\|NZ_CP015350\|CRT	3936429-3936455	27	MN163280	Klebsiella phage KpGranit, complete genome	83373-83399	6	0.778
NZ_CP015350_3	3.5\|3936429\|27\|NZ_CP015350\|CRT	3936429-3936455	27	MN163280	Klebsiella phage KpGranit, complete genome	84576-84602	6	0.778
NZ_CP015350_3	3.6\|3936474\|27\|NZ_CP015350\|CRT	3936474-3936500	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29528-29554	6	0.778
NZ_CP015350_3	3.6\|3936474\|27\|NZ_CP015350\|CRT	3936474-3936500	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3951-3977	6	0.778
NZ_CP015350_3	3.7\|3936519\|27\|NZ_CP015350\|CRT	3936519-3936545	27	MN163280	Klebsiella phage KpGranit, complete genome	81270-81296	6	0.778
NZ_CP015350_3	3.7\|3936519\|27\|NZ_CP015350\|CRT	3936519-3936545	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	85222-85248	6	0.778
NZ_CP015350_3	3.7\|3936519\|27\|NZ_CP015350\|CRT	3936519-3936545	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3951-3977	6	0.778
NZ_CP015350_3	3.7\|3936519\|27\|NZ_CP015350\|CRT	3936519-3936545	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29528-29554	6	0.778
NZ_CP015350_3	3.7\|3936519\|27\|NZ_CP015350\|CRT	3936519-3936545	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	76467-76493	6	0.778
NZ_CP015350_3	3.7\|3936519\|27\|NZ_CP015350\|CRT	3936519-3936545	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78603-78629	6	0.778
NZ_CP015350_3	3.7\|3936519\|27\|NZ_CP015350\|CRT	3936519-3936545	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79815-79841	6	0.778
NZ_CP015350_3	3.7\|3936519\|27\|NZ_CP015350\|CRT	3936519-3936545	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	80972-80998	6	0.778
NZ_CP015350_3	3.7\|3936519\|27\|NZ_CP015350\|CRT	3936519-3936545	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83108-83134	6	0.778
NZ_CP015350_3	3.7\|3936519\|27\|NZ_CP015350\|CRT	3936519-3936545	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84320-84346	6	0.778
NZ_CP015350_3	3.2\|3936276\|36\|NZ_CP015350\|CRT	3936276-3936311	36	MN163280	Klebsiella phage KpGranit, complete genome	83364-83399	7	0.806
NZ_CP015350_3	3.2\|3936276\|36\|NZ_CP015350\|CRT	3936276-3936311	36	MN163280	Klebsiella phage KpGranit, complete genome	84567-84602	7	0.806
NZ_CP015350_3	3.3\|3936330\|36\|NZ_CP015350\|CRT	3936330-3936365	36	MN163280	Klebsiella phage KpGranit, complete genome	83364-83399	7	0.806
NZ_CP015350_3	3.3\|3936330\|36\|NZ_CP015350\|CRT	3936330-3936365	36	MN163280	Klebsiella phage KpGranit, complete genome	84567-84602	7	0.806
NZ_CP015350_3	3.2\|3936276\|36\|NZ_CP015350\|CRT	3936276-3936311	36	MN101228	Klebsiella phage KPN4, complete genome	27720-27755	8	0.778
NZ_CP015350_3	3.3\|3936330\|36\|NZ_CP015350\|CRT	3936330-3936365	36	MN101228	Klebsiella phage KPN4, complete genome	27720-27755	8	0.778
NZ_CP015350_3	3.2\|3936276\|36\|NZ_CP015350\|CRT	3936276-3936311	36	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81946-81981	9	0.75
NZ_CP015350_3	3.3\|3936330\|36\|NZ_CP015350\|CRT	3936330-3936365	36	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81946-81981	9	0.75

1. spacer 3.1|3936231|27|NZ_CP015350|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 3, identity: 0.889

acctcaaggtaacacaggtgctactgg	CRISPR spacer
ccctcagggtaacactggtgctactgg	Protospacer
 *****.******** ***********

2. spacer 3.1|3936231|27|NZ_CP015350|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

acctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
 ** **.********************

3. spacer 3.1|3936231|27|NZ_CP015350|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

acctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
 ** **.********************

4. spacer 3.1|3936231|27|NZ_CP015350|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 3, identity: 0.889

acctcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcaaggtaacacaggtcctaccgg	Protospacer
 ****************** ****.**

5. spacer 3.1|3936231|27|NZ_CP015350|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 3, identity: 0.889

acctcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcagggtaacactggtgctactgg	Protospacer
 *****.******** ***********

6. spacer 3.4|3936384|27|NZ_CP015350|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcaaggtaacacaggtcctaccgg	Protospacer
* ***************** ****.**

7. spacer 3.4|3936384|27|NZ_CP015350|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcagggtaacactggtgctactgg	Protospacer
* ****.******** ***********

8. spacer 3.4|3936384|27|NZ_CP015350|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
* * **.********************

9. spacer 3.4|3936384|27|NZ_CP015350|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
* * **.********************

10. spacer 3.4|3936384|27|NZ_CP015350|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
ccctcagggtaacactggtgctactgg	Protospacer
. ****.******** ***********

11. spacer 3.4|3936384|27|NZ_CP015350|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacaaggtaacaaaggtgatactgg	Protospacer
* * ********** ***** ******

12. spacer 3.4|3936384|27|NZ_CP015350|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacaccggtgctactgg	Protospacer
* * **.******** ***********

13. spacer 3.4|3936384|27|NZ_CP015350|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

14. spacer 3.4|3936384|27|NZ_CP015350|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

15. spacer 3.4|3936384|27|NZ_CP015350|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

16. spacer 3.4|3936384|27|NZ_CP015350|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

17. spacer 3.4|3936384|27|NZ_CP015350|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

18. spacer 3.4|3936384|27|NZ_CP015350|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

19. spacer 3.5|3936429|27|NZ_CP015350|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 4, identity: 0.852

cgttcaaggtaacacaggtgctaccgg	CRISPR spacer
tcctcaaggtaacacaggtcctaccgg	Protospacer
. .**************** *******

20. spacer 3.6|3936474|27|NZ_CP015350|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

tgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
* . **.********************

21. spacer 3.6|3936474|27|NZ_CP015350|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

tgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
* . **.********************

22. spacer 3.6|3936474|27|NZ_CP015350|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 4, identity: 0.852

tgttcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcaaggtaacacaggtcctaccgg	Protospacer
* .**************** ****.**

23. spacer 3.6|3936474|27|NZ_CP015350|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 4, identity: 0.852

tgttcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcagggtaacactggtgctactgg	Protospacer
* .***.******** ***********

24. spacer 3.7|3936519|27|NZ_CP015350|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
ccctcagggtaacactggtgctactgg	Protospacer
* .***.******** ***********

25. spacer 3.9|3936600|27|NZ_CP015350|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 4, identity: 0.852

tgttcaaggcaacacaggtgctaccgg	CRISPR spacer
tcctcaaggtaacacaggtcctaccgg	Protospacer
* .******.********* *******

26. spacer 1.1|752201|26|NZ_CP015350|CRISPRCasFinder matches to NZ_CP045855 (Agrobacterium sp. MA01 plasmid punnamed1, complete sequence) position: , mismatch: 5, identity: 0.808

tggtgggcacaatcataacggcggac	CRISPR spacer
atctgggcacaatcatagcggcggaa	Protospacer
   **************.*******

27. spacer 3.4|3936384|27|NZ_CP015350|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
  * ********.***** ********

28. spacer 3.4|3936384|27|NZ_CP015350|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 5, identity: 0.815

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
  * ********.***** ********

29. spacer 3.6|3936474|27|NZ_CP015350|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 5, identity: 0.815

tgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacaccggtgctactgg	Protospacer
* . **.******** ***********

30. spacer 3.6|3936474|27|NZ_CP015350|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 5, identity: 0.815

tgttcaaggtaacacaggtgctactgg	CRISPR spacer
ccctcagggtaacactggtgctactgg	Protospacer
. .***.******** ***********

31. spacer 3.6|3936474|27|NZ_CP015350|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 5, identity: 0.815

tgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacaaggtaacaaaggtgatactgg	Protospacer
* . ********** ***** ******

32. spacer 3.6|3936474|27|NZ_CP015350|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 5, identity: 0.815

tgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* . **.******** ***********

33. spacer 3.6|3936474|27|NZ_CP015350|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 5, identity: 0.815

tgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* . **.******** ***********

34. spacer 3.6|3936474|27|NZ_CP015350|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 5, identity: 0.815

tgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
* . **.******** ***********

35. spacer 3.6|3936474|27|NZ_CP015350|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 5, identity: 0.815

tgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* . **.******** ***********

36. spacer 3.6|3936474|27|NZ_CP015350|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 5, identity: 0.815

tgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* . **.******** ***********

37. spacer 3.6|3936474|27|NZ_CP015350|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 5, identity: 0.815

tgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
* . **.******** ***********

38. spacer 3.7|3936519|27|NZ_CP015350|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 5, identity: 0.815

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
. . **.********************

39. spacer 3.7|3936519|27|NZ_CP015350|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 5, identity: 0.815

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
. . **.********************

40. spacer 3.7|3936519|27|NZ_CP015350|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 5, identity: 0.815

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcaaggtaacacaggtcctaccgg	Protospacer
. .**************** ****.**

41. spacer 3.7|3936519|27|NZ_CP015350|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 5, identity: 0.815

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcagggtaacactggtgctactgg	Protospacer
. .***.******** ***********

42. spacer 3.5|3936429|27|NZ_CP015350|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctaccgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
. . **.*****************.**

43. spacer 3.5|3936429|27|NZ_CP015350|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctaccgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
. . **.*****************.**

44. spacer 3.6|3936474|27|NZ_CP015350|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 6, identity: 0.778

tgttcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
  . ********.***** ********

45. spacer 3.6|3936474|27|NZ_CP015350|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

tgttcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
  . ********.***** ********

46. spacer 3.7|3936519|27|NZ_CP015350|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacaccggtgctactgg	Protospacer
. . **.******** ***********

47. spacer 3.7|3936519|27|NZ_CP015350|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacaaggtaacaaaggtgatactgg	Protospacer
. . ********** ***** ******

48. spacer 3.7|3936519|27|NZ_CP015350|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
  . ********.***** ********

49. spacer 3.7|3936519|27|NZ_CP015350|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
  . ********.***** ********

50. spacer 3.7|3936519|27|NZ_CP015350|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
. . **.******** ***********

51. spacer 3.7|3936519|27|NZ_CP015350|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
. . **.******** ***********

52. spacer 3.7|3936519|27|NZ_CP015350|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
. . **.******** ***********

53. spacer 3.7|3936519|27|NZ_CP015350|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
. . **.******** ***********

54. spacer 3.7|3936519|27|NZ_CP015350|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
. . **.******** ***********

55. spacer 3.7|3936519|27|NZ_CP015350|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
. . **.******** ***********

56. spacer 3.2|3936276|36|NZ_CP015350|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 7, identity: 0.806

tgctcaaggtaacacaggtgctactggtgctaccgg	CRISPR spacer
tccacagggtaacacaggtgctactggtcctcaggg	Protospacer
* * **.********************* **   **

57. spacer 3.2|3936276|36|NZ_CP015350|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 7, identity: 0.806

tgctcaaggtaacacaggtgctactggtgctaccgg	CRISPR spacer
tccacagggtaacacaggtgctactggtcctcaggg	Protospacer
* * **.********************* **   **

58. spacer 3.3|3936330|36|NZ_CP015350|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 7, identity: 0.806

tgctcaaggtaacacaggtgctactggtgctaccgg	CRISPR spacer
tccacagggtaacacaggtgctactggtcctcaggg	Protospacer
* * **.********************* **   **

59. spacer 3.3|3936330|36|NZ_CP015350|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 7, identity: 0.806

tgctcaaggtaacacaggtgctactggtgctaccgg	CRISPR spacer
tccacagggtaacacaggtgctactggtcctcaggg	Protospacer
* * **.********************* **   **

60. spacer 3.2|3936276|36|NZ_CP015350|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 8, identity: 0.778

tgctcaaggtaacacaggtgctactggtgctaccgg	CRISPR spacer
tcctcagggtaacactggtgctactggttcccaagg	Protospacer
* ****.******** ************ *.   **

61. spacer 3.3|3936330|36|NZ_CP015350|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 8, identity: 0.778

tgctcaaggtaacacaggtgctactggtgctaccgg	CRISPR spacer
tcctcagggtaacactggtgctactggttcccaagg	Protospacer
* ****.******** ************ *.   **

62. spacer 3.2|3936276|36|NZ_CP015350|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 9, identity: 0.75

tgctcaaggtaacacaggtgctactggtgctaccgg	CRISPR spacer
ccctcagggtaacactggtgctactggtccacaagg	Protospacer
. ****.******** ************ *    **

63. spacer 3.3|3936330|36|NZ_CP015350|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 9, identity: 0.75

tgctcaaggtaacacaggtgctactggtgctaccgg	CRISPR spacer
ccctcagggtaacactggtgctactggtccacaagg	Protospacer
. ****.******** ************ *    **

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

262525 : 270476

uncultured_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000917311.1\|262525_262810_+	co-chaperone GroES	A0A221S3C8	uncultured_virus	1.2e-20	54.8
WP_001029992.1\|262848_264483_+	chaperonin GroEL	A0A219YK78	uncultured_virus	1.3e-156	57.8
WP_141534831.1\|264889_266428_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	2.6e-21	31.2
WP_000833096.1\|266814_268140_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	4.1e-44	29.4
WP_000929891.1\|268285_268987_+	response regulator transcription factor	W8CYM9	Bacillus_phage	7.3e-40	36.9
WP_000719239.1\|268970_270476_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	5.4e-32	30.8

DBSCAN-SWA_2

293831 : 302207

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000625682.1\|293831_295139_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.9e-21	25.3
WP_001170549.1\|295227_295947_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	8.0e-50	44.8
WP_000278823.1\|295939_296194_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_065481564.1\|296190_296874_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_065481567.1\|296857_299077_+	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	1.5e-163	41.2
WP_000879026.1\|299061_300477_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	3.3e-55	35.4
WP_001262441.1\|300582_301623_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.1e-67	45.9
WP_000088590.1\|301619_302207_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	9.1e-28	37.4

DBSCAN-SWA_3

326491 : 428673

114

Bacillus_phage(62.5%)

transposase,tail,capsid,terminase,protease,portal,tRNA,integrase,head,plate

attL 389402:389430|attR 431094:431122

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000086999.1\|326491_326782_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_000051441.1\|326797_328255_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_001047685.1\|328269_329697_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_000977679.1\|330256_331162_+	diacylglycerol kinase	A0A1V0SBJ0	Catovirus	4.1e-27	30.8
WP_065481591.1\|331302_332049_+	HAD family hydrolase	NA	NA	NA	NA
WP_140157274.1\|332128_333568_+	4-aminobutyrate--2-oxoglutarate transaminase	NA	NA	NA	NA
WP_000225140.1\|333683_335051_+	PAS domain-containing protein	NA	NA	NA	NA
WP_065481594.1\|335043_336495_+	NADP-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_000263262.1\|336542_336866_+	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_000915109.1\|336998_337490_+	DUF4352 domain-containing protein	NA	NA	NA	NA
WP_000007372.1\|337535_338765_-	aminopeptidase	NA	NA	NA	NA
WP_001233710.1\|338881_339964_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_157686132.1\|340501_340666_+	hypothetical protein	NA	NA	NA	NA
WP_065481597.1\|340652_341720_-\|integrase	site-specific integrase	H0UST3	Bacillus_phage	1.1e-156	76.6
WP_065481602.1\|342555_343686_+	hypothetical protein	NA	NA	NA	NA
WP_065481605.1\|343956_344139_+	hypothetical protein	NA	NA	NA	NA
WP_065481608.1\|344167_344509_-	helix-turn-helix transcriptional regulator	A0A290GJU0	Caldibacillus_phage	1.7e-10	35.3
WP_065481611.1\|344688_344898_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_065481613.1\|344964_345153_+	helix-turn-helix transcriptional regulator	W8CYN7	Bacillus_phage	6.3e-23	88.7
WP_065481615.1\|345386_345620_+	hypothetical protein	A0A0S2GLB6	Bacillus_phage	1.6e-20	70.4
WP_094194459.1\|345605_346395_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_065481624.1\|346814_347750_+	hypothetical protein	S6C475	Thermus_phage	1.4e-102	60.1
WP_065481628.1\|347764_347980_+	hypothetical protein	NA	NA	NA	NA
WP_065481631.1\|347979_348777_+	recombination protein RecT	S6AVW6	Thermus_phage	3.0e-90	64.3
WP_065481634.1\|348814_349687_+	hypothetical protein	V9QKF6	Oenococcus_phage	7.7e-39	41.2
WP_065481638.1\|349686_350988_+	AAA family ATPase	A0A1B1P7G6	Bacillus_phage	5.2e-92	42.6
WP_157686133.1\|351052_351256_+	hypothetical protein	NA	NA	NA	NA
WP_065481645.1\|351262_351688_+	DUF1064 domain-containing protein	A0A2P1JTY5	Anoxybacillus_phage	2.1e-29	51.9
WP_065481648.1\|351703_352411_+	2-methylcitrate dehydratase	NA	NA	NA	NA
WP_094194460.1\|352376_353117_+	zinc-finger domain-containing protein	A0A2H4JAV2	uncultured_Caudovirales_phage	4.4e-11	38.0
WP_065486036.1\|353126_353549_+	hypothetical protein	NA	NA	NA	NA
WP_094194461.1\|354026_354816_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_065481653.1\|355197_355704_-	hypothetical protein	NA	NA	NA	NA
WP_065481655.1\|355812_356610_+	DNA-binding protein	A0A1Q1PVZ8	Staphylococcus_phage	2.0e-73	52.5
WP_065481659.1\|357003_357378_+	ArpU family transcriptional regulator	D2XQ27	Bacillus_virus	3.2e-10	34.4
WP_065481663.1\|357719_358481_-	hypothetical protein	NA	NA	NA	NA
WP_094194462.1\|359546_360715_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.2e-58	44.0
WP_065481672.1\|360904_361141_+	hypothetical protein	NA	NA	NA	NA
WP_094194463.1\|361226_361556_+	HNH endonuclease	A0A1S7FZ53	Listeria_phage	4.5e-16	44.8
WP_065481679.1\|361558_361867_+	hypothetical protein	NA	NA	NA	NA
WP_065486039.1\|362177_362681_+	RNA polymerase subunit sigma-70	A0A1B1P762	Bacillus_phage	3.7e-09	37.1
WP_094194464.1\|362664_364335_+\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	3.0e-185	57.9
WP_065481685.1\|364353_365592_+\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	1.0e-73	38.3
WP_065481687.1\|365533_366232_+\|protease	Clp protease ClpP	D2XR17	Bacillus_phage	4.3e-40	46.8
WP_065481689.1\|366245_367367_+\|capsid	phage major capsid protein	R4IBU5	Listeria_phage	5.2e-96	49.7
WP_065481691.1\|367380_367692_+	hypothetical protein	A0A1B1P751	Bacillus_phage	3.4e-13	41.7
WP_065481694.1\|367691_368057_+\|head,tail	phage head-tail adapter protein	NA	NA	NA	NA
WP_065481696.1\|368034_368415_+	hypothetical protein	NA	NA	NA	NA
WP_065481699.1\|368404_368815_+	hypothetical protein	NA	NA	NA	NA
WP_065481701.1\|368815_369385_+\|tail	phage tail protein	Q858W9	Listeria_phage	2.0e-35	42.2
WP_065481703.1\|369444_369801_+	hypothetical protein	A0A1S7FZ84	Listeria_phage	6.4e-08	33.7
WP_065481706.1\|369983_373403_+	hypothetical protein	A0A0S2SXL7	Bacillus_phage	6.9e-83	37.3
WP_065481709.1\|373404_374088_+\|tail	phage tail protein	A0A1C8EA72	Bacillus_phage	1.7e-86	67.3
WP_065481711.1\|374084_376424_+	endopeptidase	A0A1C8E983	Bacillus_phage	0.0e+00	89.3
WP_065481712.1\|376438_377527_+\|plate	BppU family phage baseplate upper protein	A0A1B1P768	Bacillus_phage	4.2e-135	65.6
WP_065481713.1\|377647_377929_+	hypothetical protein	D2XR31	Bacillus_phage	1.7e-32	76.9
WP_065481715.1\|377931_378135_+	hypothetical protein	D2XR32	Bacillus_phage	7.8e-19	60.6
WP_065481717.1\|378195_379230_+	N-acetylmuramoyl-L-alanine amidase	A0A0A7AQV3	Bacillus_phage	7.5e-150	74.9
WP_065481720.1\|379415_379631_-	hypothetical protein	NA	NA	NA	NA
WP_094194466.1\|379673_380463_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_065481729.1\|380492_380738_-\|transposase	DDE transposase family protein	NA	NA	NA	NA
WP_065481731.1\|380855_381884_-	collagen-like repeat preface domain-containing protein	NA	NA	NA	NA
WP_065481734.1\|382501_383614_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_065481737.1\|384617_385445_-	cytosolic protein	A0A2H4J9W9	uncultured_Caudovirales_phage	1.1e-100	79.8
WP_065486040.1\|385803_386400_+	hypothetical protein	NA	NA	NA	NA
WP_001200491.1\|386446_387643_-	NupC family nucleoside transporter	NA	NA	NA	NA
WP_065481740.1\|388068_389448_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	8.5e-117	46.7
389402:389430	attL	NA	NA	NA	NA
WP_065481742.1\|389506_390631_-\|integrase	site-specific integrase	A0A1B0T6A8	Bacillus_phage	1.1e-210	97.6
WP_094194467.1\|391156_391946_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_065481749.1\|393759_394899_+	hypothetical protein	H0UST6	Bacillus_phage	2.5e-61	36.3
WP_065481751.1\|395186_395372_+	hypothetical protein	NA	NA	NA	NA
WP_065481753.1\|395382_395730_-	helix-turn-helix transcriptional regulator	S5MUA5	Brevibacillus_phage	3.9e-10	38.3
WP_065481756.1\|396887_397238_+	helix-turn-helix domain-containing protein	A0A1B0T6C2	Bacillus_phage	2.5e-49	77.6
WP_065486042.1\|397237_397429_+	hypothetical protein	A0A0U3B230	Bacillus_phage	4.1e-14	68.5
WP_065481512.1\|398550_399807_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	5.8e-112	60.2
WP_139359406.1\|399933_400026_+	hypothetical protein	NA	NA	NA	NA
WP_094194468.1\|400213_401089_+	ATP-binding protein	A0A0U4K4W7	Exiguobacterium_phage	6.2e-12	30.0
WP_065481758.1\|401122_401317_+	hypothetical protein	A0A0U3K3J8	Bacillus_phage	1.8e-20	78.1
WP_065481760.1\|401333_401612_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	7.4e-12	57.6
WP_065481763.1\|401604_401964_+	cell division protein SepF	A0A1B1P7A1	Bacillus_phage	5.4e-31	53.3
WP_065481766.1\|401984_402152_+	DUF3954 domain-containing protein	A0A1B0T6B8	Bacillus_phage	1.5e-12	60.4
WP_065481767.1\|402177_402429_+	hypothetical protein	A0A0K2CNP4	Brevibacillus_phage	6.5e-07	42.2
WP_065481768.1\|402783_403182_+	hypothetical protein	A0A1B0T6B6	Bacillus_phage	1.7e-62	90.9
WP_065481769.1\|405234_405450_-	spore germination protein	A0A2H4J3A3	uncultured_Caudovirales_phage	5.5e-23	79.1
WP_157686134.1\|405620_405734_+	DUF3983 domain-containing protein	A0A1B1P7V8	Bacillus_phage	2.6e-08	78.4
WP_065481770.1\|406053_406542_+	ArpU family transcriptional regulator	A0A1B0T6C9	Bacillus_phage	3.7e-75	84.5
WP_094194470.1\|406538_406838_+\|integrase	tyrosine-type recombinase/integrase	A0A1B0T6D2	Bacillus_phage	7.7e-31	91.9
WP_065481734.1\|407110_408223_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_094194471.1\|408328_408655_+\|integrase	tyrosine-type recombinase/integrase	H0USV4	Bacillus_phage	7.3e-51	95.3
WP_094194472.1\|408862_409108_+	hypothetical protein	A0A1B0T6C4	Bacillus_phage	9.0e-30	75.3
WP_065481772.1\|409461_409677_+	hypothetical protein	NA	NA	NA	NA
WP_065481775.1\|409776_409995_+	hypothetical protein	NA	NA	NA	NA
WP_065481778.1\|410054_410378_+	hypothetical protein	A0A1B1P7N8	Bacillus_phage	9.5e-19	56.8
WP_065481781.1\|410374_410749_+	HNH endonuclease	A0A1C8E9C7	Bacillus_phage	5.0e-64	87.8
WP_065481783.1\|410852_411278_+\|terminase	P27 family phage terminase small subunit	A0A1B0T688	Bacillus_phage	4.4e-64	87.9
WP_065481785.1\|411274_412999_+\|terminase	terminase large subunit	A0A1B0T685	Bacillus_phage	3.6e-306	90.1
WP_065481788.1\|413014_414199_+\|portal	phage portal protein	A0A2H4JBS9	uncultured_Caudovirales_phage	7.6e-215	95.2
WP_065481793.1\|414188_414770_+\|head,protease	HK97 family phage prohead protease	A0A1B1P7P1	Bacillus_phage	1.3e-87	87.4
WP_065481795.1\|414771_416091_+\|capsid	phage major capsid protein	A0A1C8E976	Bacillus_phage	3.2e-182	95.9
WP_065481798.1\|416159_416450_+	hypothetical protein	NA	NA	NA	NA
WP_065481800.1\|416464_416722_+\|head,tail	phage gp6-like head-tail connector protein	A0A2H4J865	uncultured_Caudovirales_phage	1.2e-32	80.0
WP_065481802.1\|416702_417035_+	hypothetical protein	A0A1C8E986	Bacillus_phage	1.2e-48	88.0
WP_065481804.1\|417024_417354_+	hypothetical protein	A0A1C8E981	Bacillus_phage	4.2e-46	81.7
WP_065481807.1\|417353_417731_+	hypothetical protein	A0A2H4JDG0	uncultured_Caudovirales_phage	6.9e-53	82.4
WP_065481810.1\|417743_418370_+\|tail	phage tail protein	A0A1B1P7Q4	Bacillus_phage	1.3e-101	86.5
WP_065481813.1\|418387_418774_+	hypothetical protein	A0A2H4J956	uncultured_Caudovirales_phage	5.8e-55	84.4
WP_065481814.1\|419017_422311_+\|tail	phage tail tape measure protein	A0A1B0T698	Bacillus_phage	1.1e-295	81.1
WP_065481816.1\|422311_422995_+\|tail	phage tail protein	A0A1B0T6A0	Bacillus_phage	7.4e-114	87.2
WP_065481819.1\|422991_425355_+	endopeptidase	A0A1B0T695	Bacillus_phage	0.0e+00	92.0
WP_065481821.1\|426649_426871_+	hypothetical protein	A0A1B1P780	Bacillus_phage	1.8e-24	85.9
WP_065486045.1\|426931_427132_+	hypothetical protein	A0A1B2APY8	Phage_Wrath	1.8e-12	56.1
WP_065481824.1\|427134_427344_+	hypothetical protein	A0A0S2GM50	Bacillus_phage	2.7e-19	63.6
WP_065481826.1\|427418_428441_+	N-acetylmuramoyl-L-alanine amidase	A0A0A7AQV3	Bacillus_phage	7.2e-145	71.7
WP_065481828.1\|428478_428673_-	hypothetical protein	A0A1B0T6A3	Bacillus_phage	7.4e-19	82.5
431094:431122	attR	NA	NA	NA	NA

DBSCAN-SWA_4

611375 : 679455

Bacillus_phage(71.79%)

transposase,tail,capsid,terminase,protease,portal,tRNA,integrase,head,plate

attL 609239:609259|attR 687738:687758

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
609239:609259	attL	NA	NA	NA	NA
WP_065481944.1\|611375_612518_+\|tRNA	tRNA epoxyqueuosine(34) reductase QueG	NA	NA	NA	NA
WP_000279323.1\|612562_613450_+	amidase domain-containing protein	NA	NA	NA	NA
WP_000538147.1\|613508_613997_+\|tRNA	tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL	NA	NA	NA	NA
WP_065481947.1\|614124_616194_+	phosphodiesterase	NA	NA	NA	NA
WP_000353273.1\|616586_618482_+	PrkA family serine protein kinase	A0MN77	Thermus_phage	1.2e-100	35.8
WP_000503516.1\|618934_620110_+	sporulation protein YhbH	A0A140HLI1	Bacillus_phage	1.5e-24	43.9
WP_065481734.1\|621132_622245_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_000289526.1\|626053_626917_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_065481956.1\|627018_628569_-	glycine betaine transporter OpuD	A0A2I7QNT1	Vibrio_phage	8.9e-22	25.6
WP_065481958.1\|628815_631701_+	PKD domain-containing protein	NA	NA	NA	NA
WP_065481960.1\|631708_632872_-\|integrase	site-specific integrase	A0A0M5M609	Bacillus_phage	3.3e-162	70.9
WP_065481962.1\|632939_633365_-	ImmA/IrrE family metallo-endopeptidase	A0A1C8E988	Bacillus_phage	8.8e-73	93.6
WP_061656788.1\|633380_633803_-	helix-turn-helix transcriptional regulator	A0A1C8E9A4	Bacillus_phage	3.3e-64	89.3
WP_065481965.1\|634127_634262_+	helix-turn-helix transcriptional regulator	A0A0M3ULF9	Bacillus_phage	8.2e-09	79.5
WP_065481968.1\|634261_634534_+	DUF771 domain-containing protein	A0A1C8E9B3	Bacillus_phage	2.0e-41	87.8
WP_065481971.1\|634593_634785_+	hypothetical protein	A0A1B1P7M3	Bacillus_phage	1.7e-07	68.0
WP_065481973.1\|634759_635110_+	hypothetical protein	A0A2H4JBP9	uncultured_Caudovirales_phage	1.7e-50	86.2
WP_157686137.1\|635272_635584_+	hypothetical protein	NA	NA	NA	NA
WP_065481985.1\|635580_635814_+	hypothetical protein	NA	NA	NA	NA
WP_065481986.1\|635776_636460_+	AAA family ATPase	A0A1B2AQ06	Phage_Wrath	2.1e-108	87.6
WP_065481988.1\|636452_636977_+	hypothetical protein	A0A0C5K996	Enterococcus_phage	1.6e-36	45.3
WP_065481997.1\|637169_638288_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_065482000.1\|638653_639052_+	DUF669 domain-containing protein	A0A1B2AQ07	Phage_Wrath	1.1e-19	46.3
WP_065482002.1\|641749_641977_+	hypothetical protein	NA	NA	NA	NA
WP_065482004.1\|641964_642399_+	hypothetical protein	A0A2H4JFQ6	uncultured_Caudovirales_phage	1.0e-52	63.8
WP_065482005.1\|643324_643708_+	hypothetical protein	A0A288WFT8	Bacillus_phage	8.0e-49	75.8
WP_065482006.1\|643838_644720_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	E9P639	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	7.3e-21	27.2
WP_065482007.1\|644792_645095_+	hypothetical protein	A0A1B0T6C6	Bacillus_phage	3.0e-43	85.6
WP_065482010.1\|645091_645484_+	HNH endonuclease	A0A1B0T6C5	Bacillus_phage	1.5e-71	94.6
WP_065482012.1\|645566_645992_+\|terminase	P27 family phage terminase small subunit	A0A1C8E969	Bacillus_phage	3.7e-71	97.2
WP_065482016.1\|645988_647713_+\|terminase	terminase large subunit	A0A1C8E985	Bacillus_phage	0.0e+00	99.3
WP_065482019.1\|647728_648901_+\|portal	phage portal protein	A0A1C8E972	Bacillus_phage	4.6e-220	99.0
WP_065482021.1\|649069_649327_-	hypothetical protein	A0A1C8E966	Bacillus_phage	2.8e-29	74.1
WP_065482024.1\|649399_649981_+\|head,protease	HK97 family phage prohead protease	A0A1C8EA63	Bacillus_phage	4.6e-96	95.3
WP_065482026.1\|649982_651293_+\|capsid	phage major capsid protein	A0A1C8E976	Bacillus_phage	6.7e-196	90.9
WP_065482029.1\|651361_651670_+	collagen-like protein	NA	NA	NA	NA
WP_065482031.1\|651684_651945_+\|head,tail	phage gp6-like head-tail connector protein	A0A1B2APX3	Phage_Wrath	3.6e-37	86.0
WP_065482034.1\|651922_652255_+\|head,tail	head-tail adaptor protein	A0A2H4J9Y9	uncultured_Caudovirales_phage	4.5e-48	87.2
WP_016125429.1\|652244_652574_+	hypothetical protein	A0A1C8E981	Bacillus_phage	9.3e-54	91.7
WP_065482037.1\|652573_652951_+	HK97 gp10 family phage protein	A0A1C8E995	Bacillus_phage	5.6e-63	97.6
WP_065482040.1\|652962_653619_+\|tail	phage tail protein	A0A1B1P7Q4	Bacillus_phage	4.6e-105	88.2
WP_065482043.1\|653630_654017_+	hypothetical protein	A0A1C8E984	Bacillus_phage	1.4e-64	96.9
WP_006927278.1\|654055_654244_+	hypothetical protein	A0A1C8E979	Bacillus_phage	8.2e-31	98.4
WP_065482046.1\|654260_657554_+\|tail	phage tail tape measure protein	A0A1B1P7P9	Bacillus_phage	0.0e+00	85.6
WP_065482050.1\|657554_658238_+\|tail	phage tail protein	A0A1B0T6A0	Bacillus_phage	2.2e-126	96.9
WP_065482053.1\|658234_660577_+	endopeptidase	A0A1B0T695	Bacillus_phage	0.0e+00	95.6
WP_065482056.1\|660591_661737_+\|plate	BppU family phage baseplate upper protein	A0A1B1P768	Bacillus_phage	7.1e-101	53.7
WP_065482059.1\|661800_662001_+	hypothetical protein	NA	NA	NA	NA
WP_065482062.1\|662004_662208_+	hypothetical protein	A0A1B1P886	Bacillus_phage	8.6e-18	63.3
WP_065482065.1\|663524_665075_-	hypothetical protein	NA	NA	NA	NA
WP_065482087.1\|665087_667499_-	hypothetical protein	NA	NA	NA	NA
WP_065482090.1\|667981_668290_-	hypothetical protein	A0A0S2GLF3	Bacillus_phage	7.9e-31	68.7
WP_065482093.1\|668411_669464_-	cytosolic protein	A0A0S2MVF4	Bacillus_phage	3.9e-13	46.7
WP_063546389.1\|670173_670722_+	hypothetical protein	NA	NA	NA	NA
WP_000154998.1\|670734_672303_+	flotillin family protein	NA	NA	NA	NA
WP_000486195.1\|672551_674528_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	8.4e-17	51.4
WP_003269387.1\|674672_676280_+	sensor histidine kinase	NA	NA	NA	NA
WP_000503464.1\|676282_676975_+	response regulator	NA	NA	NA	NA
WP_000880477.1\|677021_678326_-	CitMHS family transporter	NA	NA	NA	NA
WP_094194452.1\|678665_679455_-\|transposase	IS5 family transposase	NA	NA	NA	NA
687738:687758	attR	NA	NA	NA	NA

DBSCAN-SWA_5

929352 : 983466

Bacillus_phage(30.0%)

transposase,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000265278.1\|929352_929922_-\|coat	spore coat protein CotJC	NA	NA	NA	NA
WP_001076510.1\|929934_930198_-\|coat	spore coat protein CotJB	NA	NA	NA	NA
WP_001046257.1\|930206_930422_-\|coat	spore coat associated protein CotJA	NA	NA	NA	NA
WP_120460775.1\|930470_930884_+	lactoylglutathione lyase	NA	NA	NA	NA
WP_023521229.1\|930898_931678_+	DUF2935 domain-containing protein	A0A2I2L551	Orpheovirus	5.3e-39	35.2
WP_023521230.1\|931696_932509_-	Ku protein	A0A249XRB2	Mycobacterium_phage	1.4e-29	31.9
WP_000733842.1\|932861_933143_+	DUF1232 domain-containing protein	NA	NA	NA	NA
WP_023521232.1\|933154_933760_+	DedA family protein	NA	NA	NA	NA
WP_001277540.1\|933858_934227_+	DUF3992 domain-containing protein	NA	NA	NA	NA
WP_000525819.1\|934247_934592_+	DUF3992 domain-containing protein	NA	NA	NA	NA
WP_080672344.1\|934648_935074_-	DUF3992 domain-containing protein	NA	NA	NA	NA
WP_023521234.1\|935426_937886_+	Purple acid phosphatase/fibronectin domain protein	NA	NA	NA	NA
WP_000435797.1\|937965_938169_+	hypothetical protein	NA	NA	NA	NA
WP_000838715.1\|938380_939784_-	amino acid permease	NA	NA	NA	NA
WP_120460771.1\|939954_941166_+	cation:proton antiporter	NA	NA	NA	NA
WP_065482290.1\|941290_941605_+	outer surface protein	NA	NA	NA	NA
WP_000648159.1\|941634_942498_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_065481734.1\|942754_943867_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_000892345.1\|944227_945112_+	N-acetylmuramic acid 6-phosphate etherase	NA	NA	NA	NA
WP_065482293.1\|945136_946501_+	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_023521237.1\|946549_947623_+	DUF871 domain-containing protein	NA	NA	NA	NA
WP_001077751.1\|947775_948180_+	DoxX family protein	NA	NA	NA	NA
WP_065482296.1\|948334_948736_+	DUF4440 domain-containing protein	NA	NA	NA	NA
WP_023521239.1\|948735_949221_+	PRK06770 family protein	G3MB13	Bacillus_virus	1.6e-09	28.5
WP_065482299.1\|949255_950167_-	DMT family transporter	NA	NA	NA	NA
WP_023521241.1\|950372_950867_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_023521242.1\|950995_951451_+	N-acetyltransferase	NA	NA	NA	NA
WP_065482302.1\|951531_952302_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_000288069.1\|952436_952796_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_000796022.1\|953184_953529_+	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_000539671.1\|953531_953846_+	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_065482304.1\|953997_954576_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_000742953.1\|954788_955991_+	tetracycline resistance MFS efflux pump	NA	NA	NA	NA
WP_065482306.1\|956024_956363_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_065482309.1\|956532_957072_+	ester cyclase	NA	NA	NA	NA
WP_065482312.1\|957095_957644_+	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_016078064.1\|957760_957964_-	hypothetical protein	NA	NA	NA	NA
WP_000037549.1\|958275_958791_-	type 1 glutamine amidotransferase	NA	NA	NA	NA
WP_065482315.1\|958814_960812_-	catalase	A0A2K9L572	Tupanvirus	2.2e-150	51.1
WP_065482317.1\|961086_962286_-	ABC transporter permease	NA	NA	NA	NA
WP_001186293.1\|962346_963771_-	amino acid permease	NA	NA	NA	NA
WP_153578374.1\|963949_964111_+	hypothetical protein	NA	NA	NA	NA
WP_000109671.1\|964300_965131_+	glutamate racemase	NA	NA	NA	NA
WP_000423688.1\|965243_966329_+	DUF3626 domain-containing protein	A0A2H4UV60	Bodo_saltans_virus	2.5e-07	24.3
WP_000213616.1\|966408_967848_-	NADP-dependent glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_000953768.1\|968461_970222_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	3.5e-46	27.7
WP_065482319.1\|970218_972219_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.2e-40	30.2
WP_000732858.1\|972513_973311_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000281502.1\|973297_973996_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_065482322.1\|974024_974759_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.6e-40	45.3
WP_000013339.1\|974810_975014_-	small acid-soluble spore protein, SasP family	Q77YX0	Bacillus_phage	6.1e-16	65.1
WP_000510477.1\|975469_975715_+	hypothetical protein	NA	NA	NA	NA
WP_000658108.1\|975734_977192_-	YheC/YheD family protein	NA	NA	NA	NA
WP_000242799.1\|977212_978265_-	hypothetical protein	NA	NA	NA	NA
WP_139359406.1\|978451_978544_-	hypothetical protein	NA	NA	NA	NA
WP_065481512.1\|978670_979927_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	5.8e-112	60.2
WP_065486048.1\|980179_981313_+	DUF445 domain-containing protein	NA	NA	NA	NA
WP_000164614.1\|981455_981812_+	YlbF/YmcA family competence regulator	NA	NA	NA	NA
WP_094194456.1\|982422_983466_+\|transposase	IS630 family transposase	NA	NA	NA	NA

DBSCAN-SWA_6

1219561 : 1282176

Bacillus_phage(51.35%)

transposase,tail,capsid,terminase,protease,portal,head,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065482552.1\|1219561_1220410_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_065482555.1\|1220411_1220768_+	hypothetical protein	NA	NA	NA	NA
WP_016082517.1\|1220799_1221099_+	DUF2101 family protein	NA	NA	NA	NA
WP_065482557.1\|1221339_1222608_+	M48 family metallopeptidase	NA	NA	NA	NA
WP_063535862.1\|1222742_1224470_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.6e-11	47.0
WP_000727104.1\|1225091_1225748_+	S-layer homology domain-containing protein	A0A0E3DEP6	Bacillus_phage	3.7e-09	23.9
WP_113304420.1\|1225886_1226654_+	S-layer homology domain-containing protein	NA	NA	NA	NA
WP_065482560.1\|1226873_1228463_+	malate synthase A	NA	NA	NA	NA
WP_000787341.1\|1228486_1229764_+	isocitrate lyase	NA	NA	NA	NA
WP_065482563.1\|1229873_1230665_-	phosphotransferase	NA	NA	NA	NA
WP_001060338.1\|1230684_1231179_-	hypothetical protein	NA	NA	NA	NA
WP_000301523.1\|1231462_1231666_+	RNA chaperone/antiterminator CspA	Q9AZD3	Lactococcus_phage	5.6e-17	64.5
WP_000356914.1\|1231865_1232069_-	hypothetical protein	NA	NA	NA	NA
WP_000659558.1\|1232415_1232601_-	hypothetical protein	NA	NA	NA	NA
WP_000444444.1\|1232885_1233467_+	competence protein	NA	NA	NA	NA
WP_000347517.1\|1233840_1234434_+	TVP38/TMEM64 family protein	NA	NA	NA	NA
WP_065482566.1\|1234490_1235054_+	signal peptidase I	NA	NA	NA	NA
WP_065482570.1\|1235170_1238686_+	helicase-exonuclease AddAB subunit AddB	NA	NA	NA	NA
WP_065482573.1\|1238682_1242408_+	helicase-exonuclease AddAB subunit AddA	G3MA40	Bacillus_virus	7.6e-19	25.1
WP_000255723.1\|1242420_1242708_+	hypothetical protein	NA	NA	NA	NA
WP_001141570.1\|1242845_1243061_-	spore germination protein GerPF	A0A2H4J3A3	uncultured_Caudovirales_phage	1.5e-25	82.4
WP_063546774.1\|1243103_1243490_-	spore germination protein GerPE	NA	NA	NA	NA
WP_001052807.1\|1243505_1243700_-	spore germination protein GerPD	NA	NA	NA	NA
WP_063546776.1\|1243706_1244321_-	spore germination protein GerPC	NA	NA	NA	NA
WP_001012508.1\|1244388_1244595_-	spore germination protein GerPB	NA	NA	NA	NA
WP_001111187.1\|1244609_1244831_-	spore germination protein GerPA	NA	NA	NA	NA
WP_000462857.1\|1244927_1245107_-	aspartyl-phosphate phosphatase Spo0E family protein	NA	NA	NA	NA
WP_120461128.1\|1245351_1246254_+	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_000926859.1\|1246288_1246570_-	hypothetical protein	NA	NA	NA	NA
WP_000616660.1\|1246680_1247871_-	ornithine aminotransferase	A0A1V0SKB7	Klosneuvirus	1.9e-27	27.7
WP_000233495.1\|1248021_1248390_+	YisL family protein	NA	NA	NA	NA
WP_000616066.1\|1248445_1249000_-	DUF2777 domain-containing protein	NA	NA	NA	NA
WP_065482576.1\|1249238_1251017_+	asparagine synthase (glutamine-hydrolyzing)	A0A1V0SGM7	Hokovirus	6.0e-22	27.1
WP_065482579.1\|1251047_1252451_-	recombinase family protein	A0A2I7SDG6	Paenibacillus_phage	1.8e-114	44.8
WP_000289676.1\|1252563_1252782_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_065482581.1\|1252797_1253481_-	LexA family transcriptional regulator	A0A2I6PF08	Staphylococcus_phage	3.8e-17	30.7
WP_065482584.1\|1253631_1253904_+	helix-turn-helix transcriptional regulator	A0A141E0W0	Streptococcus_phage	2.3e-10	50.0
WP_065482587.1\|1254196_1254388_+	hypothetical protein	A0A1B1P7M3	Bacillus_phage	1.7e-07	68.0
WP_065482590.1\|1254362_1254713_+	hypothetical protein	A0A2H4JBP9	uncultured_Caudovirales_phage	8.6e-50	84.5
WP_065482597.1\|1255183_1255381_+	hypothetical protein	NA	NA	NA	NA
WP_065482600.1\|1255382_1256066_+	AAA family ATPase	A0A1B2AQ06	Phage_Wrath	1.1e-109	89.4
WP_065482603.1\|1256150_1256597_+	hypothetical protein	A0A2K9V4F4	Staphylococcus_phage	6.7e-31	52.1
WP_065482606.1\|1257170_1259525_+	DNA primase	A0A1B2AQ05	Phage_Wrath	0.0e+00	78.1
WP_157686141.1\|1259784_1260018_+	hypothetical protein	NA	NA	NA	NA
WP_065482612.1\|1260005_1260434_+	hypothetical protein	A0A2H4JFQ6	uncultured_Caudovirales_phage	9.5e-59	71.8
WP_065482613.1\|1260436_1260967_+	nuclease	A0A0S2SXQ1	Bacillus_phage	4.7e-47	53.2
WP_065482005.1\|1261368_1261752_+	hypothetical protein	A0A288WFT8	Bacillus_phage	8.0e-49	75.8
WP_065482615.1\|1261882_1262764_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	E9P639	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	2.8e-20	27.2
WP_065482619.1\|1262836_1263151_+	hypothetical protein	A0A1B0T6C6	Bacillus_phage	2.8e-47	88.5
WP_065482622.1\|1263147_1263540_+	HNH endonuclease	A0A1B0T6C5	Bacillus_phage	2.1e-73	96.2
WP_065482625.1\|1263622_1264048_+\|terminase	P27 family phage terminase small subunit	A0A1B0T688	Bacillus_phage	5.2e-65	88.6
WP_065482633.1\|1267043_1268228_+\|portal	phage portal protein	A0A2H4JBS9	uncultured_Caudovirales_phage	2.2e-214	95.4
WP_065482636.1\|1268217_1268799_+\|head,protease	HK97 family phage prohead protease	A0A2H4J861	uncultured_Caudovirales_phage	2.4e-89	88.5
WP_065482639.1\|1268800_1270117_+\|capsid	phage major capsid protein	A0A1C8E976	Bacillus_phage	1.7e-175	95.4
WP_065482642.1\|1270184_1270484_+	collagen-like protein	NA	NA	NA	NA
WP_065482645.1\|1270498_1270756_+\|head,tail	phage gp6-like head-tail connector protein	A0A1C8E967	Bacillus_phage	5.7e-35	83.5
WP_065482648.1\|1270736_1271069_+	hypothetical protein	A0A1C8E986	Bacillus_phage	1.7e-47	85.2
WP_065482650.1\|1271058_1271388_+	hypothetical protein	A0A1B0T6B7	Bacillus_phage	8.4e-47	85.3
WP_065482653.1\|1271387_1271765_+	HK97 gp10 family phage protein	A0A1C8E995	Bacillus_phage	1.5e-52	82.4
WP_065482656.1\|1271777_1272422_+\|tail	phage tail protein	A0A1B1P7Q4	Bacillus_phage	1.2e-102	86.6
WP_065482659.1\|1272440_1272827_+	hypothetical protein	A0A2H4J956	uncultured_Caudovirales_phage	1.1e-53	82.8
WP_065482662.1\|1273070_1276361_+\|tail	phage tail tape measure protein	A0A1B1P7P9	Bacillus_phage	6.9e-290	79.0
WP_065482663.1\|1276362_1277046_+\|tail	phage tail protein	A0A1C8EA72	Bacillus_phage	5.9e-103	77.4
WP_065482665.1\|1277042_1279469_+	endopeptidase	A0A1B1P770	Bacillus_phage	0.0e+00	81.9
WP_065482667.1\|1279458_1280613_+\|plate	BppU family phage baseplate upper protein	A0A1B1P768	Bacillus_phage	6.5e-102	52.9
WP_065482059.1\|1280676_1280877_+	hypothetical protein	NA	NA	NA	NA
WP_065482062.1\|1280880_1281084_+	hypothetical protein	A0A1B1P886	Bacillus_phage	8.6e-18	63.3
WP_065482672.1\|1281141_1282176_+	N-acetylmuramoyl-L-alanine amidase	A0A0A7AQV3	Bacillus_phage	2.6e-150	74.6

DBSCAN-SWA_7

2006686 : 2013588

Bacillus_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053564725.1\|2006686_2008447_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.1e-273	98.2
WP_000612415.1\|2008487_2009165_+	response regulator transcription factor	W8CYM9	Bacillus_phage	3.0e-123	99.6
WP_065483250.1\|2009161_2010235_+	sensor histidine kinase	W8CYF6	Bacillus_phage	4.8e-184	96.4
WP_071731001.1\|2010259_2010853_-	DUF3139 domain-containing protein	NA	NA	NA	NA
WP_000818985.1\|2011043_2011763_+	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
WP_000014165.1\|2011910_2012582_+	O-methyltransferase	W8CYT3	Bacillus_phage	1.8e-64	92.0
WP_001258527.1\|2012715_2013588_+	aminoglycoside 6-adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	4.0e-64	44.4

DBSCAN-SWA_8

2063474 : 2071862

Lactococcus_phage(62.5%)

integrase,terminase

attL 2055983:2055996|attR 2069663:2069676

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2055983:2055996	attL	NA	NA	NA	NA
WP_000536897.1\|2063474_2063918_+	DNA starvation/stationary phase protection protein	A0A0A7RTZ1	Clostridium_phage	4.8e-45	62.1
WP_065483273.1\|2064315_2065512_-\|integrase	site-specific integrase	Q9AZK8	Lactococcus_phage	2.8e-100	45.4
WP_065483276.1\|2065590_2066139_-	helix-turn-helix transcriptional regulator	A0A286QR63	Streptococcus_phage	4.6e-05	44.3
WP_065483279.1\|2066285_2066477_+	hypothetical protein	R9QNG3	Lactococcus_phage	2.2e-07	47.6
WP_065483283.1\|2066595_2066865_+	hypothetical protein	NA	NA	NA	NA
WP_065483286.1\|2066881_2067109_+	hypothetical protein	NA	NA	NA	NA
WP_065486061.1\|2067200_2068022_+	hypothetical protein	Q9AZI6	Lactococcus_phage	1.7e-67	49.6
WP_065483289.1\|2068038_2069424_+	hypothetical protein	Q9AZE5	Lactococcus_phage	1.6e-168	63.4
WP_065483292.1\|2069811_2070219_+	DUF722 domain-containing protein	A5GYP6	Lactococcus_phage	1.6e-10	34.3
2069663:2069676	attR	NA	NA	NA	NA
WP_157686145.1\|2070269_2070446_+	hypothetical protein	NA	NA	NA	NA
WP_065483295.1\|2070628_2071249_+	hypothetical protein	NA	NA	NA	NA
WP_065483297.1\|2071376_2071862_+\|terminase	terminase small subunit	A7J290	Streptococcus_phage	6.6e-32	54.6

DBSCAN-SWA_9

2408081 : 2468287

Bacillus_phage(37.5%)

transposase,integrase,protease

attL 2404954:2404969|attR 2469951:2469966

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2404954:2404969	attL	NA	NA	NA	NA
WP_000794825.1\|2408081_2408978_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003270543.1\|2408977_2409637_+	AAA family ATPase	NA	NA	NA	NA
WP_000853593.1\|2409895_2410501_+	PRK06770 family protein	NA	NA	NA	NA
WP_000425898.1\|2410571_2411438_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_065483516.1\|2411567_2412611_+	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_065483519.1\|2412690_2413122_-	hypothetical protein	NA	NA	NA	NA
WP_000936604.1\|2414583_2414835_+	hypothetical protein	NA	NA	NA	NA
WP_065483522.1\|2414931_2415834_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_001262982.1\|2415990_2416680_+	MOSC domain-containing protein	NA	NA	NA	NA
WP_000528665.1\|2416938_2417826_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_065483524.1\|2417852_2418449_+	DUF1349 domain-containing protein	NA	NA	NA	NA
WP_000834774.1\|2418670_2420425_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.8e-47	29.2
WP_065483527.1\|2420417_2422214_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.0e-53	27.7
WP_065483530.1\|2422299_2423073_-	collagen-like protein	A0A285PWR0	Cedratvirus	1.9e-12	34.3
WP_048657278.1\|2423502_2423763_-	hypothetical protein	NA	NA	NA	NA
WP_065483534.1\|2424147_2424930_-	glycosyltransferase family 2 protein	A0A1V0SJD8	Klosneuvirus	5.9e-22	31.6
WP_065483537.1\|2425109_2425694_-	LysE family transporter	NA	NA	NA	NA
WP_065483540.1\|2425808_2426366_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_065483543.1\|2426740_2427364_-	collagen-like protein	NA	NA	NA	NA
WP_001121647.1\|2428518_2428809_-	DUF4183 domain-containing protein	NA	NA	NA	NA
WP_065483546.1\|2429278_2430574_+	collagen-like repeat preface domain-containing protein	NA	NA	NA	NA
WP_065483548.1\|2431125_2431758_-	cupin domain-containing protein	NA	NA	NA	NA
WP_065483551.1\|2431987_2432305_+	DUF5519 family protein	NA	NA	NA	NA
WP_139359406.1\|2432514_2432607_-	hypothetical protein	NA	NA	NA	NA
WP_065481512.1\|2432733_2433990_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	5.8e-112	60.2
WP_065483554.1\|2434170_2435481_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_065483556.1\|2435458_2436328_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_065486065.1\|2436823_2437417_+	methyltransferase domain-containing protein	A0A2P1JQT7	Mycobacterium_phage	3.0e-10	32.8
WP_000137402.1\|2437730_2438843_+	toxic anion resistance protein	NA	NA	NA	NA
WP_065483559.1\|2438867_2439701_+	DUF3974 domain-containing protein	NA	NA	NA	NA
WP_065483562.1\|2439758_2441318_-	family 10 glycosylhydrolase	NA	NA	NA	NA
WP_000865907.1\|2441545_2441851_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_065483565.1\|2441862_2443146_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_065483568.1\|2443224_2443497_+	hypothetical protein	NA	NA	NA	NA
WP_065483570.1\|2443512_2444667_+	anhydro-N-acetylmuramic acid kinase	NA	NA	NA	NA
WP_000876627.1\|2444682_2445576_+	ATPase	NA	NA	NA	NA
WP_000610875.1\|2445714_2446263_+	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_065483572.1\|2446333_2447917_+	aminotransferase class V-fold PLP-dependent enzyme	NA	NA	NA	NA
WP_061661061.1\|2447991_2448993_+	bifunctional threonine ammonia-lyase/L-serine ammonia-lyase TdcB	NA	NA	NA	NA
WP_065483576.1\|2449216_2449687_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_065483579.1\|2449826_2451062_+	MFS transporter	A0A2H4UVM2	Bodo_saltans_virus	3.2e-06	20.6
WP_000415089.1\|2451214_2451544_-	DUF1232 domain-containing protein	NA	NA	NA	NA
WP_003270559.1\|2452979_2454356_+	DEAD/DEAH box helicase	A0A1V0SIR5	Klosneuvirus	1.5e-57	36.0
WP_094194618.1\|2455302_2456446_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.0e-59	43.2
WP_000033159.1\|2457114_2457327_-	hypothetical protein	NA	NA	NA	NA
WP_065483587.1\|2458014_2458293_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	7.9e-14	62.7
WP_065483588.1\|2458285_2458645_+	cell division protein SepF	A0A1B1P7A1	Bacillus_phage	4.9e-32	52.5
WP_006923988.1\|2458663_2458831_+	DUF3954 domain-containing protein	A0A1B1P7U5	Bacillus_phage	5.2e-13	66.0
WP_006923989.1\|2458856_2459108_+	hypothetical protein	A0A0K2CNP4	Brevibacillus_phage	3.8e-07	43.8
WP_094194456.1\|2459850_2460895_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_006923995.1\|2462050_2462437_-	hypothetical protein	NA	NA	NA	NA
WP_016122509.1\|2462944_2463409_-	hypothetical protein	NA	NA	NA	NA
WP_065481512.1\|2465599_2466856_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	5.8e-112	60.2
WP_139359406.1\|2466982_2467075_+	hypothetical protein	NA	NA	NA	NA
WP_065483591.1\|2467262_2467745_+	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	2.7e-70	83.1
WP_065483594.1\|2467744_2468287_+\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	4.3e-88	91.7
2469951:2469966	attR	NA	NA	NA	NA

DBSCAN-SWA_10

2613469 : 2681806

Planktothrix_phage(25.0%)

transposase,bacteriocin,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000558614.1\|2613469_2615023_+\|tRNA	lysine--tRNA ligase	NA	NA	NA	NA
WP_001128402.1\|2615082_2615511_-	cell wall hydrolase	NA	NA	NA	NA
WP_094194461.1\|2616413_2617202_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_000238996.1\|2617553_2618261_+	response regulator transcription factor	NA	NA	NA	NA
WP_015055137.1\|2618257_2619241_+	sensor histidine kinase	NA	NA	NA	NA
WP_000376270.1\|2619560_2620187_-	hypothetical protein	NA	NA	NA	NA
WP_065486071.1\|2620896_2622525_+	ABC-F type ribosomal protection protein	A0A1B0RXA0	Streptococcus_phage	4.2e-54	33.5
WP_063547369.1\|2622545_2623139_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003270612.1\|2623693_2624188_+	DUF3267 domain-containing protein	NA	NA	NA	NA
WP_000404443.1\|2624503_2625274_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.6e-32	39.9
WP_000144179.1\|2625248_2627180_+	ABC transporter permease	NA	NA	NA	NA
WP_063547372.1\|2627247_2627916_+	hypothetical protein	NA	NA	NA	NA
WP_048657145.1\|2627992_2628334_-	DUF3914 domain-containing protein	NA	NA	NA	NA
WP_065483749.1\|2628612_2629854_+	lipase	NA	NA	NA	NA
WP_065483752.1\|2629941_2630967_+	homoserine dehydrogenase	NA	NA	NA	NA
WP_065483755.1\|2631057_2632506_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_003270605.1\|2632510_2633425_+	D-alanine--D-alanine ligase	NA	NA	NA	NA
WP_053564403.1\|2633731_2634421_+	thiaminase II	NA	NA	NA	NA
WP_002082716.1\|2634872_2635136_+	DUF3937 domain-containing protein	NA	NA	NA	NA
WP_065483758.1\|2635605_2635935_+\|bacteriocin	heterocycloanthracin/sonorensin family bacteriocin	NA	NA	NA	NA
WP_065483761.1\|2636427_2636913_+	homoserine dehydrogenase	NA	NA	NA	NA
WP_065483764.1\|2637224_2639612_+	DUF3893 domain-containing protein	NA	NA	NA	NA
WP_065483768.1\|2639819_2640587_+	DUF3959 family protein	NA	NA	NA	NA
WP_065483771.1\|2640731_2641148_+	DUF3995 domain-containing protein	NA	NA	NA	NA
WP_065483774.1\|2641268_2641472_+	hypothetical protein	NA	NA	NA	NA
WP_000362067.1\|2641801_2642014_-	hypothetical protein	NA	NA	NA	NA
WP_065483777.1\|2642223_2643228_+	DUF1835 domain-containing protein	NA	NA	NA	NA
WP_065483779.1\|2643373_2643778_+	hypothetical protein	NA	NA	NA	NA
WP_065483782.1\|2646708_2647341_+	Vat family streptogramin A O-acetyltransferase	A0A2R8FE91	Brazilian_cedratvirus	2.1e-25	43.1
WP_000046095.1\|2647411_2647567_+	DUF1540 domain-containing protein	NA	NA	NA	NA
WP_000289124.1\|2647670_2648168_-	PadR family transcriptional regulator	NA	NA	NA	NA
WP_065483785.1\|2648308_2649523_+	cytochrome P450	NA	NA	NA	NA
WP_000766393.1\|2650388_2651240_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_065483788.1\|2651662_2653450_+	PAS domain-containing protein	NA	NA	NA	NA
WP_094194523.1\|2654720_2655812_+	penicillin-binding protein 2	NA	NA	NA	NA
WP_065483789.1\|2656676_2657864_+	UDP-glucosyltransferase	A0A2H4ZK81	Cryptophlebia_leucotreta_granulosis_virus	8.9e-06	29.3
WP_063547418.1\|2657955_2658636_-	aspartate/glutamate racemase family protein	NA	NA	NA	NA
WP_065483792.1\|2659044_2659593_+	ECF-type riboflavin transporter substrate-binding protein	NA	NA	NA	NA
WP_065483795.1\|2659603_2661304_+	energy-coupling factor ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	4.7e-16	30.0
WP_065483798.1\|2661296_2662097_+	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_000120182.1\|2662233_2662341_+	YjcZ family sporulation protein	NA	NA	NA	NA
WP_065483801.1\|2662432_2663701_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.6e-24	29.1
WP_094194618.1\|2665555_2666700_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.0e-59	43.2
WP_043924670.1\|2668866_2669331_-	hypothetical protein	NA	NA	NA	NA
WP_094194459.1\|2669407_2670197_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_065483804.1\|2670473_2670938_-	exosporium protein D	NA	NA	NA	NA
WP_000453747.1\|2671799_2672033_+	hypothetical protein	NA	NA	NA	NA
WP_065483806.1\|2672288_2672588_-	hypothetical protein	NA	NA	NA	NA
WP_065483809.1\|2673043_2673385_+	hypothetical protein	NA	NA	NA	NA
WP_094194456.1\|2673455_2674499_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_065483812.1\|2674680_2675682_-	alpha/beta hydrolase family protein	NA	NA	NA	NA
WP_065483815.1\|2676258_2677683_+	ABC transporter permease	NA	NA	NA	NA
WP_000447851.1\|2677694_2678372_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.8e-25	36.0
WP_000273220.1\|2678667_2678850_-	hypothetical protein	NA	NA	NA	NA
WP_023522117.1\|2679051_2679588_-	DinB family protein	NA	NA	NA	NA
WP_094194525.1\|2680346_2680754_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_094194456.1\|2680761_2681806_-\|transposase	IS630 family transposase	NA	NA	NA	NA

DBSCAN-SWA_11

3099521 : 3179379

Bacillus_phage(30.77%)

transposase,coat,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065484257.1\|3099521_3101909_-\|protease	M6 family metalloprotease domain-containing protein	NA	NA	NA	NA
WP_065484260.1\|3102151_3104758_-	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	1.6e-47	36.4
WP_065484263.1\|3105248_3106106_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_065484273.1\|3107237_3107717_-\|coat	spore coat protein CotF	NA	NA	NA	NA
WP_065484274.1\|3108237_3108996_+	YqcI/YcgG family protein	NA	NA	NA	NA
WP_065484277.1\|3109765_3111109_-	amino acid permease	NA	NA	NA	NA
WP_065484280.1\|3111485_3111698_-	alpha/beta-type small acid-soluble spore protein	A0A1P8CX76	Bacillus_phage	3.5e-14	68.3
WP_065484283.1\|3111973_3112450_+	YndM family protein	NA	NA	NA	NA
WP_065486078.1\|3112485_3113001_-	DUF3231 family protein	NA	NA	NA	NA
WP_063547816.1\|3113295_3113508_-	small acid-soluble spore protein, SasP family	Q77YX0	Bacillus_phage	7.1e-15	61.5
WP_000649092.1\|3113774_3114908_+	glutathione-dependent formaldehyde dehydrogenase	A0A0G2YAX3	Acanthamoeba_polyphaga_mimivirus	1.3e-14	28.5
WP_002164086.1\|3115111_3115996_+	manganese catalase family protein	NA	NA	NA	NA
WP_065484285.1\|3116084_3117758_+	ribonuclease J	NA	NA	NA	NA
WP_023522375.1\|3118061_3118403_-	YolD-like family protein	A0A2H4JEH6	uncultured_Caudovirales_phage	4.2e-09	36.0
WP_065484287.1\|3118399_3119665_-	Y-family DNA polymerase	O64031	Bacillus_phage	1.5e-99	46.2
WP_065484289.1\|3122080_3123412_-	erythromycin esterase family protein	NA	NA	NA	NA
WP_065484291.1\|3123933_3125523_-	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
WP_023522382.1\|3125932_3126769_-	bromoperoxidase	R4JMP9	Mycobacterium_phage	4.5e-12	27.0
WP_000131213.1\|3127271_3127916_+	hydrolase	NA	NA	NA	NA
WP_065484294.1\|3128092_3128737_+	hydrolase	NA	NA	NA	NA
WP_000806856.1\|3128733_3129327_+	hypothetical protein	NA	NA	NA	NA
WP_023522384.1\|3129340_3131176_+	amidohydrolase	NA	NA	NA	NA
WP_023522386.1\|3131482_3132361_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_000111424.1\|3132577_3133021_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_065484298.1\|3133967_3136043_-	serine hydrolase	A0A2P1JR59	Mycobacterium_phage	5.7e-08	27.0
WP_065484301.1\|3138667_3139618_-	magnesium transporter	NA	NA	NA	NA
WP_065484304.1\|3139923_3140949_-	ParM/StbA family protein	A0A0S2MVG2	Bacillus_phage	2.4e-71	40.6
WP_043924679.1\|3140984_3141386_-	hypothetical protein	NA	NA	NA	NA
WP_065484307.1\|3141471_3141858_-	general stress protein	NA	NA	NA	NA
WP_000564622.1\|3143074_3143197_-	flavoprotein	NA	NA	NA	NA
WP_065484310.1\|3143519_3144623_-	Ger(x)C family spore germination protein	NA	NA	NA	NA
WP_094194456.1\|3145969_3147013_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_094194544.1\|3147028_3148414_-	spore germination protein	NA	NA	NA	NA
WP_001225224.1\|3148871_3149237_+	YxeA family protein	NA	NA	NA	NA
WP_065484314.1\|3149324_3150035_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_000749744.1\|3150138_3150594_-	tryptophan-rich sensory protein	NA	NA	NA	NA
WP_065484317.1\|3150705_3152136_-	deoxyribodipyrimidine photo-lyase	A0A1V0SGL1	Hokovirus	2.7e-57	30.7
WP_000743889.1\|3152349_3152919_+	DUF3841 domain-containing protein	NA	NA	NA	NA
WP_000365631.1\|3153009_3154227_-	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_065484320.1\|3154526_3155048_-	carbonic anhydrase	NA	NA	NA	NA
WP_065484323.1\|3155127_3157734_-	DUF2309 family protein	NA	NA	NA	NA
WP_023522401.1\|3157733_3159266_-	NADH dehydrogenase subunit 5	NA	NA	NA	NA
WP_094194456.1\|3159700_3160744_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_000798162.1\|3161041_3161404_-	DUF2294 domain-containing protein	NA	NA	NA	NA
WP_065484325.1\|3161770_3162613_-	polysaccharide deacetylase	NA	NA	NA	NA
WP_065484330.1\|3162991_3163552_+	streptothricin N-acetyltransferase SatA	E4ZFP7	Streptococcus_phage	3.1e-25	47.7
WP_065484333.1\|3163638_3164550_-	1,4-dihydroxy-2-naphthoate polyprenyltransferase	NA	NA	NA	NA
WP_023522410.1\|3164829_3165234_-	arsenate reductase (thioredoxin)	A0A2H4PQT9	Staphylococcus_phage	3.2e-48	72.2
WP_065484335.1\|3165259_3166300_-	ACR3 family arsenite efflux transporter	NA	NA	NA	NA
WP_023522412.1\|3166318_3166756_-	glyoxalase/bleomycin resistance/dioxygenase family protein	NA	NA	NA	NA
WP_065484338.1\|3166816_3167122_-	arsenical resistance operon transcriptional regulator ArsR	NA	NA	NA	NA
WP_157686151.1\|3167347_3167494_-	hypothetical protein	NA	NA	NA	NA
WP_065484342.1\|3167603_3168113_-	DinB family protein	NA	NA	NA	NA
WP_065481734.1\|3168765_3169878_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_001127750.1\|3170751_3170931_+	DUF4083 family protein	NA	NA	NA	NA
WP_065484346.1\|3171140_3172355_-	MFS transporter	NA	NA	NA	NA
WP_065484348.1\|3172857_3174024_-	serine hydrolase	A0A1D8EXR7	Mycobacterium_phage	3.3e-21	28.0
WP_065484351.1\|3174611_3176468_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_001072324.1\|3176526_3177093_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_094194456.1\|3178334_3179379_-\|transposase	IS630 family transposase	NA	NA	NA	NA

DBSCAN-SWA_12

3200103 : 3266665

Bacillus_phage(29.41%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065481512.1\|3200103_3201360_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	5.8e-112	60.2
WP_139359406.1\|3201486_3201579_+	hypothetical protein	NA	NA	NA	NA
WP_065484387.1\|3203583_3204324_-	YrrS family protein	NA	NA	NA	NA
WP_157686152.1\|3204561_3204996_-	sodium:proton symporter	NA	NA	NA	NA
WP_023522435.1\|3205509_3207594_-	serine hydrolase	A0A2P1JR59	Mycobacterium_phage	6.0e-05	24.8
WP_065484392.1\|3207685_3208852_-	serine hydrolase	A0A1D8EXR7	Mycobacterium_phage	2.4e-19	26.0
WP_065484394.1\|3210016_3211336_+	septum formation initiator	NA	NA	NA	NA
WP_065484396.1\|3211743_3212616_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_065484397.1\|3212736_3213606_+	DMT family transporter	NA	NA	NA	NA
WP_023522446.1\|3213845_3214151_-	monooxygenase	NA	NA	NA	NA
WP_139359406.1\|3214338_3214431_-	hypothetical protein	NA	NA	NA	NA
WP_065481512.1\|3214557_3215814_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	5.8e-112	60.2
WP_033690982.1\|3216158_3216509_-	DoxX family membrane protein	NA	NA	NA	NA
WP_001048563.1\|3216835_3217255_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000589728.1\|3217730_3218129_-	DUF1259 domain-containing protein	NA	NA	NA	NA
WP_139359406.1\|3219370_3219463_-	hypothetical protein	NA	NA	NA	NA
WP_065481512.1\|3219589_3220846_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	5.8e-112	60.2
WP_065484400.1\|3220988_3221459_-	hypothetical protein	NA	NA	NA	NA
WP_033695812.1\|3221730_3222405_+	response regulator transcription factor	W8CYM9	Bacillus_phage	9.2e-32	33.5
WP_065484402.1\|3222401_3223775_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	2.6e-25	27.5
WP_001104104.1\|3223966_3224182_-	hypothetical protein	NA	NA	NA	NA
WP_065484404.1\|3224528_3225974_-	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_065484406.1\|3226611_3227490_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_065484408.1\|3227849_3229187_+	erythromycin esterase family protein	NA	NA	NA	NA
WP_065484410.1\|3229531_3230110_+	luciferase	NA	NA	NA	NA
WP_023522453.1\|3230225_3232013_+	response regulator	Q6XM27	Feldmannia_irregularis_virus	6.0e-06	34.5
WP_065484413.1\|3232176_3234006_-	ABC transporter permease	NA	NA	NA	NA
WP_000595170.1\|3234022_3234784_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.0e-35	40.5
WP_065484416.1\|3234976_3236053_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	6.4e-19	29.5
WP_023522456.1\|3236049_3236736_-	response regulator transcription factor	W8CYM9	Bacillus_phage	7.1e-40	40.0
WP_065484418.1\|3236926_3237877_-	class A beta-lactamase	A0A1B0VBP7	Salmonella_phage	1.1e-51	43.2
WP_023522458.1\|3238185_3238614_-	DUF5412 domain-containing protein	NA	NA	NA	NA
WP_065484421.1\|3239134_3241246_+	TerD family protein	A0A1I9SAC2	Rhodococcus_phage	2.5e-67	31.7
WP_065484423.1\|3241457_3244655_-	bifunctional P-450/NADPH--P450 reductase	V5UQK0	Mycobacterium_phage	4.3e-79	37.9
WP_157686153.1\|3245228_3246668_-	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_065484425.1\|3247064_3247661_+	hypothetical protein	NA	NA	NA	NA
WP_065484428.1\|3248041_3249832_-	S9 family peptidase	NA	NA	NA	NA
WP_065484431.1\|3250162_3251158_-	D-cysteine desulfhydrase	NA	NA	NA	NA
WP_023522465.1\|3251514_3252747_-	DUF4073 domain-containing protein	NA	NA	NA	NA
WP_065484434.1\|3252944_3254486_-	serine hydrolase	A0A2P1JR59	Mycobacterium_phage	5.0e-09	28.0
WP_094194550.1\|3254696_3255617_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_065484440.1\|3255831_3256422_+	AAA family ATPase	NA	NA	NA	NA
WP_000851004.1\|3256561_3257674_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_000202606.1\|3257723_3258395_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.6e-36	38.6
WP_023522472.1\|3258394_3259459_-	ABC transporter permease	NA	NA	NA	NA
WP_023522473.1\|3259644_3260268_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_065484451.1\|3260337_3261597_+	MFS transporter	NA	NA	NA	NA
WP_065484453.1\|3261701_3262172_-	DinB family protein	NA	NA	NA	NA
WP_065484455.1\|3262372_3263749_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.3e-56	40.3
WP_094194461.1\|3263892_3264681_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_065481734.1\|3265552_3266665_-\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_13

3344060 : 3407111

Klosneuvirus(20.0%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065484525.1\|3344060_3345530_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	G3MB42	Bacillus_virus	3.0e-67	39.3
WP_000845630.1\|3345845_3346409_-	maltose O-acetyltransferase	NA	NA	NA	NA
WP_065484526.1\|3346606_3347605_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_023522534.1\|3347995_3349153_+	1-deoxy-D-xylulose-5-phosphate reductoisomerase	NA	NA	NA	NA
WP_000411478.1\|3349182_3350304_-	AI-2E family transporter	NA	NA	NA	NA
WP_000539730.1\|3350367_3350616_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_023522535.1\|3350825_3351287_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_065484528.1\|3351726_3353850_-	collagen-like protein	NA	NA	NA	NA
WP_065484531.1\|3353870_3355376_-	collagen-like protein	NA	NA	NA	NA
WP_080672404.1\|3355523_3355658_-	ubiquinone biosynthesis protein UbiE	NA	NA	NA	NA
WP_023522539.1\|3355688_3356603_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_023522540.1\|3356902_3357280_+	hypothetical protein	NA	NA	NA	NA
WP_023522541.1\|3357356_3357596_+	DUF3923 family protein	NA	NA	NA	NA
WP_000938438.1\|3357716_3358265_-	DUF2179 domain-containing protein	NA	NA	NA	NA
WP_023522542.1\|3358463_3358877_-	ATP synthase subunit I	NA	NA	NA	NA
WP_000402258.1\|3358929_3360258_-	HlyC/CorC family transporter	NA	NA	NA	NA
WP_000285635.1\|3360377_3360785_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_065481512.1\|3361168_3362425_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	5.8e-112	60.2
WP_139359406.1\|3362551_3362644_+	hypothetical protein	NA	NA	NA	NA
WP_065484533.1\|3362831_3363605_+	glycosyltransferase family 2 protein	A0A1V0SJD8	Klosneuvirus	1.2e-19	30.8
WP_023522544.1\|3363720_3364488_+	glucose-1-phosphate cytidylyltransferase	NA	NA	NA	NA
WP_065484536.1\|3364489_3365545_+	CDP-glucose 4,6-dehydratase	C7U075	Ostreococcus_tauri_virus	3.9e-13	26.4
WP_023522546.1\|3365557_3366781_+	class I SAM-dependent methyltransferase	A0A1V0SJ68	Klosneuvirus	1.9e-43	32.2
WP_023522547.1\|3366777_3367701_+	NAD-dependent epimerase/dehydratase family protein	A0A1V0SAI6	Catovirus	1.5e-08	23.0
WP_080672406.1\|3367669_3368482_-	glycosyltransferase family 2 protein	A0A1V0SJD8	Klosneuvirus	3.8e-16	31.4
WP_000814762.1\|3368968_3369853_+	DMT family transporter	NA	NA	NA	NA
WP_000350943.1\|3369870_3370407_-	hypothetical protein	NA	NA	NA	NA
WP_065484539.1\|3370426_3371248_-	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_001162791.1\|3371443_3371620_+	DUF1272 domain-containing protein	NA	NA	NA	NA
WP_000782228.1\|3371685_3372753_-	lactonase family protein	NA	NA	NA	NA
WP_065484542.1\|3372873_3374415_-	gluconokinase	NA	NA	NA	NA
WP_001057598.1\|3374524_3375850_-	gluconate permease GntP	NA	NA	NA	NA
WP_000667692.1\|3376247_3376916_-	fructose-6-phosphate aldolase	A0A0E3HNZ3	Synechococcus_phage	3.7e-49	47.5
WP_001195925.1\|3377025_3377919_-	decarboxylating 6-phosphogluconate dehydrogenase	A0A222YX62	Synechococcus_phage	2.2e-57	37.2
WP_065484547.1\|3378031_3380026_-	transketolase	NA	NA	NA	NA
WP_023522553.1\|3380065_3381550_-	glucose-6-phosphate dehydrogenase	M1UG55	Synechococcus_phage	3.5e-76	35.2
WP_023522554.1\|3381914_3382463_-	glucose-6-phosphate dehydrogenase	M4SIY3	Cyanophage	2.0e-16	32.4
WP_065484550.1\|3382553_3383507_-	NADP-dependent oxidoreductase	NA	NA	NA	NA
WP_065484552.1\|3383520_3384393_-	LLM class oxidoreductase	NA	NA	NA	NA
WP_065484553.1\|3384814_3385216_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_065484555.1\|3385208_3386207_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_065484559.1\|3386266_3387262_+	zinc-dependent alcohol dehydrogenase family protein	K7Z7U2	Megavirus	6.1e-08	27.2
WP_023522558.1\|3387681_3388140_+	hypothetical protein	NA	NA	NA	NA
WP_023522559.1\|3388322_3389117_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_023522560.1\|3389907_3391605_-	M4 family metallopeptidase	NA	NA	NA	NA
WP_094194456.1\|3391762_3392806_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_094194456.1\|3395122_3396166_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_065484562.1\|3396647_3398372_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	9.9e-14	46.6
WP_000668221.1\|3398825_3399395_-	HAD hydrolase-like protein	NA	NA	NA	NA
WP_023522564.1\|3399454_3400552_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	4.9e-59	37.2
WP_023522565.1\|3400544_3401282_-	GTP cyclohydrolase II	A0A1V0SE20	Indivirus	1.2e-24	40.1
WP_016124968.1\|3401584_3401902_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_094194452.1\|3402605_3403395_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_023522566.1\|3404044_3405118_-	hypothetical protein	NA	NA	NA	NA
WP_094194456.1\|3406066_3407111_-\|transposase	IS630 family transposase	NA	NA	NA	NA

DBSCAN-SWA_14

3548820 : 3661868

Bacillus_phage(70.59%)

transposase,tail,capsid,terminase,protease,portal,integrase,head,bacteriocin

attL 3535263:3535289|attR 3622412:3622438

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3535263:3535289	attL	NA	NA	NA	NA
WP_094194456.1\|3548820_3549864_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_065484672.1\|3550067_3551561_+	spore germination protein	NA	NA	NA	NA
WP_023522660.1\|3551562_3552666_+	endospore germination permease	NA	NA	NA	NA
WP_065484674.1\|3552662_3553790_+	Ger(x)C family spore germination protein	NA	NA	NA	NA
WP_065484677.1\|3554195_3554870_+	papain-like cysteine peptidase	NA	NA	NA	NA
WP_023522663.1\|3555433_3556183_+	NTP transferase domain-containing protein	NA	NA	NA	NA
WP_065484680.1\|3556203_3558270_+	glycosyl transferase	NA	NA	NA	NA
WP_023522665.1\|3558352_3559312_+	NAD(P)-dependent oxidoreductase	A0A2K9L0I7	Tupanvirus	1.9e-22	28.4
WP_023522666.1\|3559340_3560429_+	CDP-glucose 4,6-dehydratase	M4QRT5	Synechococcus_phage	4.3e-15	25.7
WP_063548252.1\|3561546_3562662_+	tetratricopeptide repeat protein	A0A2H4J8G3	uncultured_Caudovirales_phage	2.5e-111	55.3
WP_065484683.1\|3562971_3564954_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	6.7e-14	34.2
WP_016118415.1\|3565823_3566108_-	hypothetical protein	NA	NA	NA	NA
WP_065484686.1\|3567638_3568187_-	hypothetical protein	NA	NA	NA	NA
WP_065484689.1\|3568510_3570832_-	S8 family serine peptidase	NA	NA	NA	NA
WP_065484691.1\|3570936_3573303_-	DUF3472 domain-containing protein	NA	NA	NA	NA
WP_065484694.1\|3573435_3575676_-	hypothetical protein	NA	NA	NA	NA
WP_065484697.1\|3576869_3577697_+	cytosolic protein	A0A2H4J6G7	uncultured_Caudovirales_phage	2.1e-102	69.9
WP_065484700.1\|3577706_3578327_-	hypothetical protein	H0USY2	Bacillus_phage	1.8e-111	95.6
WP_065484702.1\|3578268_3579450_-	cell division protein FtsK	H0USY1	Bacillus_phage	6.9e-208	91.6
WP_016098414.1\|3579564_3579747_-	hypothetical protein	Q2I8E2	Bacillus_phage	1.5e-21	88.3
WP_065484704.1\|3579743_3580061_-	hypothetical protein	H0USY0	Bacillus_phage	1.1e-51	97.1
WP_065484707.1\|3580249_3580465_+	helix-turn-helix transcriptional regulator	A0A288WG80	Bacillus_phage	1.5e-07	44.4
WP_065484709.1\|3582964_3583189_-	hypothetical protein	A0A1B1P780	Bacillus_phage	1.6e-28	91.9
WP_157686155.1\|3592736_3592913_-	hypothetical protein	Q3HL07	Bacillus_phage	1.6e-12	63.8
WP_065484711.1\|3592942_3593260_-	hypothetical protein	W8CYN3	Bacillus_phage	2.8e-47	90.4
WP_006921167.1\|3593306_3593912_-\|tail	phage major tail protein	A0A2H4J8F3	uncultured_Caudovirales_phage	3.2e-92	86.1
WP_065484714.1\|3593912_3594272_-	DUF3168 domain-containing protein	H0USX0	Bacillus_phage	2.7e-59	96.6
WP_000763220.1\|3594268_3594703_-	HK97 gp10 family phage protein	H0USW9	Bacillus_phage	5.6e-75	97.2
WP_065484716.1\|3594695_3595019_-\|head	phage head closure protein	H0USW8	Bacillus_phage	5.3e-54	95.3
WP_065484718.1\|3595005_3595293_-\|head,tail	phage gp6-like head-tail connector protein	H0USW7	Bacillus_phage	1.7e-43	97.9
WP_065484721.1\|3595313_3596486_-\|capsid	phage major capsid protein	W8CYN2	Bacillus_phage	4.9e-198	94.1
WP_065484724.1\|3596523_3597234_-\|protease	Clp protease ClpP	W8CYT5	Bacillus_phage	1.1e-123	96.2
WP_065484727.1\|3597220_3598474_-\|portal	phage portal protein	A0A2H4J371	uncultured_Caudovirales_phage	4.2e-232	95.0
WP_065484730.1\|3598662_3600357_-\|terminase	terminase large subunit	A6M948	Geobacillus_virus	2.2e-207	63.9
WP_000532714.1\|3600353_3600854_-\|terminase	phage terminase small subunit P27 family	A0A0S2GLF2	Bacillus_phage	1.4e-64	74.1
WP_065484733.1\|3601159_3601537_-	HNH endonuclease	A0A0S2GLI5	Bacillus_phage	5.4e-58	82.4
WP_000602688.1\|3601786_3602008_-	hypothetical protein	B5LPQ8	Bacillus_virus	4.6e-25	78.9
WP_000377847.1\|3602053_3602329_-	hypothetical protein	H0USV6	Bacillus_phage	4.0e-18	53.8
WP_065486084.1\|3603789_3604287_+	hypothetical protein	NA	NA	NA	NA
WP_065484736.1\|3604678_3604897_-	hypothetical protein	H0USV5	Bacillus_phage	4.0e-21	67.6
WP_065484739.1\|3605110_3605653_-\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	4.9e-92	94.4
WP_000166150.1\|3605652_3606135_-	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	9.0e-74	83.8
WP_000645584.1\|3606414_3606537_-	DUF3983 domain-containing protein	NA	NA	NA	NA
WP_001013298.1\|3606790_3607036_+	hypothetical protein	NA	NA	NA	NA
WP_065484741.1\|3608911_3609178_-	hypothetical protein	A0A288WFR1	Bacillus_phage	1.6e-43	96.6
WP_065484744.1\|3609403_3609574_-	DUF3954 domain-containing protein	A0A0S2GLF5	Bacillus_phage	4.8e-22	92.9
WP_006929366.1\|3609645_3609912_-	hypothetical protein	W8CYZ5	Bacillus_phage	2.3e-39	93.2
WP_065484748.1\|3609953_3610766_-	ATP-binding protein	W8CZ50	Bacillus_phage	3.0e-154	98.9
WP_065484751.1\|3611941_3612589_-	sigma-70 family RNA polymerase sigma factor	A0A0S2GLJ1	Bacillus_phage	8.9e-109	92.6
WP_065484753.1\|3612863_3613178_-	hypothetical protein	A0A0S2GLB6	Bacillus_phage	5.0e-49	94.2
WP_006929382.1\|3614103_3614286_-	hypothetical protein	I7J4K2	Bacillus_phage	3.4e-18	82.4
WP_000277643.1\|3614302_3614491_-	helix-turn-helix domain-containing protein	A0A1B2APY7	Phage_Wrath	2.6e-21	80.6
WP_065484756.1\|3614635_3614881_-	hypothetical protein	NA	NA	NA	NA
WP_006929389.1\|3615094_3615424_+	helix-turn-helix transcriptional regulator	H0UST7	Bacillus_phage	2.5e-51	98.2
WP_065484762.1\|3615844_3617098_-	hypothetical protein	H0UST6	Bacillus_phage	9.8e-213	98.9
WP_006922645.1\|3618381_3619443_+\|integrase	site-specific integrase	H0UST3	Bacillus_phage	2.4e-196	99.2
WP_016080733.1\|3620364_3621597_-	N-acetylmuramoyl-L-alanine amidase	A0A0U4JE28	Exiguobacterium_phage	8.7e-20	36.1
WP_065484765.1\|3622347_3623091_-	M15 family metallopeptidase	NA	NA	NA	NA
3622412:3622438	attR	NA	NA	NA	NA
WP_023522679.1\|3623349_3623604_+	hypothetical protein	NA	NA	NA	NA
WP_065486049.1\|3625300_3627187_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	4.9e-30	29.5
WP_157686156.1\|3627925_3628162_-	hypothetical protein	NA	NA	NA	NA
WP_094194559.1\|3628199_3629249_-	hypothetical protein	NA	NA	NA	NA
WP_094194459.1\|3629358_3630148_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_094194560.1\|3630172_3630871_-	hypothetical protein	A0A0U4J920	Pseudomonas_phage	1.9e-24	37.5
WP_023522681.1\|3633773_3634127_+	hypothetical protein	NA	NA	NA	NA
WP_023522682.1\|3634499_3634940_-	hypothetical protein	NA	NA	NA	NA
WP_063548274.1\|3635558_3636812_+	sensor histidine kinase	NA	NA	NA	NA
WP_065484771.1\|3637192_3640108_-	PKD domain-containing protein	NA	NA	NA	NA
WP_000109724.1\|3640309_3640987_-	MgtC/SapB family protein	G3MA03	Bacillus_virus	6.2e-20	45.0
WP_063548278.1\|3641273_3641792_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_065484773.1\|3641839_3642748_-	glyoxalase	NA	NA	NA	NA
WP_000488980.1\|3642922_3643834_-	VanW family protein	NA	NA	NA	NA
WP_000283711.1\|3644263_3644593_+	hypothetical protein	NA	NA	NA	NA
WP_065484775.1\|3644708_3645785_+	DUF3900 domain-containing protein	NA	NA	NA	NA
WP_016125016.1\|3646962_3647088_-	DUF3961 domain-containing protein	NA	NA	NA	NA
WP_016125017.1\|3647072_3647405_-	hypothetical protein	NA	NA	NA	NA
WP_000869305.1\|3647554_3647758_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_016123139.1\|3647834_3648161_+	hypothetical protein	A0A0S2GLG3	Bacillus_phage	1.3e-18	47.2
WP_016125018.1\|3648203_3649301_-	N-acetylmuramoyl-L-alanine amidase	A0A1B1P878	Bacillus_phage	5.2e-133	65.5
WP_000480958.1\|3649297_3649534_-\|bacteriocin	bacteriocin biosynthesis protein	A0A1B0T697	Bacillus_phage	3.9e-14	54.1
WP_065484778.1\|3649570_3649939_-	hypothetical protein	A0A0S2MVE0	Bacillus_phage	2.0e-41	73.5
WP_065484784.1\|3649950_3655299_-	peptidase S74	A0A0S2MVB4	Bacillus_phage	0.0e+00	44.6
WP_016125021.1\|3655295_3656780_-\|tail	phage tail family protein	A0A0A7AQV1	Bacillus_phage	7.2e-138	54.0
WP_094194561.1\|3656794_3660535_-\|tail	phage tail tape measure protein	A6M961	Geobacillus_virus	1.3e-10	41.0
WP_016125023.1\|3660597_3660897_-	hypothetical protein	NA	NA	NA	NA
WP_016125024.1\|3660938_3661313_-	hypothetical protein	NA	NA	NA	NA
WP_016125025.1\|3661379_3661868_-\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA

DBSCAN-SWA_15

3673908 : 3687176

uncultured_Caudovirales_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065484806.1\|3673908_3674169_-	helix-turn-helix domain-containing protein	A0A290FZJ4	Caldibacillus_phage	4.9e-18	58.0
WP_157686157.1\|3674165_3674336_-	hypothetical protein	NA	NA	NA	NA
WP_065484807.1\|3674658_3674931_-	hypothetical protein	NA	NA	NA	NA
WP_157686158.1\|3675056_3675197_-	hypothetical protein	NA	NA	NA	NA
WP_065484808.1\|3675231_3675762_-	hypothetical protein	A0A2H4J2L4	uncultured_Caudovirales_phage	6.3e-12	37.8
WP_065484810.1\|3675761_3676166_-	sigma-70 family RNA polymerase sigma factor	A0A0N9RZI0	Paenibacillus_phage	8.0e-15	40.0
WP_094194562.1\|3676170_3678153_-	DNA (cytosine-5-)-methyltransferase	Q02778	Bacillus_phage	1.5e-101	36.5
WP_065486086.1\|3678654_3679281_-	hypothetical protein	A0A0N9SJZ0	Paenibacillus_phage	6.3e-35	45.8
WP_065484811.1\|3680033_3680738_-	FAD-dependent thymidylate synthase	U5PWA7	Bacillus_virus	1.7e-84	66.5
WP_065484814.1\|3680737_3681175_-	alpha/beta hydrolase	A0A2H4IZM2	uncultured_Caudovirales_phage	5.7e-43	69.2
WP_065484815.1\|3681174_3681687_-	hypothetical protein	NA	NA	NA	NA
WP_065484816.1\|3681673_3682450_-	HNH endonuclease	A0A2H4IZM3	uncultured_Caudovirales_phage	9.5e-73	52.1
WP_065484817.1\|3682442_3683456_-	hypothetical protein	A0A2H4J7K6	uncultured_Caudovirales_phage	4.8e-117	59.2
WP_065484818.1\|3683509_3683770_-	hypothetical protein	NA	NA	NA	NA
WP_065484819.1\|3683784_3683940_-	BC1881 family protein	NA	NA	NA	NA
WP_065484821.1\|3683936_3684341_-	hypothetical protein	NA	NA	NA	NA
WP_065484822.1\|3684341_3687176_-	hypothetical protein	A0A0N9S7Z3	Paenibacillus_phage	3.7e-106	40.9

DBSCAN-SWA_16

3692640 : 3700681

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065484831.1\|3692640_3693840_-	hypothetical protein	A0A288WGM1	Bacillus_phage	9.7e-93	45.4
WP_016125072.1\|3693954_3694152_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_157686159.1\|3694189_3694408_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_157686160.1\|3694461_3695430_-	hypothetical protein	A0A2H4J6E6	uncultured_Caudovirales_phage	8.8e-68	42.1
WP_016125074.1\|3695417_3695681_-	hypothetical protein	A0A1B1P870	Bacillus_phage	3.3e-22	59.1
WP_065484833.1\|3695698_3697042_-	DNA helicase	A0A2H4IZL9	uncultured_Caudovirales_phage	5.2e-135	55.8
WP_065484835.1\|3697360_3698551_+	peptidase S8	A0A1B0T6A2	Bacillus_phage	1.5e-165	73.7
WP_065484837.1\|3698743_3699508_-	DNA replication protein	A0A0N7GFF0	Paenibacillus_phage	5.6e-78	57.6
WP_065484839.1\|3699507_3700215_-	DUF723 domain-containing protein	G9J2C6	Bacillus_phage	8.5e-12	51.7
WP_065484841.1\|3700294_3700681_-	hypothetical protein	A0A2H4J134	uncultured_Caudovirales_phage	6.0e-12	35.4

DBSCAN-SWA_17

3724740 : 3786478

Bacillus_phage(83.72%)

transposase,tail,capsid,terminase,protease,portal,integrase,head

attL 3748652:3748670|attR 3799331:3799349

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065484856.1\|3724740_3725448_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	5.3e-38	42.9
WP_000656237.1\|3725935_3726214_-	YhdT family protein	NA	NA	NA	NA
WP_065484858.1\|3726487_3727972_+	aldehyde dehydrogenase DhaS	NA	NA	NA	NA
WP_000395352.1\|3728022_3728763_-	3-oxoacyl-ACP reductase FabG	NA	NA	NA	NA
WP_001035815.1\|3728896_3729046_+	YfhD family protein	NA	NA	NA	NA
WP_000447823.1\|3731071_3731497_-	divergent PAP2 family protein	NA	NA	NA	NA
WP_023522694.1\|3731575_3732517_-	EamA family transporter RarD	NA	NA	NA	NA
WP_065484860.1\|3732609_3732858_-	DUF1294 domain-containing protein	NA	NA	NA	NA
WP_000367304.1\|3733040_3733439_-	hypothetical protein	NA	NA	NA	NA
WP_065484861.1\|3733722_3734772_-	Mrp/NBP35 family ATP-binding protein	NA	NA	NA	NA
WP_000628502.1\|3734844_3735081_-	molybdopterin converting factor subunit 1	NA	NA	NA	NA
WP_001248111.1\|3735085_3735550_-	molybdopterin synthase catalytic subunit MoaE	NA	NA	NA	NA
WP_065484863.1\|3735530_3736838_-	molybdopterin molybdotransferase MoeA	NA	NA	NA	NA
WP_065484864.1\|3736855_3737872_-	molybdopterin-synthase adenylyltransferase MoeB	NA	NA	NA	NA
WP_065486087.1\|3737896_3738676_-	formate/nitrite transporter family protein	NA	NA	NA	NA
WP_023522699.1\|3738867_3739884_-	GTP 3',8-cyclase MoaA	NA	NA	NA	NA
WP_065484865.1\|3739900_3740698_-	formate dehydrogenase accessory sulfurtransferase FdhD	NA	NA	NA	NA
WP_000039582.1\|3740714_3741059_-	DUF2294 domain-containing protein	NA	NA	NA	NA
WP_023522701.1\|3741174_3741657_-	DUF1641 domain-containing protein	NA	NA	NA	NA
WP_065484867.1\|3744291_3745368_+	cytosolic protein	A0A0S2MVF4	Bacillus_phage	2.2e-11	37.0
WP_065484868.1\|3745368_3745989_-	hypothetical protein	H0USY2	Bacillus_phage	1.5e-108	93.7
WP_065484869.1\|3745930_3747112_-	cell division protein FtsK	H0USY1	Bacillus_phage	2.7e-204	89.6
WP_065484872.1\|3747224_3747410_-	hypothetical protein	Q2I8E2	Bacillus_phage	5.8e-21	86.7
WP_065484874.1\|3747406_3747715_-	hypothetical protein	H0USY0	Bacillus_phage	2.4e-40	82.7
WP_065484876.1\|3747889_3748111_+	helix-turn-helix transcriptional regulator	A0A288WG80	Bacillus_phage	2.0e-07	47.7
WP_065484877.1\|3748125_3748710_+	type IV secretory system conjugative DNA transfer family protein	A0A288WFT6	Bacillus_phage	3.3e-78	72.3
3748652:3748670	attL	NA	NA	NA	NA
WP_065484878.1\|3749522_3749723_+	hypothetical protein	A0A1B0T6A3	Bacillus_phage	5.5e-17	80.0
WP_065484880.1\|3749756_3750797_-	N-acetylmuramoyl-L-alanine amidase	A0A1B1P878	Bacillus_phage	2.6e-158	77.0
WP_065484881.1\|3750857_3751061_-	hypothetical protein	A0A1B1P886	Bacillus_phage	1.1e-17	65.0
WP_000151299.1\|3751063_3751345_-	hypothetical protein	D2XR31	Bacillus_phage	1.0e-32	76.9
WP_065484882.1\|3751451_3755552_-	hypothetical protein	W8CYT7	Bacillus_phage	0.0e+00	82.3
WP_065484884.1\|3755548_3757033_-\|tail	phage tail protein	W8CYY9	Bacillus_phage	5.0e-280	93.7
WP_065484885.1\|3757045_3760894_-\|tail	phage tail tape measure protein	A0A2H4J380	uncultured_Caudovirales_phage	0.0e+00	84.6
WP_065484886.1\|3761114_3761432_-	hypothetical protein	H0USX2	Bacillus_phage	8.9e-46	86.5
WP_065484888.1\|3761480_3762083_-\|tail	phage tail protein	W8CYT6	Bacillus_phage	2.3e-95	96.0
WP_065484889.1\|3762083_3762443_-	DUF3168 domain-containing protein	A0A0S2GLE3	Bacillus_phage	2.1e-59	95.8
WP_000763223.1\|3762439_3762877_-	HK97 gp10 family phage protein	A0A0S2GLH3	Bacillus_phage	7.9e-77	100.0
WP_065484890.1\|3762869_3763193_-\|head	phage head closure protein	H0USW8	Bacillus_phage	9.7e-56	97.2
WP_065484891.1\|3763179_3763467_-\|head,tail	phage gp6-like head-tail connector protein	H0USW7	Bacillus_phage	2.1e-41	93.6
WP_065484893.1\|3763487_3764660_-\|capsid	phage major capsid protein	A0A2H4J387	uncultured_Caudovirales_phage	1.2e-196	90.0
WP_094194633.1\|3764698_3765292_-\|protease	Clp protease ClpP	A0A2H4JC29	uncultured_Caudovirales_phage	9.4e-89	85.3
WP_065484896.1\|3765392_3766643_-\|portal	phage portal protein	A0A0S2GLJ4	Bacillus_phage	2.5e-216	88.5
WP_065484898.1\|3766830_3768525_-\|terminase	terminase large subunit	A6M948	Geobacillus_virus	2.2e-207	63.8
WP_065484899.1\|3768521_3769022_-\|terminase	phage terminase small subunit P27 family	A0A0S2GLF2	Bacillus_phage	1.0e-64	74.1
WP_065484901.1\|3769350_3769725_-	HNH endonuclease	A0A2H4J3B4	uncultured_Caudovirales_phage	4.3e-55	80.6
WP_030022649.1\|3770145_3770358_-	hypothetical protein	A0A0S2GM40	Bacillus_phage	3.3e-28	94.3
WP_065484902.1\|3771543_3771741_-	hypothetical protein	NA	NA	NA	NA
WP_030022646.1\|3772192_3772438_-	hypothetical protein	W8CYG8	Bacillus_phage	1.7e-36	95.1
WP_065484903.1\|3772644_3773187_-\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	3.0e-94	98.3
WP_065484904.1\|3773183_3773669_-	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	3.3e-84	97.5
WP_065484906.1\|3773819_3774422_-	hypothetical protein	NA	NA	NA	NA
WP_065484908.1\|3776547_3777018_+	hypothetical protein	NA	NA	NA	NA
WP_065484910.1\|3777189_3777357_-	DUF3954 domain-containing protein	A0A0S2GLF5	Bacillus_phage	1.0e-16	77.8
WP_065484912.1\|3777429_3777696_-	hypothetical protein	A0A0S2GLK4	Bacillus_phage	5.0e-34	81.8
WP_065484914.1\|3777692_3777995_-	hypothetical protein	A0A1B1P7W1	Bacillus_phage	1.5e-18	52.7
WP_157686161.1\|3777998_3778826_-	ATP-binding protein	D2XQ17	Bacillus_virus	6.4e-120	79.4
WP_065484916.1\|3778773_3779676_-	DNA replication protein DnaD	A0A0S2GLI6	Bacillus_phage	1.5e-117	75.1
WP_065484918.1\|3780823_3781144_-	hypothetical protein	A0A0S2GLB6	Bacillus_phage	9.1e-30	68.7
WP_065484919.1\|3781159_3781921_-	antirepressor	A0A0S2GLP8	Bacillus_phage	2.0e-91	69.8
WP_000549469.1\|3782130_3782319_-	helix-turn-helix transcriptional regulator	W8CYN7	Bacillus_phage	3.3e-24	90.3
WP_065484921.1\|3782350_3782587_-	helix-turn-helix transcriptional regulator	W8CYU0	Bacillus_phage	1.3e-33	92.2
WP_030022621.1\|3782733_3783081_+	helix-turn-helix transcriptional regulator	I7J6V3	Bacillus_phage	7.0e-52	92.0
WP_065486090.1\|3783413_3784619_-	hypothetical protein	A0A0U3TNF6	Bacillus_phage	7.3e-88	43.8
WP_065484922.1\|3785386_3786478_+\|integrase	site-specific integrase	A0A0S2GLI2	Bacillus_phage	4.3e-164	80.1
3799331:3799349	attR	NA	NA	NA	NA

DBSCAN-SWA_18

4482894 : 4543575

Bacillus_phage(48.39%)

transposase,tail,capsid,terminase,protease,portal,tRNA,integrase,head,plate

attL 4475962:4475982|attR 4535438:4535458

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4475962:4475982	attL	NA	NA	NA	NA
WP_094194461.1\|4482894_4483684_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_065485204.1\|4484415_4486800_+	hypothetical protein	NA	NA	NA	NA
WP_065485206.1\|4486905_4488456_+	hypothetical protein	NA	NA	NA	NA
WP_094194574.1\|4488691_4490046_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.4e-127	85.1
WP_065485212.1\|4490119_4491154_-	N-acetylmuramoyl-L-alanine amidase	A0A1B1P878	Bacillus_phage	8.3e-149	74.1
WP_065485214.1\|4491415_4491697_-	hypothetical protein	D2XR31	Bacillus_phage	4.5e-33	78.0
WP_065485216.1\|4491817_4492906_-\|plate	BppU family phage baseplate upper protein	A0A1B1P768	Bacillus_phage	1.6e-134	65.9
WP_065485219.1\|4492920_4495263_-	endopeptidase	A0A1C8E983	Bacillus_phage	0.0e+00	89.6
WP_065485221.1\|4495259_4495943_-\|tail	phage tail protein	A0A1C8EA72	Bacillus_phage	1.8e-88	68.6
WP_065485224.1\|4495944_4499706_-\|tail	phage tail tape measure protein	A0A2H4J957	uncultured_Caudovirales_phage	4.3e-70	46.8
WP_065485227.1\|4499888_4500257_-	hypothetical protein	A0A1S7FZ84	Listeria_phage	1.3e-08	34.6
WP_065485229.1\|4500315_4500885_-\|tail	phage tail protein	Q858W9	Listeria_phage	9.8e-35	42.1
WP_065485231.1\|4500885_4501296_-	hypothetical protein	NA	NA	NA	NA
WP_065485234.1\|4501285_4501666_-	hypothetical protein	NA	NA	NA	NA
WP_065485236.1\|4501643_4502009_-\|head,tail	phage head-tail adapter protein	NA	NA	NA	NA
WP_065485238.1\|4502008_4502320_-	hypothetical protein	A0A1B1P751	Bacillus_phage	3.4e-13	41.7
WP_065485240.1\|4502333_4503455_-\|capsid	phage major capsid protein	R4IBU5	Listeria_phage	8.8e-96	50.0
WP_065485242.1\|4503468_4504167_-\|protease	Clp protease ClpP	D2XR17	Bacillus_phage	2.5e-40	46.8
WP_065485244.1\|4504108_4505347_-\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	1.7e-52	32.3
WP_065485246.1\|4505365_4507033_-\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	6.6e-180	57.0
WP_065485248.1\|4507016_4507469_-	hypothetical protein	E2ELI1	Clostridium_phage	1.1e-23	43.5
WP_065485250.1\|4507644_4507956_-	hypothetical protein	NA	NA	NA	NA
WP_065485252.1\|4507958_4508285_-	HNH endonuclease	A0A1S7FZ53	Listeria_phage	2.2e-15	43.8
WP_065485254.1\|4508369_4508612_-	hypothetical protein	NA	NA	NA	NA
WP_065485258.1\|4509453_4509741_-	hypothetical protein	NA	NA	NA	NA
WP_094194461.1\|4510843_4511632_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_065485260.1\|4511812_4512388_-	zinc-finger domain-containing protein	A0A0S2MV86	Bacillus_phage	4.8e-13	37.4
WP_094194456.1\|4513349_4514394_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_157686165.1\|4514925_4515090_-	hypothetical protein	NA	NA	NA	NA
WP_065485262.1\|4515089_4515521_-	hypothetical protein	A0A2H4JFQ6	uncultured_Caudovirales_phage	2.1e-58	71.6
WP_065485264.1\|4515508_4515736_-	hypothetical protein	NA	NA	NA	NA
WP_065485265.1\|4516054_4518397_-	DNA primase	A0A1B2AQ05	Phage_Wrath	0.0e+00	84.2
WP_065485267.1\|4518469_4518946_-	DUF669 domain-containing protein	A0A1B2AQ07	Phage_Wrath	6.5e-32	50.0
WP_065485269.1\|4518966_4519638_-	AAA family ATPase	A0A1B2AQ06	Phage_Wrath	2.9e-118	94.6
WP_065482597.1\|4519639_4519837_-	hypothetical protein	NA	NA	NA	NA
WP_065486099.1\|4519833_4520013_-	hypothetical protein	NA	NA	NA	NA
WP_065485271.1\|4520020_4520233_-	hypothetical protein	NA	NA	NA	NA
WP_065485273.1\|4520879_4521089_-	hypothetical protein	NA	NA	NA	NA
WP_065485275.1\|4522450_4522639_-	helix-turn-helix transcriptional regulator	W8CYN7	Bacillus_phage	4.8e-23	87.1
WP_065485277.1\|4522706_4522913_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_065485279.1\|4523082_4523418_+	helix-turn-helix transcriptional regulator	H0UST7	Bacillus_phage	2.4e-17	44.3
WP_094194636.1\|4523831_4525073_-	hypothetical protein	A0A0U3TNF6	Bacillus_phage	9.4e-107	49.7
WP_065485282.1\|4525861_4526923_+\|integrase	site-specific integrase	H0UST3	Bacillus_phage	6.9e-159	77.9
WP_000871362.1\|4526984_4528262_-	MFS transporter	NA	NA	NA	NA
WP_001052031.1\|4528379_4528991_-	superoxide dismutase [Mn]	Q56AR7	Bacillus_thuringiensis_phage	4.5e-70	62.2
WP_000021895.1\|4529528_4530287_+	DUF1189 domain-containing protein	NA	NA	NA	NA
WP_065481512.1\|4530475_4531732_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	5.8e-112	60.2
WP_139359406.1\|4531858_4531951_+	hypothetical protein	NA	NA	NA	NA
WP_000825415.1\|4532137_4532503_+	hypothetical protein	NA	NA	NA	NA
WP_016080269.1\|4532658_4533771_+	flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase	NA	NA	NA	NA
WP_001054516.1\|4533850_4534264_-	transcriptional repressor	NA	NA	NA	NA
WP_000613817.1\|4534277_4535111_-	metal ABC transporter permease	NA	NA	NA	NA
WP_065485283.1\|4535110_4535881_-	metal ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.0e-18	33.2
4535438:4535458	attR	NA	NA	NA	NA
WP_000435960.1\|4536060_4536939_-	YitT family protein	NA	NA	NA	NA
WP_001048958.1\|4537088_4537343_+	DUF2624 domain-containing protein	NA	NA	NA	NA
WP_000912471.1\|4537361_4538258_-	deoxyribonuclease IV	A0A2H4UU70	Bodo_saltans_virus	1.2e-23	32.1
WP_065485285.1\|4538344_4539736_-	DEAD/DEAH box helicase	A0A0N9Q9J4	Chrysochromulina_ericina_virus	3.2e-47	29.3
WP_065485287.1\|4539916_4540669_+	VrrA protein	NA	NA	NA	NA
WP_000706657.1\|4540758_4541709_+	4-hydroxy-3-methylbut-2-enyl diphosphate reductase	NA	NA	NA	NA
WP_000036248.1\|4541749_4542871_-	Nif3-like dinuclear metal center hexameric protein	A0A2P1EK93	Megavirus	4.6e-20	48.0
WP_001006547.1\|4542867_4543575_-\|tRNA	tRNA (adenine(22)-N(1))-methyltransferase TrmK	NA	NA	NA	NA

DBSCAN-SWA_19

4771367 : 4779047

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000221100.1\|4771367_4772291_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	6.9e-46	44.0
WP_000247669.1\|4772417_4773353_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	4.9e-23	26.3
WP_000018060.1\|4773354_4774047_-	response regulator transcription factor	W8CYM9	Bacillus_phage	6.3e-36	38.2
WP_001014310.1\|4774389_4774584_+	YwbE family protein	NA	NA	NA	NA
WP_001255968.1\|4774624_4775824_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	5.6e-72	41.2
WP_000587824.1\|4776115_4776439_+	heme oxygenase	NA	NA	NA	NA
WP_000095598.1\|4776507_4777272_-	class B sortase	NA	NA	NA	NA
WP_065485373.1\|4777303_4778074_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-13	26.6
WP_001036824.1\|4778063_4779047_-	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	7.1e-17	26.9

DBSCAN-SWA_20

4976926 : 4983549

Staphylococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000817275.1\|4976926_4978084_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q331V1	Clostridium_botulinum_C_phage	9.6e-122	59.0
WP_004412121.1\|4978080_4978431_-\|transposase	IS607 family transposase	Q331V0	Clostridium_botulinum_C_phage	9.2e-44	66.7
WP_001129340.1\|4978645_4978795_-	hypothetical protein	NA	NA	NA	NA
WP_139359406.1\|4978981_4979074_-	hypothetical protein	NA	NA	NA	NA
WP_065481512.1\|4979200_4980457_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	5.8e-112	60.2
WP_000840869.1\|4980595_4980859_-	YtzC family protein	NA	NA	NA	NA
WP_000868033.1\|4980970_4981930_+	TIGR01212 family radical SAM protein	A0A2H4PQV5	Staphylococcus_phage	1.7e-55	72.0
WP_000764492.1\|4981926_4982499_+	methyltransferase domain-containing protein	A0A2H4PQV0	Staphylococcus_phage	4.1e-49	53.4
WP_000959717.1\|4982715_4983549_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.8e-16	31.1

DBSCAN-SWA_21

5131431 : 5225585

Bacillus_phage(43.59%)

transposase,tail,capsid,protease,portal,tRNA,integrase,head,plate,coat

attL 5144155:5144187|attR 5208118:5208150

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065481512.1\|5131431_5132688_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	5.8e-112	60.2
WP_063549376.1\|5132976_5133360_+	kinase	NA	NA	NA	NA
WP_000344360.1\|5133400_5134024_-	3'-5' exonuclease KapD	NA	NA	NA	NA
WP_000545210.1\|5134313_5135639_+	ArsB/NhaD family transporter	NA	NA	NA	NA
WP_000390061.1\|5135718_5136186_-	hypothetical protein	NA	NA	NA	NA
WP_065485508.1\|5136303_5137017_+	DNA alkylation repair protein	NA	NA	NA	NA
WP_065485510.1\|5137362_5138739_+\|tRNA	glycine--tRNA ligase	A0A1V0SIF1	Klosneuvirus	5.8e-49	28.1
WP_001140612.1\|5138778_5139162_-	hotdog fold thioesterase	NA	NA	NA	NA
WP_000810334.1\|5139257_5140001_+	DUF3298 and DUF4163 domain-containing protein	NA	NA	NA	NA
WP_001253379.1\|5140051_5140645_+	biotin transporter BioY	NA	NA	NA	NA
WP_030029053.1\|5140690_5141578_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	4.1e-80	54.1
WP_023523269.1\|5141685_5143410_-	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	1.2e-176	53.7
WP_065485511.1\|5143553_5144159_+	hypothetical protein	NA	NA	NA	NA
5144155:5144187	attL	NA	NA	NA	NA
WP_023523274.1\|5144333_5145818_-	cytosol aminopeptidase	Q6GYZ8	Mycoplasma_phage	2.5e-58	36.4
WP_002094181.1\|5145963_5146590_-	3D domain-containing protein	A0A0H3UZG2	Geobacillus_virus	2.1e-14	43.0
WP_000027016.1\|5146675_5146993_-	hypothetical protein	NA	NA	NA	NA
WP_000517993.1\|5146989_5147496_-	NUDIX hydrolase	NA	NA	NA	NA
WP_000856602.1\|5147813_5149022_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_000829772.1\|5149484_5150474_+	NAD(P)/FAD-dependent oxidoreductase	Q9JRK7	Streptococcus_phage	2.3e-31	52.4
WP_065485513.1\|5150591_5160794_-	DUF11 domain-containing protein	NA	NA	NA	NA
WP_000606660.1\|5161258_5161738_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_000391931.1\|5161955_5163203_+	MFS transporter	NA	NA	NA	NA
WP_000535246.1\|5163220_5164102_-	decarboxylase	NA	NA	NA	NA
WP_065485516.1\|5164182_5164644_+	DUF523 domain-containing protein	NA	NA	NA	NA
WP_065485518.1\|5164968_5166036_+	HTH domain-containing protein	A0A0S2MVF4	Bacillus_phage	8.3e-11	78.6
WP_065485520.1\|5166835_5167258_+	hypothetical protein	NA	NA	NA	NA
WP_094194582.1\|5168010_5169339_-	YncE family protein	NA	NA	NA	NA
WP_065485524.1\|5169979_5171023_-	N-acetylmuramoyl-L-alanine amidase	A0A1B1P878	Bacillus_phage	8.3e-165	81.1
WP_065485526.1\|5171084_5171288_-	hypothetical protein	D2XR32	Bacillus_phage	8.6e-18	60.6
WP_065485528.1\|5171290_5171572_-	hypothetical protein	D2XR31	Bacillus_phage	1.9e-31	74.7
WP_065485530.1\|5171645_5172752_-\|plate	BppU family phage baseplate upper protein	A0A1B1P768	Bacillus_phage	3.5e-105	52.7
WP_065485532.1\|5172766_5175109_-	endopeptidase	A0A1C8E983	Bacillus_phage	0.0e+00	89.2
WP_065485534.1\|5175105_5175789_-\|tail	phage tail protein	A0A1C8EA72	Bacillus_phage	1.2e-87	67.7
WP_065485536.1\|5175790_5179552_-\|tail	phage tail tape measure protein	A0A2H4J957	uncultured_Caudovirales_phage	8.1e-69	46.5
WP_065485227.1\|5179734_5180103_-	hypothetical protein	A0A1S7FZ84	Listeria_phage	1.3e-08	34.6
WP_065485538.1\|5180161_5180731_-\|tail	phage tail protein	Q858W9	Listeria_phage	7.5e-35	42.2
WP_065485540.1\|5180731_5181142_-	hypothetical protein	NA	NA	NA	NA
WP_065485542.1\|5181131_5181512_-	hypothetical protein	NA	NA	NA	NA
WP_065485544.1\|5181489_5181855_-\|head,tail	phage head-tail adapter protein	NA	NA	NA	NA
WP_065485546.1\|5181854_5182166_-	hypothetical protein	A0A1B1P751	Bacillus_phage	7.5e-13	40.5
WP_065485548.1\|5182179_5183301_-\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	1.1e-95	51.4
WP_065485549.1\|5183314_5184010_-\|protease	Clp protease ClpP	D2XR17	Bacillus_phage	1.9e-40	47.1
WP_065485551.1\|5183951_5185190_-\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	1.8e-73	38.3
WP_094194452.1\|5185648_5186437_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_094194583.1\|5187710_5188163_-	hypothetical protein	A0A1S7FYW6	Listeria_phage	4.6e-11	40.8
WP_065485554.1\|5188338_5188647_-	hypothetical protein	NA	NA	NA	NA
WP_065485556.1\|5188649_5188976_-	HNH endonuclease	A0A1S7FZ53	Listeria_phage	3.4e-16	44.8
WP_065485558.1\|5189022_5189265_-	hypothetical protein	NA	NA	NA	NA
WP_065485560.1\|5189331_5189883_-	signal peptidase I	NA	NA	NA	NA
WP_065485561.1\|5190281_5190656_-	ArpU family transcriptional regulator	Q9ZXB9	Bacillus_phage	8.4e-19	43.1
WP_065485563.1\|5190801_5191344_+\|integrase	tyrosine-type recombinase/integrase	A3F636	Streptococcus_phage	4.1e-22	37.8
WP_065485565.1\|5191375_5191858_-	hypothetical protein	NA	NA	NA	NA
WP_065485567.1\|5193398_5194133_-	sigma-70 family RNA polymerase sigma factor	A0A288WG21	Bacillus_phage	2.5e-59	50.0
WP_065485568.1\|5194116_5194539_-	hypothetical protein	NA	NA	NA	NA
WP_065485569.1\|5194548_5195307_-	zinc-finger domain-containing protein	NA	NA	NA	NA
WP_065485570.1\|5195296_5195965_-	2-methylcitrate dehydratase	NA	NA	NA	NA
WP_065485571.1\|5195985_5196396_-	DUF1064 domain-containing protein	A0A2P1JTY5	Anoxybacillus_phage	6.8e-30	51.1
WP_157686166.1\|5196402_5196606_-	hypothetical protein	NA	NA	NA	NA
WP_065485575.1\|5196670_5197972_-	DNA helicase	A0A1B1P7G6	Bacillus_phage	5.8e-91	42.6
WP_094194585.1\|5197971_5198847_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_065485577.1\|5198882_5199680_-	recombination protein RecT	S6AVW6	Thermus_phage	2.3e-90	64.2
WP_065485579.1\|5199701_5200637_-	hypothetical protein	S6C475	Thermus_phage	1.4e-99	59.2
WP_065485581.1\|5200716_5200911_-	hypothetical protein	NA	NA	NA	NA
WP_065485584.1\|5200911_5201214_-	hypothetical protein	A0A0S2GLB6	Bacillus_phage	5.0e-30	67.6
WP_023523323.1\|5201730_5201919_-	helix-turn-helix transcriptional regulator	A0A0S2GLE9	Bacillus_phage	1.2e-18	77.4
WP_065485587.1\|5201963_5202260_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_023523325.1\|5202441_5202780_+	helix-turn-helix transcriptional regulator	E9LUL4	Lactobacillus_phage	3.8e-10	37.1
WP_065485590.1\|5203250_5204381_-	hypothetical protein	NA	NA	NA	NA
WP_065485591.1\|5205033_5206095_+\|integrase	site-specific integrase	A0A1B2AQ00	Phage_Wrath	8.4e-173	84.7
WP_000833148.1\|5206184_5206538_-	YxeA family protein	A0A0K2CYS5	Paenibacillus_phage	1.3e-13	40.2
WP_003272374.1\|5206644_5206830_-	methyltransferase	NA	NA	NA	NA
WP_023523329.1\|5207233_5208004_-	hypothetical protein	NA	NA	NA	NA
WP_001068190.1\|5208917_5209481_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
5208118:5208150	attR	NA	NA	NA	NA
WP_000573830.1\|5209586_5209940_-	iron-sulfur cluster assembly accessory protein	A0A2H4N7M3	Lake_Baikal_phage	8.2e-16	42.3
WP_000077392.1\|5209981_5210848_-	diaminopimelate epimerase	NA	NA	NA	NA
WP_000595026.1\|5211094_5211334_-	YuzB family protein	NA	NA	NA	NA
WP_000682065.1\|5211686_5212757_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_001054089.1\|5212990_5213164_+	aspartyl-phosphate phosphatase Spo0E family protein	NA	NA	NA	NA
WP_063246395.1\|5213218_5213878_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.9e-22	34.6
WP_000679254.1\|5213861_5214659_+	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
WP_023523332.1\|5214859_5215201_-	alkylphosphonate utilization operon protein PhnA	NA	NA	NA	NA
WP_003272364.1\|5215711_5216509_-	DUF2628 domain-containing protein	NA	NA	NA	NA
WP_065485593.1\|5216835_5217513_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003272363.1\|5217611_5218406_-	nucleotidyltransferase domain-containing protein	NA	NA	NA	NA
WP_000248588.1\|5218458_5218767_-	YuzD family protein	NA	NA	NA	NA
WP_000431159.1\|5218962_5219199_+	NifU family protein	Q58MC7	Prochlorococcus_phage	2.0e-10	46.6
WP_065485595.1\|5219517_5219733_+	carbonic anhydrase	NA	NA	NA	NA
WP_065485597.1\|5219794_5220796_-\|coat	spore coat protein CotS	NA	NA	NA	NA
WP_000665103.1\|5220916_5221408_+	phosphatidylglycerophosphatase A	G3MBC5	Bacillus_virus	3.5e-41	53.8
WP_063548937.1\|5221431_5221911_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_063548939.1\|5222072_5223176_+	HpcH/HpaI aldolase/citrate lyase family protein	NA	NA	NA	NA
WP_023523339.1\|5223120_5224467_+	hypothetical protein	NA	NA	NA	NA
WP_000241506.1\|5224472_5225585_+\|protease	cysteine protease StiP family protein	NA	NA	NA	NA

DBSCAN-SWA_22

5233942 : 5290269

Bacillus_phage(50.0%)

tail,holin,transposase,capsid,terminase,protease,portal,integrase,head

attL 5229593:5229608|attR 5289219:5289234

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
5229593:5229608	attL	NA	NA	NA	NA
WP_002094186.1\|5233942_5234758_+\|protease	YhfC family intramembrane metalloprotease	NA	NA	NA	NA
WP_000738182.1\|5234783_5235215_-	hypothetical protein	NA	NA	NA	NA
WP_065485604.1\|5235348_5235903_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_000272748.1\|5235977_5236457_+	YbaK/EbsC family protein	NA	NA	NA	NA
WP_000166367.1\|5236477_5237374_-	lipoyl synthase	NA	NA	NA	NA
WP_065485606.1\|5237563_5238547_+	M23 family metallopeptidase	NA	NA	NA	NA
WP_000021807.1\|5238620_5239352_-	sporulation protein YunB	NA	NA	NA	NA
WP_000248467.1\|5239406_5239709_-	DUF1805 domain-containing protein	NA	NA	NA	NA
WP_094194588.1\|5239774_5241166_-	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
WP_065485610.1\|5241857_5242691_+	cytosolic protein	A0A2H4J6G7	uncultured_Caudovirales_phage	7.6e-129	85.6
WP_065485612.1\|5242705_5242996_-	hypothetical protein	A0A1C8E992	Bacillus_phage	6.7e-40	85.6
WP_065485619.1\|5243019_5243238_-	hypothetical protein	A0A1C8E991	Bacillus_phage	3.6e-30	90.3
WP_065485621.1\|5243376_5244960_+	cytoplasmic protein	A0A2H4J389	uncultured_Caudovirales_phage	3.1e-30	48.1
WP_016109438.1\|5244972_5245431_+	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_065485625.1\|5245718_5246831_-	histidine kinase	A0A2H4J8G3	uncultured_Caudovirales_phage	2.7e-97	50.0
WP_065485628.1\|5247323_5248259_-	N-acetylmuramoyl-L-alanine amidase	A0A0S2MVR5	Bacillus_phage	2.1e-159	84.6
WP_016099116.1\|5248258_5248684_-\|holin	phage holin family protein	A0A0S2MVC4	Bacillus_phage	8.3e-71	97.2
WP_016099117.1\|5248719_5249100_-	hypothetical protein	A0A0S2MVE0	Bacillus_phage	1.3e-43	73.3
WP_065485630.1\|5249111_5253497_-	hypothetical protein	A0A0S2MVB4	Bacillus_phage	0.0e+00	53.8
WP_016099119.1\|5253493_5254951_-\|tail	phage tail family protein	A0A0A7AQV1	Bacillus_phage	5.2e-173	59.5
WP_000415931.1\|5258857_5259220_-	hypothetical protein	A0A2H4JAG8	uncultured_Caudovirales_phage	1.4e-42	71.7
WP_065485633.1\|5259226_5259820_-\|tail	phage tail protein	A0A2H4JDV4	uncultured_Caudovirales_phage	2.8e-101	91.8
WP_065485634.1\|5259820_5260156_-	hypothetical protein	A0A2H4JAG4	uncultured_Caudovirales_phage	3.6e-53	93.6
WP_065485635.1\|5260152_5260497_-	HK97 gp10 family phage protein	A0A2H4JAH8	uncultured_Caudovirales_phage	2.2e-45	79.6
WP_065485636.1\|5260498_5260849_-\|head	phage head closure protein	D2XR20	Bacillus_phage	1.9e-52	87.1
WP_001243201.1\|5260850_5261147_-	hypothetical protein	D2XR19	Bacillus_phage	4.6e-44	91.7
WP_000234860.1\|5261159_5262323_-\|capsid	phage major capsid protein	A0A2H4JH29	uncultured_Caudovirales_phage	2.3e-208	95.6
WP_065485639.1\|5262342_5263119_-\|protease	Clp protease ClpP	R9TLM7	Paenibacillus_phage	3.3e-57	52.4
WP_050428367.1\|5263102_5264209_-\|portal	phage portal protein	A0A2H4JAJ1	uncultured_Caudovirales_phage	6.3e-187	90.1
WP_065485640.1\|5264274_5265930_-\|terminase	terminase large subunit	A0A2H4JHE9	uncultured_Caudovirales_phage	0.0e+00	96.4
WP_000763336.1\|5265926_5266283_-	hypothetical protein	A0A2H4JBV9	uncultured_Caudovirales_phage	3.6e-59	100.0
WP_065485642.1\|5266435_5266771_-	alpha/beta hydrolase	D2XR61	Bacillus_phage	6.8e-52	89.2
WP_065485644.1\|5266794_5267103_-	hypothetical protein	A0A288WFY9	Bacillus_phage	1.1e-16	46.5
WP_139359406.1\|5267289_5267382_-	hypothetical protein	NA	NA	NA	NA
WP_065481512.1\|5267508_5268765_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	5.8e-112	60.2
WP_065485646.1\|5269687_5269963_-	hypothetical protein	H0USV6	Bacillus_phage	2.0e-17	52.7
WP_065485648.1\|5272312_5272531_-	hypothetical protein	H0USV5	Bacillus_phage	5.2e-21	66.2
WP_065485650.1\|5272990_5273272_-\|integrase	tyrosine-type recombinase/integrase	W8CYP1	Bacillus_phage	1.0e-37	88.0
WP_065485652.1\|5273268_5273757_-	ArpU family transcriptional regulator	A0A1B0T6C9	Bacillus_phage	1.6e-78	91.4
WP_113732895.1\|5274047_5274161_-	DUF3983 domain-containing protein	A0A1B0T6D3	Bacillus_phage	4.2e-06	77.8
WP_065485654.1\|5274465_5274678_-	hypothetical protein	D2XR53	Bacillus_phage	2.4e-15	57.5
WP_065485656.1\|5276656_5277193_-	dUTPase	A0A2H4J4W9	uncultured_Caudovirales_phage	4.5e-90	91.0
WP_065485658.1\|5277317_5277752_-	hypothetical protein	A0A2H4JBD8	uncultured_Caudovirales_phage	1.5e-75	94.4
WP_139359406.1\|5277939_5278032_-	hypothetical protein	NA	NA	NA	NA
WP_065481512.1\|5278158_5279415_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	5.8e-112	60.2
WP_065485659.1\|5280152_5280383_-	hypothetical protein	A0A1C8E9C2	Bacillus_phage	1.3e-33	98.7
WP_065485660.1\|5280375_5280855_-	hypothetical protein	A0A1C8E9A8	Bacillus_phage	6.9e-82	95.6
WP_065485661.1\|5280866_5281820_-	DnaD domain protein	A0A0S2MVA0	Bacillus_phage	2.1e-146	89.9
WP_065485662.1\|5281913_5282252_-	hypothetical protein	A0A0S2MVH7	Bacillus_phage	2.9e-50	97.3
WP_065485664.1\|5282184_5282400_-	hypothetical protein	A0A1C8E9A6	Bacillus_phage	6.7e-29	91.5
WP_000178946.1\|5282399_5283113_-	hypothetical protein	A0A0S2MV99	Bacillus_phage	1.9e-128	99.6
WP_000453492.1\|5283130_5283565_-	hypothetical protein	A0A0S2MVA8	Bacillus_phage	3.1e-73	98.6
WP_001187283.1\|5283591_5283780_-	hypothetical protein	A0A2H4J4V8	uncultured_Caudovirales_phage	2.6e-13	62.9
WP_065485666.1\|5283791_5284553_-	antirepressor	A0A2H4JBC7	uncultured_Caudovirales_phage	2.0e-128	93.3
WP_065485668.1\|5284731_5284920_-	hypothetical protein	R9TQ08	Paenibacillus_phage	6.1e-18	69.0
WP_065485670.1\|5284947_5285193_-	helix-turn-helix transcriptional regulator	A0A1B2APZ4	Phage_Wrath	6.9e-22	73.3
WP_065485672.1\|5285357_5285984_+	helix-turn-helix domain-containing protein	A0A1B2APZ3	Phage_Wrath	5.5e-71	63.2
WP_065485674.1\|5286071_5287115_+\|integrase	site-specific integrase	A0A1J0MF14	Staphylococcus_phage	1.0e-93	47.9
WP_001118824.1\|5287181_5288579_-	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
WP_000009523.1\|5288627_5289059_-	iron-sulfur cluster assembly scaffold protein SufU	A0A0K1LS29	Mycobacterium_phage	1.5e-14	37.6
WP_001020767.1\|5289048_5290269_-	cysteine desulfurase SufS	Q2XUY6	environmental_halophage	2.3e-118	47.6
5289219:5289234	attR	NA	NA	NA	NA

DBSCAN-SWA_23

5363934 : 5439783

Bacillus_phage(72.92%)

transposase,tail,holin,capsid,terminase,protease,portal,tRNA,integrase,head

attL 5399803:5399824|attR 5437486:5437507

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_094194456.1\|5363934_5364979_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_001022535.1\|5367765_5368686_-	Cys-Gln thioester bond-forming surface protein	NA	NA	NA	NA
WP_000793561.1\|5368797_5369637_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	6.4e-83	56.1
WP_000100584.1\|5369653_5370868_-	MFS transporter	NA	NA	NA	NA
WP_000760481.1\|5371190_5371535_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_001115309.1\|5371970_5372411_+	DUF1641 domain-containing protein	NA	NA	NA	NA
WP_000043199.1\|5372455_5373634_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_001021094.1\|5373829_5375089_-\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	6.9e-89	42.4
WP_001057106.1\|5375457_5376375_-	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_000573647.1\|5376757_5377153_-	SET domain-containing protein	NA	NA	NA	NA
WP_065485694.1\|5377361_5378864_-	DUF4077 domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	6.0e-07	56.1
WP_065485695.1\|5378896_5379955_-	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_001986875.1\|5380271_5380706_+	fluoride efflux transporter CrcB	NA	NA	NA	NA
WP_000568581.1\|5380702_5381059_+	fluoride efflux transporter CrcB	NA	NA	NA	NA
WP_000980930.1\|5381088_5381328_-	DUF3947 family protein	NA	NA	NA	NA
WP_078994137.1\|5381407_5381659_-	DUF3955 domain-containing protein	NA	NA	NA	NA
WP_065485696.1\|5381775_5382291_-	spermidine N1-acetyltransferase	NA	NA	NA	NA
WP_000834709.1\|5382432_5382837_-	phosphate-starvation-inducible protein PsiE	NA	NA	NA	NA
WP_016079776.1\|5382886_5383843_-	NERD domain-containing protein	NA	NA	NA	NA
WP_065485697.1\|5384319_5384877_+	cysteine hydrolase	A0A1V0SL12	Klosneuvirus	4.2e-06	27.7
WP_003313360.1\|5384917_5385352_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_065485698.1\|5385708_5386674_+	DUF4822 domain-containing protein	NA	NA	NA	NA
WP_000608841.1\|5386772_5387204_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_000409981.1\|5387193_5387490_-	transporter suffix domain-containing protein	NA	NA	NA	NA
WP_000576726.1\|5387685_5389224_-	anthrolysin O/cereolysin O family cholesterol-dependent cytolysin	NA	NA	NA	NA
WP_000590061.1\|5389648_5390401_-	ATP-binding cassette domain-containing protein	NA	NA	NA	NA
WP_065485699.1\|5390397_5391462_-	iron chelate uptake ABC transporter family permease subunit	NA	NA	NA	NA
WP_000042077.1\|5391458_5392475_-	iron chelate uptake ABC transporter family permease subunit	A0A2H4IY97	uncultured_Caudovirales_phage	3.0e-58	36.8
WP_000749445.1\|5392494_5393511_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_065485700.1\|5393893_5394574_-	response regulator transcription factor	NA	NA	NA	NA
WP_016123739.1\|5395069_5395837_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_001123920.1\|5396644_5397112_-	SsrA-binding protein	W5RAM5	Staphylococcus_phage	5.4e-47	63.2
WP_065485702.1\|5397238_5399671_-	ribonuclease R	Q0GXV6	Lactococcus_phage	1.4e-90	40.4
5399803:5399824	attL	NA	NA	NA	NA
WP_065485703.1\|5400163_5401039_+	cytosolic protein	I7ILW0	Bacillus_phage	1.2e-113	77.1
WP_065485705.1\|5401041_5401650_-	hypothetical protein	A0A0S2GLL8	Bacillus_phage	9.3e-92	80.1
WP_065485707.1\|5401639_5402806_-	DNA translocase FtsK	W8CYG2	Bacillus_phage	1.4e-181	80.4
WP_065485708.1\|5402816_5403137_-	hypothetical protein	A0A0S2GLK1	Bacillus_phage	1.4e-33	67.0
WP_060852440.1\|5403600_5403825_+	helix-turn-helix transcriptional regulator	A0A1B1P883	Bacillus_phage	7.7e-28	78.4
WP_065485710.1\|5405024_5405222_+	hypothetical protein	A0A1B0T6A3	Bacillus_phage	7.5e-19	83.1
WP_065485711.1\|5405312_5406065_-	N-acetylmuramoyl-L-alanine amidase	S5M842	Bacillus_phage	1.8e-73	78.7
WP_065486106.1\|5406064_5406271_-	hypothetical protein	D2XR32	Bacillus_phage	1.6e-27	84.8
WP_065485712.1\|5406279_5406561_-	hypothetical protein	D2XR31	Bacillus_phage	4.5e-33	79.1
WP_065485713.1\|5406626_5406851_-	hypothetical protein	A0A1B1P780	Bacillus_phage	2.5e-26	86.3
WP_065485715.1\|5408345_5410751_-	endopeptidase	A0A1B1P770	Bacillus_phage	0.0e+00	83.4
WP_065485716.1\|5410747_5411431_-\|tail	phage tail protein	A0A1B0T6A0	Bacillus_phage	1.6e-124	94.7
WP_065485717.1\|5411431_5414956_-\|tail	phage tail tape measure protein	A0A1B1P7P9	Bacillus_phage	0.0e+00	93.9
WP_006927278.1\|5414972_5415161_-	hypothetical protein	A0A1C8E979	Bacillus_phage	8.2e-31	98.4
WP_065485718.1\|5415199_5415586_-	hypothetical protein	A0A1C8E984	Bacillus_phage	1.8e-64	97.7
WP_065485719.1\|5415597_5416233_-\|tail	phage tail protein	A0A1C8E980	Bacillus_phage	2.2e-112	96.7
WP_065485721.1\|5416244_5416622_-	HK97 gp10 family phage protein	A0A1B1P7P3	Bacillus_phage	5.6e-63	97.6
WP_065485723.1\|5416621_5416951_-	hypothetical protein	A0A2H4JFJ3	uncultured_Caudovirales_phage	3.0e-52	89.9
WP_065485725.1\|5416940_5417273_-	hypothetical protein	A0A1C8E986	Bacillus_phage	2.3e-52	94.4
WP_065485727.1\|5417250_5417511_-\|head,tail	phage gp6-like head-tail connector protein	A0A1B2APX3	Phage_Wrath	9.6e-38	84.9
WP_065485728.1\|5417525_5417825_-	collagen-like protein	NA	NA	NA	NA
WP_065485730.1\|5417893_5419210_-\|capsid	phage major capsid protein	A0A1C8E976	Bacillus_phage	3.6e-197	92.9
WP_065485732.1\|5419211_5419793_-\|head,protease	HK97 family phage prohead protease	A0A1C8EA63	Bacillus_phage	2.7e-96	96.4
WP_065485733.1\|5419782_5420049_-	hypothetical protein	NA	NA	NA	NA
WP_065485735.1\|5420023_5421226_-\|portal	phage portal protein	A0A1C8E972	Bacillus_phage	1.0e-214	96.6
WP_065485736.1\|5421241_5422966_-\|terminase	terminase large subunit	A0A1C8E985	Bacillus_phage	0.0e+00	92.0
WP_065485738.1\|5422962_5423388_-\|terminase	P27 family phage terminase small subunit	A0A1C8E969	Bacillus_phage	3.5e-69	93.6
WP_065485739.1\|5423471_5423864_-	HNH endonuclease	A0A2H4JFG4	uncultured_Caudovirales_phage	6.0e-68	90.0
WP_065485740.1\|5423860_5424154_-	hypothetical protein	A0A1B1P7N8	Bacillus_phage	8.6e-35	76.3
WP_065485744.1\|5425455_5425968_-	hypothetical protein	NA	NA	NA	NA
WP_065485746.1\|5425979_5426252_-	hypothetical protein	NA	NA	NA	NA
WP_065485748.1\|5426657_5427200_-\|integrase	site-specific integrase	A0A1B0T6D2	Bacillus_phage	3.5e-90	93.9
WP_065485749.1\|5427196_5427682_-	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	9.4e-71	80.7
WP_127064183.1\|5427984_5428098_-	DUF3983 domain-containing protein	A0A1B0T6D3	Bacillus_phage	9.9e-08	86.5
WP_065485750.1\|5428313_5428517_+	hypothetical protein	A0A2H4J3A3	uncultured_Caudovirales_phage	3.2e-12	65.4
WP_065485752.1\|5428641_5429451_-	phage antirepressor KilAC domain-containing protein	A0A2H4JAT4	uncultured_Caudovirales_phage	5.2e-74	52.5
WP_065485753.1\|5429484_5429652_-	DUF3954 domain-containing protein	A0A0S2GLF5	Bacillus_phage	2.3e-13	63.0
WP_065485754.1\|5429690_5429957_-	hypothetical protein	A0A0S2GLK4	Bacillus_phage	9.8e-22	59.1
WP_065485755.1\|5429953_5430241_-	hypothetical protein	A0A1B1P7W1	Bacillus_phage	6.0e-17	48.4
WP_065485757.1\|5430254_5431118_-	ATP-binding protein	A0A1B0T6C3	Bacillus_phage	1.5e-90	63.7
WP_065485758.1\|5431068_5431887_-	replication protein	A0A1P8VVR3	Streptococcus_phage	6.8e-21	45.7
WP_023523419.1\|5432956_5433145_-	helix-turn-helix transcriptional regulator	W8CYN7	Bacillus_phage	5.7e-24	90.3
WP_065485760.1\|5433212_5433419_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_065485279.1\|5433588_5433924_+	helix-turn-helix transcriptional regulator	H0UST7	Bacillus_phage	2.4e-17	44.3
WP_065485764.1\|5434339_5435533_-	helix-turn-helix transcriptional regulator	A0A0U3TNF6	Bacillus_phage	2.1e-108	51.4
WP_065485766.1\|5436373_5437435_+\|integrase	site-specific integrase	H0UST3	Bacillus_phage	4.6e-155	74.8
WP_000976874.1\|5437496_5438240_-	carboxylesterase	NA	NA	NA	NA
5437486:5437507	attR	NA	NA	NA	NA
WP_000557266.1\|5438397_5438631_-	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_000078304.1\|5438725_5439418_-	LrgB family protein	NA	NA	NA	NA
WP_000673222.1\|5439414_5439783_-\|holin	CidA/LrgA family holin-like protein	NA	NA	NA	NA

DBSCAN-SWA_24

5471825 : 5545440

Bacillus_phage(45.24%)

transposase,holin,tail,capsid,terminase,protease,portal,head,bacteriocin,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001267308.1\|5471825_5472206_-\|holin	phage holin family protein	NA	NA	NA	NA
WP_000394744.1\|5472321_5472771_-	DUF4275 family protein	NA	NA	NA	NA
WP_065485787.1\|5472830_5475707_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	57.1
WP_000400987.1\|5475712_5477689_-	excinuclease ABC subunit B	NA	NA	NA	NA
WP_065485789.1\|5477840_5478272_-	DUF4362 domain-containing protein	NA	NA	NA	NA
WP_000025200.1\|5478316_5478937_-	hypothetical protein	NA	NA	NA	NA
WP_000260342.1\|5478933_5479695_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_000524131.1\|5479796_5480024_-	hypothetical protein	NA	NA	NA	NA
WP_000538364.1\|5480171_5480369_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_023523453.1\|5480666_5481689_-	YeiH family putative sulfate export transporter	NA	NA	NA	NA
WP_053563369.1\|5481839_5482733_+	LysR family transcriptional regulator	A0A2H4J8I9	uncultured_Caudovirales_phage	2.5e-08	42.5
WP_065481512.1\|5482906_5484163_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	5.8e-112	60.2
WP_139359406.1\|5484289_5484382_+	hypothetical protein	NA	NA	NA	NA
WP_001219212.1\|5484569_5484938_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_000497599.1\|5484942_5485482_+	flavodoxin family protein	NA	NA	NA	NA
WP_023523456.1\|5485490_5485850_+	macrolide efflux pump	NA	NA	NA	NA
WP_000637523.1\|5485950_5486262_-	heavy metal-binding domain-containing protein	NA	NA	NA	NA
WP_000944629.1\|5486327_5488043_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	9.1e-60	31.4
WP_016085217.1\|5488355_5489558_-	hypothetical protein	NA	NA	NA	NA
WP_065485791.1\|5489649_5491134_-	PDZ domain-containing protein	A0A0R6PIZ1	Moraxella_phage	1.1e-21	27.4
WP_065485793.1\|5491204_5492098_-	cell division ABC transporter permease FtsX	NA	NA	NA	NA
WP_000594319.1\|5492087_5492774_-	cell division ATP-binding protein FtsE	G9BWD6	Planktothrix_phage	4.1e-27	37.9
WP_000727971.1\|5493059_5493383_-	cytochrome c-551	NA	NA	NA	NA
WP_098852422.1\|5493822_5494921_-	peptide chain release factor 2	NA	NA	NA	NA
WP_000579372.1\|5495065_5497573_-	preprotein translocase subunit SecA	NA	NA	NA	NA
WP_000671189.1\|5497845_5498388_-	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
WP_001990088.1\|5498711_5498909_-	cold shock protein CspC	Q9AZD3	Lactococcus_phage	9.8e-19	67.7
WP_071713846.1\|5499035_5499740_-	ComF family protein	NA	NA	NA	NA
WP_065485795.1\|5500911_5501739_+	cytosolic protein	A0A2H4J6G7	uncultured_Caudovirales_phage	7.9e-118	80.2
WP_065485797.1\|5501873_5502584_-	DUF1282 family protein	NA	NA	NA	NA
WP_065485799.1\|5502696_5503896_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_000631624.1\|5503892_5504573_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.9e-35	40.1
WP_065485801.1\|5504569_5505763_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_006922886.1\|5506044_5506368_+\|bacteriocin	circular bacteriocin, circularin A/uberolysin family	NA	NA	NA	NA
WP_065485804.1\|5506451_5508158_+	hypothetical protein	NA	NA	NA	NA
WP_006922881.1\|5508162_5508672_+	stage II sporulation protein M	NA	NA	NA	NA
WP_065485806.1\|5508685_5509234_+	hypothetical protein	NA	NA	NA	NA
WP_065485808.1\|5509223_5509862_+	ATP-binding cassette domain-containing protein	NA	NA	NA	NA
WP_065485809.1\|5510216_5511269_-	N-acetylmuramoyl-L-alanine amidase	A0A1C8E990	Bacillus_phage	1.6e-184	90.0
WP_033692567.1\|5511265_5511496_-\|bacteriocin	bacteriocin biosynthesis protein	A0A1B1P7Q9	Bacillus_phage	3.7e-33	97.4
WP_065485810.1\|5511559_5512825_-\|plate	BppU family phage baseplate upper protein	A0A1B0T696	Bacillus_phage	3.7e-175	75.0
WP_065485811.1\|5512839_5515182_-	endopeptidase	A0A1B1P7P0	Bacillus_phage	0.0e+00	96.7
WP_065485813.1\|5515178_5515862_-\|tail	phage tail protein	A0A1B1P7Q0	Bacillus_phage	1.2e-124	96.0
WP_065485815.1\|5515863_5519154_-\|tail	phage tail tape measure protein	A0A1B1P7P9	Bacillus_phage	1.1e-295	81.4
WP_065485817.1\|5519397_5519784_-	hypothetical protein	A0A2H4J956	uncultured_Caudovirales_phage	1.1e-53	82.8
WP_065485819.1\|5519802_5520447_-\|tail	phage tail protein	A0A1B1P7Q4	Bacillus_phage	3.6e-102	86.1
WP_065485820.1\|5520458_5520836_-	HK97 gp10 family phage protein	A0A2H4JDG0	uncultured_Caudovirales_phage	4.9e-51	80.0
WP_065482650.1\|5520835_5521165_-	hypothetical protein	A0A1B0T6B7	Bacillus_phage	8.4e-47	85.3
WP_065485821.1\|5521154_5521487_-\|head,tail	head-tail adaptor protein	A0A1C8E986	Bacillus_phage	1.5e-48	87.0
WP_065485826.1\|5521464_5521725_-\|head,tail	phage gp6-like head-tail connector protein	A0A1B2APX3	Phage_Wrath	4.3e-38	88.4
WP_065485829.1\|5521739_5522057_-	collagen-like protein	NA	NA	NA	NA
WP_065485831.1\|5522125_5523445_-\|capsid	phage major capsid protein	A0A1C8E976	Bacillus_phage	5.2e-180	95.6
WP_065485833.1\|5523446_5524028_-\|head,protease	HK97 family phage prohead protease	A0A1B1P7P1	Bacillus_phage	5.4e-89	89.0
WP_065485835.1\|5524017_5525202_-\|portal	phage portal protein	A0A1C8E972	Bacillus_phage	4.8e-217	97.4
WP_065485836.1\|5525217_5526942_-\|terminase	terminase large subunit	A0A1C8E985	Bacillus_phage	0.0e+00	92.5
WP_065485837.1\|5526938_5527364_-\|terminase	P27 family phage terminase small subunit	A0A1C8E969	Bacillus_phage	2.9e-68	92.9
WP_065485838.1\|5527467_5527842_-	HNH endonuclease	A0A1C8E9C7	Bacillus_phage	1.9e-63	87.8
WP_065486108.1\|5528865_5529849_-	class A beta-lactamase	NA	NA	NA	NA
WP_065486110.1\|5530248_5530644_-	hypothetical protein	A0A2H4JFW6	uncultured_Caudovirales_phage	2.1e-52	77.9
WP_094194592.1\|5530738_5531230_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_065485839.1\|5531828_5532368_-	nuclease	A0A0S2SXQ1	Bacillus_phage	2.3e-49	53.7
WP_065485840.1\|5532364_5532799_-	hypothetical protein	A0A2H4JFQ6	uncultured_Caudovirales_phage	1.3e-55	68.1
WP_065485842.1\|5533063_5535436_-	DNA primase	A0A1B2AQ05	Phage_Wrath	5.2e-311	68.4
WP_065485843.1\|5535508_5535988_-	DUF669 domain-containing protein	A0A1B2AQ07	Phage_Wrath	2.8e-27	45.6
WP_065485844.1\|5536007_5536532_-	hypothetical protein	A0A0C5K996	Enterococcus_phage	7.4e-37	46.0
WP_065485849.1\|5536524_5537208_-	AAA family ATPase	A0A1B2AQ06	Phage_Wrath	1.1e-109	89.0
WP_065485851.1\|5537213_5537405_-	hypothetical protein	NA	NA	NA	NA
WP_023523491.1\|5537875_5538226_-	hypothetical protein	A0A2H4JBP9	uncultured_Caudovirales_phage	2.3e-50	86.2
WP_065485855.1\|5538400_5538634_-	hypothetical protein	A0A1B1P7N2	Bacillus_phage	2.7e-23	70.7
WP_065485856.1\|5538646_5538883_-	helix-turn-helix transcriptional regulator	A0A2H4JE95	uncultured_Caudovirales_phage	9.3e-32	89.7
WP_065485859.1\|5539079_5539736_+	helix-turn-helix domain-containing protein	A0A1B1P7L1	Bacillus_phage	8.7e-112	90.4
WP_065486114.1\|5539757_5541110_+	recombinase family protein	A0A2H4J992	uncultured_Caudovirales_phage	3.1e-212	82.6
WP_065485861.1\|5541142_5541544_-	hypothetical protein	NA	NA	NA	NA
WP_065485862.1\|5541670_5543101_-	N-acetylmuramoyl-L-alanine amidase	A0A2H4PQY6	Streptomyces_phage	2.0e-12	37.2
WP_000400857.1\|5543249_5543564_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000684727.1\|5543725_5544568_-	DegV family protein	A0A0N9SI50	Staphylococcus_phage	6.1e-17	40.8
WP_065485863.1\|5544804_5545440_+	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	6.2e-38	40.6

DBSCAN-SWA_25

5813320 : 5858204

Streptococcus_phage(14.29%)

transposase,holin,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_094194459.1\|5813320_5814109_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_000104901.1\|5814360_5814792_-\|holin	antiholin-like murein hydrolase modulator LrgA	NA	NA	NA	NA
WP_065486010.1\|5814924_5815665_-	response regulator transcription factor	NA	NA	NA	NA
WP_065481734.1\|5816254_5817367_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_094194456.1\|5820204_5821248_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_065486013.1\|5821807_5823376_-	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	1.6e-15	23.9
WP_065486014.1\|5823737_5824808_-	nitric oxide synthase oxygenase	NA	NA	NA	NA
WP_000094037.1\|5825025_5825652_+	superoxide dismutase [Mn]	Q56AR7	Bacillus_thuringiensis_phage	2.6e-57	53.2
WP_043924732.1\|5825740_5826634_-	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_000540540.1\|5826730_5827321_-	acetamide transporter	NA	NA	NA	NA
WP_016079559.1\|5827692_5828094_+	hypothetical protein	NA	NA	NA	NA
WP_065486015.1\|5828664_5829681_-	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	2.1e-96	51.9
WP_001099728.1\|5829865_5830513_-	hemolysin III family protein	NA	NA	NA	NA
WP_029443708.1\|5830677_5831238_+	DUF1836 domain-containing protein	NA	NA	NA	NA
WP_065486016.1\|5831278_5832724_-	ATP-dependent RNA helicase DbpA	A0A1V0SBR7	Catovirus	2.2e-59	34.4
WP_000432447.1\|5833198_5834182_+	GMP reductase	G3MBI2	Bacillus_virus	3.4e-160	84.7
WP_065486018.1\|5834288_5836106_+	oligoendopeptidase F	A0A1X9I5X5	Streptococcus_phage	1.4e-119	38.2
WP_000713633.1\|5836143_5837022_-	radical SAM protein	NA	NA	NA	NA
WP_001027003.1\|5839054_5839534_-	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
WP_001052833.1\|5839593_5839779_-	CxxH/CxxC protein	NA	NA	NA	NA
WP_065486019.1\|5839832_5841008_-\|protease	serine protease	W5SAB9	Pithovirus	1.0e-09	31.9
WP_065486021.1\|5841071_5841866_-	MBL fold metallo-hydrolase	A0A0C5AJ83	Bacteriophage	6.1e-43	35.3
WP_000383720.1\|5841849_5842692_-	hypothetical protein	NA	NA	NA	NA
WP_000061569.1\|5842672_5843989_-	hypothetical protein	NA	NA	NA	NA
WP_000755367.1\|5843985_5845827_-	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	8.9e-37	35.0
WP_000971865.1\|5845830_5846538_-	cell wall metabolism DNA-binding response regulator WalR	W8CYM9	Bacillus_phage	7.6e-45	42.7
WP_000100230.1\|5847331_5848621_-	adenylosuccinate synthase	L7Y4J5	Megavirus	9.5e-70	36.2
WP_001286147.1\|5848836_5850186_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	2.5e-121	52.3
WP_000864223.1\|5850213_5850660_-	50S ribosomal protein L9	NA	NA	NA	NA
WP_001113779.1\|5850656_5852630_-	DHH family phosphoesterase	NA	NA	NA	NA
WP_000814844.1\|5852708_5853644_-	YybS family protein	NA	NA	NA	NA
WP_000918873.1\|5853724_5853958_-	30S ribosomal protein S18	NA	NA	NA	NA
WP_065486023.1\|5854003_5854525_-	single-stranded DNA-binding protein	A0A290GHL8	Caldibacillus_phage	1.8e-51	61.8
WP_001233781.1\|5854551_5854842_-	30S ribosomal protein S6	NA	NA	NA	NA
WP_000524670.1\|5855033_5856134_-	redox-regulated ATPase YchF	NA	NA	NA	NA
WP_000435486.1\|5856249_5856447_-	DUF951 domain-containing protein	NA	NA	NA	NA
WP_065486025.1\|5856467_5857349_-	mechanosensitive ion channel family protein	NA	NA	NA	NA
WP_001020708.1\|5857607_5858204_+\|protease	spore protease YyaC	A0A0A8WIQ6	Clostridium_phage	2.8e-24	39.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP015351

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

4715 : 73421

Streptococcus_phage(30.43%)

integrase,transposase,bacteriocin

attL 25849:25908|attR 46559:46644

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065486126.1\|4715_5834_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_065486128.1\|6176_6392_-	hypothetical protein	NA	NA	NA	NA
WP_157686170.1\|6625_6802_-	hypothetical protein	NA	NA	NA	NA
WP_065486129.1\|6844_7039_-	hypothetical protein	NA	NA	NA	NA
WP_065486130.1\|7028_7265_-	hypothetical protein	A0A1B1P789	Bacillus_phage	4.6e-07	35.4
WP_065486131.1\|7340_7568_-	hypothetical protein	NA	NA	NA	NA
WP_029441146.1\|7970_8300_+	hypothetical protein	NA	NA	NA	NA
WP_139359406.1\|9230_9323_-	hypothetical protein	NA	NA	NA	NA
WP_065481512.1\|9449_10706_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	5.8e-112	60.2
WP_094194644.1\|10933_11425_-	zinc-finger domain-containing protein	I7ILX4	Bacillus_phage	1.4e-08	36.8
WP_157686175.1\|12727_13024_+\|transposase	transposase	Q716C2	Shigella_phage	4.2e-13	41.1
WP_157686171.1\|13025_13268_-	hypothetical protein	NA	NA	NA	NA
WP_157686176.1\|13323_14502_-\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_065485082.1\|14865_15738_-\|integrase	tyrosine-type recombinase/integrase	S5M9V8	Brevibacillus_phage	8.5e-22	27.5
WP_065485081.1\|15910_18895_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	5.1e-66	23.2
WP_065486138.1\|19602_20607_+	ETX/MTX2 family pore-forming toxin	NA	NA	NA	NA
WP_065486139.1\|20719_21073_-\|transposase	IS6 family transposase	A0A1X9I6E7	Streptococcus_phage	1.4e-10	50.9
WP_065486140.1\|21248_21899_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.9e-66	59.6
WP_094194646.1\|22254_22665_-\|transposase	transposase	NA	NA	NA	NA
WP_065486141.1\|22681_23434_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	3.1e-36	34.5
25849:25908	attL	NA	NA	NA	NA
WP_157686172.1\|26463_27468_-	hypothetical protein	NA	NA	NA	NA
WP_065486148.1\|27522_28101_-	recombinase family protein	A0A219Y9V9	Aeromonas_phage	1.4e-28	39.7
WP_065486151.1\|28879_29566_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.4e-72	59.0
WP_094194663.1\|31990_32908_-	hypothetical protein	NA	NA	NA	NA
WP_094194648.1\|33773_34073_-\|transposase	transposase	NA	NA	NA	NA
WP_094194459.1\|36054_36843_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_065486159.1\|37769_38942_+\|integrase	tyrosine-type recombinase/integrase	A0A142F1N9	Bacillus_phage	6.8e-06	23.7
WP_065486160.1\|39274_39493_+	alpha/beta-type small acid-soluble spore protein	A0A1P8CX76	Bacillus_phage	2.7e-17	62.1
WP_094194649.1\|40834_42193_+	DEAD/DEAH box helicase	E5ER62	Bathycoccus_sp._RCC1105_virus	1.2e-41	31.5
WP_094194650.1\|42474_43264_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_065486164.1\|44792_45971_+	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_065486166.1\|46598_47285_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	7.1e-72	59.6
46559:46644	attR	NA	NA	NA	NA
WP_094194651.1\|47958_48747_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_094194653.1\|49585_49852_-	hypothetical protein	NA	NA	NA	NA
WP_065486168.1\|50212_50392_-	hypothetical protein	NA	NA	NA	NA
WP_157686173.1\|50624_50801_+\|transposase	transposase	NA	NA	NA	NA
WP_065486170.1\|51050_51968_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_157686177.1\|53366_54545_-\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_065486172.1\|54873_55728_-	DEAD/DEAH box helicase family protein	E5ES65	Bathycoccus_sp._RCC1105_virus	2.1e-20	28.0
WP_065486173.1\|55835_57416_-	DEAD/DEAH box helicase family protein	M1I405	Paramecium_bursaria_Chlorella_virus	4.5e-05	29.1
WP_065486175.1\|57922_59356_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_065486176.1\|59683_60370_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	4.1e-72	58.6
WP_065486178.1\|60796_61678_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_094194655.1\|62137_62350_-\|transposase	transposase	NA	NA	NA	NA
WP_157686174.1\|62297_62615_-\|transposase	transposase	A0A0N9SJT9	Paenibacillus_phage	5.9e-05	32.9
WP_065486180.1\|62514_62949_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
WP_065486181.1\|63132_63741_-	hypothetical protein	NA	NA	NA	NA
WP_094194657.1\|64151_64918_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.3e-23	42.7
WP_065486186.1\|65093_65300_-	hypothetical protein	NA	NA	NA	NA
WP_065486189.1\|66577_67216_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	2.7e-09	25.4
WP_065486191.1\|67205_67754_-	hypothetical protein	NA	NA	NA	NA
WP_065486193.1\|67767_68277_-	stage II sporulation protein M	NA	NA	NA	NA
WP_065486196.1\|68281_69988_-	hypothetical protein	NA	NA	NA	NA
WP_016106960.1\|70069_70393_-\|bacteriocin	circular bacteriocin, circularin A/uberolysin family	NA	NA	NA	NA
WP_094194658.1\|71097_72286_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	9.2e-35	36.7
WP_065486202.1\|72734_73421_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.6e-71	59.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP015356

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

9803 : 65012

Bacillus_phage(15.38%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_094194461.1\|9803_10593_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_065487013.1\|13481_14300_+	5'-nucleotidase, lipoprotein e(P4) family	NA	NA	NA	NA
WP_094194713.1\|15071_16784_+	ABC transporter ATP-binding protein	A0A1V0SJ29	Klosneuvirus	3.0e-18	25.6
WP_065487015.1\|16776_18561_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	9.5e-52	29.7
WP_065487017.1\|18827_19373_-	topology modulation protein	A0A097BYE2	Leuconostoc_phage	5.1e-33	42.1
WP_065487020.1\|19441_20764_-	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	2.9e-90	40.6
WP_094194704.1\|20885_21689_-	glutamate ligase	NA	NA	NA	NA
WP_094194705.1\|21678_22545_-	TIM barrel protein	NA	NA	NA	NA
WP_065487022.1\|22541_23408_-	shikimate dehydrogenase	NA	NA	NA	NA
WP_065487024.1\|23722_24748_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_065487026.1\|24731_25991_+	S-adenosylmethionine synthetase	NA	NA	NA	NA
WP_065487028.1\|26013_26967_+	hypothetical protein	NA	NA	NA	NA
WP_065487030.1\|26963_28037_+	glycosyltransferase	NA	NA	NA	NA
WP_065487032.1\|28071_29289_+	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_065487034.1\|29388_30570_+	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_001224536.1\|33977_34601_+	recombinase family protein	Q1MVP4	Enterobacteria_phage	9.8e-12	29.3
WP_065487036.1\|35226_35478_+	hypothetical protein	NA	NA	NA	NA
WP_065481872.1\|36273_37710_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_065487040.1\|38023_38185_+	DUF3797 domain-containing protein	A0A0H3UYX0	Geobacillus_virus	1.1e-15	62.3
WP_065487043.1\|38425_38932_+	zinc-finger domain-containing protein	A0A2H4JAV2	uncultured_Caudovirales_phage	1.7e-09	29.9
WP_065487045.1\|40082_40511_-	hypothetical protein	NA	NA	NA	NA
WP_065487048.1\|40747_41032_+	hypothetical protein	NA	NA	NA	NA
WP_094194706.1\|41464_41860_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_065487052.1\|42899_43268_-	hypothetical protein	NA	NA	NA	NA
WP_094194714.1\|43566_43872_-	hypothetical protein	NA	NA	NA	NA
WP_094194707.1\|43928_45097_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	6.2e-60	44.4
WP_094194709.1\|45506_46295_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_065487055.1\|46495_46768_-	hypothetical protein	NA	NA	NA	NA
WP_065487056.1\|46949_47576_-	hypothetical protein	NA	NA	NA	NA
WP_065487058.1\|47949_48267_-	hypothetical protein	NA	NA	NA	NA
WP_065487060.1\|48266_49043_-	ParA family protein	A0A1X9I765	Streptococcus_phage	5.4e-44	44.0
WP_065481853.1\|49448_50705_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	2.3e-113	60.8
WP_157686202.1\|50900_51071_-	hypothetical protein	NA	NA	NA	NA
WP_065487062.1\|51144_51351_-	hypothetical protein	NA	NA	NA	NA
WP_065487064.1\|51406_51781_-	hypothetical protein	NA	NA	NA	NA
WP_065487066.1\|51942_52233_-	hypothetical protein	NA	NA	NA	NA
WP_065487069.1\|53173_54613_+	PRD domain-containing protein	NA	NA	NA	NA
WP_065486618.1\|55244_56906_-	hypothetical protein	NA	NA	NA	NA
WP_065486616.1\|57387_58029_-	recombinase family protein	A0A1B0VBM1	Salmonella_phage	1.8e-13	32.7
WP_065486387.1\|58388_59036_+	VanZ family protein	NA	NA	NA	NA
WP_065487071.1\|59680_60943_+\|transposase	IS21 family transposase	A0A059NT83	Lactococcus_phage	8.2e-42	30.8
WP_065487073.1\|61038_62451_+\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_065487076.1\|62602_63355_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	2.7e-56	46.1
WP_065487078.1\|63599_65012_-\|transposase	IS66 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. NZ_CP015353

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

9224 : 56438

Bacillus_phage(54.55%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065486542.1\|9224_10637_-\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_023523644.1\|11222_12398_+	ParM/StbA family protein	NA	NA	NA	NA
WP_065486543.1\|12440_12854_+	hypothetical protein	NA	NA	NA	NA
WP_155251536.1\|13112_13259_-	hypothetical protein	NA	NA	NA	NA
WP_065486544.1\|13255_14356_-	tetratricopeptide repeat protein	A0A2H4J8G3	uncultured_Caudovirales_phage	5.1e-64	39.9
WP_065486546.1\|14912_15209_+	hypothetical protein	H0USY0	Bacillus_phage	1.6e-12	43.2
WP_000156991.1\|15210_15396_+	hypothetical protein	NA	NA	NA	NA
WP_065486548.1\|15497_16679_+	cell division protein FtsK	H0USY1	Bacillus_phage	3.2e-128	56.1
WP_043924922.1\|16617_17235_+	hypothetical protein	H0USY2	Bacillus_phage	2.1e-35	44.7
WP_016112081.1\|17252_17477_-	helix-turn-helix transcriptional regulator	A0A0S2MVM0	Bacillus_phage	7.8e-12	50.7
WP_065486550.1\|18338_18560_-	hypothetical protein	NA	NA	NA	NA
WP_157686183.1\|18757_18973_-	hypothetical protein	NA	NA	NA	NA
WP_065486552.1\|18956_19481_-	NADH dehydrogenase	NA	NA	NA	NA
WP_065486554.1\|19537_20752_-	PcfB family protein	NA	NA	NA	NA
WP_065486686.1\|20992_21724_+	hypothetical protein	NA	NA	NA	NA
WP_065486556.1\|21739_23056_+	relaxase/mobilization nuclease domain-containing protein	NA	NA	NA	NA
WP_065486558.1\|23232_23439_+	hypothetical protein	NA	NA	NA	NA
WP_065486560.1\|23467_23995_+	hypothetical protein	NA	NA	NA	NA
WP_065486562.1\|24264_25377_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_065486563.1\|26070_27024_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_065484856.1\|27227_27935_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	5.3e-38	42.9
WP_065486564.1\|27940_28540_-	hypothetical protein	NA	NA	NA	NA
WP_157686184.1\|30747_31293_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_065486567.1\|32018_32714_+	response regulator transcription factor	W8CYM9	Bacillus_phage	3.1e-35	38.1
WP_065486569.1\|32710_34495_+	HAMP domain-containing protein	W8CYF6	Bacillus_phage	2.1e-27	32.3
WP_065486571.1\|34678_35521_+	polysaccharide deacetylase	NA	NA	NA	NA
WP_065486572.1\|35613_36309_+	hypothetical protein	NA	NA	NA	NA
WP_065486574.1\|36716_37406_+	hypothetical protein	NA	NA	NA	NA
WP_065486576.1\|37486_38893_+	MBOAT family protein	A0A125RNP0	Pseudomonas_phage	2.8e-59	32.1
WP_065486577.1\|38945_40085_+	hypothetical protein	NA	NA	NA	NA
WP_065486579.1\|40245_40743_+	DUF4358 domain-containing protein	NA	NA	NA	NA
WP_065486580.1\|41647_42463_-	5'-nucleotidase, lipoprotein e(P4) family	NA	NA	NA	NA
WP_065486582.1\|43232_43718_-	hypothetical protein	NA	NA	NA	NA
WP_157686185.1\|43949_44123_-	hypothetical protein	NA	NA	NA	NA
WP_065486584.1\|44171_44933_-	membrane protein insertase YidC	NA	NA	NA	NA
WP_065486586.1\|44925_45243_-	hypothetical protein	NA	NA	NA	NA
WP_065486590.1\|46227_48072_-	ABC transporter permease	NA	NA	NA	NA
WP_065486592.1\|48088_48850_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.7e-32	38.2
WP_065486593.1\|49724_51386_-	hypothetical protein	NA	NA	NA	NA
WP_065486594.1\|51870_52530_-	recombinase family protein	M9Q1K0	Clostridium_phage	2.2e-22	37.2
WP_065486595.1\|52846_53059_+	hypothetical protein	NA	NA	NA	NA
WP_065486597.1\|53299_54394_+	hypothetical protein	NA	NA	NA	NA
WP_065486598.1\|54642_54978_+	hypothetical protein	NA	NA	NA	NA
WP_065486599.1\|55162_55450_+	hypothetical protein	NA	NA	NA	NA
WP_065486601.1\|55496_56438_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

6. NZ_CP015354

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

9994 : 85740

Bacillus_phage(35.0%)

integrase,transposase

attL 13639:13654|attR 82723:82738

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065486151.1\|9994_10681_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.4e-72	59.0
WP_065486148.1\|11459_12038_+	recombinase family protein	A0A219Y9V9	Aeromonas_phage	1.4e-28	39.7
WP_065486707.1\|12373_12562_-	DUF2187 family protein	NA	NA	NA	NA
WP_065486709.1\|12809_13127_+	hypothetical protein	A0A2H4JAV2	uncultured_Caudovirales_phage	7.4e-16	42.1
13639:13654	attL	NA	NA	NA	NA
WP_065486711.1\|13955_15467_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_065486849.1\|15466_16207_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	8.8e-36	37.5
WP_065486713.1\|16765_17209_+	hypothetical protein	NA	NA	NA	NA
WP_094194689.1\|17736_19335_-	hypothetical protein	NA	NA	NA	NA
WP_065486715.1\|19564_20623_+	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_157686194.1\|20664_21864_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_065486853.1\|22342_23470_+	peptidoglycan DD-metalloendopeptidase family protein	NA	NA	NA	NA
WP_000070738.1\|24971_25859_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_065486719.1\|26098_27535_+	DUF2252 family protein	NA	NA	NA	NA
WP_065486721.1\|28135_28894_-	ATP-binding protein	U5N3V8	Enterobacteria_phage	4.6e-56	46.2
WP_065486723.1\|28907_29300_-	hypothetical protein	NA	NA	NA	NA
WP_065486151.1\|29379_30066_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.4e-72	59.0
WP_065486854.1\|30222_30477_-	SET domain-containing protein	NA	NA	NA	NA
WP_065486725.1\|31670_32789_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_065486727.1\|33709_34282_+	hypothetical protein	NA	NA	NA	NA
WP_065486728.1\|38480_39404_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_065486730.1\|39843_40503_-	recombinase family protein	A0A1B0VBM1	Salmonella_phage	2.0e-15	33.5
WP_157686195.1\|42579_43758_+\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_065486732.1\|43892_46766_-	hypothetical protein	NA	NA	NA	NA
WP_065486734.1\|47222_47774_-	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	6.3e-39	48.3
WP_065486736.1\|47956_50929_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	4.4e-70	24.0
WP_065486741.1\|53255_53570_-	hypothetical protein	NA	NA	NA	NA
WP_065486744.1\|53751_54345_-	hypothetical protein	NA	NA	NA	NA
WP_065486747.1\|54358_55513_-	glycoside hydrolase	A0A1S5SEZ8	Streptococcus_phage	3.7e-49	36.0
WP_065486749.1\|55575_58020_-	Isocitrate dehydrogenase	NA	NA	NA	NA
WP_065486752.1\|58016_58529_-	hypothetical protein	NA	NA	NA	NA
WP_065486754.1\|58588_61171_-	recombinase RmuC	A0A1S5SF64	Streptococcus_phage	1.1e-85	28.1
WP_065486755.1\|61130_61679_-	hypothetical protein	NA	NA	NA	NA
WP_078176905.1\|61697_61946_-	hypothetical protein	NA	NA	NA	NA
WP_065486758.1\|61967_62939_-	conjugal transfer protein	NA	NA	NA	NA
WP_065486760.1\|62985_63360_-	hypothetical protein	NA	NA	NA	NA
WP_065486762.1\|63428_63662_-	hypothetical protein	NA	NA	NA	NA
WP_065486856.1\|63683_63905_-	hypothetical protein	NA	NA	NA	NA
WP_065486765.1\|63916_64123_-	hypothetical protein	NA	NA	NA	NA
WP_065486767.1\|64127_64967_-	hypothetical protein	NA	NA	NA	NA
WP_065486769.1\|64973_67811_-	hypothetical protein	NA	NA	NA	NA
WP_065486771.1\|67846_68059_-	hypothetical protein	NA	NA	NA	NA
WP_065486773.1\|68126_68357_-	hypothetical protein	NA	NA	NA	NA
WP_065486243.1\|69433_71254_-	hypothetical protein	A0A0U4J920	Pseudomonas_phage	2.3e-29	29.0
WP_065486777.1\|73390_73621_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_094194690.1\|73755_74157_+	helix-turn-helix transcriptional regulator	A0A1J0MG99	Staphylococcus_phage	4.6e-07	41.3
WP_157686192.1\|74406_74580_-	hypothetical protein	NA	NA	NA	NA
WP_065486778.1\|74582_75764_-	hypothetical protein	NA	NA	NA	NA
WP_065486779.1\|76218_77199_+	Replicase RepFR55	NA	NA	NA	NA
WP_065486781.1\|78324_79260_+\|integrase	site-specific integrase	A0A1B1P793	Bacillus_phage	6.3e-71	45.3
WP_065486859.1\|79471_79966_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_065486783.1\|80226_81285_+	ParM/StbA family protein	A0A1B1P8B7	Bacillus_phage	3.9e-45	34.0
WP_065486786.1\|81253_81631_+	hypothetical protein	NA	NA	NA	NA
WP_065486788.1\|81668_82139_-	DUF559 domain-containing protein	NA	NA	NA	NA
WP_065486790.1\|82650_82875_+	helix-turn-helix transcriptional regulator	A0A1B1P883	Bacillus_phage	3.2e-05	39.2
82723:82738	attR	NA	NA	NA	NA
WP_065486792.1\|82937_83156_-	hypothetical protein	NA	NA	NA	NA
WP_065486794.1\|83169_83826_-	hypothetical protein	A0A1B1P7T2	Bacillus_phage	2.8e-78	65.7
WP_065486796.1\|83809_84982_-	DNA translocase FtsK	W8CYG2	Bacillus_phage	2.8e-161	72.4
WP_065486797.1\|84988_85312_-	hypothetical protein	A0A1B1P7T1	Bacillus_phage	6.1e-34	70.1
WP_065486799.1\|85323_85740_-	hypothetical protein	A0A1B1P7T3	Bacillus_phage	2.5e-48	73.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

7. NZ_CP015352

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1924 : 68643

Streptococcus_phage(50.0%)

transposase,integrase

attL 26598:26621|attR 67502:67525

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065486309.1\|1924_2611_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.8e-67	56.4
WP_065486521.1\|3236_4451_-	peptidase S8	A0A1B0T6A2	Bacillus_phage	1.6e-90	48.2
WP_094194456.1\|6212_7256_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	7.1e-31	29.8
WP_065486314.1\|7492_8773_+	HBL/NHE enterotoxin family protein	NA	NA	NA	NA
WP_065486316.1\|8824_10021_+	HBL/NHE enterotoxin family protein	NA	NA	NA	NA
WP_065486317.1\|10726_10942_+	hypothetical protein	NA	NA	NA	NA
WP_065486319.1\|11387_11648_-	DNA-binding protein	NA	NA	NA	NA
WP_065486321.1\|11712_13134_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_065486322.1\|13350_13707_+\|transposase	transposase	NA	NA	NA	NA
WP_065486323.1\|13882_14539_+	hypothetical protein	NA	NA	NA	NA
WP_065486325.1\|14587_14869_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	8.3e-11	65.3
WP_065486522.1\|14934_15123_+	RNA chaperone Hfq	NA	NA	NA	NA
WP_065486327.1\|15150_15381_+	hypothetical protein	NA	NA	NA	NA
WP_065486329.1\|15410_15713_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_065486330.1\|15771_16080_+	50S ribosomal protein L7ae	NA	NA	NA	NA
WP_065486332.1\|16494_17448_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_065486333.1\|17811_18168_-	hypothetical protein	NA	NA	NA	NA
WP_065486334.1\|18315_18531_-	hypothetical protein	NA	NA	NA	NA
WP_065486338.1\|19580_20519_-	hypothetical protein	NA	NA	NA	NA
WP_065481872.1\|21024_22461_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_094194666.1\|24123_25419_+	exosporium leader peptide-containing protein	NA	NA	NA	NA
WP_065486341.1\|25564_26272_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.4e-38	43.4
26598:26621	attL	NA	NA	NA	NA
WP_065486342.1\|26725_27631_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_065486344.1\|28081_28705_+\|transposase	IS6 family transposase	A0A1X9I6E7	Streptococcus_phage	1.7e-35	46.1
WP_065486346.1\|28708_29395_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.4e-72	59.0
WP_065486348.1\|29665_30013_-	YxeA family protein	A0A0K2CYS5	Paenibacillus_phage	4.1e-12	38.7
WP_065486350.1\|30075_31929_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_065486351.1\|31945_32707_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.5e-33	38.3
WP_065486353.1\|33268_33793_+	hypothetical protein	NA	NA	NA	NA
WP_065486527.1\|34409_34619_+	hypothetical protein	NA	NA	NA	NA
WP_065486354.1\|34667_35630_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_065486355.1\|36600_37287_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.6e-71	58.6
WP_065486357.1\|37353_37815_-	DUF4158 domain-containing protein	NA	NA	NA	NA
WP_065486358.1\|38379_39066_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.8e-43	40.9
WP_065486360.1\|39062_40142_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	3.2e-18	26.6
WP_065486362.1\|40546_41308_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.9e-34	39.5
WP_065486363.1\|41324_43178_+	ABC transporter permease	NA	NA	NA	NA
WP_065486365.1\|43542_43752_+	hypothetical protein	NA	NA	NA	NA
WP_065486355.1\|43878_44565_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.6e-71	58.6
WP_065485328.1\|45006_46419_+\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_065486366.1\|47008_47704_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	9.8e-37	42.2
WP_094194667.1\|47911_49006_-	HBL/NHE enterotoxin family protein	NA	NA	NA	NA
WP_065486369.1\|49337_50465_-	HBL/NHE enterotoxin family protein	NA	NA	NA	NA
WP_065486371.1\|50523_51726_-	HBL/NHE enterotoxin family protein	NA	NA	NA	NA
WP_065486373.1\|52308_53661_-	HBL/NHE enterotoxin family protein	NA	NA	NA	NA
WP_065486375.1\|54015_54207_-	hypothetical protein	NA	NA	NA	NA
WP_094194669.1\|55157_55865_+\|transposase	transposase	NA	NA	NA	NA
WP_157686179.1\|55722_56433_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	9.3e-51	44.3
WP_065486380.1\|56582_57701_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_065486382.1\|58304_58991_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	7.8e-71	58.6
WP_065486384.1\|59095_60802_-	hypothetical protein	NA	NA	NA	NA
WP_065486387.1\|63698_64346_-	VanZ family protein	NA	NA	NA	NA
WP_065486389.1\|64821_65031_+	hypothetical protein	NA	NA	NA	NA
WP_065486390.1\|65063_66026_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_065486391.1\|66402_67344_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_065484856.1\|67935_68643_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	5.3e-38	42.9
67502:67525	attR	NA	NA	NA	NA

DBSCAN-SWA_2

83625 : 136243

Bacillus_phage(37.5%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065486413.1\|83625_83976_+\|transposase	transposase	NA	NA	NA	NA
WP_065486414.1\|84472_84637_-	aspartyl-phosphate phosphatase Spo0E family protein	NA	NA	NA	NA
WP_065486416.1\|84750_85032_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	4.8e-11	59.0
WP_065486418.1\|85055_85289_+	RNA chaperone Hfq	NA	NA	NA	NA
WP_065486420.1\|85345_85621_-	HU family DNA-binding protein	A7KV42	Bacillus_phage	1.9e-20	60.7
WP_065484856.1\|86108_86816_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	5.3e-38	42.9
WP_030030322.1\|87324_87795_-	hypothetical protein	NA	NA	NA	NA
WP_065486422.1\|87857_88688_-	ATP-binding protein	NA	NA	NA	NA
WP_065486424.1\|88733_89198_-	hypothetical protein	NA	NA	NA	NA
WP_065486425.1\|89384_89588_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_016112095.1\|89779_90274_+	helix-turn-helix transcriptional regulator	A0A1W6JPS3	Staphylococcus_phage	3.4e-07	41.3
WP_065486426.1\|90631_91861_+	hypothetical protein	NA	NA	NA	NA
WP_065486427.1\|92508_93009_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_065486431.1\|93612_94794_+	ParM/StbA family protein	NA	NA	NA	NA
WP_065486433.1\|94849_95293_+	hypothetical protein	NA	NA	NA	NA
WP_157686180.1\|95609_95756_-	hypothetical protein	NA	NA	NA	NA
WP_065486435.1\|95752_96847_-	tetratricopeptide repeat protein	A0A2H4J8G3	uncultured_Caudovirales_phage	2.9e-67	38.6
WP_065486437.1\|97313_97820_-	NADH dehydrogenase	NA	NA	NA	NA
WP_065486439.1\|97891_99094_-	DUF3801 domain-containing protein	NA	NA	NA	NA
WP_065486441.1\|99357_100068_+	hypothetical protein	NA	NA	NA	NA
WP_065486443.1\|100084_101407_+	relaxase/mobilization nuclease domain-containing protein	NA	NA	NA	NA
WP_016110577.1\|101493_101694_+	hypothetical protein	NA	NA	NA	NA
WP_061656495.1\|101830_102127_+	hypothetical protein	H0USY0	Bacillus_phage	4.9e-14	43.7
WP_065486445.1\|102128_102314_+	hypothetical protein	NA	NA	NA	NA
WP_065486447.1\|102415_103597_+	cell division protein FtsK	H0USY1	Bacillus_phage	1.3e-126	56.5
WP_065486449.1\|103535_104153_+	hypothetical protein	Q2LIA9	Bacillus_phage	6.9e-34	44.7
WP_065486450.1\|104157_104382_-	DNA-binding protein	A0A0S2MVM0	Bacillus_phage	2.7e-12	50.0
WP_065486452.1\|105224_105446_-	hypothetical protein	NA	NA	NA	NA
WP_157686181.1\|105681_105858_-	hypothetical protein	NA	NA	NA	NA
WP_065486129.1\|105900_106095_-	hypothetical protein	NA	NA	NA	NA
WP_065486454.1\|106084_106321_-	hypothetical protein	A0A1B1P789	Bacillus_phage	4.6e-07	35.4
WP_065486131.1\|106396_106624_-	hypothetical protein	NA	NA	NA	NA
WP_065486456.1\|107026_107356_+	hypothetical protein	NA	NA	NA	NA
WP_065486457.1\|107546_108089_-	hypothetical protein	NA	NA	NA	NA
WP_065486459.1\|108672_109710_-	hypothetical protein	J7Q326	Aeropyrum_coil-shaped_virus	1.1e-15	29.0
WP_065486461.1\|109723_109954_-	hypothetical protein	NA	NA	NA	NA
WP_065486463.1\|110183_111932_-	sulfate permease	A0A2H4J153	uncultured_Caudovirales_phage	1.6e-40	26.4
WP_065486465.1\|111959_112541_-	carbonic anhydrase	NA	NA	NA	NA
WP_094194675.1\|113113_113950_-	ribonuclease	A0A2P0VMP9	Tetraselmis_virus	1.0e-24	36.6
WP_065486467.1\|114311_115424_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_065486470.1\|116070_116580_-	spermidine N1-acetyltransferase	NA	NA	NA	NA
WP_065486472.1\|117402_119235_-	ABC transporter permease	NA	NA	NA	NA
WP_065486475.1\|119251_120013_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-34	39.3
WP_065486478.1\|120701_121367_+	hypothetical protein	NA	NA	NA	NA
WP_065486482.1\|122243_123059_-	5'-nucleotidase, lipoprotein e(P4) family	NA	NA	NA	NA
WP_065486485.1\|123709_124195_-	hypothetical protein	NA	NA	NA	NA
WP_065486531.1\|124723_125260_+	hypothetical protein	NA	NA	NA	NA
WP_065486488.1\|125432_125804_+	hypothetical protein	NA	NA	NA	NA
WP_065486490.1\|126124_126586_+	hypothetical protein	NA	NA	NA	NA
WP_065486493.1\|126662_127184_+	hypothetical protein	NA	NA	NA	NA
WP_065486495.1\|127289_128681_+	alkaline phosphatase	NA	NA	NA	NA
WP_065486499.1\|129445_130087_-	recombinase family protein	A0A1B0VBM1	Salmonella_phage	2.2e-14	33.7
WP_065486346.1\|130566_131253_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.4e-72	59.0
WP_065486501.1\|131415_132828_-\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_065486503.1\|132923_133718_-	hypothetical protein	NA	NA	NA	NA
WP_157686182.1\|133805_133961_-	hypothetical protein	NA	NA	NA	NA
WP_065486504.1\|134172_134541_-	hypothetical protein	NA	NA	NA	NA
WP_065486506.1\|134876_135089_-	hypothetical protein	NA	NA	NA	NA
WP_094194676.1\|135453_136243_-\|transposase	IS5 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

8. NZ_CP015355

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3747 : 79003

Streptococcus_phage(72.73%)

integrase,tRNA,transposase

attL 32259:32318|attR 80184:80865

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065484856.1\|3747_4455_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	5.3e-38	42.9
WP_065486867.1\|4914_5577_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	4.1e-69	58.6
WP_065486869.1\|5643_5931_+	hypothetical protein	NA	NA	NA	NA
WP_065486870.1\|5977_6883_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_065486872.1\|7179_7887_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-37	42.0
WP_065486874.1\|8119_8806_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	9.5e-77	63.4
WP_065486878.1\|10445_11675_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	1.5e-80	47.4
WP_065486880.1\|12040_13363_+	HBL/NHE enterotoxin family protein	NA	NA	NA	NA
WP_065486882.1\|13599_14808_+	HBL/NHE enterotoxin family protein	NA	NA	NA	NA
WP_065486884.1\|15047_16133_+	HBL/NHE enterotoxin family protein	NA	NA	NA	NA
WP_065486886.1\|17064_17346_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_065486888.1\|17482_18583_-	endospore germination permease	NA	NA	NA	NA
WP_065486890.1\|18617_19802_-	Ger(x)C family spore germination protein	NA	NA	NA	NA
WP_065486892.1\|19801_21340_-	spore germination protein	NA	NA	NA	NA
WP_065486874.1\|22083_22770_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	9.5e-77	63.4
WP_157686196.1\|22853_23876_-	hypothetical protein	NA	NA	NA	NA
WP_065486894.1\|23917_25096_-	hypothetical protein	NA	NA	NA	NA
WP_065486895.1\|25192_25522_+	hypothetical protein	NA	NA	NA	NA
WP_065486874.1\|26117_26804_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	9.5e-77	63.4
WP_065486896.1\|27201_27414_+	hypothetical protein	NA	NA	NA	NA
WP_065486898.1\|28148_28790_+	hypothetical protein	NA	NA	NA	NA
WP_065486874.1\|29429_30116_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	9.5e-77	63.4
WP_065486901.1\|30372_30921_-	hypothetical protein	NA	NA	NA	NA
WP_157686201.1\|31224_31923_-\|transposase	IS3 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	6.8e-22	35.7
32259:32318	attL	NA	NA	NA	NA
WP_065486905.1\|32322_33015_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.1e-72	65.4
WP_065486907.1\|33453_34002_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_065486909.1\|33958_34489_+	hypothetical protein	NA	NA	NA	NA
WP_065486913.1\|35897_36143_+	hypothetical protein	NA	NA	NA	NA
WP_065486915.1\|36504_37944_+	PRD domain-containing protein	NA	NA	NA	NA
WP_157686197.1\|38073_38331_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_065486874.1\|38396_39083_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	9.5e-77	63.4
WP_065486917.1\|39152_39617_-	hypothetical protein	NA	NA	NA	NA
WP_065486919.1\|40533_41220_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	3.6e-76	62.9
WP_065486920.1\|41619_42531_-	HBL/NHE enterotoxin family protein	NA	NA	NA	NA
WP_065486996.1\|42728_43868_-	alpha-helical pore-forming toxin family protein	NA	NA	NA	NA
WP_065486922.1\|44218_45442_-	alpha-helical pore-forming toxin family protein	NA	NA	NA	NA
WP_065486923.1\|45488_46796_-	HBL/NHE enterotoxin family protein	NA	NA	NA	NA
WP_065486925.1\|48404_49853_+	PRD domain-containing protein	NA	NA	NA	NA
WP_065486927.1\|51445_52132_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	9.5e-77	63.4
WP_065486929.1\|52555_53746_-	peptidase C1	A0A2L2DJ06	Acanthamoeba_polyphaga_mimivirus	4.0e-14	26.6
WP_065486931.1\|54949_55375_-	hypothetical protein	NA	NA	NA	NA
WP_065486933.1\|55376_56564_-	ParM/StbA family protein	NA	NA	NA	NA
WP_065486937.1\|59885_60440_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_065486874.1\|60837_61524_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	9.5e-77	63.4
WP_065486939.1\|61954_64582_+\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_157686198.1\|64604_65291_+	hypothetical protein	NA	NA	NA	NA
WP_065486943.1\|65954_67277_+	MFS transporter	NA	NA	NA	NA
WP_065486945.1\|67787_69227_+	NADP-dependent glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_065486947.1\|69488_70232_+	SDR family oxidoreductase	A0A2P0VP75	Tetraselmis_virus	4.1e-09	28.7
WP_065486874.1\|70491_71177_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	9.5e-77	63.4
WP_094194456.1\|72499_73543_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	7.1e-31	29.8
WP_065486954.1\|73668_73875_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_065486956.1\|73999_74635_+	helix-turn-helix transcriptional regulator	S5MCH5	Brevibacillus_phage	2.4e-13	32.3
WP_065486874.1\|74860_75548_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	9.5e-77	63.4
WP_065486958.1\|75613_76615_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_065486960.1\|77020_78205_+\|integrase	tyrosine-type recombinase/integrase	A0A142F1N9	Bacillus_phage	8.9e-06	23.7
WP_065486962.1\|78295_79003_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	4.0e-38	42.5
80184:80865	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

9. NZ_CP015360

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

8483 : 14309

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065487315.1\|8483_9803_-	replication protein	B5LPT8	Bacillus_virus	7.3e-134	63.0
WP_065487316.1\|10168_10699_+	DUF3967 domain-containing protein	NA	NA	NA	NA
WP_065487318.1\|10976_12008_+	ParM/StbA family protein	A0A1B1P8B7	Bacillus_phage	4.2e-169	84.0
WP_065487320.1\|11967_12294_+	peptidylprolyl isomerase	D2XQ05	Bacillus_virus	3.4e-32	64.8
WP_065487322.1\|12724_13756_-	N-acetylmuramoyl-L-alanine amidase	A0A0A7AQV3	Bacillus_phage	2.7e-147	72.6
WP_065487324.1\|13815_14025_-	hypothetical protein	A0A0S2GM50	Bacillus_phage	1.2e-19	69.4
WP_065487325.1\|14027_14309_-	hypothetical protein	D2XR31	Bacillus_phage	1.0e-32	78.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage