CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP015133	Klebsiella pneumoniae strain Kpn555 plasmid pKPN-d6b, complete sequence	0 crisprs	NA	0	0	1
NZ_CP015130	Klebsiella pneumoniae strain Kpn555 chromosome, complete genome	3 crisprs	DEDDh,DinG,csa3,cas3,WYL	2	13	8
NZ_CP015132	Klebsiella pneumoniae strain Kpn555 plasmid pKPN-d90, complete sequence	0 crisprs	RT,csa3	0	0	3
NZ_CP015131	Klebsiella pneumoniae strain Kpn555 plasmid pKPN-7c3, complete sequence	0 crisprs	RT	0	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1926 : 25776

Escherichia_phage(100.0%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004217321.1\|1926_2631_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.2e-138	99.6
WP_001620097.1\|3603_4692_-	AAA family ATPase	A0A077SLJ9	Escherichia_phage	8.0e-211	100.0
WP_001620096.1\|4778_5039_-	hypothetical protein	A0A077SK33	Escherichia_phage	1.9e-41	100.0
WP_001620095.1\|5336_6197_+	class A broad-spectrum beta-lactamase SHV-1	A0A077SL40	Escherichia_phage	4.4e-156	99.7
WP_002210513.1\|6217_6979_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.9e-134	100.0
WP_002210514.1\|7239_8142_+	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	5.3e-160	100.0
WP_002210515.1\|8153_9419_+	four-carbon acid sugar kinase family protein	A0A077SLJ7	Escherichia_phage	2.7e-234	100.0
WP_002210516.1\|9411_10032_+	aldolase	A0A077SK32	Escherichia_phage	8.0e-115	100.0
WP_004217321.1\|10743_11448_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.2e-138	99.6
WP_001620097.1\|12420_13509_-	AAA family ATPase	A0A077SLJ9	Escherichia_phage	8.0e-211	100.0
WP_001620096.1\|13595_13856_-	hypothetical protein	A0A077SK33	Escherichia_phage	1.9e-41	100.0
WP_001620095.1\|14153_15014_+	class A broad-spectrum beta-lactamase SHV-1	A0A077SL40	Escherichia_phage	4.4e-156	99.7
WP_002210513.1\|15034_15796_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.9e-134	100.0
WP_002210514.1\|16056_16959_+	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	5.3e-160	100.0
WP_002210515.1\|16970_18236_+	four-carbon acid sugar kinase family protein	A0A077SLJ7	Escherichia_phage	2.7e-234	100.0
WP_002210516.1\|18228_18849_+	aldolase	A0A077SK32	Escherichia_phage	8.0e-115	100.0
WP_004217321.1\|19560_20265_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.2e-138	99.6
WP_001620097.1\|21237_22326_-	AAA family ATPase	A0A077SLJ9	Escherichia_phage	8.0e-211	100.0
WP_001620096.1\|22412_22673_-	hypothetical protein	A0A077SK33	Escherichia_phage	1.9e-41	100.0
WP_001620095.1\|22970_23831_+	class A broad-spectrum beta-lactamase SHV-1	A0A077SL40	Escherichia_phage	4.4e-156	99.7
WP_002210513.1\|23851_24613_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.9e-134	100.0
WP_002210514.1\|24873_25776_+	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	5.3e-160	100.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP015130

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP015130_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015130_1

4297723-4297862

Orphan

Consensus_repeat	Method
CGCCAGCCGCCACCCGGCATAAAGCGGCTCCGTGCCCGGCGGCGCTGCGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015130_1

>merge|NZ_CP015130|1|4297723-4297862|CRISPRCasFinder
CGCCAGCCGCCACCCGGCATAAAGCGGCTCCGTGCCCGGCGGCGCTGCGCTTGCCGGGGCTGCTGCTTCGGTTTTGTAGGCCGGGTAAGACGCCAGCCGCCACCCTGCATAAAGCGGCTCCGTGCCCGGCGGCGCTGCGC

>NZ_CP015130|1|1|4297723-4297862|CRISPRCasFinder
CGCCAGCCGCCACCCGGCATAAAGCGGCTCCGTGCCCGGCGGCGCTGCGC	TTGCCGGGGCTGCTGCTTCGGTTTTGTAGGCCGGGTAAGA
CGCCAGCCGCCACCCTGCATAAAGCGGCTCCGTGCCCGGCGGCGCTGCGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015130.1\|WP_004177335.1\|4295613_4296210_+\|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-E	unknown	unknown	gnl\|CDD\|235074
NZ_CP015130.1\|WP_002889733.1\|4302264_4302723_+\|xanthine-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|236395
NZ_CP015130.1\|WP_002889699.1\|4290451_4291192_-\|murein-L,D-transpeptidase	unknown	unknown	gnl\|CDD\|225577
NZ_CP015130.1\|WP_002889720.1\|4296222_4297446_+\|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-F	unknown	unknown	gnl\|CDD\|235481
NZ_CP015130.1\|WP_004145825.1\|4289057_4289639_+\|D-sedoheptulose-7-phosphate-isomerase	unknown	unknown	gnl\|CDD\|179012
NZ_CP015130.1\|WP_002889726.1\|4298996_4300052_+\|DNA-polymerase-IV	unknown	unknown	gnl\|CDD\|235035
NZ_CP015130.1\|WP_004215795.1\|4305267_4305684_-\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|176863
NZ_CP015130.1\|WP_002889742.1\|4302828_4304073_+\|esterase-FrsA	unknown	unknown	gnl\|CDD\|235337
NZ_CP015130.1\|WP_004147186.1\|4292950_4294189_+\|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-B	unknown	unknown	gnl\|CDD\|235425
NZ_CP015130.1\|WP_004178678.1\|4297448_4297664_+\|(Na+)-NQR-maturation-NqrM	unknown	unknown	gnl\|CDD\|225538
NZ_CP015130.1\|WP_002889702.1\|4291603_4292947_+\|Na(+)-translocating-NADH-quinone-reductase-subunit-A	unknown	unknown	gnl\|CDD\|235426
NZ_CP015130.1\|WP_004191877.1\|4294181_4294976_+\|Na(+)-translocating-NADH-quinone-reductase-subunit-C	unknown	unknown	gnl\|CDD\|235423
NZ_CP015130.1\|WP_002889696.1\|4289713_4290481_+\|class-II-glutamine-amidotransferase	unknown	unknown	gnl\|CDD\|372525
NZ_CP015130.1\|WP_023325095.1\|4305716_4306514_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187602
NZ_CP015130.1\|WP_032420366.1\|4304897_4305110_-\|DUF1471-domain-containing-protein	unknown	unknown	gnl\|CDD\|369322
NZ_CP015130.1\|WP_002889716.1\|4294968_4295607_+\|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-D	unknown	unknown	gnl\|CDD\|236457
NZ_CP015130.1\|WP_002889727.1\|4300054_4300507_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|182099
NZ_CP015130.1\|WP_064840026.1\|4297976_4298837_-\|glycerophosphodiester-phosphodiesterase	unknown	unknown	gnl\|CDD\|176522
NZ_CP015130.1\|WP_004152033.1\|4300549_4302007_-\|cytosol-nonspecific-dipeptidase	unknown	unknown	gnl\|CDD\|184986
NZ_CP015130.1\|WP_002889793.1\|4304130_4304529_+\|sigma-factor-binding-protein-Crl	unknown	unknown	gnl\|CDD\|182882

Protein	Function_ID	Function_description	E-value
NZ_CP015130.1\|WP_004177335.1\|4295613_4296210_+\|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-E	gnl\|CDD\|235074	PRK02830, PRK02830, Na(+)-translocating NADH-quinone reductase subunit E; Provisional.	4.25239e-127
NZ_CP015130.1\|WP_002889733.1\|4302264_4302723_+\|xanthine-phosphoribosyltransferase	gnl\|CDD\|236395	PRK09177, PRK09177, xanthine-guanine phosphoribosyltransferase; Validated.	2.19173e-113
NZ_CP015130.1\|WP_002889699.1\|4290451_4291192_-\|murein-L,D-transpeptidase	gnl\|CDD\|225577	COG3034, COG3034, Uncharacterized protein conserved in bacteria [Function unknown].	1.01465e-109
NZ_CP015130.1\|WP_002889720.1\|4296222_4297446_+\|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-F	gnl\|CDD\|235481	PRK05464, PRK05464, Na(+)-translocating NADH-quinone reductase subunit F; Provisional.	0
NZ_CP015130.1\|WP_004145825.1\|4289057_4289639_+\|D-sedoheptulose-7-phosphate-isomerase	gnl\|CDD\|179012	PRK00414, gmhA, D-sedoheptulose 7-phosphate isomerase.	2.35176e-148
NZ_CP015130.1\|WP_002889726.1\|4298996_4300052_+\|DNA-polymerase-IV	gnl\|CDD\|235035	PRK02406, PRK02406, DNA polymerase IV; Validated.	0
NZ_CP015130.1\|WP_004215795.1\|4305267_4305684_-\|SRPBCC-family-protein	gnl\|CDD\|176863	cd07821, PYR_PYL_RCAR_like, Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins. The PYR/PYL/RCAR-like family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. PYR/PYL/RCAR plant proteins are receptors involved in signal transduction. They bind abscisic acid (ABA) and mediate its signaling. ABA is a vital plant hormone, which regulates plant growth, development, and response to environmental stresses. Upon binding ABA, these plant proteins interact with a type 2C protein phosphatase (PP2C), such as ABI1 and ABI2, and inhibit their activity. When ABA is bound, a loop (designated the gate/CL2 loop) closes over the ligand binding pocket, resulting in the weakening of the inactive PYL dimer and facilitating type 2C protein phosphatase binding. In the ABA:PYL1:ABI1 complex, the gate blocks substrate access to the phosphatase active site. A conserved Trp from PP2C inserts into PYL to lock the receptor in a closed formation. This group also contains Methylobacterium extorquens AM1 MxaD. The mxaD gene is located within the mxaFJGIR(S)ACKLDEHB cluster which encodes proteins involved in methanol oxidation. MxaD may participate in the periplasmic electron transport chain for oxidation of methanol. Mutants lacking MxaD exhibit a reduced growth on methanol, and a lower rate of respiration with methanol.	1.22655e-44
NZ_CP015130.1\|WP_002889742.1\|4302828_4304073_+\|esterase-FrsA	gnl\|CDD\|235337	PRK05077, frsA, esterase FrsA.	0
NZ_CP015130.1\|WP_004147186.1\|4292950_4294189_+\|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-B	gnl\|CDD\|235425	PRK05349, PRK05349, Na(+)-translocating NADH-quinone reductase subunit B; Provisional.	0
NZ_CP015130.1\|WP_004178678.1\|4297448_4297664_+\|(Na+)-NQR-maturation-NqrM	gnl\|CDD\|225538	COG2991, COG2991, Uncharacterized protein conserved in bacteria [Function unknown].	4.00668e-29
NZ_CP015130.1\|WP_002889702.1\|4291603_4292947_+\|Na(+)-translocating-NADH-quinone-reductase-subunit-A	gnl\|CDD\|235426	PRK05352, PRK05352, Na(+)-translocating NADH-quinone reductase subunit A; Provisional.	0
NZ_CP015130.1\|WP_004191877.1\|4294181_4294976_+\|Na(+)-translocating-NADH-quinone-reductase-subunit-C	gnl\|CDD\|235423	PRK05346, PRK05346, Na(+)-translocating NADH-quinone reductase subunit C; Provisional.	1.16359e-153
NZ_CP015130.1\|WP_002889696.1\|4289713_4290481_+\|class-II-glutamine-amidotransferase	gnl\|CDD\|372525	pfam13230, GATase_4, Glutamine amidotransferases class-II. This family captures members that are not found in pfam00310.	1.08772e-144
NZ_CP015130.1\|WP_023325095.1\|4305716_4306514_-\|SDR-family-oxidoreductase	gnl\|CDD\|187602	cd05344, BKR_like_SDR_like, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR)-like, SDR. This subgroup resembles the SDR family, but does not have a perfect match to the NAD-binding motif or the catalytic tetrad characteristic of the SDRs. It includes the SDRs, Q9HYA2 from Pseudomonas aeruginosa PAO1 and APE0912 from Aeropyrum pernix K1. BKR catalyzes the NADPH-dependent reduction of ACP in the first reductive step of de novo fatty acid synthesis (FAS). FAS consists of four elongation steps, which are repeated to extend the fatty acid chain through the addition of two-carbo units from malonyl acyl-carrier protein (ACP): condensation, reduction, dehydration, and a final reduction. Type II FAS, typical of plants and many bacteria, maintains these activities on discrete polypeptides, while type I FAS utilizes one or two multifunctional polypeptides. BKR resembles enoyl reductase, which catalyzes the second reduction step in FAS. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs.	1.29477e-50
NZ_CP015130.1\|WP_032420366.1\|4304897_4305110_-\|DUF1471-domain-containing-protein	gnl\|CDD\|369322	pfam07338, DUF1471, Protein of unknown function (DUF1471). This family consists of several hypothetical Enterobacterial proteins of around 90 residues in length. Some members of this family are annotated as ydgH precursors and contain two copies of this region, one at the N-terminus and the other at the C-terminus. The function of this family is unknown.	5.26043e-05
NZ_CP015130.1\|WP_002889716.1\|4294968_4295607_+\|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-D	gnl\|CDD\|236457	PRK09292, PRK09292, Na(+)-translocating NADH-quinone reductase subunit D; Validated.	1.0782e-142
NZ_CP015130.1\|WP_002889727.1\|4300054_4300507_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|182099	PRK09831, PRK09831, GNAT family N-acetyltransferase.	3.92264e-85
NZ_CP015130.1\|WP_064840026.1\|4297976_4298837_-\|glycerophosphodiester-phosphodiesterase	gnl\|CDD\|176522	cd08580, GDPD_Rv2277c_like, Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial protein Rv2277c and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in uncharacterized bacterial protein Rv2277c and similar proteins. Members in this subfamily are bacterial homologous of mammalian GDE4, a transmembrane protein whose cellular function has not yet been elucidated.	5.74056e-129
NZ_CP015130.1\|WP_004152033.1\|4300549_4302007_-\|cytosol-nonspecific-dipeptidase	gnl\|CDD\|184986	PRK15026, PRK15026, aminoacyl-histidine dipeptidase; Provisional.	0
NZ_CP015130.1\|WP_002889793.1\|4304130_4304529_+\|sigma-factor-binding-protein-Crl	gnl\|CDD\|182882	PRK10984, PRK10984, sigma factor-binding protein Crl.	2.69204e-83

>NZ_CP015130.1|WP_004178678.1|4297448_4297664_+|(Na+)-NQR-maturation-NqrM
MLTVFIATFVIFALVIFGMSLGYLVKRKSIQGSCGGISALGLEKVCDCPEPCDARKKRLAREAQRQQRRIL
>NZ_CP015130.1|WP_002889720.1|4296222_4297446_+|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-F
MEIILGVVMFTLIVLVLSGLILAARSKLVNAGDVVIEINNEADKQIRTPAGDKLLNTLSSNGIFVSSACGGGGSCGQCRVTVKEGGGDILPTELSHITKRDAKAGCRLACQVAVKQNMKIELPEEIFGVKKWECEVISNDNKATFIKELKLRIPEGEVVPFRAGGYIQIECPPHKVAYADFDVPDEYRSDWDKFNLFRYVSEVKEPTLRAYSMANYPEEKGIIMLNVRIATPPPKVPDAPPGIMSSYIWSLKPGDKVTISGPFGEFFAKETDAEMVFIGGGAGMAPMRSHIFDQLKRLHSTRKISFWYGARSLREMFYDEEFEQLARDNPNFTFHVALSDPLPEDNWTGHTGFIHNVLYENYLRDHPAPEDCEFYMCGPPVMNAAVIKMLKDLGVEDENILLDDFGG
>NZ_CP015130.1|WP_004177335.1|4295613_4296210_+|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-E
MAHYISLFVRAVFVENMALAFFLGMCTFLAVSKKVSTAFGLGVAVTVVLGLAVPINNLVYNLVLRDGALVEGVDLSFLNFITFIGVIAALVQILEMILDKYFPALYNALGIFLPLIAVNCAIFGGVSFMVQRDYNFPESIVYGFGSGIGWMLAIVAMAGIREKMKYANVPAGLRGLGITFITTGLMALGFMSFSGVQL
>NZ_CP015130.1|WP_002889716.1|4294968_4295607_+|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-D
MAEQSDMKEVKRVLVGPLIANNPIALQVLGVCSALAVTTKLETAFVMTIAVTLVTAFSSMFISMIRHHIPNSVRIIVQMAIIASLVIVVDQLLRAFAYETSKQLSVFVGLIITNCIVMGRAEAYAMKSPPLASFMDGIGNGLGYGAILIIVGFLRELIGSGKLFGITVLETVQNGGWYQPNGLFLLAPSAFFIIGLLIWALRSWKPEQQEKE
>NZ_CP015130.1|WP_004191877.1|4294181_4294976_+|Na(+)-translocating-NADH-quinone-reductase-subunit-C
MAEKKSNDSIGKTLLVVLVLCLVCSIVVAGSAVGLKSRQQAQRALDKQRNILAVSGLMHPDMDADAVADTFAARITPRLVNLATGELLEKDPGKFNQAQALKDPQQSMALDASQDPAGIKRRSNLAEIYLVRDAQQKIEQVVLPIYGNGLWSMMYAFVALDVDGRTVKGITYYDQGETPGLGGEVENPNWRQQFVGKQVLDDNGMPALKVVKGGARAGDLHAVDGLSGATLTSNGVQHSFDFWMGELGFGPFLKKVREGELNNG
>NZ_CP015130.1|WP_004147186.1|4292950_4294189_+|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-B
MGLKHLIEKLEPHFTHGGKLEKYYPLYEAAATIFYTPGQVTRGAAHVRDAIDLKRMMILVWFAVFPAMFWGMYNVGLQTIPALHKLYGAEQLQQAIANNWHYSVAQWLGVSFSADAGWLSMMTLGAVFFLPIYITVFIVGGFWEVLFAIVRKHEINEGFFVTSILFALIVPPTLPLWQAALGISFGVVIAKEIFGGTGRNFLNPALAGRAFLFFAYPAQISGDLVWTAADGFSGATPLSQWASGGGEALVNVATGVPVSWMDAFLGNIPGSIGEVSTLMIFIGGAIILFGRVASWRIVAGVMIGMIATATLFNVIGSDTNPMFAMPWYWHLVLGGFAFGMMFMATDPVSASFTDKGKWSYGVLIGVMCVLIRVVNPAYPEGMMLAILFANLFAPLFDYLVVQANIKRRKSRG
>NZ_CP015130.1|WP_002889702.1|4291603_4292947_+|Na(+)-translocating-NADH-quinone-reductase-subunit-A
MIKITKGLDLPIAGMPLQQISPAPAVKRVALLGEEYVGMRPAMAVKEGDRVKKGQILFEDKKIPGVCFTAPASGIVSAIHRGERRVLQSVVIDIEGNDAVAFTRYAADALAELPRDTVQQQLLASGQWTALRTRPFSKTPLPGSTPAAIFVNAMDTNPLAAEPQPIILAERAAFDAGLTVLTRLTDGKVHVCQPSGGKLGGHPLGQVCFNQFSGPHPAGLPGTHIHFLEPVSLNKQVWHLNYQDAIAIGKLFLDGELYCERIIALGGPQVTSPRLVKTTLGASLEDLLAGELQEGENRVISGSVLSGARAHGPHAFLGRFHLQVSVVKEGREKELFGWVMPGKEKFSITRTTLGHFFKRKRFHFSTDTNGGERAMVPIGNYERVMPLDILPTILLRDLLAGDTDSAQALGCLELDEEDLALCTYVCPGKYEYGPALRSVLTRIEQEG
>NZ_CP015130.1|WP_002889699.1|4290451_4291192_-|murein-L,D-transpeptidase
MRKIALFIAMLLLPCVSFAGLLSSNSPTTPVSKEYKQQLMGSPVYIEIFKEERMLDLYVKMGETYQLLDSYRICNYSGGLGPKQRQGDFKSPEGFYNVTRSQLKPDSRFYKAINIGFPNAYDRAHGYEGKYLMIHGDCVSVGCYAMTDSGIDEIFQFVTGALVFGQPSVQVSIYPFRMTNANMERHKYSYYADFWKQLKPGYDYFQQTHKPPVVSVTDGRYVVSKPLSHEVVQPQLASNYTLPETK
>NZ_CP015130.1|WP_002889696.1|4289713_4290481_+|class-II-glutamine-amidotransferase
MCELLGMSANVPTDICFSFTGLVQRGGGTGPHKDGWGITFYEGKGCRTFKDPQPSFQSPIAKLVQDYPIKSCSVVAHIRQANRGRVALENTHPFTRELWGRNWTYAHNGQLKGYKSLKTGNFHPVGETDSEKAFCWLLHRLTERYPRTPGNMLGVFKYIATLAGELREKGVFNMLLSDGRYVMAFCSTNLHWITRRAPFGVAKLLDQDVEIDFQRETTPNDVVTVIATQPLTANETWHKIMPGEWALFCLGERVV
>NZ_CP015130.1|WP_004145825.1|4289057_4289639_+|D-sedoheptulose-7-phosphate-isomerase
MYQDLIRNELNEAAETLANFLQDEANIHAIQRAAVLLADSFKAGGKVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPAIAISDVSHLSCVSNDFGYEYVFSRYVESVGRAGDVLLGISTSGNSGNVIKAIEAARAQGMKVITLTGKDGGKMAGSADVEIRVPHFGYADRIQEIHIKVIHILIMLIEKEMAKG
>NZ_CP015130.1|WP_064840026.1|4297976_4298837_-|glycerophosphodiester-phosphodiesterase
MKKILTALCLLATAGAWAAPQLIAHRGGTGDAPENTLPAIKLALENNAEAIWVTVQLSRDGVPVLYRSSDLSALTNSEGKVSSLTAAELAKVDAGWKWGDDSHPWRGKQATIPTLQSVLQQWPHTFFYIDIKSPDADPTVMGQRLLEVLKTTDSLDRVRVYSTEDRYIAALPPAIPRFVTRSETRTRLANISLSHQCQPASQRDGEQWYGLELKRKVEVVEKFTLGEGISPATLTWDKEAMDCFRSQDKAHIIFFGINSAEDYRTAKELGADGMMVDSPAQAKSWQ
>NZ_CP015130.1|WP_002889726.1|4298996_4300052_+|DNA-polymerase-IV
MRKIIHVDMDCFFAAVEMRDNPALRDIPLAIGGSRVQRGVISTANYPARKFGVRSAMPTATALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVSDSEHCHGSATLIAQEIRQTIERELRLTASAGVAPVKFLAKIASDMNKPNGQFVIAPHQVAEFVRALPLAKIPGVGKVSAAKLENMGLRTCGDVQNSDLAMLLKRFGKFGRILWERSHGIDEREIHNDRQRKSVGVERTLAEDIHEWPECEAIIENLYPELERRLAKVKPDLLIARQGIKLKFNDFQLTTQEHVWPRLNKEDLIATAHKAWDERRGGRGVRLVGLHVTLLDPQLERQLLLGI
>NZ_CP015130.1|WP_002889727.1|4300054_4300507_+|GNAT-family-N-acetyltransferase
MHIRAYRDSDLPLLCQIFLRAVRETASRDYTPGQIAAWAQVDETRWRQKLADSIGLVAVVNSQPVGFITAIGTHIDLLFVSPDRARQGIGGALIEALCVQYPAQILTVDASITAKPCFTAHGFKVVAEQRVAARGEWFINYRMEKRVALR
>NZ_CP015130.1|WP_004152033.1|4300549_4302007_-|cytosol-nonspecific-dipeptidase
MSELSQLSPQPLWDIFAKICSIPHPSYHEEQLAEHIMGWAKEKGLHAERDQVGNILIRKGATAGMENRKPVALQAHLDMVPQKNNDTVHDFVKDPIQPYIDGEWVKARGTTLGADNGIGMASALAVLADDSVAHGPLEVLLTMTEEAGMDGAFGLQANWLQADILINTDSEEEGEIYMGCAGGIDFTSNLALTREAIPAGFQSFKVTLKGLKGGHSGGDIHLGLGNANKLLSRFLAGHADELDLRLVDFNGGTLRNAIPREAYATVAVAADKADALKALVNTYQALLKNELEAKEKNLVVLVEAVDNDKAALTQASRDTFIRLLNATPNGVIRNSDVAKGVVETSLNVGVVTMTDDNVQIHCLIRSLIDSGKDYVVSMLDSLGKLAGAKTEAKGAYPGWQPDANSPVMHLVRETYQRLFNKTPNIQIIHAGLECGLFKKPYPEMDMVSIGPTITGPHSPDEQVHIESVGQYWTLLTELLKAIPAK
>NZ_CP015130.1|WP_002889733.1|4302264_4302723_+|xanthine-phosphoribosyltransferase
MSEKYVVTWDMLQIHARKLASRLLPVEQWKGIIAVSRGGLVPGALLARELGIRHVDTVCISSYDHDNQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPIAGR
>NZ_CP015130.1|WP_002889742.1|4302828_4304073_+|esterase-FrsA
MSQANLSETLFKPRFKHPETSTLVRRFSAGKPQAMQSALSGNHVDHWYRLINRLMWIWRGVTPQEILDVQARIVMSEAERTDPELFDTVIGYRGGNWIFEWAKEAMQWQQKAGQEADPLLSGRHWLHASNLYSIAAYPHIKGDELAEQAQALANRAYEEAAQRLPGSLRELEFTIPGGSPITGFLHMPKGEGPFPTVLMCGGLDSLQTDYYNLYENYFSPLGIAMLTIDMPSIGFSSKWTLNQDTSLLHQHALRHLENVPWIDHTRVAAFGFRFGANIAVRLGYLEPQRLKAVACLGPVVHGLLVDPLHQGRVPEMYLDVLASRLGMHDASDEALRVELNRYSLKTQGLLGRRCPTPMLSGFWKDDPFSPEEESRLITSSSADGKLLEIPFNPVYRNFDHALRQIARWINHRFG
>NZ_CP015130.1|WP_002889793.1|4304130_4304529_+|sigma-factor-binding-protein-Crl
MTLPSGHLKSKLIKKFTALGPYIREEQCHDNRFFFDCLAVCVNVKPAPEKREFWGWWMEMEAQESRFTYSYQFGLFNKEGSWQAVDIDDPEVSDRLEKTLREFHERAAALLTTFNLKLEPADDFSEPVRLRA
>NZ_CP015130.1|WP_032420366.1|4304897_4305110_-|DUF1471-domain-containing-protein
MKTVSTIFSAAALSLFAFTASAHSVTATSNTLDSAEAMIAKKAKELNATDYKITSAHMGNKVTMSAVLDK
>NZ_CP015130.1|WP_004215795.1|4305267_4305684_-|SRPBCC-family-protein
MATTTVSIEIPASVDQVWQLMGGFDSLPDWLPFIPKSMVSEGGRVRTLTTSDGGTVIERLEAFDNRQRSYSYSIIQAPFPVVDYLSTIAVVATADSNITRVEWSGSFTPVNVSDADAEALFSGIYRDGLQALKNNFSA
>NZ_CP015130.1|WP_023325095.1|4305716_4306514_-|SDR-family-oxidoreductase
MKLDLTHKVAVVSGSTSGIGLGIAKGLAWAGATVVIVGRQQRGVDTAIAAINAEHPDAQLRGVVADLSTEEGVSALLAAEPHADVVVNNLGIFNDKDFFSVPDSEWMHFYNVNVLSGVRLSRHYAQGMIDNGWGRIIFVSSESGVAIPADMINYGVTKSANLAVSHGLAKRLAGTGVTVNAILPGPTFTEGLQEMLAEAATQSGRSPREQADEFVKTARPSSIIQRAADVDEVANLAVYLASPLSSATTGAALRVDGGVVDTLAM

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP015130_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015130_2

4903566-4903643

Orphan

Consensus_repeat	Method
AAGGCGTCAGCCGCCACCCGGCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015130_2

>merge|NZ_CP015130|2|4903566-4903643|CRISPRCasFinder
AAGGCGTCAGCCGCCACCCGGCAAAATAACCGCGCAATAGCACCGTAGGCCGGGCAAGGCGTCAGCCGCCGCCCGGCA

>NZ_CP015130|2|2|4903566-4903643|CRISPRCasFinder
AAGGCGTCAGCCGCCACCCGGCA	AAATAACCGCGCAATAGCACCGTAGGCCGGGC
AAGGCGTCAGCCGCCGCCCGGCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015130.1\|WP_004147680.1\|4913138_4914236_-\|two-component-system-sensor-histidine-kinase-PmrB	unknown	unknown	gnl\|CDD\|236751
NZ_CP015130.1\|WP_002895580.1\|4905845_4906886_+\|biotin-synthase-BioB	unknown	unknown	gnl\|CDD\|185063
NZ_CP015130.1\|WP_002895575.1\|4903795_4904272_-\|kinase-inhibitor	unknown	unknown	gnl\|CDD\|182339
NZ_CP015130.1\|WP_004147662.1\|4888621_4889707_-\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|273776
NZ_CP015130.1\|WP_004179084.1\|4890723_4893411_+\|cation-transporting-P-type-ATPase	unknown	unknown	gnl\|CDD\|319775
NZ_CP015130.1\|WP_064840185.1\|4896438_4897395_+\|formimidoylglutamase	unknown	unknown	gnl\|CDD\|234974
NZ_CP015130.1\|WP_002895652.1\|4910244_4910457_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015130.1\|WP_004152853.1\|4909435_4910158_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223487
NZ_CP015130.1\|WP_004183465.1\|4890240_4890672_+\|universal-stress-protein	unknown	unknown	gnl\|CDD\|185353
NZ_CP015130.1\|WP_004147671.1\|4900009_4901536_+\|histidine-ammonia-lyase	unknown	unknown	gnl\|CDD\|236484
NZ_CP015130.1\|WP_014342949.1\|4899074_4900013_+\|urocanate-hydratase	unknown	unknown	gnl\|CDD\|235448
NZ_CP015130.1\|WP_002895648.1\|4908771_4909494_+\|ATP-dependent-dethiobiotin-synthetase-BioD	unknown	unknown	gnl\|CDD\|234625
NZ_CP015130.1\|WP_023341213.1\|4897456_4898182_+\|histidine-utilization-repressor	unknown	unknown	gnl\|CDD\|184961
NZ_CP015130.1\|WP_064840303.1\|4904342_4905632_-\|adenosylmethionine--8-amino-7-oxononanoate-transaminase	unknown	unknown	gnl\|CDD\|181189
NZ_CP015130.1\|WP_004147672.1\|4901634_4903017_+\|amino-acid-permease	unknown	unknown	gnl\|CDD\|182566
NZ_CP015130.1\|WP_004893301.1\|4908023_4908779_+\|malonyl-ACP-O-methyltransferase-BioC	unknown	unknown	gnl\|CDD\|182340
NZ_CP015130.1\|WP_002895655.1\|4910868_4912890_+\|excinuclease-ABC-subunit-B	unknown	unknown	gnl\|CDD\|235395
NZ_CP015130.1\|WP_183366022.1\|4895122_4896442_+\|imidazolonepropionase	unknown	unknown	gnl\|CDD\|236478
NZ_CP015130.1\|WP_064840184.1\|4893684_4894968_-\|putative-acyl-CoA-thioester-hydrolase	unknown	unknown	gnl\|CDD\|236709
NZ_CP015130.1\|WP_004183475.1\|4906882_4908040_+\|8-amino-7-oxononanoate-synthase	unknown	unknown	gnl\|CDD\|235655

Protein	Function_ID	Function_description	E-value
NZ_CP015130.1\|WP_004147680.1\|4913138_4914236_-\|two-component-system-sensor-histidine-kinase-PmrB	gnl\|CDD\|236751	PRK10755, PRK10755, two-component system sensor histidine kinase PmrB.	0
NZ_CP015130.1\|WP_002895580.1\|4905845_4906886_+\|biotin-synthase-BioB	gnl\|CDD\|185063	PRK15108, PRK15108, biotin synthase; Provisional.	0
NZ_CP015130.1\|WP_002895575.1\|4903795_4904272_-\|kinase-inhibitor	gnl\|CDD\|182339	PRK10257, PRK10257, putative kinase inhibitor protein; Provisional.	7.58373e-117
NZ_CP015130.1\|WP_004147662.1\|4888621_4889707_-\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|273776	TIGR01730, COG0845:_Membrane-fusion_protein, RND family efflux transporter, MFP subunit. This model represents the MFP (membrane fusion protein) component of the RND family of transporters. RND refers to Resistance, Nodulation, and cell Division. It is, in part, a subfamily of pfam00529 (Pfam release 7.5) but hits substantial numbers of proteins missed by that model. The related HlyD secretion protein, for which pfam00529 is named, is outside the scope of this model. Attributed functions imply outward transport. These functions include nodulation, acriflavin resistance, heavy metal efflux, and multidrug resistance proteins. Most members of this family are found in Gram-negative bacteria. The proposed function of MFP proteins is to bring the inner and outer membranes together and enable transport to the outside of the outer membrane. Note, however, that a few members of this family are found in Gram-positive bacteria, where there is no outer membrane. [Transport and binding proteins, Unknown substrate].	6.18674e-67
NZ_CP015130.1\|WP_004179084.1\|4890723_4893411_+\|cation-transporting-P-type-ATPase	gnl\|CDD\|319775	cd02080, P-type_ATPase_cation, P-type cation-transporting ATPase similar to Exiguobacterium aurantiacum Mna, an Na(+)-ATPase, and Synechocystis sp. PCC 6803 PMA1, a putative Ca(2+)-ATPase. This subfamily includes the P-type Na(+)-ATPase of an alkaliphilic bacterium Exiguobacterium aurantiacum Mna and cyanobacterium Synechocystis sp. PCC 6803 PMA1, a cation-transporting ATPase which may translocate calcium. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP015130.1\|WP_064840185.1\|4896438_4897395_+\|formimidoylglutamase	gnl\|CDD\|234974	PRK01722, PRK01722, formimidoylglutamase; Provisional.	2.65105e-177
NZ_CP015130.1\|WP_002895655.1\|4910868_4912890_+\|excinuclease-ABC-subunit-B	gnl\|CDD\|235395	PRK05298, PRK05298, excinuclease ABC subunit UvrB.	0
NZ_CP015130.1\|WP_004152853.1\|4909435_4910158_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223487	COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism].	3.17026e-74
NZ_CP015130.1\|WP_004183465.1\|4890240_4890672_+\|universal-stress-protein	gnl\|CDD\|185353	PRK15456, PRK15456, universal stress protein UspG; Provisional.	1.69931e-44
NZ_CP015130.1\|WP_004147671.1\|4900009_4901536_+\|histidine-ammonia-lyase	gnl\|CDD\|236484	PRK09367, PRK09367, histidine ammonia-lyase; Provisional.	0
NZ_CP015130.1\|WP_014342949.1\|4899074_4900013_+\|urocanate-hydratase	gnl\|CDD\|235448	PRK05414, PRK05414, urocanate hydratase; Provisional.	0
NZ_CP015130.1\|WP_002895648.1\|4908771_4909494_+\|ATP-dependent-dethiobiotin-synthetase-BioD	gnl\|CDD\|234625	PRK00090, bioD, ATP-dependent dethiobiotin synthetase BioD.	4.52132e-105
NZ_CP015130.1\|WP_023341213.1\|4897456_4898182_+\|histidine-utilization-repressor	gnl\|CDD\|184961	PRK14999, PRK14999, histidine utilization repressor; Provisional.	1.97888e-172
NZ_CP015130.1\|WP_064840303.1\|4904342_4905632_-\|adenosylmethionine--8-amino-7-oxononanoate-transaminase	gnl\|CDD\|181189	PRK07986, PRK07986, adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated.	0
NZ_CP015130.1\|WP_004147672.1\|4901634_4903017_+\|amino-acid-permease	gnl\|CDD\|182566	PRK10580, proY, putative proline-specific permease; Provisional.	0
NZ_CP015130.1\|WP_004893301.1\|4908023_4908779_+\|malonyl-ACP-O-methyltransferase-BioC	gnl\|CDD\|182340	PRK10258, PRK10258, biotin biosynthesis protein BioC; Provisional.	1.45632e-160
NZ_CP015130.1\|WP_183366022.1\|4895122_4896442_+\|imidazolonepropionase	gnl\|CDD\|236478	PRK09356, PRK09356, imidazolonepropionase; Validated.	0
NZ_CP015130.1\|WP_064840184.1\|4893684_4894968_-\|putative-acyl-CoA-thioester-hydrolase	gnl\|CDD\|236709	PRK10531, PRK10531, putative acyl-CoA thioester hydrolase.	0
NZ_CP015130.1\|WP_004183475.1\|4906882_4908040_+\|8-amino-7-oxononanoate-synthase	gnl\|CDD\|235655	PRK05958, PRK05958, 8-amino-7-oxononanoate synthase; Reviewed.	0

>NZ_CP015130.1|WP_004147672.1|4901634_4903017_+|amino-acid-permease
MQQQHKPHLLRGLNARHIRFIALGSAIGTGLFYGSASAIKAAGPAVLLAYLIGGAAVFIVMRALGEMAVRNPVSGSFGSYARQYLGPLAGFITGWTYTFEMVIVALADVTAFGIYMGLWYPDVPRWIWILSIIFFIGAMNLCNVRVFGEMEFWLSLVKVVAIIAMMLAGAGIIFFGFGHSFPATGLENLWSHGGFAPNGWQGVIASLGIVMFAFGGVEIIGVTAAEAKDPKKVIPQAINTIPLRIILFYVCTLAVLMAIFPWNSFGEQGSPFVLIFDGLGIPAAATILNIIVISASISAINSDIFGAGRMMYGMSKEGLAPKSFQRIASNGVPWMTVVVMGGALLAAVVLNYLIPEQVFVLIASLAAFATVWVWLMILLSHFAMRRGLSAEERSQIAFPIPFWPVAPLLTLLFMGLVIAVLGMFAETRMALIAGLVWLGLLTVVWYARVRKTALQVATEQ
>NZ_CP015130.1|WP_004147671.1|4900009_4901536_+|histidine-ammonia-lyase
MKSLTLIPGQLSLSQLRDVYSHPVNITLDSGAFAAIDESVACVNAILAEGRTAYGINTGFGLLAQTRISTEDLENLQRSLVLSHAAGVGEPLDDDLARLIMVLKINSLSRGFSGIRLSVIQALIGLVNAGVTPWIPAKGSVGASGDLAPLAHMSLTLLGEGKARVRGGEWLPATEALRQVGLEPITLAAKEGLALLNGTQASTAFALRGLFEAEDLFASAVVCGALTTEAALGSRRPFDARIHEVRGQRGQIDAAALYRHLLTEDSAISQSHHNCSKVQDPYSLRCQPQVMGACLTQIRQAAEVLLAEANAVSDNPLVFAAENDVISGGNFHAEPVAMAADNIALAIAEIGSLSERRIALMMDSHMSQLPPFLVKNGGVNSGFMIAQVTAAALASENKALSHPHSVDSLPTSANQEDHVSMAPAAGRRLWAMAENTRGVLAVEWLAAAQGLDMREGLTTSPLLEEARHLLRERVPHYTQDRYFAPDIDNAIALLAARHLTRLLPAVLH
>NZ_CP015130.1|WP_014342949.1|4899074_4900013_+|urocanate-hydratase
MKRGVRPDMVTDQTSAHDPLHGYLPKGWSWEEYQQKAESDPQGTILAAKRSMADHVQAMLAFHEMGVPTFDYGNNIRQMAQEVGVSNAFDFPGFVPAYIRPLFCRGIGPFRWVALSGDPQDIYKTDAKVKEIIKDDQHLHHWLDMARERISFQGLPARICWVGLEWRQKLGLAFNEMVRSGEVSAPIVIGRDHLDSGSVASPNRETEAMRDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGMGFSQHSGMVIVCDGTDEAAARIARVLHNDPATGVMRHADAGYEIAIECAAEQGLNLPMVAATQGNAK
>NZ_CP015130.1|WP_023341213.1|4897456_4898182_+|histidine-utilization-repressor
MFAQQPRSAPAPFYEKVKQAISEKIHSGVWRPHDRIPSEAELVAQFGFSRMTINRALRELTDEGLLVRLQGVGTFVAEPKGQSALFEVRSIAAEIVARHHQHRCEVLLLEETRADHIQATALSVPEGTRIFHSLMVHYENEVPVQIEDRCVNAAVVPDYLHQDYTTTTPHDYLSLIAPLTEGEHIVEAVQATAEECALLHIHAHDPCLLIRRRTWSTTHIVSHARLLFPGSRYRLQGRFGS
>NZ_CP015130.1|WP_064840185.1|4896438_4897395_+|formimidoylglutamase
MMLWQATPASLWQGRDDSAEAPNALRLFQTIARAERFAPQEMPGDIALLGFACDEGVRRNKGRTGAADGPATLRRALANMASHQGHDRCVDMGNISVDGEQLEAAHQALREAVADCQRAGKRTLVLGGGHETAFGHGAGVLDAFPGEKVGIINLDAHLDLRFADCASSGTPFRQLALECDAQQRGFHYTCIGVSRAANTQALWDEAARRQVAIVEDLEVLTAFETRVLPELERNIAQFDRLYLTIDLDVLPAREMPAVSAPAALGVPLGTLLRIVEPLCRSGKLQAVDLVEFNPLFDIDCQGARAAARLAWQIAHWWR
>NZ_CP015130.1|WP_183366022.1|4895122_4896442_+|imidazolonepropionase
MVFSHKKITFPCAIVDFTGVMKINVYTTHDKLSAMTEATSELVIWRNGRLATLNPDHAQPYGLLERHALLVRDGRIAAIVAEDDVPSGRSIDLEGRLVTPGLIDCHTHLVFGGSRAQEWEQRLNGVSYQTISASGGGINSTVRATRESSEAELLALAQPRLERLLREGVTTLEIKSGYGLDLPNERKMLRVARQLADHNGVELSATLLSAHATPPEYQGDADGYITLVCETILPTLWQEGLFESVDVFCENVGFSPQQTERVFQAAQALGIPVKGHVEQLSSLGGAQLVSRYHGLSADHIEYLTEEGVAAMRESGTVAALLPGAFYFLNETRKPPVELLRKYQVPMAVATDFNPGTSPFASLHLAMNMACVKFGLTPEEAWAGVTRHAARALGRQASHGQLAPGFVANFAIWDAEHPVEMVYEPGRSPLWHRVVQGELQ
>NZ_CP015130.1|WP_064840184.1|4893684_4894968_-|putative-acyl-CoA-thioester-hydrolase
MNTYSVSRLALALAFGVTLSACSSTPADQQPSTQTAPGTTARPILNAEEAKNFTPAAYFQSLAPNAAAWTPSAISLPAQPDFIVGPAGTQGVTHTTIQAAVDAAIARHSNRRLYIAIMPGEYPGTVYVPAAPGALTLYGTGDKPIDVKISEAIDSEMDRNTWRRLVNPGGKYMPGKPAWYMFDSCQSKSAATVGVMCSAVFWSQNNGLQLQNLTIANNLGDSVDAGTHQAVTLRSDGDQVQINKVNILGRQNTFFVTNSGVQNRLQDNRQTRTLVTNSYIEGDVDIVSGRGAVVFDNTDFRVVNSRTQKEAYVFAPATLKSVTYGFLATNSRFTASGDNVAQLGRALDVDGNSNGQVVIRDSAINEGFNIAQPWAAAVGSGRPFSGNTGSADDKGNLQRNLNDNGFNRMWEYNNRGVGSTVVAEPKQ
>NZ_CP015130.1|WP_004179084.1|4890723_4893411_+|cation-transporting-P-type-ATPase
MNTDKPGAPYYQRSVEETLASVQSSPEGISGTEAATRLQQYGENALPQKPGKPAWLRFIAHFNDVLIYVLLAAALLKAVMGHWIDMAVILAVAVVNALIGFIQESNAEKSLQSIRNMLSSEAVAIRQGNHETIPTTSLVPGDIVVIRAGDRIPADLRVIEAHNLRVEEAILTGESTVVEKTTEPLSGDLPLGDRSNLLFSGTTVSSGAGKGIVVATGGDTELGHINQMMAGIEKHRTPLLVQMDKLGKAIFILILVMMAALFVFSLLFRDMPVSELMLSLISLAVASVPEGLPAIISIILSLGVQAMARQKAIIRKLPTVETLGAMTVICSDKTGTLTMNEMTVKAVITADSVYRVEGDSYEPVGKIHAIDDPTPVTIAPGSLFERYLRTIDLCNDSQLIKEESGLWKITGGPTEGALKVLAAKVTLPPLTSELRSKIPFDSQYKYMSTLYRLGEEEVVLVTGAPDVLFRLCQYQQSDSGLQPLDLPYWEGKIEEYAREGLRMVAAAWKPAAAGQTELTHQDLQQGVILLGVAGMMDPPRPEAITAIADCLQAGIRVKMITGDHPQTAMSIGKMLGIGNAGNAITGRELEVMDDAQLSVAAQQFDIFARTSPEDKFRLVQALQSKKEIVGMTGDGVNDAPALKQADVGVAMGIKGTEVTKEAADMVLTDDNFATIASAVREGRRVYDNLKKTILFVMPTNLAQGLLIVIALLAGNVLPLTPVLILWMNMATSATLSFGLAFEAGEKNIMRRPPRDPKIHVMDGFAIWRVAFVGSMIAVSAFILEAWLQPRGYSPEFIRTVLLQTLVTAQWFYMLNCRVSDGFSLTKGLLANKGIWIVSGVLLLLQLLIIYAPFMQMLFGTTGLPFRYWVITFIIGFAMFLIVELEKPLTRKWRSA
>NZ_CP015130.1|WP_004183465.1|4890240_4890672_+|universal-stress-protein
MYKNIVVPVDVFDAGLADKALSHAKFLAQHSAGQIHLIHVIPAFSPVLTRGFISDARKMEDHLLNTAKEKLSELVKKNGLAEDASHLYVRSGNVRDQVIALADELKADVVIVGSRNPGIQTHLLGSEAANIVRYAHVPVFVVR
>NZ_CP015130.1|WP_004147662.1|4888621_4889707_-|efflux-RND-transporter-periplasmic-adaptor-subunit
MNRYFSLIPVVIIFTTACDQKAPTVESAPRMVKVAQVTAVGNTQQRTFPARIESGDSTELSFKRGGQVESLDIRQGASVAQGQTLARLNAREAQQRVNERQTAATLAQRQFDRFQTLAGRQAISQAEMDVQRANRDAANAALKIAREELAQMSLIAPFSGIAAGVHIRNHQVVAAGQPVITLTRTDLLDVVFSIPENLFTSLDIRNTAYRPVVRINTLPGREFTAEYKEHTGSSDNSTLTWQIVLTMPRPDDFPAVGGVSGTVTVNLGNLPASAGRETLIVPAEAVFNPDNRPKNEPVVWVVKGDNAHRYLEERKVTVGEVTSQGVAITDGLRAGEQVVAAGVSELHAGQPVRVWTRERGL
>NZ_CP015130.1|WP_002895575.1|4903795_4904272_-|kinase-inhibitor
MKLISHDLQDGGKLPNRHVFNGMGYDGDNISPHLMWDDVPAGTKSFVVTCYDPDAPTGSGWWHWVVANLPADTRVLPQGAGSGQAELPEEAVQTRTDFGKAGYGGAAPPKGETHRYIFTVHALDVEKIEVDAEASGAMVGFNVHFHSLASASITALFS
>NZ_CP015130.1|WP_064840303.1|4904342_4905632_-|adenosylmethionine--8-amino-7-oxononanoate-transaminase
MTLDDLAFDRRHIWHPYTSMTFPLPVYPVVSAHGCELSLAGGKQLVDGMSSWWAAIHGYNHPRLNAALKGQIDQMSHVMFGGITHPPAVALCRQLVAMTPASLECVFLADSGSVAVEVAMKMALQYWQAKGEPRRRFLTFRNGYHGDTFGAMSVCDPQNSMHSLWQGYLPDNLFAPAPQSRFDGEWDEMDMVPFARLMAAHRHEIAAVILEPIVQGAGGMRMYHPEWLKRVRKMCDREGILLIADEIATGFGRTGKLFACEHAGITADILCLGKALTGGTMTLSAAITTRTVAETISNGEAGCFMHGPTFMGNPLACAVASESLRLLESGEWQPQVAAIEAQLQAELAPARGSALVADVRVLGAIGVVETRRPVNMATLQRFFVEQGVWIRPFGRLIYLMPPYIITPEQLTRLTRAVNQAVQDETFFSE
>NZ_CP015130.1|WP_002895580.1|4905845_4906886_+|biotin-synthase-BioB
MAHQPRWTMSQVTELFNKPLIDLLFEAQQIHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSARYKTGLEAERLMEVEQVLESARQAKNAGSTRFCMGAAWKNPNDRDMPYLEQMVKGVKALGLESCMTLGTLTDSQAQRLAEAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLDKVRDAGIKVCSGGIVGLGESVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIRTIAIARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLFRKLGINPQQTAVLEGDNEQQQRLEQALLTPDTEEYYNAAAL
>NZ_CP015130.1|WP_004183475.1|4906882_4908040_+|8-amino-7-oxononanoate-synthase
MSWQQRIDRALDERRAAEAFRRRLPVTHGAGRWLEREGERWLNFSSNDYLGLSQHPAIIAAWQQGATRYGVGAGGSGHVSGYSEAHRALEEALADWLGYPRALLFISGFAANQALIAALVEKDDRIVADRLSHASLLEAASLSPAQLRRFTHNDPQQLAQLLAKPLAGEQLAVTEGIFSMDGDSAPLAAIHAATQAAGAVLLVDDAHGVGVVGDEGRGSCAAQAVRPELLVVTFGKAFGVSGAAVLCDEAMADYLLQFARHLIYSTAMPPAQAVALSAALGIIRSDEGQQRRDILAARIRQFREGMGEVSLGLTDSVSAIQPLIVGDNARALNLACRLRDAGCWATAIRPPTVPVGSARLRLTLTAAHHTEDINRLLEVLHGHSE
>NZ_CP015130.1|WP_004893301.1|4908023_4908779_+|malonyl-ACP-O-methyltransferase-BioC
MATVNKQAVAAAFGRAASGYTQHDELQRRCADLLLRQLARRDFAQVLDAGCGPGSMSRYWREAGSVVTALDLSAGMLAQAQRNDAAQHYLLGDIEALPLPDACVDLAWSNLAVQWCDDLRAAIGELYRVARPGGRVAFSTLLADSLPELNQAWQAIDDRPHANRFLSEAAVRAALSGLRATGEVHQISLPFADALSAMRSLKGIGATHLHQGRTVAPLGRGKLRELQLAWPQRQGICPLTYSLFTGVIERD
>NZ_CP015130.1|WP_002895648.1|4908771_4909494_+|ATP-dependent-dethiobiotin-synthetase-BioD
MTKRFFVTGTDTEVGKTIASSALLQAANLLGFHTAGYKPVASGSELTGDGLRNEDALALQRHSRVALRYDQVNPYTFAEPTSPHIISADEGRPIAAARLSSGLRELEGLADWVLVEGAGGWFTPLSDSLTFADWAQAEQLPVILVVGVKLGCINHAMLTAQAVRQAGLPLAGWIANDVQPPGKRHAEYLATLKNRLAAPFLGEIPWLADIAQRDDLGQYLDLRALDPALSTAPAAAHPAP
>NZ_CP015130.1|WP_004152853.1|4909435_4910158_-|ATP-binding-cassette-domain-containing-protein
MLNLQAVNHFYGNQHSLWNVDLVLRPGECIGVLGREGMGKTTLVNCIAGHLPVASGRMTWHDIGAPPQDLTPLSAQSRSAIGIGYVPQDKRIFSQLSVEENLHIALAAGKPGANASGGEIYEHFPELYALRQRKGASLSDDDQYQLALARALIVQPRLLILDEPSRGRGPRCLQKLADLLLRLNRDIGLTVLLAEQHLPFIRRVADRFCVLHRGRNVAEGDIMALDEPLLAQWITPDPAP
>NZ_CP015130.1|WP_002895652.1|4910244_4910457_-|hypothetical-protein
MDNCPQPKTTAARRLSPFAVNRVAKNFYRTIFDNYPLKAARFLLLFAPPFSVGHRKSAAPALTRPDGIGV
>NZ_CP015130.1|WP_002895655.1|4910868_4912890_+|excinuclease-ABC-subunit-B
MSKSFVLHSAFRPSGDQPEAIRRLEEGLEDGLAHQTLLGVTGSGKTFTIANVIADLQRPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYYDYYQPEAYVPSSDTFIEKDASVNEHIEQMRLSATKALLERRDVVVVASVSAIYGLGDPDLYLKMMLHLTVGMLIDQRAILRRLAELQYTRNDQAFQRGTFRVRGEVIDVFPAESDDIALRIELFDEEVERLSLFDPLTGHVEGTVPRYTIYPKTHYVTPRERIVQAMEEIKLELAERRKVLLANNKLLEEQRLTQRTQFDLEMMNELGYCSGIENYSRFLSGRGPGEPPPTLFDYLPADGLLVIDESHVTVPQIGGMYRGDRARKETLVEYGFRLPSALDNRPMKFEEFEALAPQTIYVSATPGAYELDKSGGEVVDQVVRPTGLLDPIIEVRPVATQVDDLLSEIRLRTAINERVLVTTLTKRMAEDLTEYLEEHGERVRYLHSDIDTVERMEIIRDLRLGEFDVLVGINLLREGLDMPEVSLVAILDADKEGFLRSERSLIQTIGRAARNVNGKAILYGDKITPSMAKAIGETERRREKQQRYNEEHGIVPQGLNKKVVDILQLGQGLAKTKAKGRGKAKAVEPAGLSAVDMTPKALQQKIHELEGQMMQHAQNLEFEEAAQIRDQLHQLRELFIAAS
>NZ_CP015130.1|WP_004147680.1|4913138_4914236_-|two-component-system-sensor-histidine-kinase-PmrB
MALFATETWTMRHRLLLTIGAILVVCQLISVFWLWHESKEQIQLLVASAIEGHNNQKHVEHEVREAVASLLVPSLLIVGLALYISMLAVRKITRPLSRLQSELENRTPDNLTPIVLSESVPEVTAVTTALNQLVSRLNLTLDRERLFTADVAHELRTPLAGLRLHLELLAKVHGMGVDPLIQRLDQMTTSISQLLQLARVGQSFSAGSYQQVLLLDDVVKPLQDELEAMLAQRQQRLLLTDIENEAVVSGDATLIRVILRNLVENAHRYSPEGSTIRVSVKAGLMPVMAVEDEGPGIDEAKSGELSKAFVRMDSRYGGIGLGLSIVTRIAQLHDAQFFLHNRQPGPGVRAWVLFPQRGGQNVSTH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP015130_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015130_3

5136631-5140922

Orphan

Consensus_repeat	Method
GANTCNGANTCNGACAGCGA	CRT

36 spacers

The CRISPR arrays of NZ_CP015130_3

>merge|NZ_CP015130|3|5136631-5140922|CRT
GACTCCGACTCGGACAGCGATTCTGACTCTGACAGCGACTCCGATTCGGACAGTGATTCCGACTCTGACAGCGATTCGGACTCCGACAGTGATTCGGACTCCGACTCCGACTCTGACAGCGACTCGGATTCTGACAGCGATTCGGATTCTGACAGCGATTCTGACTCGGACAGCGACTCGGACTCCGACAGCGACTCTGACTCCGATTCGGACAGCGATTCGGATTCCGACAGTGATTCGGATTCTGACAGCGATTCGGACTCTGACAGCGACTCCGACTCCGACAGTGATTCGGATTCCGACAGTGATTCGGACTCGGACAGCGACTCTGACTCCGACAGCGACAGTGATTCGGATTCTGACAGCGACTCCGATTCTGACAGCGATTCTGACTCTGACAGCGACTCTGACTCGGACAGCGATTCGGATTCTGACAGCGATTCGGACTCTGACAGTGACTCGGATTCGGACAGTGATTCCGACTCCGACAGCGATTCGGACTCTGACAGTGACTCGGATTCGGACAGCGACTCCGATTCGGACAGTGATTCCGACTCCGACAGCGACTCGGATTCTGACAGTGACTCCGATTCGGACAGCGACTCGGACTCCGACAGTGATTCGGATTCGGACAGCGACTCCGACTCCGACTCGGATTCGGACAGCGACTCCGATTCGGACTCCGACAGCGATTCCGATTCCGACAGCGACTCGGACTCCGACAGCGACAGTGATTCGGACTCGGACAGCGACTCTGACTCGGACAGCGACTCGGATGCTGACAGCGACTCCGACTCCGACTCCGACAGCGACTCTGACTCGGACAGCGATTCGGACTCTGACAGTGACTCCGATTCGGACAGCGACTCTGACTCTGACAGCGACTCCGATTCCGACAGTGACTCGGATTCCGACAGCGACTCAGACTCTGACAGTGACTCGGATTCTGACAGCGACTCGGATTCGGACAGCGATTCGGATTCTGACAGCGACTCCGACTCCGACAGTGATTCGGATTCCGACAGTGATTCGGACTCTGACAGCGATTCCGACTCCGACAGCGACTCGGATTCCGACAGCGACTCTGACTCGGACAGCGATTCGGATTCTGACAGCGATTCGGACTCTGACAGTGACTCGGATTCCGACAGTGATTCGGACTCGGACAGCGACTCTGACTCTGACTCTGACAGCGATTCCGACTCCGACAGCGACTCGGATTCCGACAGCGACTCTGACTCGGACAGCGATTCTGACTCGGACAGCGATTCGGATTCTGACAGCGATTCGGACTCTGACAGTGACTCGGATTCGGACAGCGACTCCGACTCGGACTCCGACTCTGACAGTGACTCGGATTCTGACAGCGATTCGGATTCTGACAGTGACTCCGATTCGGACAGCGACTCTGACTCTGACAGCGACTCCGACTCTGACAGTGACTCGGATTCTGACAGCGATTCTGACTCGGACAGCGACTCGGACTCCGACAGCGACTCGGACTCCGACAGCGACTCGGATTCTGACTCCGACTCTGATTCCGACAGCGATTCGGACTCTGACAGCGATTCGGATTCCGACAGTGATTCCGACTCCGACAGCGACTCGGACTCTGACAGTGACTCGGATTCCGACAGCGACTCGGACTCTGACAGTGATTCCGACTCCGACAGCGACTCGGATTCTGACAGTGACTCGGATTCTGACAGCGACTCGGATGCTGACAGCGATTCGGACTCTGACAGTGACTCCGATTCGGACAGCGACTCTGACTCTGACAGCGATTCGGATTCCGACAGTGACTCCGACTCCGACAGCGACTCCGATTCGGACAGTGACTCCGATTCTGACTCCGACTCTGATTCCGACAGCGATTCGGATTCCGACAGTGACTCCGACTCCGACAGCGACAGTGATTCGGATTCTGACAGCGACTCAGACTCCGACAGCGACTCCGATTCGGACAGCGATTCGGATTCCGACAGCGATTCGGATTCTGACAGCGATTCGGACTCTGACAGTGACTCGGACTCGGACAGCGACTCTGACTCCGACAGCGACAGCGATTCGGATTCCGACAGCGACTCCGATTCGGACAGTGATTCCGACTCTGACAGCGATTCGGACTCCGACAGTGATTCGGATTCGGACAGTGATTCGGACTCCGACAGCGATTCCGATTCCGACAGTGATTCGGACTCTGACAGTGACTCGGATTCTGACAGCGACTCCGACTCTGACAGTGACTCGGATTCTGACAGTGACTCCGATTCGGACAGCGATTCGGACTCTGACAGCGACTCGGATTCGGACAGTGATTCGGACTCTGACAGCGACTCGGATTCTGACAGTGATTCAGACTCTGACAGCGATTCCGACTCCGACAGCGACTCGGACTCTGACAGCGATTCGGATTCCGACAGCGACTCGGACTCTGACTCCGACTCCGATTCCGATTCCGACAGCGACTCGGATGCTGACAGTGATTCGGACTCGGACTCTGACAGCGACTCCGATTCGGACAGCGATTCGGACAGCGATTCGGACTCTGACAGTGACTCCGATTCGGACAGCGACTCTGACTCTGACAGCGATTCCGACTCCGACAGTGACTCCGATTCCGACAGCGACAGTGATTCGGACTCCGACAGCGATTCCGATTCCGACAGTGACTCGGACTCTGACAGCGATTCCGATTCCGACAGTGATTCGGACTCTGACAGCGACTCCGACTCTGACAGTGACTCGGACTCTGACAGTGATTCGGATTCTGACAGCGACTCCGATTCTGACAGCGATTCTGACTCTGACAGCGACTCCGACTCCGACAGCGACAGCGATTCGGATTCCGACAGCGACTCCGATTCGGACAGTGATTCCGACTCTGACAGCGACTCTGACTCGGACAGCGATTCGGATTCTGACAGTGATTCGGACTCTGACAGCGATTCCGACTCCGACAGCGACTCTGACTCCGACAGCGACAGTGATTCGGATTCTGACAGCGACTCCGATTCTGACAGCGATTCTGACTCTGACAGCGACTCCGATTCTGACAGTGATTCGGACTCTGACAGCGATTCGGACTCCGACAGTGATTCGGATTCGGACAGCGACTCGGATTCTGACAGCGATTCTGACTCTGACAGCGACTCCGATTCTGACAGTGATTCGGACTCTGACAGCGATTCGGACTCCGACAGTGATTCGGATTCGGACAGCGACTCGGATTCTGACAGCGATTCCGACTCCGACAGTGACTCCGACTCTGACAGCGATTCGGACTCCGACAGCGACTCGGATTCTGACAGTGACTCGGACTCTGACAGTGATTCGGATTCTGACAGCGACTCCGATTCTGACAGCGATTCTGACTCTGACAGCGACTCTGACTCGGACAGCGATTCGGATTCTGACAGTGATTCGGACTCTGACAGCGATTCCGACTCCGACAGCGACTCTGACTCCGACAGCGACAGTGATTCGGATTCTGACAGCGACTCCGATTCTGACAGCGATTCTGACTCTGACAGCGACTCCGATTCTGACAGTGATTCGGACTCTGACAGCGATTCGGACTCCGACAGTGATTCGGATTCGGACAGCGACTCCGATTCTGACAGCGATTCTGACTCTGACAGCGACTCCGATTCTGACAGTGATTCGGACTCTGACAGCGATTCGGACTCCGACAGTGATTCGGATTCGGACAGCGACTCGGATTCTGACAGCGATTCCGACTCCGACAGTGACTCCGACTCTGACAGCGATTCGGACTCCGACAGTGATTCGGATTCGGACTCCGACTCCGACTCTGACAGCGATTCGGATTCCGACAGTGATTCCGACTCTGACAGCGACTCTGACTCCGACAGTGATTCGGATTCTGACAGCGACTCCGACTCTGACAGCGATTCGGATTCCGACAGCGACTCAGACTCTGACTCTGACAGCGACTCTGACTCGGACAGCGATTCGGATTCTGACAGTGATTCGGACTCTGACAGCGATTCCGACTCCGACAGCGACTCGGATTCCGACAGCGACTCTGACTCGGACAGCGATTCGGACTCCGACAGTGATTCGGATTCGGACAGCGACTCCGACTCCGACTCCGACTCGGATTCGGACAGCGACTCCGATTCGGACTCCGACAGCGACTCGGACTCCGACAGCGACAGCGATTCGGATTCTGACAGCGATTCGGACTCCGACAGCGATTCGGATTCCGACAGCGACTCGGACTCTGACAGTGACTCCGATTCGGACAGCGACTCGGATTCTGACAGCGA

>NZ_CP015130|3|1|5136631-5140922|CRT
GACTCCGACTCGGACAGCGA	TTCTGACTCTGACAGCGACTCCGATTCGGACAGTGATTCCGACTCTGACAGCGATTCGGACTCCGACAGTGATTCGGACTCCGACTCCGACTCTGACAGCGACTCGGATTCTGACAGCGATTCGGATTCTGACAGCGATTCTGACTCGGACAGCGACTCGGACTCCGACAGCGACTCT
GACTCCGATTCGGACAGCGA	TTCGGATTCCGACAGTGATTCGGATTCTGACAGCGATTCGGACTCTGACAGCGACTCCGACTCCGACAGTGATTCGGATTCCGACAGTGATTCGGACTCGGACAGCGACTCTGACTCCGACAGCGACAGTGATTCGGATTCTGACAGCGACTCCGATTCTGACAGCGATTCTGACTCTGACAGC
GACTCTGACTCGGACAGCGA	TTCGGATTCTGACAGCGATTCGGACTCTGACAGTGACTCGGATTCGGACAGTGATTCCGACTCCGACAGCGATTCGGACTCTGACAGTGACTCGGATTCGGACAGCGACTCCGATTCGGACAGTGATTCCGACTCCGACAGCGACTCGGATTCTGACAGT
GACTCCGATTCGGACAGCGA	CTCGGACTCCGACAGTGATTCGGATTCGGACAGCGACTCCGACTCCGACTCGGATTCGGACAGCGACTCCGATTCGGACTCCGACAGCGATTCCGATTCCGACAGCGACTCGGACTCCGACAGCGACAGTGATTCGGACTCGGACAGCGACTCTGACTCGGACAGC
GACTCGGATGCTGACAGCGA	CTCCGACTCCGACTCCGACAGCGACTCTGACTCGGACAGCGATTCGGACTCTGACAGTGACTCCGATTCGGACAGCGACTCTGACTCTGACAGCGACTCCGATTCCGACAGTGACTCGGATTCCGACAGCGACTCAGACTCTGACAGT
GACTCGGATTCTGACAGCGA	CTCGGATTCGGACAGCGATTCGGATTCTGACAGCGACTCCGACTCCGACAGTGATTCGGATTCCGACAGTGATTCGGACTCTGACAGCGATTCCGACTCCGACAGCGACTCGGATTCCGACAGCGACTCTGACTCGGACAGC
GATTCGGATTCTGACAGCGA	TTCGGACTCTGACAGTGACTCGGATTCCGACAGTGATTCGGACTCGGACAGCGACTCTGACTCTGACTCTGACAGCGATTCCGACTCCGACAGCGACTCGGATTCCGACAGCGACTCTGACTCGGACAGCGATTCTGACTCGGACAGC
GATTCGGATTCTGACAGCGA	TTCGGACTCTGACAGTGACTCGGATTCGGACAGCGACTCCGACTCGGACTCCGACTCTGACAGTGACTCGGATTCTGACAGCGATTCGGATTCTGACAGTGACTCCGATTCGGACAGCGACTCTGACTCTGACAGCGACTCCGACTCTGACAGT
GACTCGGATTCTGACAGCGA	TTCTGACTCGGACAGCGACTCGGACTCCGACAGCGACTCGGACTCCGACAGCGACTCGGATTCTGACTCCGACTCTGATTCCGACAGCGATTCGGACTCTGACAGCGATTCGGATTCCGACAGTGATTCCGACTCCGACAGC
GACTCGGACTCTGACAGTGA	CTCGGATTCCGACAGCGACTCGGACTCTGACAGTGATTCCGACTCCGACAGCGACTCGGATTCTGACAGTGACTCGGATTCTGACAGCGACTCGGATGCTGACAGC
GATTCGGACTCTGACAGTGA	CTCCGATTCGGACAGCGACTCTGACTCTGACAGCGATTCGGATTCCGACAGTGACTCCGACTCCGACAGCGACTCCGATTCGGACAGTGACTCCGATTCTGACTCCGACTCTGATTCCGACAGC
GATTCGGATTCCGACAGTGA	CTCCGACTCCGACAGCGACAGTGATTCGGATTCTGACAGCGACTCAGACTCCGACAGCGACTCCGATTCGGACAGCGATTCGGATTCCGACAGCGATTCGGATTCTGACAGC
GATTCGGACTCTGACAGTGA	CTCGGACTCGGACAGCGACTCTGACTCCGACAGCGACAGCGATTCGGATTCCGACAGCGACTCCGATTCGGACAGTGATTCCGACTCTGACAGCGATTCGGACTCCGACAGTGATTCGGATTCGGACAGT
GATTCGGACTCCGACAGCGA	TTCCGATTCCGACAGTGATTCGGACTCTGACAGTGACTCGGATTCTGACAGCGACTCCGACTCTGACAGTGACTCGGATTCTGACAGTGACTCCGATTCGGACAGC
GATTCGGACTCTGACAGCGA	CTCGGATTCGGACAGTGATTCGGACTCTGACAGCGACTCGGATTCTGACAGTGATTCAGACTCTGACAGCGATTCCGACTCCGACAGCGACTCGGACTCTGACAGCGATTCGGATTCCGACAGC
GACTCGGACTCTGACTCCGA	CTCCGATTCCGATTCCGACAGCGACTCGGATGCTGACAGTGATTCGGACTCGGACTCTGACAGCGACTCCGATTCGGACAGCGATTCGGACAGCGATTCGGACTCTGACAGTGACTCCGATTCGGACAGC
GACTCTGACTCTGACAGCGA	TTCCGACTCCGACAGTGACTCCGATTCCGACAGCGACAGTGATTCGGACTCCGACAGCGATTCCGATTCCGACAGTGACTCGGACTCTGACAGCGATTCCGATTCCGACAGTGATTCGGACTCTGACAGC
GACTCCGACTCTGACAGTGA	CTCGGACTCTGACAGTGATTCGGATTCTGACAGCGACTCCGATTCTGACAGCGATTCTGACTCTGACAGCGACTCCGACTCCGACAGCGACAGCGATTCGGATTCCGACAGCGACTCCGATTCGGACAGT
GATTCCGACTCTGACAGCGA	CTCTGACTCGGACAGCGATTCGGATTCTGACAGTGATTCGGACTCTGACAGCGATTCCGACTCCGACAGCGACTCTGACTCCGACAGCGACAGTGATTCGGATTCTGACAGC
GACTCCGATTCTGACAGCGA	TTCTGACTCTGACAGCGACTCCGATTCTGACAGTGATTCGGACTCTGACAGCGATTCGGACTCCGACAGTGATTCGGATTCGGACAGC
GACTCGGATTCTGACAGCGA	TTCTGACTCTGACAGCGACTCCGATTCTGACAGTGATTCGGACTCTGACAGCGATTCGGACTCCGACAGTGATTCGGATTCGGACAGC
GACTCGGATTCTGACAGCGA	TTCCGACTCCGACAGTGACTCCGACTCTGACAGCGATTCGGACTCCGACAGC
GACTCGGATTCTGACAGTGA	CTCGGACTCTGACAGTGATTCGGATTCTGACAGCGACTCCGATTCTGACAGCGATTCTGACTCTGACAGCGACTCTGACTCGGACAGC
GATTCGGATTCTGACAGTGA	TTCGGACTCTGACAGCGATTCCGACTCCGACAGCGACTCTGACTCCGACAGCGACAGT
GATTCGGATTCTGACAGCGA	CTCCGATTCTGACAGCGATTCTGACTCTGACAGCGACTCCGATTCTGACAGTGATTCGGACTCTGACAGCGATTCGGACTCCGACAGT
GATTCGGATTCGGACAGCGA	CTCCGATTCTGACAGCGATTCTGACTCTGACAGCGACTCCGATTCTGACAGTGATTCGGACTCTGACAGC
GATTCGGACTCCGACAGTGA	TTCGGATTCGGACAGCGACTCGGATTCTGACAGCGATTCCGACTCCGACAGT
GACTCCGACTCTGACAGCGA	TTCGGACTCCGACAGTGATTCGGATTCG
GACTCCGACTCCGACTCTGA	CAGCGATTCGGATTCCGACAGT
GATTCCGACTCTGACAGCGA	CTCTGACTCCGACAGTGATTCGGATTCTGACAGC
GACTCCGACTCTGACAGCGA	TTCGGATTCCGACAGCGACTCA
GACTCTGACTCTGACAGCGA	CTCTGACTCGGACAGCGATTCGGATTCTGACAGT
GATTCGGACTCTGACAGCGA	TTCCGACTCCGACAGCGACTCGGATTCCGACAGCGACTCTGACTCGGACAGC
GATTCGGACTCCGACAGTGA	TTCGGATTCGGACAGCGACTCCGACTCCGACTCCGACTCGGATTCGGACAGCGACTCC
GATTCGGACTCCGACAGCGA	CTCGGACTCCGACAGCGACAGCGATTCGGATTCTGACAGC
GATTCGGACTCCGACAGCGA	TTCGGATTCCGACAGCGACTCGGACTCTGACAGTGACTCCGATTCGGACAGC
GACTCGGATTCTGACAGCGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015130.1\|WP_004144085.1\|5133195_5133609_+\|CoA-binding-protein	unknown	unknown	gnl\|CDD\|224745
NZ_CP015130.1\|WP_002898408.1\|5124901_5125972_-\|porin-OmpA	unknown	unknown	gnl\|CDD\|236764
NZ_CP015130.1\|WP_004183587.1\|5157466_5157748_+\|acylphosphatase	unknown	unknown	gnl\|CDD\|184675
NZ_CP015130.1\|WP_004141638.1\|5148814_5150035_+\|HlyD-family-type-I-secretion-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|130902
NZ_CP015130.1\|WP_004141630.1\|5154664_5155867_-\|23S-rRNA-(cytosine(1962)-C(5))-methyltransferase-RlmI	unknown	unknown	gnl\|CDD\|185082
NZ_CP015130.1\|WP_064840214.1\|5146670_5148818_+\|type-I-secretion-system-permease/ATPase	unknown	unknown	gnl\|CDD\|274550
NZ_CP015130.1\|WP_004179217.1\|5127182_5127779_+\|TfoX/Sxy-family-DNA-transformation-protein	unknown	unknown	gnl\|CDD\|377439
NZ_CP015130.1\|WP_023159781.1\|5150088_5153223_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340855
NZ_CP015130.1\|WP_002898404.1\|5124316_5124769_+\|macrodomain-Ter-protein-MatP	unknown	unknown	gnl\|CDD\|235344
NZ_CP015130.1\|WP_002898422.1\|5127792_5129928_-\|TIGR01666-family-membrane-protein	unknown	unknown	gnl\|CDD\|130727
NZ_CP015130.1\|WP_002898441.1\|5154287_5154605_-\|heat-shock-protein-HspQ	unknown	unknown	gnl\|CDD\|184526
NZ_CP015130.1\|WP_004179227.1\|5145237_5146674_+\|TolC-family-outer-membrane-protein	unknown	unknown	gnl\|CDD\|273829
NZ_CP015130.1\|WP_064840213.1\|5122373_5124131_-\|Lon-protease-family-protein	unknown	unknown	gnl\|CDD\|223994
NZ_CP015130.1\|WP_002898425.1\|5129945_5130392_-\|YccF-domain-containing-protein	unknown	unknown	gnl\|CDD\|225841
NZ_CP015130.1\|WP_020324397.1\|5156057_5156612_+\|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein	unknown	unknown	gnl\|CDD\|182092
NZ_CP015130.1\|WP_004179218.1\|5130516_5132571_+\|DNA-helicase-IV	unknown	unknown	gnl\|CDD\|182930
NZ_CP015130.1\|WP_040241201.1\|5153369_5154245_+\|peptidase	unknown	unknown	unknown
NZ_CP015130.1\|WP_002898432.1\|5132582_5133041_-\|methylglyoxal-synthase	unknown	unknown	gnl\|CDD\|179969
NZ_CP015130.1\|WP_002898418.1\|5126324_5126834_-\|cell-division-inhibitor-SulA	unknown	unknown	gnl\|CDD\|182577
NZ_CP015130.1\|WP_004183586.1\|5156629_5157418_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197666

Protein	Function_ID	Function_description	E-value
NZ_CP015130.1\|WP_004144085.1\|5133195_5133609_+\|CoA-binding-protein	gnl\|CDD\|224745	COG1832, COG1832, Predicted CoA-binding protein [General function prediction only].	1.40083e-74
NZ_CP015130.1\|WP_002898408.1\|5124901_5125972_-\|porin-OmpA	gnl\|CDD\|236764	PRK10808, PRK10808, outer membrane protein A; Reviewed.	0
NZ_CP015130.1\|WP_004183587.1\|5157466_5157748_+\|acylphosphatase	gnl\|CDD\|184675	PRK14426, PRK14426, acylphosphatase; Provisional.	6.34671e-59
NZ_CP015130.1\|WP_004141638.1\|5148814_5150035_+\|HlyD-family-type-I-secretion-periplasmic-adaptor-subunit	gnl\|CDD\|130902	TIGR01843, Hemolysin_secretion_protein_D_plasmid, type I secretion membrane fusion protein, HlyD family. Type I secretion is an ABC transport process that exports proteins, without cleavage of any signal sequence, from the cytosol to extracellular medium across both inner and outer membranes. The secretion signal is found in the C-terminus of the transported protein. This model represents the adaptor protein between the ATP-binding cassette (ABC) protein of the inner membrane and the outer membrane protein, and is called the membrane fusion protein. This model selects a subfamily closely related to HlyD; it is defined narrowly and excludes, for example, colicin V secretion protein CvaA and multidrug efflux proteins. [Protein fate, Protein and peptide secretion and trafficking].	4.66714e-100
NZ_CP015130.1\|WP_004141630.1\|5154664_5155867_-\|23S-rRNA-(cytosine(1962)-C(5))-methyltransferase-RlmI	gnl\|CDD\|185082	PRK15128, PRK15128, 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI.	0
NZ_CP015130.1\|WP_064840214.1\|5146670_5148818_+\|type-I-secretion-system-permease/ATPase	gnl\|CDD\|274550	TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family. Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion. This model is related to models TIGR01842 and TIGR01846, and to bacteriocin ABC transporters that cleave their substrates during export. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis].	0
NZ_CP015130.1\|WP_004179217.1\|5127182_5127779_+\|TfoX/Sxy-family-DNA-transformation-protein	gnl\|CDD\|377439	pfam04994, TfoX_C, TfoX C-terminal domain. TfoX may play a key role in the development of genetic competence by regulating the expression of late competence-specific genes. This family corresponds to the C-terminal presumed domain of TfoX. The domain is found associated with pfam00383 in Neisseria meningitidis TadA. It is also found as an isolated domain in some proteins suggesting this is an autonomous domain.	1.23971e-31
NZ_CP015130.1\|WP_023159781.1\|5150088_5153223_+\|glycosyltransferase	gnl\|CDD\|340855	cd04949, GT4_GtfA-like, accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.	1.24288e-48
NZ_CP015130.1\|WP_002898404.1\|5124316_5124769_+\|macrodomain-Ter-protein-MatP	gnl\|CDD\|235344	PRK05097, PRK05097, macrodomain Ter protein MatP.	1.02992e-100
NZ_CP015130.1\|WP_002898422.1\|5127792_5129928_-\|TIGR01666-family-membrane-protein	gnl\|CDD\|130727	TIGR01666, Uncharacterized_protein_HI_1680, TIGR01666 family membrane protein. This model represents a clade of sequences from gamma and beta proteobacteria. These proteins are >700 amino acids long and many have been annotated as putative membrane proteins. The gene from Salmonella has been annotated as a putative efflux transporter. The gene from E. coli has the name yccS. [Cell envelope, Other].	0
NZ_CP015130.1\|WP_002898441.1\|5154287_5154605_-\|heat-shock-protein-HspQ	gnl\|CDD\|184526	PRK14129, PRK14129, heat shock protein HspQ; Provisional.	3.13982e-74
NZ_CP015130.1\|WP_004179227.1\|5145237_5146674_+\|TolC-family-outer-membrane-protein	gnl\|CDD\|273829	TIGR01844, Proteases_secretion_protein_PrtF, type I secretion outer membrane protein, TolC family. Members of this model are outer membrane proteins from the TolC subfamily within the RND (Resistance-Nodulation-cell Division) efflux systems. These proteins, unlike the NodT subfamily, appear not to be lipoproteins. All are believed to participate in type I protein secretion, an ABC transporter system for protein secretion without cleavage of a signal sequence, although they may, like TolC, participate also in the efflux of smaller molecules as well. This family includes the well-documented examples TolC (E. coli), PrtF (Erwinia), and AprF (Pseudomonas aeruginosa). [Protein fate, Protein and peptide secretion and trafficking, Transport and binding proteins, Porins].	2.44996e-74
NZ_CP015130.1\|WP_064840213.1\|5122373_5124131_-\|Lon-protease-family-protein	gnl\|CDD\|223994	COG1067, LonB, Predicted ATP-dependent protease [Posttranslational modification, protein turnover, chaperones].	0
NZ_CP015130.1\|WP_002898425.1\|5129945_5130392_-\|YccF-domain-containing-protein	gnl\|CDD\|225841	COG3304, COG3304, Predicted membrane protein [Function unknown].	3.05694e-71
NZ_CP015130.1\|WP_020324397.1\|5156057_5156612_+\|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein	gnl\|CDD\|182092	PRK09818, PRK09818, kinase inhibitor.	3.79873e-82
NZ_CP015130.1\|WP_004179218.1\|5130516_5132571_+\|DNA-helicase-IV	gnl\|CDD\|182930	PRK11054, helD, DNA helicase IV; Provisional.	0
NZ_CP015130.1\|WP_002898432.1\|5132582_5133041_-\|methylglyoxal-synthase	gnl\|CDD\|179969	PRK05234, mgsA, methylglyoxal synthase; Validated.	3.53529e-94
NZ_CP015130.1\|WP_002898418.1\|5126324_5126834_-\|cell-division-inhibitor-SulA	gnl\|CDD\|182577	PRK10595, PRK10595, cell division inhibitor SulA.	1.30492e-94
NZ_CP015130.1\|WP_004183586.1\|5156629_5157418_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|197666	smart00342, HTH_ARAC, helix_turn_helix, arabinose operon control protein.	3.2001e-20

>NZ_CP015130.1|WP_004144085.1|5133195_5133609_+|CoA-binding-protein
MKENDIAGILTSTRTIALVGASDKPDRPSYRVMKYLLDQGYHVIPVSPKVAGKTLLGQQGYATLADVPEKVDMVDVFRNSEAAWGVAQEAIAIGAKTLWLQLGVINEQAAVLAREAGLSVVMDRCPAIELPRLGLAK
>NZ_CP015130.1|WP_002898432.1|5132582_5133041_-|methylglyoxal-synthase
MELTTRTLPAQKHIALVAHDHCKDMLMKWVARHQALLAQHILYATGTTGNLVSRATGLEVNAMLSGPMGGDQQVGALISEGKIDVLIFFWDPLNAVPHDPDVKALLRLATVWNIPVATNVSTADFIIQSPHFGQPLDILIPDYPRYLAERLK
>NZ_CP015130.1|WP_004179218.1|5130516_5132571_+|DNA-helicase-IV
MELKATTLGKRMAQHPYDRVQLLNAGVKVSGDRHEYLIPFNQLLSVHCKRGLVWGELEFVLPDGKVVRLHGTEWSETQRFYHHLHTLWQQWSTEMSDIAAGVLKQQLATIEHTRAEGKWLTRQQVADVQDNIRHALTGLPMPTSRLDAFDNCRELWRECQRWLGDIEATRLAHNQAFTEAMLEQYREFFDSVESSPLNASQARAVVNGERSLLVLAGAGSGKTSVLVARAGWLLARGEAAADQILLLAFGRQAAQEMDERIRERLASDDITARTFHSLALHIIQQGSKKVPTISKLESDTAARHALLLKSWQKQCQEKKAQAKGWRLWLEEEMGWQLPEGDFWQDKKVQRRMASRLDRWVSLMRMHGGSQAEMIAGAPEAVRDLFSKRVKLMSPLMKDWKAALKAENAVDFSGLIHQAVNILDKGRFVSPWKHILVDEFQDISPQRASLLAALRRQNSQTTLFAVGDDWQAIYRFSGAQLSLTTAFNHYFGEGDCCALDTTYRFNGRIGEIANGFIQQNPHQLSKPLNSLMAGDKKAVTLLADDKLDDLLDKLSGYVKPEQRILLLARYHHLKPEALNKAATRWPHLQLDFMTIHASKGQQADFVIVLGLQDGEDAFPAPARESIMEQALLPQPEDFPDAEERRLLYVALTRARHRVWLLFNKAQPSPFVEILQALDVPVARKP
>NZ_CP015130.1|WP_002898425.1|5129945_5130392_-|YccF-domain-containing-protein
MRTILNILNFILGGFATTLGWLLATLVSIILIVTLPLTRSCWEITRLSLFPYGNEAIHVDELEPGRKNGLLNAGGTVLNILWFIFFGWWLCLMHIFSGIAQCLTIIGIPVGIANFKIAAIALWPVGRRVVSVETARAAREANARRRFQ
>NZ_CP015130.1|WP_002898422.1|5127792_5129928_-|TIGR01666-family-membrane-protein
MISPLLRRYTWNSAWLYNVRIFIALCGTTLFPWWIGEVKLTIPLTLGVVAAALTDLDDRLAGRLRNLAITLVCFFIASASVELLFPWPPLFALGLTVSTIGFILLGGLGQRYATIAFGALLIAIYTMLGVTLYDHWYLQPLFLLAGAVWYNLLTLSGHLIFPIRPLQDNLARSYEQLARYLELKSRLFDPDLEDESQAPLYDLALANGQLVATLNQTKVSLLTRLRGDRGQRGTRRTLQYYFVAQDIHERASSSHIQYQTLRDQFRYSDVMFRFQRMLSMQAQACQKLSRAILLREPYQHDAHFERAFMHLDAALERVRAGGASDEQLNALGYLLNNLRAIDAQLATIESVQTTAPAGSNTETLLADDRLGGLSDIWLRLQRNMSPESALFRHAVRMSLVLCAGYAFIQFTGLQHGYWILLTSLFVCQPNYNATRHRLALRIIGTLVGVAIGLPVLLLVPSVEGQLLLIVLTGVLFFAFRNVQYAHATMFITLLVLLCFNLLGEGFEVALPRIIDTLIGCAIAWAAVSFIWPDWKFRNLPRVLDRAMNANCRYLDAILEQYHQGRDNRLAYRVARRDAYNRDAELASVVSNLSTEPRADATQRETAFRLLCLNHTFTSYISALGAHREKLSTPEILALLDDAVCYVDDALHHTPADEQRVQQALNSLQSRIHHLEPRADSKEPLVLQQIGLLLALLPEICRLQQRVHAQTE
>NZ_CP015130.1|WP_004179217.1|5127182_5127779_+|TfoX/Sxy-family-DNA-transformation-protein
MRKLVCPRLPQFQACVSPLGQLHTRPLFGGYSLAIDDTVFAMVAEGNIYLKACEQSAAYRVEHRNPLLTLRRHGRIVPLKYYQIDDTLWRDEQQLFRLSLLSWQSAQREKNCRRASGRLKDLPNISFHMELQLIHAGIPDVRTLREVGAQEAWLRLRVNNASLSLSVLLALEGAIAGVHAAALPTPRRQELLEWAATR
>NZ_CP015130.1|WP_002898418.1|5126324_5126834_-|cell-division-inhibitor-SulA
MFTSAHANRSAQASAPAGHYAHRSGEQNTNGLISEIVYREDQPMMTQLLLLPLLQQLGQQSRWQLWLTPQQKLSREWVQSAGLPLSKVMQISQLSPSHTIDSMIRALRTGNYSVVICWLAEELTADEHERLVNAAQVGSAMGFIMRPVRNQGTLGRQLSGLKIHSNLYH
>NZ_CP015130.1|WP_002898408.1|5124901_5125972_-|porin-OmpA
MKKTAIAIAVALAGFATVAQAAPKDNTWYAGGKLGWSQYHDTGFYGNGFQNNNGPTRNDQLGAGAFGGYQVNPYLGFEMGYDWLGRMAYKGSVDNGAFKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADSKGNYASTGVSRSEHDTGVSPVFAGGVEWAVTRDIATRLEYQWVNNIGDAGTVGTRPDNGMLSLGVSYRFGQEDAAPVVAPAPAPAPEVATKHFTLKSDVLFNFNKATLKPEGQQALDQLYTQLSNMDPKDGSAVVLGYTDRIGSEAYNQQLSEKRAQSVVDYLVAKGIPAGKISARGMGESNPVTGNTCDNVKARAALIDCLAPDRRVEIEVKGYKEVVTQPAA
>NZ_CP015130.1|WP_002898404.1|5124316_5124769_+|macrodomain-Ter-protein-MatP
MKYQQLENLESGWKWKYLVKKHREGELITRYIEASAAQAAVDDLLTLENEPVLVHAWIEQHMNPALMNRMKQTIRARRKRHFNAEHQHTRKKSIDLEFVVWQRLAGLAQRRGKTLSETIVQLIEDAEHKEKYASKMSSLKHDLQVLLGKE
>NZ_CP015130.1|WP_064840213.1|5122373_5124131_-|Lon-protease-family-protein
MTITKLTRTDLAPDLEAYQALFAQAELSHPAPSLSGDLQPRLFYGLEQLLYTPAVSSFMLVKAPEEPEYLQWLAAETRTLHEPAAPLYGVRYEVTDAQVTLAPAQGAEDNFASTAPVVMADWVEAEQLFGCVRQFNGAITLQPGLVHQANGGVLVLSLRTLLAQPLLWVRLKNMVTRQRFDWLSMDESRPLPVSIPSMPLSLKIILVGERESLADFQEMEPELAAQAIYSEYEDTLQFADADTLKAWCQWVWQNAQQLELPGPAADAWPLLIDEGTRYTGDQETLPLSPLWITRQLREAAAFCEGEEITGEAMQTMLARRIWREGYLAERMQDEILQEQILIETEGECVGQINALSVIEFPGHPRAFGEPSRISCVVHIGDGEFIDVERKAELGGNIHAKGMMIMQAFLMSELELEQQLPFTASLTFEQSYSEVDGDSASMAELCALISALANVPINQSIAITGSVDQFGRVQPVGGLNEKIEGFFTICQQRGLTGKQGVIIPAANVRHLSLSHELRQAVADNQFAIWAIDDITEALPMLTQLMWDGEGQTLRQTIQERIAQATQQETRHRFPWPLRWLGGTSSN
>NZ_CP015130.1|WP_004179227.1|5145237_5146674_+|TolC-family-outer-membrane-protein
MRLFQKKGMVSVYSCSTIFLSICVVLTVDAEELSFPPTSISTQRLNDTQQVAGYSEELINPESHLAGPLDIATAVKSAVNWHPAINQQVSKLQEQVQKVDVAKAKYYPQVNAGMNNGYSNTYSDSGYSPSLVVSVSQMLYDFGKVSSSVRAADAAVAQQQAMVMLNIDQVAHDTAGAVVQLQGYQKLVKIAQAQVDSLKHIGDLIRQRNDAGATSLSDVVQTDTRVEGAQATLIQYQAALERWKATLATYLGLGSITSVTESVPQAMDAACAVSKIDYRTVPAVLAALAQATQAQAQVDNATAQMLPTISLEPQVTHYLNDNYANSAVLNKTQYSAWVKVEMPIYQGGALTASREAAQQTLSAANAGIRNAQLDASQKLSASRDEAVNLKQSIAIQRRQQLLGEQTRALYQDQYLQLGTRPLLDLLNVDQEIYQAQFNQVLTEAQLRNLELDCLFSTGKMRAVFALDNQRIQGVEIRP
>NZ_CP015130.1|WP_064840214.1|5146670_5148818_+|type-I-secretion-system-permease/ATPase
MSEQPQRSDIPHLQDWANAMAFVASHYRQSYSPGTLHAAAEWATQKTLPDALKHLCRHAGLHCQFLNGNDRKMSAWRLPLVVQLKDGQIGIIESFDLHNSVGIRFVKELTLLSHCPLDSLLDEIEFTVAFRPASPEKDIRTESYLTRFQPDWLRKIVLKDWRPYTHVMLASLAINILALAGILFSMQVYDRVIPAQSYPTLYVLFSGVLIAAVFNFVLKITRGHVTDLLGKRGDIRISDRIFGHALRLKNTAVPRSTGSFISQIRELEQVREMMTSTMMTVIADLPFFLLFQLVLFIVSPWLSWIAPVATILMLLPGLLLQKKLAELANKNQHESTLRNAILVESIQGLPDIKMMQAESRFLQQWNSYVAITAESGVQTRKVTHGLVSWGMSIQNLLYATVVAVGAPLVINGDITTGAMVAASMLSSRMVAPMTALCGVLARWQQVKVAKASLDNLMALPVEGGLDEPRIHRAVLHGNYEFRNAEFRYGKDNGPAPLRIKQLSIKAGEKIAVLGRIGAGKSTLLQAMMGNVELTSGELRLDDLSLPQIDLADIRRNATLLTQEARLFHGTLRENVTLGRPMASDDELVKVLELCGALEFVNKLPMGLEHLVMEGGLGLSGGQRQSLLLARALIRDPNIILLDEPTSFFDERTEKAFVEQLARWAGERTLIIATHKAAVLNIVDRILVIQDGQLALDKPKATVFEQEKARAQVVNI
>NZ_CP015130.1|WP_004141638.1|5148814_5150035_+|HlyD-family-type-I-secretion-periplasmic-adaptor-subunit
MNKPTAAIFPLVKELDPVAAMADNERDEAELVKSRRLIALLALLLVVTGVWAWFATLDEVSTGTGKVIPSSREQVLQTLDGGILTELNVREGSRVAAGQVVARLDPTRSESNVGESQAKYRASLAASIRLTAEVNNQPLIFPPSLKAWPGLLAEETRLYHSRREQLTKSMRQLEQSLSLVNSELAINEKLAKTGAASNVEVLRLRQQAADIELKKIDLNTRYYVDAREQLSKANADVASLAEVIKGRADSVARLTVRSPVQGIVKNIKVNTIGGVIAPNGELMDIVPIDGRLLIEARISPRDIAFIHPDQKALVKITAYDYAIYGALNGVVETISPDTIQDEAKPDVYYYRVFIRTDHNYLENKRGKRFLIGPGMIATVDIKTGEKTVMDYLVKPFNRAKEALRER
>NZ_CP015130.1|WP_023159781.1|5150088_5153223_+|glycosyltransferase
MALSDLLQQACFQCKPLKTTALPADYPGWVIFFSVSDGKQRAHVHVSTAASFDQAWLAGARALQEWRKKQDNETQWLRIDIVDSVEKLTWENLLKKLNITKRNYFRFGISFDTQFTQAILEQEIAANALLYDGDNGVAAPNDINLENYGQRRFKRSLNWPSEPQQILWRFKTRSVFCDRNGAKLIEHTGRSSGYRVIGDEWQKNYLPEVIKKGSDYLARQVKKDGLYYYGWFPCFDRPVRSYNALRHASSTYSLIEGWEATKQPHLRQAIDRAIAYLVNNLISVRTLADGRQAAFLCDVENEIKLGGNAVSILALVKYTETTGDRQYLDLLSQLATGIAFMQDAQSGEFVHVLNSHDLSLKAKHRIIYYDGEAAFALMRLYSLTLAPQWLVMVEKAFEYFIRQKHWQHHDHWLSYCVNELTRFRPEERYFRFGLDNVRDHLDFVLQRVTTYPTLLELMMAAAEMIARLEASTTQRHLLDDFDKDKFYQALEARARYLLDGFFWPELAMFFKNPARIVNSFFIRHHSYRVRIDDVEHYLSGYIAYQKYFQAASKRQQSPIAAPPAPRGTTLFLLENLRDVGNGIEVAATRRARLFVEHLHTVPWLITAVWNPDLNDAVKALKARGALPEAVPVYNLYNALASCLSAGKIVPLPGLKGEVELRQTVVPKAEAPIGKNNYQLRPQGQLVEDYVDSAGNVLLRKYFDIKKANLQIIRMDVALPGGEVKSFNQQEAFFSWMLEMMLPAAGNWHFIVDKNKAWKDFVCSQPAQRMNCTVSAVIHSHHQLLNGGIKASYRHLLEQPQLVDRLIVLTDEQWQDLQQEGIPGARLVVIPNHMDDSKIPVNPQKEPSETVIYLARYSEEKQHLTLFNAFRKVSAQRPDARLHTYGVGPLRRKLSDQVKAWGLEDVIKINGFTSDIAAVHRHACCTVLCSNQEGQSLSAVEAMVYGTPLISFAIKYGPRDILQDRQAGILVPYGDEEALAAALVRVISDKALQKEMQAAAIRNARRYYATAIAGRWESWLQHNEQRMKEQEEKPLNVASLKQRVV
>NZ_CP015130.1|WP_040241201.1|5153369_5154245_+|peptidase
MVQESRCVKGSILLNHRLEKEYVEDDFHIFYSLQGRDALKYQYDSSGSGVPDSIKDIAGQLQAAKYLYSSVLGLRFPLQQKIYAQARQINVYVLQLPKGNGLAFDRVAAETMSDGRQLPCGLKFVLNAALEPARNITPAHEFFHLYQYGYAVFKQKWFLEGMARWMENSFKAPEKNTRRLSPLPHCDSNFTRGYNAANYWASFAQAHFADVAIPAAAQRFRYSDGSPVLIAQEVKGGAMLAPFFNQLAQGSAAQSRQLNQANIRWSEAQQRSPQFNEAICQALAAAVAKKK
>NZ_CP015130.1|WP_002898441.1|5154287_5154605_-|heat-shock-protein-HspQ
MIASKFGIGQQVRHTLLGYLGVIVDVDPEYSLAEPEEDEIAANDELRAAPWYHVVMEDDDGQPIHTYLAEAQLSSETRDEHPEQPSLDELAKTIRQQLQAPRLRN
>NZ_CP015130.1|WP_004141630.1|5154664_5155867_-|23S-rRNA-(cytosine(1962)-C(5))-methyltransferase-RlmI
MTDSLFPRLVLAKGREKSLLRRHPWIFSGGVARMEGKARSGETIDIVDHQGKWLARGAYSPSSQIRARVWTFDRNEAIDSAFFERRLQQAQTWRAWLAERDGLDSYRLIAGESDGLPGVTIDRFGNFFVLQLLSAGAEYQRAAIISALQNLFPDCAIYDRSDVAVRKKEGLELAQGPVVGELPPALLPITEHGMKLLVDIQGGHKTGYYLDQRDSRLATRRYVADKRVLNCFSYTGGFAVSALMGGCRQVTSVDTSQEALDVARQNVEINGLDLSKAEFVRDDVFKLLRKYRDQGEKFDVIVMDPPKFVENKSQLMGACRGYKDINMLAIQLLNPGGVLLTFSCSGLMTTDLFQKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM
>NZ_CP015130.1|WP_020324397.1|5156057_5156612_+|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein
MKTGIRMAVAMVTAVSSGAMAAPFSVSSNDMRDGQPLAQQHWFAGFGCTGGNVSPQLAWKNAPAGTRSFAVTVRDPDAPTGSGWWHWTVVNIASSVFSLPAGAGDKNSATLPGGAIQGRNDFGYAGFGGACPPAGDKPHRYRFTVWALDVPTLPVDAGASGALVGYLLHSHALASAQLTAMAGR
>NZ_CP015130.1|WP_004183586.1|5156629_5157418_+|AraC-family-transcriptional-regulator
MESIHFQHNALTAAEITTRRLCRLHRVRLFSPALCRVKRGSKVIVQGESRVLATPQQLIVLPADVELEVINQPENGLFCSDLLSLTPELLTRFKTRYLSEPPPGRLTSLCAPVTTELAFMWQSVLQAVREGLSVALQQHQTMGLLLALHEAGYAGPLLVERQQDLSAQVRQLIMLSPAQAWSVSRVAKMLFLGESTLRRRLQQESQSFRQIVEEVRMAHALGQLQTTSRPIGEIAQNSGYQSGSRFTARFRQHYGLLPKHVR
>NZ_CP015130.1|WP_004183587.1|5157466_5157748_+|acylphosphatase
MASICTMAWVYGSVQGVGFRYSTQREAMQLGVTGYARNLDDGGVEVLACGEAEQVEKLIAWLKAGGPRSARVDRVLTEPHQPTRSWDKFAILY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	NZ_CP015130.1	5142132-5142153	1	0.955
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	NZ_CP015130.1	5142078-5142099	2	0.909
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	NZ_CP015130.1	5142120-5142153	2	0.941

1. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to position: 5142132-5142153, mismatch: 1, identity: 0.955

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattctgacagt	Protospacer
***************.******

2. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to position: 5142078-5142099, mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgactcggattctgacagt	Protospacer
******.********.******

3. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to position: 5142120-5142153, mismatch: 2, identity: 0.941

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
ctccgattcggacagcgattcggattctgacagt	Protospacer
***.**.***************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1492-1519	0	1.0
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3364-3391	0	1.0
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1630-1651	0	1.0
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2650-2671	0	1.0
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3148-3169	0	1.0
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3202-3223	0	1.0
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3466-3487	0	1.0
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3562-3583	0	1.0
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1258-1285	1	0.964
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3100-3127	1	0.964
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151882-151909	1	0.964
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1072-1093	1	0.955
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1504-1525	1	0.955
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1558-1579	1	0.955
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1900-1921	1	0.955
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1972-1993	1	0.955
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2368-2389	1	0.955
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2686-2707	1	0.955
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3376-3397	1	0.955
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3688-3709	1	0.955
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153631-153652	1	0.955
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151840-151861	1	0.955
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151930-151951	1	0.955
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153097-153118	1	0.955
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153169-153190	1	0.955
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153613-153634	1	0.955
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153823-153844	1	0.955
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153949-153970	1	0.955
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154057-154078	1	0.955
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154219-154240	1	0.955
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155743-155764	1	0.955
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155917-155938	1	0.955
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156097-156118	1	0.955
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156571-156592	1	0.955
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157117-157138	1	0.955
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1000-1021	1	0.955
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	25-58	1	0.971
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2422-2455	1	0.971
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2602-2623	1	0.955
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1288-1321	1	0.971
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1396-1429	1	0.971
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2686-2719	1	0.971
NZ_CP015130_3	3.22\|5139873\|52\|NZ_CP015130\|CRT	5139873-5139924	52	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1126-1177	2	0.962
NZ_CP015130_3	3.22\|5139873\|52\|NZ_CP015130\|CRT	5139873-5139924	52	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153967-154018	2	0.962
NZ_CP015130_3	3.27\|5140329\|52\|NZ_CP015130\|CRT	5140329-5140380	52	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153169-153220	2	0.962
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1618-1645	2	0.929
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3550-3577	2	0.929
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3676-3703	2	0.929
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1546-1573	2	0.929
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153157-153184	2	0.929
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153211-153238	2	0.929
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153637-153664	2	0.929
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154741-154768	2	0.929
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154939-154966	2	0.929
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155137-155164	2	0.929
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155371-155398	2	0.929
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155491-155518	2	0.929
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156271-156298	2	0.929
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157429-157456	2	0.929
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151408-151435	2	0.929
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153085-153112	2	0.929
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153619-153646	2	0.929
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153895-153922	2	0.929
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	25-46	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1126-1147	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1288-1309	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1750-1771	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1846-1867	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2254-2275	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2404-2425	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2422-2443	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2872-2893	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3004-3025	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3622-3643	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151329-151350	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151384-151405	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151420-151441	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151456-151477	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151546-151567	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151582-151603	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151744-151765	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151762-151783	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151780-151801	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151858-151879	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151966-151987	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151984-152005	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153187-153208	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153205-153226	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153649-153670	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153667-153688	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153685-153706	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154429-154450	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154645-154666	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154663-154684	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154681-154702	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154699-154720	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154717-154738	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154771-154792	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154879-154900	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154897-154918	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154915-154936	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155059-155080	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155077-155098	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155095-155116	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155113-155134	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155167-155188	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155221-155242	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155293-155314	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155311-155332	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155329-155350	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155347-155368	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155401-155422	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155827-155848	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155863-155884	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155935-155956	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156805-156826	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156823-156844	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156841-156862	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156973-156994	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156991-157012	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157009-157030	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157549-157570	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1072-1093	2	0.909
NZ_CP015130_3	3.29\|5140449\|22\|NZ_CP015130\|CRT	5140449-5140470	22	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1108-1129	2	0.909
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2686-2719	2	0.941
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1252-1285	2	0.941
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1288-1321	2	0.941
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3094-3127	2	0.941
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154429-154462	2	0.941
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154315-154336	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154693-154714	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154711-154732	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154765-154786	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154909-154930	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155107-155128	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155161-155182	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155215-155236	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155341-155362	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155395-155416	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151287-151308	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151378-151399	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151414-151435	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151450-151471	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151630-151651	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151684-151705	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151738-151759	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151960-151981	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153199-153220	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153319-153340	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153625-153646	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153901-153922	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155053-155074	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155287-155308	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155821-155842	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155929-155950	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156403-156424	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156817-156838	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156985-157006	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157345-157366	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157543-157564	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1318-1339	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2176-2197	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2866-2887	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	19-40	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1120-1141	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1246-1267	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1282-1303	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1480-1501	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1840-1861	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2398-2419	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2644-2665	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2998-3019	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3196-3217	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3352-3373	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3460-3481	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3616-3637	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1066-1087	2	0.909
NZ_CP015130_3	3.31\|5140545\|22\|NZ_CP015130\|CRT	5140545-5140566	22	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1102-1123	2	0.909
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	25-58	2	0.941
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2422-2455	2	0.941
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1072-1105	2	0.941
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1504-1537	2	0.941
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1900-1933	2	0.941
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1972-2005	2	0.941
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2554-2587	2	0.941
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151293-151326	2	0.941
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151329-151362	2	0.941
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154429-154462	2	0.941
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151930-151963	2	0.941
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157081-157114	2	0.941
NZ_CP015130_3	3.35\|5140791\|40\|NZ_CP015130\|CRT	5140791-5140830	40	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2608-2647	2	0.95
NZ_CP015130_3	3.22\|5139873\|52\|NZ_CP015130\|CRT	5139873-5139924	52	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156619-156670	3	0.942
NZ_CP015130_3	3.27\|5140329\|52\|NZ_CP015130\|CRT	5140329-5140380	52	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151420-151471	3	0.942
NZ_CP015130_3	3.27\|5140329\|52\|NZ_CP015130\|CRT	5140329-5140380	52	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154003-154054	3	0.942
NZ_CP015130_3	3.27\|5140329\|52\|NZ_CP015130\|CRT	5140329-5140380	52	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155521-155572	3	0.942
NZ_CP015130_3	3.27\|5140329\|52\|NZ_CP015130\|CRT	5140329-5140380	52	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1864-1915	3	0.942
NZ_CP015130_3	3.27\|5140329\|52\|NZ_CP015130\|CRT	5140329-5140380	52	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2236-2287	3	0.942
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1564-1591	3	0.893
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1738-1765	3	0.893
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1852-1879	3	0.893
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2260-2287	3	0.893
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2392-2419	3	0.893
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3154-3181	3	0.893
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156607-156634	3	0.893
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151786-151813	3	0.893
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151846-151873	3	0.893
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153655-153682	3	0.893
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153673-153700	3	0.893
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153859-153886	3	0.893
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154471-154498	3	0.893
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154669-154696	3	0.893
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154885-154912	3	0.893
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155047-155074	3	0.893
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155083-155110	3	0.893
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155281-155308	3	0.893
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155317-155344	3	0.893
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155941-155968	3	0.893
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156031-156058	3	0.893
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156379-156406	3	0.893
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156415-156442	3	0.893
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156559-156586	3	0.893
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156811-156838	3	0.893
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156829-156856	3	0.893
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156979-157006	3	0.893
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156997-157024	3	0.893
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157555-157582	3	0.893
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21235-21262	3	0.893
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1060-1087	3	0.893
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15856-15883	3	0.893
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9793-9820	3	0.893
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9937-9964	3	0.893
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1486-1519	3	0.912
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1558-1591	3	0.912
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1612-1645	3	0.912
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1846-1879	3	0.912
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2062-2095	3	0.912
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3358-3391	3	0.912
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3544-3577	3	0.912
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153151-153184	3	0.912
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155485-155518	3	0.912
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156265-156298	3	0.912
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2254-2287	3	0.912
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1450-1483	3	0.912
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157027-157060	3	0.912
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1018-1051	3	0.912
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1072-1105	3	0.912
NZ_CP015130_3	3.33\|5140641\|52\|NZ_CP015130\|CRT	5140641-5140692	52	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1306-1357	3	0.942
NZ_CP015130_3	3.36\|5140851\|52\|NZ_CP015130\|CRT	5140851-5140902	52	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154735-154786	3	0.942
NZ_CP015130_3	3.36\|5140851\|52\|NZ_CP015130\|CRT	5140851-5140902	52	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155131-155182	3	0.942
NZ_CP015130_3	3.36\|5140851\|52\|NZ_CP015130\|CRT	5140851-5140902	52	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155365-155416	3	0.942
NZ_CP015130_3	3.36\|5140851\|52\|NZ_CP015130\|CRT	5140851-5140902	52	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156025-156076	3	0.942
NZ_CP015130_3	3.36\|5140851\|52\|NZ_CP015130\|CRT	5140851-5140902	52	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156373-156424	3	0.942
NZ_CP015130_3	3.22\|5139873\|52\|NZ_CP015130\|CRT	5139873-5139924	52	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154255-154306	4	0.923
NZ_CP015130_3	3.27\|5140329\|52\|NZ_CP015130\|CRT	5140329-5140380	52	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153541-153592	4	0.923
NZ_CP015130_3	3.27\|5140329\|52\|NZ_CP015130\|CRT	5140329-5140380	52	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3292-3343	4	0.923
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	31-58	4	0.857
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1078-1105	4	0.857
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1906-1933	4	0.857
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2188-2215	4	0.857
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2428-2455	4	0.857
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2692-2719	4	0.857
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2770-2797	4	0.857
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3028-3055	4	0.857
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151239-151266	4	0.857
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151642-151669	4	0.857
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151696-151723	4	0.857
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151972-151999	4	0.857
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153691-153718	4	0.857
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153793-153820	4	0.857
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154327-154354	4	0.857
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156067-156094	4	0.857
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156133-156160	4	0.857
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156205-156232	4	0.857
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157357-157384	4	0.857
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157519-157546	4	0.857
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157645-157672	4	0.857
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2764-2797	4	0.882
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2968-3001	4	0.882
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154465-154498	4	0.882
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2968-3001	4	0.882
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1846-1879	4	0.882
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3022-3055	4	0.882
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151780-151813	4	0.882
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153823-153856	4	0.882
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156097-156130	4	0.882
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156571-156604	4	0.882
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157477-157510	4	0.882
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157549-157582	4	0.882
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1108-1141	4	0.882
NZ_CP015130_3	3.24\|5140053\|58\|NZ_CP015130\|CRT	5140053-5140110	58	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2212-2269	5	0.914
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154099-154126	5	0.821
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154135-154162	5	0.821
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2887814-2887841	5	0.821
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153823-153856	5	0.853
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156097-156130	5	0.853
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156571-156604	5	0.853
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157639-157672	5	0.853
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2764-2797	5	0.853
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154183-154216	5	0.853
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153829-153856	6	0.786
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156103-156130	6	0.786
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156577-156604	6	0.786
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152044-152071	6	0.786
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157639-157672	6	0.824
NZ_CP015130_3	3.35\|5140791\|40\|NZ_CP015130\|CRT	5140791-5140830	40	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3202-3241	6	0.85
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1186-1213	7	0.75
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2134-2161	7	0.75
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1180-1213	7	0.794
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151798-151831	7	0.794
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16445-16478	7	0.794
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16739-16772	7	0.794
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17123-17156	7	0.794
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17735-17768	7	0.794
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18497-18530	7	0.794
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19217-19250	7	0.794
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154537-154570	7	0.794
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154807-154840	7	0.794
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156145-156178	7	0.794
NZ_CP015130_3	3.35\|5140791\|40\|NZ_CP015130\|CRT	5140791-5140830	40	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2764-2803	7	0.825
NZ_CP015130_3	3.28\|5140401\|28\|NZ_CP015130\|CRT	5140401-5140428	28	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	5098655-5098682	8	0.714
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2128-2161	8	0.765
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154537-154570	8	0.765
NZ_CP015130_3	3.30\|5140491\|34\|NZ_CP015130\|CRT	5140491-5140524	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154807-154840	8	0.765
NZ_CP015130_3	3.32\|5140587\|34\|NZ_CP015130\|CRT	5140587-5140620	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152020-152053	8	0.765
NZ_CP015130_3	3.36\|5140851\|52\|NZ_CP015130\|CRT	5140851-5140902	52	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154285-154336	8	0.846
NZ_CP015130_3	3.26\|5140239\|70\|NZ_CP015130\|CRT	5140239-5140308	70	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157585-157654	13	0.814
NZ_CP015130_3	3.5\|5137419\|148\|NZ_CP015130\|CRT	5137419-5137566	148	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1306-1453	90	0.392

1. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 0, identity: 1.0

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggactccgacagtgattcggattcg	Protospacer
****************************

2. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 0, identity: 1.0

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggactccgacagtgattcggattcg	Protospacer
****************************

3. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 0, identity: 1.0

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattccgacagt	Protospacer
**********************

4. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 0, identity: 1.0

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattccgacagt	Protospacer
**********************

5. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 0, identity: 1.0

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattccgacagt	Protospacer
**********************

6. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 0, identity: 1.0

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattccgacagt	Protospacer
**********************

7. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 0, identity: 1.0

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattccgacagt	Protospacer
**********************

8. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 0, identity: 1.0

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattccgacagt	Protospacer
**********************

9. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.964

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctcggactccgacagtgattcggattcg	Protospacer
.***************************

10. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.964

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctcggactccgacagtgattcggattcg	Protospacer
.***************************

11. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.964

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggactccgacagtgattccgattcg	Protospacer
********************* ******

12. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.955

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattctgacagt	Protospacer
***************.******

13. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.955

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggactccgacagt	Protospacer
************.*********

14. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.955

cagcgattcggattccgacagt	CRISPR spacer
cagtgattcggattccgacagt	Protospacer
***.******************

15. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.955

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattctgacagt	Protospacer
***************.******

16. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.955

cagcgattcggattccgacagt	CRISPR spacer
cagcgattccgattccgacagt	Protospacer
********* ************

17. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.955

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattctgacagt	Protospacer
***************.******

18. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.955

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattctgacagt	Protospacer
***************.******

19. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.955

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggactccgacagt	Protospacer
************.*********

20. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.955

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggactccgacagt	Protospacer
************.*********

21. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.955

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattccgacagc	Protospacer
*********************.

22. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.955

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattcggacagt	Protospacer
*************** ******

23. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.955

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattctgacagt	Protospacer
***************.******

24. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.955

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggactccgacagt	Protospacer
************.*********

25. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.955

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggactccgacagt	Protospacer
************.*********

26. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.955

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattcggacagt	Protospacer
*************** ******

27. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.955

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattctgacagt	Protospacer
***************.******

28. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.955

cagcgattcggattccgacagt	CRISPR spacer
cagcgactcggattccgacagt	Protospacer
******.***************

29. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.955

cagcgattcggattccgacagt	CRISPR spacer
cagcgactcggattccgacagt	Protospacer
******.***************

30. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.955

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggactccgacagt	Protospacer
************.*********

31. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.955

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggactccgacagt	Protospacer
************.*********

32. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.955

cagcgattcggattccgacagt	CRISPR spacer
cagcgactcggattccgacagt	Protospacer
******.***************

33. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.955

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattctgacagt	Protospacer
***************.******

34. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.955

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattctgacagt	Protospacer
***************.******

35. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.955

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggactccgacagt	Protospacer
************.*********

36. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 1, identity: 0.955

cagcgattcggattccgacagt	CRISPR spacer
cagcgattccgattccgacagt	Protospacer
********* ************

37. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.971

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
ctctgactccgacagcgattcggattctgacagc	Protospacer
***************.******************

38. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.971

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
ctctgactccgacagcgattcggattctgacagc	Protospacer
***************.******************

39. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.955

ttcggattccgacagcgactca	CRISPR spacer
ttcggattctgacagcgactca	Protospacer
*********.************

40. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.971

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
ctctgactcggacagcgattcggattctgacagc	Protospacer
*********************************.

41. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.971

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
ctctgactcggacagcgattcggactctgacagt	Protospacer
************************.*********

42. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.971

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
ctctgactccgacagcgattcggattctgacagt	Protospacer
********* ************************

43. spacer 3.22|5139873|52|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.962

ttccgactccgacagtgactccgactctgacagcgattcggactccgacagc	CRISPR spacer
ctccgactccgacagtgactcggactctgacagcgattcggactccgacagc	Protospacer
.******************** ******************************

44. spacer 3.22|5139873|52|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.962

ttccgactccgacagtgactccgactctgacagcgattcggactccgacagc	CRISPR spacer
ttccgactccgacagtgactccgattctgacagcgattcggactctgacagc	Protospacer
************************.********************.******

45. spacer 3.27|5140329|52|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.962

ttcggattcggacagcgactcggattctgacagcgattccgactccgacagt	CRISPR spacer
ttcggattcggacagcgactcggattccgacagcgattcggactccgacagt	Protospacer
***************************.*********** ************

46. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggattccgacagtgattcggattct	Protospacer
******.********************

47. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggattccgacagtgattcggattct	Protospacer
******.********************

48. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggactccgacagtgattcggactcc	Protospacer
************************.**

49. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggattccgacagtgattcggactcg	Protospacer
******.*****************.***

50. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggactccgacagtgactcggattct	Protospacer
******************.********

51. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctcggactccgacagcgattcggattcg	Protospacer
.**************.************

52. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggactccgacagcgattcggattcc	Protospacer
***************.***********

53. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctcggactccgacagtgattccgattcg	Protospacer
.******************** ******

54. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctcggactccgacagtgattccgattcg	Protospacer
.******************** ******

55. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctcggactccgacagtgattccgattcg	Protospacer
.******************** ******

56. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctcggactccgacagtgattccgattcg	Protospacer
.******************** ******

57. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggactccgacagtgattccgattct	Protospacer
********************* *****

58. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggactccgacagtgattccgattct	Protospacer
********************* *****

59. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctcggactccgacagtgattcggactcg	Protospacer
.***********************.***

60. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggactccgacagcgactcggattcg	Protospacer
***************.**.*********

61. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggactccgacagtgactccgattcg	Protospacer
******************.** ******

62. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggattccgacagcgattcggattcg	Protospacer
******.********.************

63. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggactccgacagcgactcggattcg	Protospacer
***************.**.*********

64. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattctgacagc	Protospacer
***************.*****.

65. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggactccgacagc	Protospacer
************.********.

66. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattctgacagc	Protospacer
***************.*****.

67. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggactccgacagc	Protospacer
************.********.

68. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattctgacagc	Protospacer
***************.*****.

69. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattctgacagc	Protospacer
***************.*****.

70. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggactccgacagc	Protospacer
************.********.

71. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattctgacagc	Protospacer
***************.*****.

72. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgactcggattccgacagc	Protospacer
******.**************.

73. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggactccgacagc	Protospacer
************.********.

74. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattctgacagc	Protospacer
***************.*****.

75. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
tagcgattcggattctgacagt	Protospacer
.**************.******

76. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggactccgacagc	Protospacer
************.********.

77. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggactccgacagc	Protospacer
************.********.

78. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattcggacagc	Protospacer
*************** *****.

79. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgactcggattccgacagc	Protospacer
******.**************.

80. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgactcggattccgacagc	Protospacer
******.**************.

81. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattctgacagc	Protospacer
***************.*****.

82. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattctgacagc	Protospacer
***************.*****.

83. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattctgacagc	Protospacer
***************.*****.

84. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgactcggattccgacagc	Protospacer
******.**************.

85. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattctgacagc	Protospacer
***************.*****.

86. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgactcggattccgacagc	Protospacer
******.**************.

87. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgactcggattccgacagc	Protospacer
******.**************.

88. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattcggacagc	Protospacer
*************** *****.

89. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggactccgacagc	Protospacer
************.********.

90. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggactccgacagc	Protospacer
************.********.

91. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggactccgacagc	Protospacer
************.********.

92. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattctgacagc	Protospacer
***************.*****.

93. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattcggacagc	Protospacer
*************** *****.

94. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattcggacagc	Protospacer
*************** *****.

95. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgactcggattccgacagc	Protospacer
******.**************.

96. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgactcggattccgacagc	Protospacer
******.**************.

97. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgactcggattccgacagc	Protospacer
******.**************.

98. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgactcggattccgacagc	Protospacer
******.**************.

99. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattcggacagc	Protospacer
*************** *****.

100. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgactcggattccgacagc	Protospacer
******.**************.

101. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgactcggattccgacagc	Protospacer
******.**************.

102. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggactccgacagc	Protospacer
************.********.

103. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattcggacagc	Protospacer
*************** *****.

104. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgactcggattccgacagc	Protospacer
******.**************.

105. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgactcggattccgacagc	Protospacer
******.**************.

106. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgactcggattccgacagc	Protospacer
******.**************.

107. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgactcggattccgacagc	Protospacer
******.**************.

108. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggactccgacagc	Protospacer
************.********.

109. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattcggacagc	Protospacer
*************** *****.

110. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgactcggattccgacagc	Protospacer
******.**************.

111. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgactcggattccgacagc	Protospacer
******.**************.

112. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgactcggattccgacagc	Protospacer
******.**************.

113. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattcggacagc	Protospacer
*************** *****.

114. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgactcggattccgacagc	Protospacer
******.**************.

115. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattcggacagc	Protospacer
*************** *****.

116. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgactcggattccgacagc	Protospacer
******.**************.

117. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggactccgacagc	Protospacer
************.********.

118. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggactccgacagc	Protospacer
************.********.

119. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgactcggattccgacagc	Protospacer
******.**************.

120. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggactccgacagc	Protospacer
************.********.

121. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggactccgacagc	Protospacer
************.********.

122. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattctgacagc	Protospacer
***************.*****.

123. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggactccgacagc	Protospacer
************.********.

124. spacer 3.29|5140449|22|NZ_CP015130|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.909

cagcgattcggattccgacagt	CRISPR spacer
cagcgattcggattctgacagc	Protospacer
***************.*****.

125. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.941

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
ctctgactccgacagcgattcggattctgacagt	Protospacer
***************.*****************.

126. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.941

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
ctcggactccgacagtgattcggattcggacagc	Protospacer
*** *********************** ******

127. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.941

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
ctctgactcggacagcgattcggattctgacagc	Protospacer
********* *****.******************

128. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.941

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
ctcggactccgacagtgattcggattcggacagc	Protospacer
*** *********************** ******

129. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
ctctgactctgacagcgattcggattctgacagc	Protospacer
*********.*****.******************

130. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ctcggattccgacagcgactcg	Protospacer
.********************.

131. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ctcggattccgacagcgactcg	Protospacer
.********************.

132. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ctcggattccgacagcgactcg	Protospacer
.********************.

133. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ctcggattccgacagcgactcg	Protospacer
.********************.

134. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ctcggattccgacagcgactcg	Protospacer
.********************.

135. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ctcggattccgacagcgactcg	Protospacer
.********************.

136. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ctcggattccgacagcgactcg	Protospacer
.********************.

137. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ctcggattccgacagcgactcg	Protospacer
.********************.

138. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ctcggattccgacagcgactcg	Protospacer
.********************.

139. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ctcggattccgacagcgactcg	Protospacer
.********************.

140. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttcggattctgacagcgactct	Protospacer
*********.***********

141. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttcggactccgacagcgactcg	Protospacer
******.**************.

142. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttcggactccgacagcgactcg	Protospacer
******.**************.

143. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttcggattcggacagcgactcg	Protospacer
********* ***********.

144. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttccgattccgacagcgactcg	Protospacer
*** *****************.

145. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttccgattccgacagcgactcg	Protospacer
*** *****************.

146. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttcggattctgacagcgactcg	Protospacer
*********.***********.

147. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttcggattctgacagcgactcg	Protospacer
*********.***********.

148. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttcggattcggacagcgactcg	Protospacer
********* ***********.

149. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttccgattccgacagcgactcg	Protospacer
*** *****************.

150. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttcggattccgacagcgattcg	Protospacer
******************.**.

151. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttcggactccgacagcgactcg	Protospacer
******.**************.

152. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttcggactccgacagcgactcg	Protospacer
******.**************.

153. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttcggactccgacagcgactcg	Protospacer
******.**************.

154. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttcggattcggacagcgactcg	Protospacer
********* ***********.

155. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttcggattcggacagcgactcg	Protospacer
********* ***********.

156. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttccgattccgacagcgactcg	Protospacer
*** *****************.

157. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttcggactccgacagcgactcg	Protospacer
******.**************.

158. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttcggactccgacagcgactcg	Protospacer
******.**************.

159. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttccgattccgacagcgactcg	Protospacer
*** *****************.

160. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttcggattctgacagcgactcg	Protospacer
*********.***********.

161. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ctcggattccgacagcgactct	Protospacer
.********************

162. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ctcggattccgacagcgactcg	Protospacer
.********************.

163. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ctcggattccgacagcgactcg	Protospacer
.********************.

164. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttcggattctgacagcgactct	Protospacer
*********.***********

165. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttcggactccgacagcgactcg	Protospacer
******.**************.

166. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttcggattcggacagcgactcc	Protospacer
********* ***********

167. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttcggattctgacagcgactcg	Protospacer
*********.***********.

168. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttcggattcggacagcgactct	Protospacer
********* ***********

169. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttcggattctgacagcgactcc	Protospacer
*********.***********

170. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttcggactccgacagcgactcg	Protospacer
******.**************.

171. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttcggattccgacagtgactcc	Protospacer
***************.*****

172. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttcggactccgacagcgactct	Protospacer
******.**************

173. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttcggattccgacagtgactcc	Protospacer
***************.*****

174. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttcggattcggacagcgactcc	Protospacer
********* ***********

175. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttcggattccgacagtgactct	Protospacer
***************.*****

176. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttcggattctgacagcgactcc	Protospacer
*********.***********

177. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttcggactccgacagcgactcg	Protospacer
******.**************.

178. spacer 3.31|5140545|22|NZ_CP015130|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.909

ttcggattccgacagcgactca	CRISPR spacer
ttcggattctgacagcgactct	Protospacer
*********.***********

179. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.941

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
ctctgactccgacagcgattcggattctgacagc	Protospacer
********* ***********************.

180. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.941

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
ctctgactccgacagcgattcggattctgacagc	Protospacer
********* ***********************.

181. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.941

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
ctcggactctgacagcgattcggattctgacagt	Protospacer
*** ***** ************************

182. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.941

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
ctctgactcggacagcgattcggactccgacagt	Protospacer
************************.**.******

183. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.941

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
ctcggactctgacagcgattcggattctgacagt	Protospacer
*** ***** ************************

184. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.941

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
ctctgactcggacagcgattccgattccgacagt	Protospacer
********************* *****.******

185. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.941

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
ctctgactcggacagcgattcggactctgatagt	Protospacer
************************.*****.***

186. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
ctctgactcggatagcgattcggattctgacagc	Protospacer
************.********************.

187. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
ttctgactcggatagcgattcggattctgacagt	Protospacer
.***********.*********************

188. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
ctctgactctgacagcgattcggattctgacagc	Protospacer
********* ***********************.

189. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
ctcggattcggacagcgattcggattctgacagt	Protospacer
*** **.***************************

190. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
ctctgactctgacagcgattcggactctgacagt	Protospacer
********* **************.*********

191. spacer 3.35|5140791|40|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.95

ctcggactccgacagcgacagcgattcggattctgacagc	CRISPR spacer
ctccgactccgacagcgacagtgattcggattctgacagc	Protospacer
*** *****************.******************

192. spacer 3.22|5139873|52|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.942

ttccgactccgacagtgactccgactctgacagcgattcggactccgacagc	CRISPR spacer
ttcggactccgacagtgactccgactctgacagcgactcggactccgacagt	Protospacer
*** ********************************.**************.

193. spacer 3.27|5140329|52|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.942

ttcggattcggacagcgactcggattctgacagcgattccgactccgacagt	CRISPR spacer
ttcggattcggacagcgactcggattcggacagcgattcggactccgacagc	Protospacer
*************************** *********** ***********.

194. spacer 3.27|5140329|52|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.942

ttcggattcggacagcgactcggattctgacagcgattccgactccgacagt	CRISPR spacer
ctccgattcggacagcgactcggattcggacagcgattccgactccgacagt	Protospacer
.** *********************** ************************

195. spacer 3.27|5140329|52|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.942

ttcggattcggacagcgactcggattctgacagcgattccgactccgacagt	CRISPR spacer
ctcggattcggacagcgactcggattcggacagcgattccgactctgacagt	Protospacer
.************************** *****************.******

196. spacer 3.27|5140329|52|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.942

ttcggattcggacagcgactcggattctgacagcgattccgactccgacagt	CRISPR spacer
ttcggattctgacagtgactcggattctgacagcgattccgactccgacagc	Protospacer
********* *****.***********************************.

197. spacer 3.27|5140329|52|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.942

ttcggattcggacagcgactcggattctgacagcgattccgactccgacagt	CRISPR spacer
ttcggactcggacagcgattcggattctgacagcgattccgactccgacagc	Protospacer
******.***********.********************************.

198. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctccgactccgacagtgattcggattcc	Protospacer
.** ***********************

199. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggactccgacagcgattcggatgct	Protospacer
***************.********* *

200. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttccgactccgacagcgattcggattct	Protospacer
*** ***********.***********

201. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggactcggacagcgattcggattct	Protospacer
********* *****.***********

202. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggactccgacagcgactcggattct	Protospacer
***************.**.********

203. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggactctgacagcgattcggattcc	Protospacer
*********.*****.***********

204. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctcggactccgacagtgattccgattca	Protospacer
.******************** *****.

205. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggactctgacagcgattcggattct	Protospacer
*********.*****.***********

206. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctcggattccgacagcgattcggattcg	Protospacer
.*****.********.************

207. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggactccgacagcgattcggactcc	Protospacer
***************.********.**

208. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggactccgacagcgattcggactcc	Protospacer
***************.********.**

209. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggactctgacagtgattccgattca	Protospacer
*********.*********** *****.

210. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttccgactccgacagtgattcggactct	Protospacer
*** ********************.**

211. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctcggattccgacagcgattcggattcg	Protospacer
.*****.********.************

212. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctcggattccgacagcgattcggattcg	Protospacer
.*****.********.************

213. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggactccgacagcgactcggattct	Protospacer
***************.**.********

214. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctcggattccgacagcgattcggattcg	Protospacer
.*****.********.************

215. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggactccgacagcgactcggattct	Protospacer
***************.**.********

216. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctcggattccgacagcgattcggattcg	Protospacer
.*****.********.************

217. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctcggactctgacagcgattcggattcg	Protospacer
.********.*****.************

218. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctcggactccgacagtgactccgattcg	Protospacer
.*****************.** ******

219. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctcggactccgacagtgactccgattcg	Protospacer
.*****************.** ******

220. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttccgactccgacagtgattccgattcc	Protospacer
*** ***************** *****

221. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggattctgacagtgattcggattct	Protospacer
******.**.*****************

222. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggactccgacagcgactcggattcc	Protospacer
***************.**.********

223. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggactccgacagcgattcggactcc	Protospacer
***************.********.**

224. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggactccgacagcgactcggattcc	Protospacer
***************.**.********

225. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggactccgacagcgattcggactcc	Protospacer
***************.********.**

226. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggactctgacagcgattcggattct	Protospacer
*********.*****.***********

227. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggactcagacagtgattcagattca	Protospacer
********* ***********.*****.

228. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggactccgacagcgactcggattct	Protospacer
***************.**.********

229. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggactcagacagtgattcagattca	Protospacer
********* ***********.*****.

230. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggactcagacagtgattcagattca	Protospacer
********* ***********.*****.

231. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.893

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggactcagacagtgattcagattca	Protospacer
********* ***********.*****.

232. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.912

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
ttcggactccgacagtgattcggattcggacagc	Protospacer
.** *********************** ******

233. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.912

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
ctccgactccgacagtgattcggattccgacagt	Protospacer
***.***********************.*****.

234. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.912

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
ttcggattccgacagtgattcggattctgacagc	Protospacer
.** **.***************************

235. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.912

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
ttccgactccgacagcgattcggattctgacagc	Protospacer
.**.***********.******************

236. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.912

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
ttctgactctgacagtgactcggattctgacagc	Protospacer
.********.********.***************

237. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.912

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
ttcggactccgacagtgattcggattcggacagc	Protospacer
.** *********************** ******

238. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.912

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
ttcggattccgacagtgattcggattctgacagc	Protospacer
.** **.***************************

239. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
ttcggactccgacagtgactcggattctgacagc	Protospacer
.** **************.***************

240. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
ttcggactccgacagtgattccgattctgacagc	Protospacer
.** ***************** ************

241. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
ttcggactccgacagtgattccgattctgacagc	Protospacer
.** ***************** ************

242. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.912

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
ttcggactcggacagcgattcggattctgacagc	Protospacer
.** *****************************.

243. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.912

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
ctctgactcggacagcgactcggatgctgacagc	Protospacer
******************.****** *******.

244. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
ctctgactctgacagcgattcggactctgacagc	Protospacer
********* **************.********.

245. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.912

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
ctctgactctgacagcgattcggactctgacagc	Protospacer
********* **************.********.

246. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.912

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
ctctgactcggacagcgattcggactccgacagc	Protospacer
************************.**.*****.

247. spacer 3.33|5140641|52|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.942

ttccgactccgacagcgactcggattccgacagcgactctgactcggacagc	CRISPR spacer
ctccgattccgacagtgactcggattccgacagcgactctgactcggacagc	Protospacer
.*****.********.************************************

248. spacer 3.36|5140851|52|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.942

ttcggattccgacagcgactcggactctgacagtgactccgattcggacagc	CRISPR spacer
ctcggattccgacagcgactcggactccgacagtgattccgattcggacagc	Protospacer
.**************************.********.***************

249. spacer 3.36|5140851|52|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.942

ttcggattccgacagcgactcggactctgacagtgactccgattcggacagc	CRISPR spacer
ctcggattccgacagcgactcggactccgacagtgattccgattcggacagc	Protospacer
.**************************.********.***************

250. spacer 3.36|5140851|52|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.942

ttcggattccgacagcgactcggactctgacagtgactccgattcggacagc	CRISPR spacer
ctcggattccgacagcgactcggactccgacagtgattccgattcggacagc	Protospacer
.**************************.********.***************

251. spacer 3.36|5140851|52|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.942

ttcggattccgacagcgactcggactctgacagtgactccgattcggacagc	CRISPR spacer
ctcggactccgacagcgactcggactccgacagtgactccgattcggacagc	Protospacer
.*****.********************.************************

252. spacer 3.36|5140851|52|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.942

ttcggattccgacagcgactcggactctgacagtgactccgattcggacagc	CRISPR spacer
ttccgattccgacagcgactcggactccgacagtgactccgattcggacagt	Protospacer
*** ***********************.***********************.

253. spacer 3.22|5139873|52|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.923

ttccgactccgacagtgactccgactctgacagcgattcggactccgacagc	CRISPR spacer
cagcgactccgacagtgactccgactctgacagcgattcggactctgacagc	Protospacer
.  ******************************************.******

254. spacer 3.27|5140329|52|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.923

ttcggattcggacagcgactcggattctgacagcgattccgactccgacagt	CRISPR spacer
ctccgattcggacagcgactcggattctgacagcgactccgactccgacagc	Protospacer
.** ********************************.**************.

255. spacer 3.27|5140329|52|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.923

ttcggattcggacagcgactcggattctgacagcgattccgactccgacagt	CRISPR spacer
ctcggattcggacagcgactccgattctgacagtgattccgactccgacagc	Protospacer
.******************** ***********.*****************.

256. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctctgactccgacagcgattcggattct	Protospacer
.** ***********.***********

257. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctcggactctgacagcgattcggattct	Protospacer
.********.*****.***********

258. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctcggactctgacagcgattcggattct	Protospacer
.********.*****.***********

259. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctcggactctgacagtgactcggattcc	Protospacer
.********.********.********

260. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctctgactccgacagcgattcggattct	Protospacer
.** ***********.***********

261. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctctgactccgacagcgattcggattct	Protospacer
.** ***********.***********

262. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctccgactccgacagcgattcggattct	Protospacer
.** ***********.***********

263. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggactcggacagcgattcggatgct	Protospacer
********* *****.********* *

264. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctcggactccgacagcgactcggattct	Protospacer
.**************.**.********

265. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctcggactctgacagtgattccgattcc	Protospacer
.********.*********** *****

266. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctcggactctgacagtgattccgattcc	Protospacer
.********.*********** *****

267. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctcggattccgacagcgattcggattct	Protospacer
.*****.********.***********

268. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctcggactccgacagcgattcggactcc	Protospacer
.**************.********.**

269. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctcggactccgacagtgactcggactcc	Protospacer
.*****************.*****.**

270. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctcggactctgacagtgactcggattcc	Protospacer
.********.********.********

271. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctcggactccgacagtgactcggactcc	Protospacer
.*****************.*****.**

272. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctcggactctgacagtgattccgattca	Protospacer
.********.*********** *****.

273. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctcggactccgacagcgactcggattct	Protospacer
.**************.**.********

274. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctcggactctgacagtgattccgattcc	Protospacer
.********.*********** *****

275. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctcggactctgacagtgattccgattcc	Protospacer
.********.*********** *****

276. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttcggactccgacagtgattcggattcg	CRISPR spacer
tgcggactccgacagcgattccgattct	Protospacer
* *************.***** *****

277. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.882

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
ctccgactccgacagcgattcggattctgactcc	Protospacer
***.***********.***************  *

278. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.882

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
ctctgactctgacagcgattcggattctgactcc	Protospacer
*********.*****.***************  *

279. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
ttccgactccgacagtgattcggactctgacagt	Protospacer
.**.********************.********.

280. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.882

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
ctctgactctgacagcgattcggattctgactcc	Protospacer
********* *********************  .

281. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.882

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
ttccgactccgacagcgattcggattctgacagc	Protospacer
.**.***** ***********************.

282. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.882

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
ttcggactcggacagcgattcggatgctgacagc	Protospacer
.** ********************* *******.

283. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
ttcggactctgacagcgattcggattctgacagc	Protospacer
.** ***** ***********************.

284. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
cagcgactccgacagcgattcggattctgacagt	Protospacer
*  .***** ************************

285. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
cagcgactccgacagcgattcggattctgacagt	Protospacer
*  .***** ************************

286. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
cagcgactccgacagcgattcggattctgacagt	Protospacer
*  .***** ************************

287. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
ttcggactcggacagcgattcggactctgacagc	Protospacer
.** ********************.********.

288. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
ttcggactctgacagcgattcggattctgacagc	Protospacer
.** ***** ***********************.

289. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.882

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
ttccgactctgacagcgattcggattctgacagc	Protospacer
.**.***** ***********************.

290. spacer 3.24|5140053|58|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.914

ttcggactctgacagcgattccgactccgacagcgactctgactccgacagcgacagt	CRISPR spacer
ttcggattctgacagcgattccgactccgacagcgactcagactccgacagcgactcg	Protospacer
******.******************************** ***************

291. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.821

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttccgactccgacagcgattcggatagt	Protospacer
*** ***********.*********

292. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.821

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttccgactccgacagcgattcggatagt	Protospacer
*** ***********.*********

293. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 5, identity: 0.821

ttcggactccgacagtgattcggattcg	CRISPR spacer
ttcggactccgacagcgattcgtcgacg	Protospacer
***************.******    **

294. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
cagcgactccgacagcgattcggattctgacagt	Protospacer
*  .***********.*****************.

295. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
cagcgactccgacagcgattcggattctgacagt	Protospacer
*  .***********.*****************.

296. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
cagcgactccgacagcgattcggattctgacagt	Protospacer
*  .***********.*****************.

297. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
tgcggactccgacagcgattccgattctgacagc	Protospacer
. * ***********.***** ************

298. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.853

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
ctccgactccgacagcgattcggattctgactcc	Protospacer
***.***** *********************  .

299. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
cagtgactctgacagcgattcggactctgacagc	Protospacer
*  ****** **************.********.

300. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

ttcggactccgacagtgattcggattcg	CRISPR spacer
cagcgactccgacagcgattcggattct	Protospacer
.   ***********.***********

301. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

ttcggactccgacagtgattcggattcg	CRISPR spacer
cagcgactccgacagcgattcggattct	Protospacer
.   ***********.***********

302. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

ttcggactccgacagtgattcggattcg	CRISPR spacer
cagcgactccgacagcgattcggattct	Protospacer
.   ***********.***********

303. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctcggactctgacagcgattcggatagc	Protospacer
.********.*****.*********

304. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
tgcggactccgacagcgattccgattctgacagc	Protospacer
. * ***** *********** ***********.

305. spacer 3.35|5140791|40|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.85

ctcggactccgacagcgacagcgattcggattctgacagc	CRISPR spacer
cagcgattccgacagcgacagcgattcggattccgacagt	Protospacer
*   **.**************************.*****.

306. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.75

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctctgattccgacagtgattcggacagc	Protospacer
.** **.*****************.

307. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.75

ttcggactccgacagtgattcggattcg	CRISPR spacer
ctccgactccgacagtgactcggacagc	Protospacer
.** **************.*****.

308. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.794

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
ctctgattccgacagtgattcggacagcgactcc	Protospacer
******.*****************.  .***  *

309. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
ttcggatagcgacagcgattcggactctgacagc	Protospacer
.** **.  ******.********.*********

310. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
ttcagatagcgacagtgattcagattcagacagc	Protospacer
.** **.  ************.***** ******

311. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
ttcagatagcgacagtgattcagactctgacagc	Protospacer
.** **.  ************.**.*********

312. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
ttcagatagcgacagtgattcagattcagacagc	Protospacer
.** **.  ************.***** ******

313. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
ttcagatagcgacagtgattcagactctgacagc	Protospacer
.** **.  ************.**.*********

314. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
ttcagatagcgacagtgattcagactctgacagc	Protospacer
.** **.  ************.**.*********

315. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
ttcagatagcgacagtgattcagactctgacagc	Protospacer
.** **.  ************.**.*********

316. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
ttcggatagcgacagcgattcggactctgacagt	Protospacer
.** **.   **************.*********

317. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
ttcggatagcgacagcgattcggactctgacagt	Protospacer
.** **.   **************.*********

318. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
ctcggatagcgacagcgactcggactctgacagt	Protospacer
*** **.   ********.*****.*********

319. spacer 3.35|5140791|40|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.825

ctcggactccgacagcgacagcgattcggattctgacagc	CRISPR spacer
cagtgactccgactccgacagcgattcggattctgactcc	Protospacer
*   *********  **********************  *

320. spacer 3.28|5140401|28|NZ_CP015130|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.714

ttcggactccgacagtgattcggattcg	CRISPR spacer
ggcggactccgacagtgattcgacgaga	Protospacer
  ********************.    .

321. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.765

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
ctccgactccgacagtgactcggacagcgactcc	Protospacer
***.**************.*****.  .***  *

322. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.765

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
ttcggatagcgacagcgattcggactctgacagt	Protospacer
.** **.  ******.********.********.

323. spacer 3.30|5140491|34|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.765

ctctgactccgacagtgattcggattctgacagc	CRISPR spacer
ttcggatagcgacagcgattcggactctgacagt	Protospacer
.** **.  ******.********.********.

324. spacer 3.32|5140587|34|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.765

ctctgactcggacagcgattcggattctgacagt	CRISPR spacer
ttcggatagcgacagcgactcggattcggacagt	Protospacer
.** **.   ********.******** ******

325. spacer 3.36|5140851|52|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.846

ttcggattccgacagcgactcggactctgacagtgactccgattcggacagc	CRISPR spacer
ctcggattccgacagcgactcggactctgacagcgactccgacagtgactcc	Protospacer
.********************************.********.   ***  *

326. spacer 3.26|5140239|70|NZ_CP015130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 13, identity: 0.814

ctccgattctgacagcgattctgactctgacagcgactccgattctgacagtgattcgga	CRISPR spacer
ttccgattctgacagcgattccgactctgacagcgactccgattccgacagtgattcgga	Protospacer
.********************.***********************.**************

327. spacer 3.5|5137419|148|NZ_CP015130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 90, identity: 0.392

ctccgactccgactccgacagcgactctgactcggacagcgattcggactctgacagtga	CRISPR spacer
cagcgactccgactccgacagcgactctgactcggacagcgattcggactctgacagtga	Protospacer
*  *********************************************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

237452 : 286099

Klebsiella_phage(20.0%)

terminase,integrase,tRNA,holin,tail

attL 236649:236665|attR 247067:247083

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
236649:236665	attL	NA	NA	NA	NA
WP_020316476.1\|237452_238196_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	6.0e-16	30.5
WP_004148192.1\|238473_239457_+	zinc transporter ZntB	NA	NA	NA	NA
WP_004151591.1\|239982_241356_+	ATP-dependent RNA helicase DbpA	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	8.6e-53	32.3
WP_064838751.1\|241401_242337_-\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	1.4e-139	94.1
WP_064838752.1\|242385_243624_-\|integrase	site-specific integrase	A0A0U2JGI6	Escherichia_phage	7.8e-162	67.1
WP_023159475.1\|243625_243838_-	excisionase family protein	A0A0U2RY08	Escherichia_phage	1.1e-23	71.8
WP_032430507.1\|243902_244142_-	DUF4060 family protein	M9P0E0	Enterobacteria_phage	6.1e-31	82.1
WP_064838754.1\|244149_244458_-	hypothetical protein	I6PD68	Cronobacter_phage	7.1e-24	55.9
WP_064838756.1\|244454_245066_-	DUF550 domain-containing protein	S4TSR6	Salmonella_phage	1.8e-39	78.9
WP_064838757.1\|245058_245400_-	hypothetical protein	NA	NA	NA	NA
WP_064838759.1\|245434_246523_-	recombinase RecT	H6WRX0	Salmonella_phage	7.4e-108	56.5
WP_064838761.1\|246535_249631_-	PD-(D/E)XK nuclease-like domain-containing protein	H6WRX1	Salmonella_phage	3.7e-293	57.7
247067:247083	attR	NA	NA	NA	NA
WP_023282477.1\|249768_249924_-	hypothetical protein	K7PGY4	Enterobacteria_phage	2.0e-14	71.2
WP_040217592.1\|249932_250124_-	YebW family protein	NA	NA	NA	NA
WP_043875424.1\|250517_250931_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_048987746.1\|251042_251273_+	helix-turn-helix domain-containing protein	H6WRX5	Salmonella_phage	4.7e-12	44.0
WP_064838763.1\|251275_251812_+	toxin YdaT domain-containing protein	M9NZI6	Enterobacteria_phage	1.1e-59	68.9
WP_064838765.1\|252159_253077_+	replication protein	K7PGZ0	Enterobacteria_phage	1.5e-98	65.1
WP_064838767.1\|253073_253817_+	Replication protein P	A0A0M3ULE2	Salmonella_phage	4.1e-65	55.2
WP_016946299.1\|253809_254145_+	DUF977 family protein	H6WRX9	Salmonella_phage	4.4e-11	43.0
WP_064838768.1\|254137_254923_+	hypothetical protein	C7BGF1	Burkholderia_phage	8.7e-66	53.7
WP_064838770.1\|254919_255123_+	hypothetical protein	A0A2R2Z313	Escherichia_phage	2.7e-27	87.9
WP_064838771.1\|255115_255370_+	hypothetical protein	S5MQM0	Escherichia_phage	1.6e-08	49.3
WP_004184517.1\|255366_255603_+	hypothetical protein	S4TVX5	Salmonella_phage	1.5e-13	50.0
WP_064838773.1\|255595_255970_+	hypothetical protein	NA	NA	NA	NA
WP_049110734.1\|255969_256227_+	hypothetical protein	NA	NA	NA	NA
WP_064838775.1\|256223_258209_+	DNA cytosine methyltransferase	H9C171	Pectobacterium_phage	7.3e-202	53.5
WP_077255024.1\|258973_259198_+	hypothetical protein	NA	NA	NA	NA
WP_087812871.1\|259271_259871_+	DUF1367 family protein	K7PKS6	Enterobacteria_phage	1.3e-90	79.4
WP_004892208.1\|260079_260376_+	DUF1364 domain-containing protein	A0A0U2KD41	Escherichia_phage	1.2e-36	72.9
WP_004190680.1\|260372_260741_+	RusA family crossover junction endodeoxyribonuclease	G8C7V6	Escherichia_phage	3.5e-41	63.8
WP_022631482.1\|260737_261520_+	antitermination protein	F1C595	Cronobacter_phage	2.9e-114	79.1
WP_064838779.1\|261836_262283_-	hypothetical protein	NA	NA	NA	NA
WP_024940884.1\|262895_263195_+\|holin	phage holin family protein	A0A286N2Q5	Klebsiella_phage	4.5e-47	100.0
WP_004218565.1\|263191_263731_+	glycoside hydrolase family 108 protein	A0A286N2Q6	Klebsiella_phage	3.3e-101	98.9
WP_004190674.1\|263727_264072_+	hypothetical protein	A0A286N2Q7	Klebsiella_phage	2.0e-38	80.7
WP_004190672.1\|264068_264344_+	hypothetical protein	A0A286N2Q8	Klebsiella_phage	2.2e-08	72.5
WP_123618920.1\|264655_264868_+	hypothetical protein	A0A286N2Q9	Klebsiella_phage	7.8e-22	71.4
WP_004218558.1\|265302_265548_+	DUF2560 family protein	A0A286N2R1	Klebsiella_phage	4.6e-34	96.3
WP_064838781.1\|266410_267415_+\|terminase	terminase small subunit	Q5QF76	Pseudomonas_virus	1.7e-37	44.5
WP_064838782.1\|267392_268700_+\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	8.8e-148	58.4
WP_016946681.1\|268699_270100_+	DUF4055 domain-containing protein	A0A1B0VMH0	Pseudomonas_phage	6.4e-128	53.7
WP_064838784.1\|270083_271196_+	hypothetical protein	I6PD76	Cronobacter_phage	8.7e-112	55.6
WP_004190654.1\|271708_272494_+	hypothetical protein	A0A1B0VMG1	Pseudomonas_phage	1.7e-66	63.4
WP_004190653.1\|272504_273458_+	Ig domain-containing protein	A0A1B0VMF8	Pseudomonas_phage	5.0e-132	74.4
WP_151391665.1\|273466_273739_+	Ig-like domain-containing protein	NA	NA	NA	NA
WP_004216825.1\|273779_274175_+	hypothetical protein	A0A1B1P9F2	Acinetobacter_phage	1.1e-13	39.3
WP_004190649.1\|274176_274431_+	hypothetical protein	J9Q7U0	Salmonella_phage	8.0e-21	52.4
WP_004190646.1\|274440_274674_+	hypothetical protein	A0A2H4J0Y9	uncultured_Caudovirales_phage	5.8e-10	47.1
WP_029602988.1\|274660_275044_+	hypothetical protein	A0A0S2SYG4	Pseudomonas_phage	5.4e-21	45.2
WP_004190641.1\|275045_275597_+	hypothetical protein	G8C7Q1	Escherichia_phage	1.7e-28	40.4
WP_064838786.1\|275593_275986_+	electron transfer flavoprotein subunit beta	NA	NA	NA	NA
WP_064838788.1\|276009_277182_+	Ig domain-containing protein	A0A0D4DBN5	Acinetobacter_phage	5.5e-24	27.0
WP_008807841.1\|277235_277718_+	hypothetical protein	NA	NA	NA	NA
WP_016946674.1\|277855_278062_+	hypothetical protein	NA	NA	NA	NA
WP_004217333.1\|278138_278495_+	hypothetical protein	A0A1V0E5P9	Salmonella_phage	1.1e-44	75.0
WP_032416607.1\|278605_278974_+	zinc ribbon domain-containing protein	I6PDJ9	Cronobacter_phage	3.3e-15	42.9
WP_064838790.1\|279047_281702_+\|tail	phage tail length tape measure family protein	A0A192Y7S1	Enterobacteria_phage	9.7e-85	31.4
WP_064840249.1\|281701_282175_+	hypothetical protein	A0A286S298	Klebsiella_phage	2.5e-60	67.9
WP_004899613.1\|282161_282644_+	DUF1833 family protein	A0A286S2B1	Klebsiella_phage	1.1e-84	98.1
WP_017880229.1\|282653_283034_+	hypothetical protein	A0A286S2A6	Klebsiella_phage	4.6e-73	100.0
WP_064838792.1\|283030_286099_+	hypothetical protein	A0A286S259	Klebsiella_phage	0.0e+00	97.3

DBSCAN-SWA_2

386194 : 427470

Salmonella_phage(32.56%)

capsid,terminase,head,holin,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_064838831.1\|386194_386710_-	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	2.0e-23	54.5
WP_002903398.1\|387002_387161_+	hypothetical protein	NA	NA	NA	NA
WP_032454800.1\|387769_388033_-	pyocin activator PrtN family protein	A0A1L5C290	Pseudoalteromonas_phage	1.6e-11	43.7
WP_064838837.1\|388424_389141_-	hypothetical protein	M1F3E2	Salmonella_phage	1.0e-41	44.8
WP_064171434.1\|389133_389478_-	hypothetical protein	NA	NA	NA	NA
WP_064838839.1\|389474_389699_-	hypothetical protein	A0A286S2B3	Klebsiella_phage	3.6e-17	56.8
WP_023297265.1\|389929_390151_-	hypothetical protein	NA	NA	NA	NA
WP_064165593.1\|390223_390517_-	host cell division inhibitory peptide Kil	NA	NA	NA	NA
WP_064838841.1\|391140_391344_+	hypothetical protein	A0A192Y6Q5	Salmonella_phage	2.7e-19	73.1
WP_175295299.1\|391374_391551_+	hypothetical protein	NA	NA	NA	NA
WP_064838843.1\|391602_392439_-	hypothetical protein	A0A0R6PIN1	Moraxella_phage	8.7e-24	27.8
WP_023339685.1\|392401_392581_-	hypothetical protein	NA	NA	NA	NA
WP_139041349.1\|392675_392774_-	YoaK family small membrane protein	NA	NA	NA	NA
WP_047667478.1\|392788_393487_-	helix-turn-helix transcriptional regulator	Q76H56	Enterobacteria_phage	3.1e-107	83.7
WP_032443511.1\|393598_393826_+	helix-turn-helix domain-containing protein	Q76H55	Enterobacteria_phage	1.1e-24	76.1
WP_064838844.1\|393865_394147_+	hypothetical protein	A2SY75	Escherichia_phage	2.4e-18	58.2
WP_023312759.1\|394350_394605_+	hypothetical protein	NA	NA	NA	NA
WP_064838846.1\|394601_395696_+	hypothetical protein	S5FM81	Shigella_phage	8.2e-22	41.8
WP_064838848.1\|395722_396118_+	hypothetical protein	NA	NA	NA	NA
WP_064838849.1\|396331_397117_+	hypothetical protein	A4JX52	Burkholderia_virus	2.0e-62	50.2
WP_064838851.1\|397244_398321_+	DGQHR domain-containing protein	T1SBJ4	Salmonella_phage	2.8e-147	74.1
WP_064838855.1\|399146_399335_+	hypothetical protein	A0A192Y8X2	Salmonella_phage	4.8e-23	88.7
WP_004196547.1\|400132_400402_+	hypothetical protein	H6WRY4	Salmonella_phage	3.5e-35	80.7
WP_064838857.1\|400636_401230_+	recombination protein NinG	A0A0M4RU10	Salmonella_phage	1.2e-43	66.4
WP_064838859.1\|401226_401997_+	hypothetical protein	D5LH17	Escherichia_phage	7.2e-65	52.0
WP_072122464.1\|401993_402638_+	phage N-6-adenine-methyltransferase	Q8HA94	Salmonella_phage	2.1e-102	81.4
WP_064838861.1\|402634_403234_+	hypothetical protein	H9C175	Pectobacterium_phage	1.0e-66	58.9
WP_133124641.1\|404121_404427_+\|holin	phage holin family protein	A0A286N2Q5	Klebsiella_phage	3.3e-45	97.9
WP_064162818.1\|404413_404893_+	glycoside hydrolase family 104 protein	A5VW81	Enterobacteria_phage	3.9e-69	82.4
WP_012967894.1\|404908_405085_+	hypothetical protein	NA	NA	NA	NA
WP_064142410.1\|405106_405289_-	hypothetical protein	NA	NA	NA	NA
WP_064838863.1\|405407_405701_+	hypothetical protein	G8C7W3	Escherichia_phage	9.8e-31	69.1
WP_064838865.1\|406036_406282_+	DUF2560 family protein	A0A286N2R1	Klebsiella_phage	4.8e-31	91.4
WP_064838866.1\|406643_406937_+	hypothetical protein	NA	NA	NA	NA
WP_064840252.1\|406940_408398_+	glycosyltransferase family 2 protein	K7PKP3	Enterobacterial_phage	5.2e-258	86.8
WP_032429033.1\|408379_408979_+	hypothetical protein	S4TR53	Salmonella_phage	1.2e-72	64.1
WP_064838868.1\|408971_409340_+	HNH endonuclease	S4TTG9	Salmonella_phage	1.0e-48	79.5
WP_060598770.1\|409518_410031_+\|terminase	terminase small subunit	S4TNN3	Salmonella_phage	1.0e-51	67.3
WP_049009200.1\|410034_411693_+\|terminase	terminase large subunit	Q3HQS7	Burkholderia_phage	2.7e-234	70.9
WP_064838870.1\|411751_413686_+\|capsid	phage major capsid protein	S4TNE3	Salmonella_phage	0.0e+00	91.1
WP_087672146.1\|413724_413892_+	hypothetical protein	S4TR49	Salmonella_phage	3.5e-17	78.2
WP_064838876.1\|416289_416616_+\|head,tail	phage gp6-like head-tail connector protein	S4TSQ3	Salmonella_phage	8.6e-28	60.7
WP_032701061.1\|416687_416900_+	hypothetical protein	A0A286S2A5	Klebsiella_phage	1.5e-09	60.0
WP_008806068.1\|416901_417252_+\|head	phage head closure protein	A0A286S2A2	Klebsiella_phage	3.9e-34	62.9
WP_008806069.1\|417244_417730_+	HK97 gp10 family phage protein	A0A0U3TGT7	Pseudomonas_phage	1.5e-52	65.2
WP_008806070.1\|417726_418089_+	DUF3168 domain-containing protein	A0A286S1R1	Klebsiella_phage	2.9e-48	77.7
WP_023343204.1\|418153_418636_+	hypothetical protein	Q9MCU9	Escherichia_phage	7.5e-52	58.9
WP_023343205.1\|418815_419346_+	KilA-N domain-containing protein	A0A1V0E5P7	Salmonella_phage	8.7e-86	90.3
WP_064838877.1\|419392_419746_+\|tail	phage tail assembly chaperone family protein, TAC	A0A286S1N4	Klebsiella_phage	3.5e-59	96.6
WP_004143895.1\|419778_420042_+	hypothetical protein	A0A286S1P2	Klebsiella_phage	5.9e-43	98.8
WP_004143894.1\|420107_420575_+	hypothetical protein	NA	NA	NA	NA
WP_064838879.1\|420619_423067_+\|tail	phage tail tape measure protein	A0A286S1S3	Klebsiella_phage	7.7e-278	66.5
WP_059689813.1\|423066_423546_+	hypothetical protein	A0A286S298	Klebsiella_phage	3.0e-93	98.1
WP_064838881.1\|423532_424015_+	DUF1833 family protein	A0A286S2B1	Klebsiella_phage	3.2e-79	92.5
WP_064838883.1\|424024_424405_+	hypothetical protein	A0A286S2A6	Klebsiella_phage	6.2e-70	95.2
WP_064838884.1\|424401_427470_+	hypothetical protein	A0A286S259	Klebsiella_phage	0.0e+00	97.2

DBSCAN-SWA_3

508465 : 519351

Escherichia_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002210516.1\|508465_509086_-	aldolase	A0A077SK32	Escherichia_phage	8.0e-115	100.0
WP_064187096.1\|509078_510344_-	four-carbon acid sugar kinase family protein	A0A077SLJ7	Escherichia_phage	4.6e-234	99.8
WP_002903955.1\|510355_511258_-	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	2.6e-159	99.7
WP_002210513.1\|511518_512280_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.9e-134	100.0
WP_001620095.1\|512300_513161_-	class A broad-spectrum beta-lactamase SHV-1	A0A077SL40	Escherichia_phage	4.4e-156	99.7
WP_004176262.1\|513458_513719_+	hypothetical protein	A0A077SK33	Escherichia_phage	5.4e-41	98.8
WP_001620097.1\|513805_514894_+	AAA family ATPase	A0A077SLJ9	Escherichia_phage	8.0e-211	100.0
WP_004176258.1\|514923_516189_-	MFS transporter	NA	NA	NA	NA
WP_064838913.1\|516243_519351_-	beta-galactosidase	L0N6M2	Herpes_simplex_virus	0.0e+00	59.6

DBSCAN-SWA_4

1441352 : 1456224

Escherichia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_064839238.1\|1441352_1442714_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.9e-12	27.1
WP_159321336.1\|1442703_1443477_-	ABC transporter permease	NA	NA	NA	NA
WP_064839240.1\|1443565_1444120_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	8.6e-52	57.6
WP_064839242.1\|1444134_1445025_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	7.4e-29	34.2
WP_004175258.1\|1445056_1445926_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	5.7e-111	67.0
WP_064839244.1\|1445939_1447004_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	2.2e-104	54.7
WP_064839245.1\|1447844_1448849_+	NAD-dependent epimerase	E3T4Y8	Cafeteria_roenbergensis_virus	1.0e-31	29.7
WP_004144151.1\|1449249_1449372_+	small membrane protein	NA	NA	NA	NA
WP_000704907.1\|1449796_1450963_-	UDP-glucose 6-dehydrogenase	M1I798	Paramecium_bursaria_Chlorella_virus	7.0e-112	54.7
WP_023278826.1\|1451142_1451697_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	1.5e-51	57.6
WP_021313306.1\|1451711_1452602_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	2.8e-28	34.2
WP_004175258.1\|1452633_1453503_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	5.7e-111	67.0
WP_064839244.1\|1453529_1454594_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	2.2e-104	54.7
WP_064839247.1\|1454817_1456224_-	NADP-dependent phosphogluconate dehydrogenase	M4QQM4	Ostreococcus_lucimarinus_virus	1.8e-37	28.7

DBSCAN-SWA_5

1499417 : 1506325

Bacillus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004149058.1\|1499417_1500896_+	two-component system sensor histidine kinase BaeS	W8CYF6	Bacillus_phage	8.5e-30	28.3
WP_004175198.1\|1500892_1501615_+	two-component system response regulator BaeR	W8CYM9	Bacillus_phage	8.3e-31	33.2
WP_004144192.1\|1501933_1503295_+\|tRNA	tRNA 5-hydroxyuridine modification protein YegQ	Q6DW11	Phage_TP	1.8e-207	94.8
WP_074184757.1\|1503536_1504433_+	lipid kinase YegS	A0A1V0SBJ0	Catovirus	1.6e-15	29.8
WP_004180550.1\|1504677_1505451_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.9e-26	36.7
WP_064840266.1\|1505461_1506325_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.7e-10	34.5

DBSCAN-SWA_6

2519956 : 2557180

Escherichia_phage(36.59%)

capsid,plate,terminase,integrase,tRNA,head,lysis,holin,portal,tail

attL 2555478:2555494|attR 2557202:2557218

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002916879.1\|2519956_2520970_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	6.3e-109	59.2
WP_001144069.1\|2521207_2521423_+	30S ribosomal protein S21	NA	NA	NA	NA
WP_004149864.1\|2521534_2523280_+	DNA primase	A0A0K1LMQ9	Caulobacter_phage	1.6e-75	38.7
WP_004174339.1\|2523498_2525340_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	8.3e-35	33.7
WP_002917636.1\|2525439_2525946_-	G/U mismatch-specific DNA glycosylase	NA	NA	NA	NA
WP_032420109.1\|2526301_2526520_-	DNA-binding transcriptional regulator	A0A2I8TV89	Erwinia_phage	3.2e-34	88.9
WP_064839606.1\|2526587_2527754_-	phage late control D family protein	Q7Y4C6	Escherichia_virus	2.8e-177	81.9
WP_015959003.1\|2527753_2528233_-\|tail	phage tail protein	A0A0F7LDE8	Escherichia_phage	1.9e-71	82.8
WP_064839607.1\|2528249_2530688_-\|tail	phage tail tape measure protein	Q7Y4C8	Escherichia_virus	2.5e-297	73.3
WP_014343413.1\|2530680_2530800_-\|tail	GpE family phage tail protein	A0A0F7LCR6	Escherichia_phage	2.0e-14	92.3
WP_004195711.1\|2530832_2531108_-\|tail	phage tail assembly protein	A0A0F7LDQ8	Escherichia_phage	2.4e-31	77.3
WP_014343412.1\|2531168_2531684_-\|tail	phage major tail tube protein	A0A0F7LDZ1	Escherichia_phage	3.2e-69	75.6
WP_064839609.1\|2531697_2532879_-\|tail	phage tail sheath protein	A0A0F7LBW9	Escherichia_phage	1.5e-194	85.6
WP_064839612.1\|2532988_2534065_-\|tail	phage tail protein	A0A2H4J931	uncultured_Caudovirales_phage	4.0e-29	46.9
WP_064839614.1\|2534076_2534805_-	hypothetical protein	NA	NA	NA	NA
WP_064839616.1\|2534810_2537075_-	hypothetical protein	B5TAB2	Burkholderia_phage	1.8e-108	44.0
WP_077268147.1\|2537076_2537664_-\|tail	phage tail protein I	E5G6N9	Salmonella_phage	1.3e-50	56.0
WP_047718554.1\|2537671_2538580_-\|plate	baseplate assembly protein	F1BUP3	Erwinia_phage	4.4e-114	71.2
WP_064165137.1\|2538584_2538932_-	GPW/gp25 family protein	Q7Y4D7	Escherichia_virus	7.5e-46	79.1
WP_064165136.1\|2538928_2539564_-\|plate	phage baseplate assembly protein V	M1SV78	Escherichia_phage	1.0e-96	83.4
WP_064165135.1\|2539632_2540082_-	phage virion morphogenesis protein	O80313	Escherichia_phage	3.6e-48	66.7
WP_047718552.1\|2540074_2540542_-\|tail	phage tail protein	A0A0F7LA33	Escherichia_phage	5.1e-66	77.4
WP_047718550.1\|2540504_2540663_-	hypothetical protein	A0A218M4L1	Erwinia_phage	1.2e-11	68.0
WP_064165134.1\|2540637_2541069_-\|lysis	LysB family phage lysis regulatory protein	O80310	Escherichia_phage	1.2e-40	65.7
WP_064839620.1\|2541065_2541563_-	glycoside hydrolase family 104 protein	A0A0F7LBS0	Escherichia_phage	7.4e-79	85.5
WP_009309693.1\|2541549_2541840_-\|holin	phage holin family protein	O80308	Escherichia_phage	9.1e-37	84.7
WP_004175163.1\|2541844_2542048_-\|tail	tail protein X	A0A0F7LCN2	Escherichia_phage	4.2e-25	80.6
WP_009309691.1\|2542047_2542554_-\|head	head completion/stabilization protein	U5N0S3	Enterobacteria_phage	5.4e-61	84.3
WP_074187707.1\|2542650_2543370_-\|terminase	terminase endonuclease subunit	Q94MJ2	Enterobacteria_phage	1.1e-94	79.0
WP_047718542.1\|2543397_2544456_-\|capsid	phage major capsid protein, P2 family	S4TUA6	Salmonella_phage	3.8e-165	84.1
WP_047718540.1\|2544529_2545384_-\|capsid	GPO family capsid scaffolding protein	Q94MB7	Escherichia_virus	4.8e-126	81.0
WP_047718537.1\|2545549_2547319_+\|terminase	terminase ATPase subunit family protein	A0A0F7LCK3	Escherichia_phage	3.7e-306	87.9
WP_004195876.1\|2547318_2548362_+\|portal	phage portal protein	M1SV64	Escherichia_phage	6.8e-167	82.4
WP_064184806.1\|2548759_2549695_-	hypothetical protein	NA	NA	NA	NA
WP_064839622.1\|2549759_2550491_-	hypothetical protein	Q37850	Escherichia_phage	2.0e-128	93.8
WP_065808430.1\|2550572_2551013_-	DinI family protein	A0A218M4I0	Erwinia_phage	2.2e-58	81.8
WP_074187341.1\|2551127_2553200_-	replication endonuclease	A0A218M4H2	Erwinia_phage	0.0e+00	90.7
WP_047718529.1\|2553348_2553630_-	DUF5405 family protein	A0A218M4I8	Erwinia_phage	3.7e-43	91.4
WP_064839624.1\|2553630_2553852_-	TraR/DksA family transcriptional regulator	A0A0M4S5Q7	Salmonella_phage	2.6e-28	86.3
WP_032454118.1\|2553851_2554079_-	DUF2732 domain-containing protein	A0A0M3UL87	Salmonella_phage	4.6e-20	74.7
WP_032454119.1\|2554147_2554486_-	DUF5347 domain-containing protein	A0A218M4I7	Erwinia_phage	8.0e-53	92.0
WP_047719163.1\|2554449_2554650_-	DUF2724 domain-containing protein	Q6K1F7	Salmonella_virus	3.3e-30	93.9
WP_047718526.1\|2554657_2555167_-	phage regulatory CII family protein	A0A0M4QWN1	Salmonella_phage	4.0e-88	97.0
2555478:2555494	attL	NA	NA	NA	NA
WP_047719162.1\|2555591_2556164_+	phage repressor protein CI	A0A218M4J1	Erwinia_phage	9.6e-99	94.7
WP_047718525.1\|2556163_2557180_+\|integrase	tyrosine-type recombinase/integrase	A0A218M4I3	Erwinia_phage	9.8e-195	96.7
2557202:2557218	attR	NA	NA	NA	NA

DBSCAN-SWA_7

3281281 : 3387799

115

Escherichia_phage(55.32%)

capsid,protease,plate,terminase,integrase,tRNA,head,lysis,portal,holin,tail

attL 3320637:3320680|attR 3350320:3350363

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002882809.1\|3281281_3281719_+\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
WP_004178031.1\|3281763_3282705_+	fatty acid biosynthesis protein FabY	NA	NA	NA	NA
WP_064839760.1\|3282718_3283636_-	alpha/beta hydrolase	S4W4Z4	Pandoravirus	1.9e-16	28.6
WP_004150355.1\|3283840_3284083_+	ribbon-helix-helix domain-containing protein	NA	NA	NA	NA
WP_002882817.1\|3284082_3284466_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_004150358.1\|3284639_3285569_-	formate dehydrogenase accessory protein FdhE	NA	NA	NA	NA
WP_002882818.1\|3285565_3286201_-	formate dehydrogenase cytochrome b556 subunit	NA	NA	NA	NA
WP_002882822.1\|3286197_3287100_-	formate dehydrogenase subunit beta	NA	NA	NA	NA
WP_085921749.1\|3287112_3290163_-	formate dehydrogenase-N subunit alpha	NA	NA	NA	NA
WP_002882828.1\|3290319_3291156_+	formate dehydrogenase accessory sulfurtransferase FdhD	NA	NA	NA	NA
WP_002882830.1\|3291284_3291497_+	DUF1471 domain-containing protein	NA	NA	NA	NA
WP_064839761.1\|3291898_3292879_+	6-phosphofructokinase	NA	NA	NA	NA
WP_004151864.1\|3292890_3293205_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_004150366.1\|3293197_3294565_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_064839763.1\|3294551_3295394_+	class II fructose-bisphosphate aldolase	NA	NA	NA	NA
WP_002882858.1\|3295452_3295722_+	hypothetical protein	NA	NA	NA	NA
WP_002882861.1\|3295731_3296169_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_064839765.1\|3296165_3296759_+	hypothetical protein	NA	NA	NA	NA
WP_064839767.1\|3296755_3297079_-	AzlD domain-containing protein	NA	NA	NA	NA
WP_064839769.1\|3297078_3297738_-	AzlC family ABC transporter permease	NA	NA	NA	NA
WP_002882865.1\|3297837_3298386_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_064839771.1\|3298473_3299469_+	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_032418234.1\|3299584_3301708_+	alpha-galactosidase	NA	NA	NA	NA
WP_064839773.1\|3301749_3303015_+	MFS transporter	NA	NA	NA	NA
WP_002882870.1\|3303052_3303367_-	L-rhamnose mutarotase	NA	NA	NA	NA
WP_002882871.1\|3303363_3304512_-	lactaldehyde reductase	NA	NA	NA	NA
WP_064839774.1\|3304601_3305606_-	ABC transporter permease	NA	NA	NA	NA
WP_004181621.1\|3305602_3306610_-	ABC transporter permease	NA	NA	NA	NA
WP_064839776.1\|3306606_3308118_-	sugar ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.9e-14	29.0
WP_002882880.1\|3308263_3309250_-	rhamnose ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002882882.1\|3309331_3310162_-	rhamnulose-1-phosphate aldolase	NA	NA	NA	NA
WP_004150375.1\|3310311_3311571_-	L-rhamnose isomerase	NA	NA	NA	NA
WP_002882885.1\|3311567_3313034_-	rhamnulokinase	NA	NA	NA	NA
WP_002882888.1\|3313344_3314181_+	HTH-type transcriptional activator RhaS	NA	NA	NA	NA
WP_002882891.1\|3314254_3315100_+	HTH-type transcriptional activator RhaR	NA	NA	NA	NA
WP_002882892.1\|3315132_3316167_-	L-rhamnose/proton symporter RhaT	NA	NA	NA	NA
WP_002882894.1\|3316456_3317077_+	superoxide dismutase [Mn]	Q56AR7	Bacillus_thuringiensis_phage	3.5e-62	57.9
WP_002882896.1\|3317149_3317824_+	6-N-hydroxylaminopurine resistance protein	NA	NA	NA	NA
WP_002882898.1\|3317891_3319265_-	envelope stress sensor histidine kinase CpxA	W8CYF6	Bacillus_phage	1.4e-10	24.0
WP_002882901.1\|3319261_3319960_-	envelope stress response regulator transcription factor CpxR	Q6XM27	Feldmannia_irregularis_virus	4.0e-06	30.3
WP_004178004.1\|3320109_3320613_+	cell-envelope stress modulator CpxP	NA	NA	NA	NA
3320637:3320680	attL	NA	NA	NA	NA
WP_006822081.1\|3320799_3321780_-\|integrase	tyrosine-type recombinase/integrase	S4TP66	Salmonella_phage	8.0e-186	99.7
WP_016237179.1\|3321849_3322143_-	helix-turn-helix domain-containing protein	Q1JS37	Enterobacteria_phage	1.0e-48	99.0
WP_001308179.1\|3322279_3322552_+	hypothetical protein	Q1JS36	Enterobacteria_phage	1.4e-47	100.0
WP_001005162.1\|3322554_3322725_+	hypothetical protein	S4TNZ7	Salmonella_phage	6.1e-25	100.0
WP_000217670.1\|3322721_3323222_+	hypothetical protein	M1SV55	Escherichia_phage	2.6e-92	100.0
WP_000557703.1\|3323285_3323510_+	DUF2732 family protein	S4TP68	Salmonella_phage	4.7e-33	100.0
WP_001277958.1\|3323509_3323812_+	DUF5405 family protein	U5N0U2	Enterobacteria_phage	5.0e-46	98.0
WP_071889787.1\|3323811_3324036_+	TraR/DksA family transcriptional regulator	S4TRY6	Salmonella_phage	1.5e-34	97.3
WP_000027664.1\|3324032_3324308_+	DUF5405 family protein	U5N3W1	Enterobacteria_phage	3.8e-45	100.0
WP_064839778.1\|3324297_3326574_+	replication endonuclease	A0A0F7LBQ2	Escherichia_phage	0.0e+00	97.8
WP_000038165.1\|3327656_3328691_-\|portal	phage portal protein	M1SV64	Escherichia_phage	4.2e-201	99.7
WP_000156861.1\|3328690_3330463_-\|terminase	terminase ATPase subunit family protein	A0A0F7LCK3	Escherichia_phage	0.0e+00	99.8
WP_001085972.1\|3330636_3331491_+\|capsid	GPO family capsid scaffolding protein	Q94MI4	Enterobacteria_phage	1.3e-139	100.0
WP_001248583.1\|3331549_3332623_+\|capsid	phage major capsid protein, P2 family	Q94MK2	Enterobacteria_phage	6.7e-202	100.0
WP_176720749.1\|3332650_3333370_+\|terminase	terminase endonuclease subunit	A0A0F7LBP7	Escherichia_phage	1.1e-118	97.9
WP_000988633.1\|3333468_3333978_+\|head	head completion/stabilization protein	U5N0S3	Enterobacteria_phage	1.1e-90	100.0
WP_000846409.1\|3333977_3334181_+\|tail	tail protein X	A0A0F7LCN2	Escherichia_phage	3.0e-31	100.0
WP_000123123.1\|3334184_3334466_+\|holin	phage holin family protein	A0A0F7LA12	Escherichia_phage	1.3e-43	100.0
WP_001144101.1\|3334465_3334963_+	glycoside hydrolase family 104 protein	A0A0F7LBS0	Escherichia_phage	3.1e-93	100.0
WP_064839782.1\|3334977_3335403_+	hypothetical protein	A0A0F7LDU9	Escherichia_phage	7.7e-61	97.9
WP_064839784.1\|3335390_3335816_+\|lysis	LysB family phage lysis regulatory protein	Q7Y4E2	Escherichia_virus	1.8e-65	95.0
WP_000917182.1\|3335923_3336391_+\|tail	phage tail protein	Q7Y4E0	Escherichia_virus	1.9e-81	99.4
WP_064839785.1\|3336383_3336836_+	phage virion morphogenesis protein	A0A0F7LBV9	Escherichia_phage	7.7e-75	98.0
WP_019841549.1\|3336902_3337538_+\|plate	phage baseplate assembly protein V	A0A0F7LDY9	Escherichia_phage	5.3e-114	99.5
WP_000127164.1\|3337534_3337882_+	GPW/gp25 family protein	A0A0F7LDQ1	Escherichia_phage	1.3e-58	100.0
WP_021525816.1\|3337886_3338795_+\|plate	baseplate assembly protein	A0A0F7LCQ9	Escherichia_phage	5.7e-162	99.7
WP_001285340.1\|3338787_3339399_+\|tail	phage tail protein I	A0A0F7LA36	Escherichia_phage	1.7e-117	100.0
WP_064839788.1\|3339395_3340721_+\|tail	phage tail protein	M1TAS6	Escherichia_phage	2.2e-178	67.7
WP_064839790.1\|3340720_3341323_+\|tail	tail fiber assembly protein	M1SV83	Escherichia_phage	4.6e-99	90.5
WP_064839792.1\|3341294_3341738_-\|tail	tail fiber assembly protein	A0A0F7LDZ0	Escherichia_phage	2.7e-80	97.3
WP_071889793.1\|3341758_3342169_-\|tail	phage tail protein	A0A0F7LBW5	Escherichia_phage	1.8e-62	93.5
WP_025670956.1\|3342199_3342793_+	recombinase family protein	A0A0F7LA37	Escherichia_phage	3.9e-103	95.9
WP_001286675.1\|3342852_3344043_+\|tail	phage tail sheath protein	A0A0F7LBW9	Escherichia_phage	1.8e-224	99.5
WP_001251408.1\|3344055_3344574_+\|tail	phage major tail tube protein	A0A0F7LDZ1	Escherichia_phage	1.4e-93	100.0
WP_001031303.1\|3344630_3344906_+\|tail	phage tail assembly protein	A0A0F7LDQ8	Escherichia_phage	5.7e-41	100.0
WP_000785970.1\|3344938_3345058_+\|tail	GpE family phage tail protein	A0A0F7LCR6	Escherichia_phage	1.0e-15	100.0
WP_038430675.1\|3345050_3347498_+\|tail	phage tail tape measure protein	M1T2S3	Escherichia_phage	0.0e+00	96.6
WP_000978897.1\|3347512_3347992_+\|tail	phage tail protein	O64315	Escherichia_phage	5.1e-85	100.0
WP_064839794.1\|3347991_3349155_+	phage late control D family protein	U5N3V4	Enterobacteria_phage	5.4e-205	99.2
WP_000468308.1\|3349236_3349455_+	prophage transcriptional regulator OgrK	A0A0F7LDQ9	Escherichia_phage	4.7e-38	100.0
WP_000416606.1\|3349595_3350237_+	hypothetical protein	NA	NA	NA	NA
WP_002882907.1\|3350454_3351357_+	CDF family cation-efflux transporter FieF	NA	NA	NA	NA
3350320:3350363	attR	NA	NA	NA	NA
WP_002882911.1\|3351553_3352516_+	6-phosphofructokinase	NA	NA	NA	NA
WP_002882913.1\|3352577_3353063_-	ribonuclease E activity regulator RraA	NA	NA	NA	NA
WP_002882914.1\|3353155_3354076_-	1,4-dihydroxy-2-naphthoate polyprenyltransferase	NA	NA	NA	NA
WP_002882917.1\|3354145_3355480_-	HslU--HslV peptidase ATPase subunit	W6AS21	Erwinia_phage	2.1e-43	29.5
WP_002882918.1\|3355489_3356020_-\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_002882919.1\|3356111_3357080_-	cell division protein FtsN	NA	NA	NA	NA
WP_002882921.1\|3357173_3358202_-	DNA-binding transcriptional regulator CytR	NA	NA	NA	NA
WP_064839796.1\|3358352_3360548_-	primosomal protein N'	NA	NA	NA	NA
WP_002882922.1\|3360800_3361013_+	50S ribosomal protein L31	NA	NA	NA	NA
WP_002882924.1\|3361114_3361432_-	met regulon transcriptional regulator MetJ	NA	NA	NA	NA
WP_064839798.1\|3361699_3362860_+	cystathionine gamma-synthase	NA	NA	NA	NA
WP_002882944.1\|3362862_3365295_+	bifunctional aspartate kinase/homoserine dehydrogenase II	NA	NA	NA	NA
WP_064839800.1\|3365269_3366406_-	cytoplasmic protein	NA	NA	NA	NA
WP_023342388.1\|3366544_3368101_+	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
WP_002882947.1\|3368138_3368510_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_004895139.1\|3368601_3369510_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_002882952.1\|3369738_3370626_+	methylenetetrahydrofolate reductase	NA	NA	NA	NA
WP_004177983.1\|3370769_3371651_+	DMT family transporter	NA	NA	NA	NA
WP_004177981.1\|3371714_3372818_-	glycerol dehydrogenase	NA	NA	NA	NA
WP_004177977.1\|3372872_3373535_-	fructose-6-phosphate aldolase	M4SLG0	Cyanophage	4.6e-28	34.0
WP_004220885.1\|3373740_3374727_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_004187297.1\|3374751_3375402_+	metal-binding protein ZinT	NA	NA	NA	NA
WP_064839802.1\|3375445_3378097_-	phosphoenolpyruvate carboxylase	NA	NA	NA	NA
WP_004177969.1\|3378355_3379507_-	acetylornithine deacetylase	NA	NA	NA	NA
WP_004181637.1\|3379620_3380625_+	N-acetyl-gamma-glutamyl-phosphate reductase	NA	NA	NA	NA
WP_015959218.1\|3380631_3381408_+	acetylglutamate kinase	NA	NA	NA	NA
WP_004146283.1\|3381507_3382881_+	argininosuccinate lyase	NA	NA	NA	NA
WP_002883015.1\|3383139_3384057_+	DNA-binding transcriptional regulator OxyR	NA	NA	NA	NA
WP_002883016.1\|3384039_3385440_-	Si-specific NAD(P)(+) transhydrogenase	NA	NA	NA	NA
WP_004151856.1\|3385636_3386272_+	HTH-type transcriptional repressor FabR	NA	NA	NA	NA
WP_002883021.1\|3386287_3386647_+	YijD family membrane protein	NA	NA	NA	NA
WP_002883023.1\|3386698_3387799_-\|tRNA	tRNA (uridine(54)-C5)-methyltransferase TrmA	NA	NA	NA	NA

DBSCAN-SWA_8

5031639 : 5041113

Dickeya_phage(16.67%)

protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002896440.1\|5031639_5032755_+	macrolide transporter subunit MacA	A0A140XAI1	Dickeya_phage	1.3e-06	52.7
WP_004150848.1\|5032751_5034692_+	macrolide ABC transporter ATP-binding protein/permease MacB	G9BWD6	Planktothrix_phage	1.9e-37	40.5
WP_002896516.1\|5034768_5034990_-	cold shock-like protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	1.3e-16	61.2
WP_002896520.1\|5035315_5035633_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	2.0e-13	45.7
WP_002896522.1\|5035663_5037943_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.6e-165	42.0
WP_001040187.1\|5038073_5038292_-	translation initiation factor IF-1	NA	NA	NA	NA
WP_002898014.1\|5038645_5039347_-\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_016532437.1\|5039391_5041113_-	cysteine/glutathione ABC transporter ATP-binding protein/permease CydC	A0A2R8FG22	Brazilian_cedratvirus	1.5e-14	34.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP015132

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2115 : 49738

Shigella_phage(33.33%)

transposase,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000427619.1\|2115_3120_-\|transposase	IS110-like element IS5075 family transposase	NA	NA	NA	NA
WP_004152284.1\|3523_4534_-	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_016831235.1\|4994_6077_+	DNA-binding transcriptional repressor LacI	C6ZCU4	Enterobacteria_phage	4.4e-185	96.1
WP_004182121.1\|6198_9273_+	beta-galactosidase	L0N6M2	Herpes_simplex_virus	0.0e+00	96.7
WP_004098904.1\|9324_10578_+	lactose permease	NA	NA	NA	NA
WP_024623136.1\|12020_12599_+	hypothetical protein	NA	NA	NA	NA
WP_020325130.1\|12601_12961_-	hypothetical protein	NA	NA	NA	NA
WP_087796248.1\|13111_14261_+\|transposase	IS3 family transposase	Q716C2	Shigella_phage	9.1e-173	95.6
WP_032432508.1\|15315_15915_-	cupin domain-containing protein	NA	NA	NA	NA
WP_032432506.1\|15960_16662_-	urea carboxylase-associated family protein	NA	NA	NA	NA
WP_032432505.1\|16658_17912_-	M20 family metallo-hydrolase	NA	NA	NA	NA
WP_169546960.1\|17908_18703_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.1e-28	38.3
WP_032432503.1\|18725_19367_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_032432501.1\|19363_20023_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_032432500.1\|20033_20879_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_087788032.1\|23237_24445_-\|transposase	IS3 family transposase	Q9ZXG3	Shigella_phage	9.8e-101	63.2
WP_003031962.1\|24550_25621_-	PD-(D/E)XK nuclease family protein	NA	NA	NA	NA
WP_003031960.1\|26033_27131_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_003031958.1\|27361_28399_+	SIS domain-containing protein	NA	NA	NA	NA
WP_032432493.1\|28404_29235_+	carbohydrate kinase	NA	NA	NA	NA
WP_003031956.1\|29300_30056_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_032432491.1\|30099_30762_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_003031954.1\|30761_31502_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.7e-29	41.0
WP_050597921.1\|31501_32332_+	TIM barrel protein	NA	NA	NA	NA
WP_064840321.1\|32352_33219_+	DMT family transporter	NA	NA	NA	NA
WP_101977911.1\|33786_34311_+\|transposase	transposase	S5WIU1	Leptospira_phage	6.7e-22	31.0
WP_024623132.1\|34685_35924_-\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	6.2e-10	22.1
WP_020325103.1\|36368_37367_-	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_071604881.1\|37561_38035_-	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_071604880.1\|39199_39544_+	MFS transporter	NA	NA	NA	NA
WP_020325099.1\|39760_41020_+	oligosaccharide MFS transporter	NA	NA	NA	NA
WP_020325120.1\|41036_42155_+	DUF2961 domain-containing protein	NA	NA	NA	NA
WP_087784434.1\|42306_43453_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	3.5e-148	93.3
WP_141769206.1\|43469_43805_-	hypothetical protein	NA	NA	NA	NA
WP_023307528.1\|44574_45432_-	incFII family plasmid replication initiator RepA	NA	NA	NA	NA
WP_004171457.1\|45424_45502_-	RepA leader peptide Tap	NA	NA	NA	NA
WP_004199332.1\|45718_45997_-	replication regulatory protein RepA	NA	NA	NA	NA
WP_117248013.1\|47416_49738_-\|bacteriocin	klebicin B-related nuclease bacteriocin	NA	NA	NA	NA

DBSCAN-SWA_2

120418 : 177457

uncultured_Caudovirales_phage(31.25%)

transposase,holin,integrase,protease

attL 109440:109455|attR 154583:154598

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
109440:109455	attL	NA	NA	NA	NA
WP_064840328.1\|120418_121159_-\|integrase	site-specific integrase	I3WFA4	Macacine_betaherpesvirus	4.5e-24	57.6
WP_004152065.1\|122302_123250_+	sensor domain-containing diguanylate cyclase	G3MA91	Bacillus_virus	1.8e-12	30.6
WP_071527918.1\|123276_123588_-	EAL domain-containing protein	NA	NA	NA	NA
WP_011977741.1\|123607_124576_+\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	2.5e-184	98.1
WP_004197688.1\|125248_125506_-	hypothetical protein	NA	NA	NA	NA
WP_080895248.1\|126125_127562_+	EAL domain-containing protein	NA	NA	NA	NA
WP_004152070.1\|128544_129822_-	DUF2254 domain-containing protein	NA	NA	NA	NA
WP_004178088.1\|129884_131882_-\|holin	choline BCCT transporter BetT	A0A2I7QNT1	Vibrio_phage	9.7e-21	25.9
WP_148722517.1\|132921_134129_-\|transposase	IS3 family transposase	Q9ZXG3	Shigella_phage	3.7e-100	62.9
WP_004178091.1\|135557_135989_-	silver-binding protein SilE	NA	NA	NA	NA
WP_003032875.1\|136239_137715_-	copper/silver sensor histidine kinase SilS	W8CYF6	Bacillus_phage	1.0e-27	30.1
WP_001572351.1\|137707_138388_-	copper/silver response regulator transcription factor SilR	W8CYM9	Bacillus_phage	2.1e-31	35.6
WP_000475512.1\|138577_139963_+	Cu(+)/Ag(+) efflux RND transporter outer membrane channel SilC	NA	NA	NA	NA
WP_001246153.1\|139991_140345_+	cation efflux system protein CusF	NA	NA	NA	NA
WP_004152079.1\|140458_141751_+	Cu(+)/Ag(+) efflux RND transporter periplasmic adaptor subunit SilB	NA	NA	NA	NA
WP_004098958.1\|141761_144908_+	Cu(+)/Ag(+) efflux RND transporter permease subunit SilA	S5VTK5	Leptospira_phage	4.0e-61	22.5
WP_000758228.1\|144994_145435_+	hypothetical protein	NA	NA	NA	NA
WP_004098955.1\|145561_148009_+	Ag(+)-translocating P-type ATPase SilP	A0A218MNH6	uncultured_virus	7.6e-84	35.8
WP_000843497.1\|148049_148247_+	DUF2933 domain-containing protein	NA	NA	NA	NA
WP_004118669.1\|148280_149018_-	peptidoglycan DD-metalloendopeptidase family protein	A0A2H4JAF5	uncultured_Caudovirales_phage	1.2e-11	32.5
WP_001023257.1\|149306_149756_-	copper resistance protein	NA	NA	NA	NA
WP_000925242.1\|149989_151807_+	multicopper oxidase PcoA	NA	NA	NA	NA
WP_001378118.1\|151812_152703_+	copper resistance outer membrane transporter PcoB	NA	NA	NA	NA
WP_000025662.1\|152742_153123_+	copper resistance system metallochaperone PcoC	NA	NA	NA	NA
WP_004118344.1\|153127_154057_+	copper resistance inner membrane protein PcoD	NA	NA	NA	NA
WP_001188930.1\|154111_154792_+	copper response regulator transcription factor PcoR	W8CYM9	Bacillus_phage	8.7e-30	34.4
154583:154598	attR	NA	NA	NA	NA
WP_004152084.1\|154788_156189_+	copper resistance membrane spanning protein PcoS	W8CYF6	Bacillus_phage	4.1e-18	26.3
WP_004152085.1\|156405_156840_+	copper resistance system metallochaperone PcoE	NA	NA	NA	NA
WP_004152086.1\|157071_157251_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_031944101.1\|158993_159503_+	aquaporin	NA	NA	NA	NA
WP_004152091.1\|159552_160050_-	N-acetyltransferase	NA	NA	NA	NA
WP_004152092.1\|160381_160708_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_004152093.1\|160704_161418_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	2.9e-92	77.0
WP_004182005.1\|161426_161972_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_004152095.1\|162047_162410_+	arsenic metallochaperone ArsD family protein	NA	NA	NA	NA
WP_004152096.1\|164306_164843_+	N-acetyltransferase	NA	NA	NA	NA
WP_004152097.1\|164875_165301_-	glutaredoxin-dependent arsenate reductase	A0A2H4J8T1	uncultured_Caudovirales_phage	2.3e-52	72.9
WP_004152098.1\|165313_166603_-	arsenite efflux transporter membrane subunit ArsB	A0A2H4J144	uncultured_Caudovirales_phage	1.9e-171	74.0
WP_004152099.1\|166650_168402_-	arsenite efflux transporter ATPase subunit ArsA	NA	NA	NA	NA
WP_004152100.1\|168419_168782_-	arsenite efflux transporter metallochaperone ArsD	NA	NA	NA	NA
WP_004152101.1\|168831_169182_-	As(III)-sensing metalloregulatory transcriptional repressor ArsR	A0A2H4J145	uncultured_Caudovirales_phage	1.4e-23	50.9
WP_004152102.1\|169539_169809_+	hypothetical protein	NA	NA	NA	NA
WP_004152103.1\|169796_170372_+	hypothetical protein	NA	NA	NA	NA
WP_004152104.1\|170402_170897_+	DNA-binding protein	NA	NA	NA	NA
WP_004152105.1\|170940_171309_+	hypothetical protein	NA	NA	NA	NA
WP_004152106.1\|171342_171546_+	hemolysin expression modulator Hha	NA	NA	NA	NA
WP_004152107.1\|171594_171852_+	hypothetical protein	NA	NA	NA	NA
WP_004152108.1\|171927_172182_+	hypothetical protein	NA	NA	NA	NA
WP_003026799.1\|172357_172624_+	DUF1778 domain-containing protein	NA	NA	NA	NA
WP_003026803.1\|172611_173094_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_020314316.1\|173305_174652_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_004152113.1\|176494_177457_-\|protease	M48 family metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_3

187280 : 196802

Escherichia_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004217321.1\|187280_187985_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.2e-138	99.6
WP_001620097.1\|188957_190046_-	AAA family ATPase	A0A077SLJ9	Escherichia_phage	8.0e-211	100.0
WP_001620096.1\|190132_190393_-	hypothetical protein	A0A077SK33	Escherichia_phage	1.9e-41	100.0
WP_001620095.1\|190690_191551_+	class A broad-spectrum beta-lactamase SHV-1	A0A077SL40	Escherichia_phage	4.4e-156	99.7
WP_002210513.1\|191571_192333_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.9e-134	100.0
WP_002210514.1\|192593_193496_+	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	5.3e-160	100.0
WP_002210515.1\|193507_194773_+	four-carbon acid sugar kinase family protein	A0A077SLJ7	Escherichia_phage	2.7e-234	100.0
WP_002210516.1\|194765_195386_+	aldolase	A0A077SK32	Escherichia_phage	8.0e-115	100.0
WP_001067855.1\|196097_196802_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP015131

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

39497 : 102287

Escherichia_phage(25.0%)

transposase,integrase

attL 44859:44879|attR 63526:63546

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000343766.1\|39497_40718_-\|transposase	ISL3-like element ISEc53 family transposase	NA	NA	NA	NA
WP_000115885.1\|40736_41255_-	ClbS/DfsB family four-helix bundle protein	NA	NA	NA	NA
WP_000619112.1\|41389_41638_+	DinI-like family protein	Q2A098	Sodalis_phage	1.2e-13	48.0
WP_000109079.1\|41634_42072_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	1.1e-25	47.6
WP_000952372.1\|43194_44367_+\|transposase	IS21-like element IS21 family transposase	U5N3F9	Enterobacteria_phage	3.5e-228	99.5
WP_000544830.1\|44366_45164_+	IS21-like element IS21 family helper ATPase IstB	U5N3V8	Enterobacteria_phage	1.9e-145	99.6
44859:44879	attL	NA	NA	NA	NA
WP_000340835.1\|45481_45874_-	plasmid partitioning/stability family protein	NA	NA	NA	NA
WP_001103694.1\|45878_46850_-	hypothetical protein	A0A222YXF2	Escherichia_phage	9.7e-67	42.9
WP_000633911.1\|47078_47723_+	AAA family ATPase	A0A222YXS3	Escherichia_phage	8.8e-40	43.5
WP_000239529.1\|47716_47992_+	hypothetical protein	NA	NA	NA	NA
WP_000016979.1\|48129_48939_-\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	7.8e-54	95.5
WP_001159871.1\|48939_49245_-	type II toxin-antitoxin system toxin CcdB	NA	NA	NA	NA
WP_000813634.1\|49246_49465_-	type II toxin-antitoxin system antitoxin CcdA	NA	NA	NA	NA
WP_000990667.1\|51786_52428_+	hypothetical protein	NA	NA	NA	NA
WP_001309253.1\|53602_54580_+	replication initiation protein	J9Q7H0	Salmonella_phage	6.1e-101	59.5
WP_064840319.1\|54822_55563_-\|integrase	site-specific integrase	I3WFA4	Macacine_betaherpesvirus	1.6e-24	57.6
WP_001309252.1\|55683_55872_-	hypothetical protein	NA	NA	NA	NA
WP_001072358.1\|56238_57408_+	hypothetical protein	NA	NA	NA	NA
WP_001322642.1\|58254_58527_-	adhesin biosynthesis transcription regulatory family protein	NA	NA	NA	NA
WP_001298664.1\|59769_61740_+	TonB-dependent hemoglobin/transferrin/lactoferrin family receptor	NA	NA	NA	NA
WP_000977394.1\|61746_62538_+	DUF4198 domain-containing protein	NA	NA	NA	NA
WP_001323403.1\|63276_64056_-	AAA family ATPase	A0A2L1IVB6	Escherichia_phage	1.5e-139	100.0
63526:63546	attR	NA	NA	NA	NA
WP_001310017.1\|64055_65078_-\|transposase	IS21-like element IS100 family transposase	A0A2L1IVA1	Escherichia_phage	3.2e-201	99.7
WP_000612626.1\|66157_66505_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	2.6e-62	100.0
WP_000839179.1\|66501_66906_-	IS66 family insertion sequence hypothetical protein	A0A0P0ZCV4	Stx2-converting_phage	3.0e-70	100.0
WP_001189113.1\|67407_68916_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	6.2e-44	31.8
WP_001020413.1\|71181_72357_-	enterotoxin production-related protein TieB	NA	NA	NA	NA
WP_001100763.1\|72425_74687_-	TonB-dependent receptor	NA	NA	NA	NA
WP_000981091.1\|74855_75632_-	energy transducer TonB	NA	NA	NA	NA
WP_001224623.1\|75639_76515_-	ChaN family lipoprotein	NA	NA	NA	NA
WP_001080732.1\|78965_79301_-	colicin transporter	NA	NA	NA	NA
WP_000142452.1\|79429_79777_+	hypothetical protein	NA	NA	NA	NA
WP_000194542.1\|79796_80306_-	hypothetical protein	NA	NA	NA	NA
WP_000371882.1\|80302_80563_-	hypothetical protein	NA	NA	NA	NA
WP_000874189.1\|83469_83955_-	hypothetical protein	NA	NA	NA	NA
WP_001267176.1\|83979_84465_-	TlpA family protein disulfide reductase	NA	NA	NA	NA
WP_000117262.1\|84451_85147_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.5e-29	38.9
WP_000729218.1\|85151_86282_-	ABC transporter permease	NA	NA	NA	NA
WP_000964653.1\|86271_87555_-	ABC transporter permease	NA	NA	NA	NA
WP_000119836.1\|87557_88937_-	DUF2318 domain-containing protein	NA	NA	NA	NA
WP_000178050.1\|89040_89568_-	iron transporter	NA	NA	NA	NA
WP_000118029.1\|89608_91495_-	FTR1 family iron permease	NA	NA	NA	NA
WP_012372823.1\|91841_92657_-	Na(+)-translocating NADH-quinone reductase subunit C	NA	NA	NA	NA
WP_000949452.1\|92839_93346_-	protein disulfide oxidoreductase	NA	NA	NA	NA
WP_000449408.1\|93335_93494_-	DsbA family protein	NA	NA	NA	NA
WP_000428546.1\|95104_95698_+	tetracyline resistance-associated transcriptional repressor TetC	NA	NA	NA	NA
WP_001089068.1\|95810_97016_-	tetracycline efflux MFS transporter Tet(B)	NA	NA	NA	NA
WP_000088605.1\|97097_97721_+	tetracycline resistance transcriptional repressor TetR(B)	NA	NA	NA	NA
WP_000656305.1\|98876_99254_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_001138064.1\|99320_102287_-\|transposase	Tn3-like element TnAs3 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	73.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP015133

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP015130

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP015132

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP015131

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection