CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_AP014636	Vibrio tritonius strain AM2	2 crisprs	DEDDh,RT,csa3,csx1,PD-DExK	1	1	3	0
NZ_AP014635	Vibrio tritonius strain AM2 chromosome 1	0 crisprs	DEDDh,RT,cas3,csa3,DinG,csx1	0	0	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_AP014636_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_AP014636_1

181353-181429

Orphan

Consensus_repeat	Method
GTGAGTGTCCTGCTAAAGTAGTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_AP014636_1

>merge|NZ_AP014636|1|181353-181429|CRISPRCasFinder
GTGAGTGTCCTGCTAAAGTAGTTTCTTTGGCAGCTTCGAGTGCTTTTAGGGACGATGAGTGTCCTGCTAAAGTAGTT

>NZ_AP014636|1|1|181353-181429|CRISPRCasFinder
GTGAGTGTCCTGCTAAAGTAGTT	TCTTTGGCAGCTTCGAGTGCTTTTAGGGACG
ATGAGTGTCCTGCTAAAGTAGTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_AP014636.1\|WP_068716356.1\|174694_177124_-\|DUF2309-domain-containing-protein	unknown	unknown	gnl\|CDD\|378378
NZ_AP014636.1\|WP_068716378.1\|190758_190959_+\|chromosome-partitioning-protein-ParA	unknown	unknown	gnl\|CDD\|341174
NZ_AP014636.1\|WP_068716382.1\|192615_193638_-\|arabinan-endo-1,5-alpha-L-arabinosidase	unknown	unknown	gnl\|CDD\|350151
NZ_AP014636.1\|WP_068716368.1\|183180_185106_-\|VWA-domain-containing-protein	unknown	unknown	gnl\|CDD\|184242
NZ_AP014636.1\|WP_068716362.1\|179467_179944_-\|L,D-transpeptidase-family-protein	unknown	unknown	gnl\|CDD\|225577
NZ_AP014636.1\|WP_068716364.1\|180207_181170_+\|transposase	unknown	unknown	unknown
NZ_AP014636.1\|WP_068718981.1\|185098_186067_-\|VWA-domain-containing-protein	unknown	unknown	gnl\|CDD\|238744
NZ_AP014636.1\|WP_068716355.1\|172160_173558_+\|aldehyde-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|184426
NZ_AP014636.1\|WP_068716371.1\|186547_187465_-\|DUF58-domain-containing-protein	unknown	unknown	gnl\|CDD\|224635
NZ_AP014636.1\|WP_068716380.1\|191278_192496_+\|aldose-1-epimerase-family-protein	unknown	unknown	gnl\|CDD\|379620
NZ_AP014636.1\|WP_068716358.1\|177123_178491_-\|NADH-quinone-oxidoreductase-subunit-L	unknown	unknown	gnl\|CDD\|236171
NZ_AP014636.1\|WP_156430570.1\|169719_169887_-\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014636.1\|WP_068716360.1\|178590_179463_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_AP014636.1\|WP_068716373.1\|187474_188431_-\|MoxR-family-ATPase	unknown	unknown	gnl\|CDD\|223786
NZ_AP014636.1\|WP_068718979.1\|173685_174657_-\|threonylcarbamoyl-AMP-synthase	unknown	unknown	gnl\|CDD\|223088
NZ_AP014636.1\|WP_169795772.1\|169894_170047_-\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014636.1\|WP_068716375.1\|188745_190662_+\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|223910
NZ_AP014636.1\|WP_068716354.1\|171127_172015_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176133
NZ_AP014636.1\|WP_156430571.1\|181525_183178_-\|BatD-family-protein	unknown	unknown	gnl\|CDD\|379280
NZ_AP014636.1\|WP_068716370.1\|186053_186542_-\|DUF4381-domain-containing-protein	unknown	unknown	gnl\|CDD\|379552

Protein	Function_ID	Function_description	E-value
NZ_AP014636.1\|WP_068716356.1\|174694_177124_-\|DUF2309-domain-containing-protein	gnl\|CDD\|378378	pfam10070, DUF2309, Uncharacterized protein conserved in bacteria (DUF2309). Members of this family of hypothetical bacterial proteins have no known function.	0
NZ_AP014636.1\|WP_068716378.1\|190758_190959_+\|chromosome-partitioning-protein-ParA	gnl\|CDD\|341174	cd17285, RMtype1_S_Csp16704I_TRD2-CR2_like, Type I restriction-modification system specificity (S) subunit Target Recognition Domain-ConseRved domain (TRD-CR), similar to Campylobacter species RM1670 S subunit (S.Csp16704I) TRD2-CR2, Aeromonas media WS S subunit (S.AmeWSORF2351P) TRD1-CR1, and Clostridium carboxidivorans P7 S subunit (S.CcaPORF573P) TRD2-CR2. Campylobacter species RM16704 S subunit (S.Csp16704I ) recognizes 5'... ACANNNNNNNNTCG ... 3', and the recognition sequences of Aeromonas media WS TRD1-CR1 S subunit (S.AmeWSORF2351P) and Clostridium carboxidivorans P7 S subunit (S.CcaPORF573P) are undetermined. The restriction-modification (RM) system S subunit consists of two variable target recognition domains (TRD1 and 2) and two conserved regions (CR1 and CR2) which separate the TRDs. The TRDs each bind to different specific sequences in the DNA. RM systems protect a bacterial cell against invasion of foreign DNA by endonucleolytic cleavage of DNA that lacks a site specific modification. The host genome is protected from cleavage by methylation of specific nucleotides in the target sites. In type I systems, both restriction and modification activities are present in one heteromeric enzyme complex composed of one DNA specificity (S) subunit (this family), two modification (M) subunits and two restriction (R) subunits. This model contains both TRD1-CR1 and TRD2-CR2. It may also include TRD-CR-like sequence-recognition domains of various type II restriction enzymes and methyltransferases and type I DNA methyltransferases.	0.00203114
NZ_AP014636.1\|WP_068716382.1\|192615_193638_-\|arabinan-endo-1,5-alpha-L-arabinosidase	gnl\|CDD\|350151	cd18830, GH43_CjArb43A-like, Glycosyl hydrolase family 43 protein such as Cellvibrio japonicus Ueda107 endo-alpha-1,5-L-arabinanase / exo-alpha-1,5-L-arabinanase 43A (ArbA;CJA_0805) (Arb43A). This glycosyl hydrolase family 43 (GH43) subgroup includes mostly enzymes annotated with alpha-L-arabinofuranosidase (ABF; EC 3.2.1.55) and endo-alpha-L-arabinanase (ABN; EC 3.2.1.99) activities, and includes the bifunctional Cellvibrio japonicus Ueda107 endo-alpha-1,5-L-arabinanase / exo-alpha-1,5-L-arabinanase 43A (ArbA;CJA_0805) (Arb43A). It belongs to the glycosyl hydrolase clan F (according to carbohydrate-active enzymes database (CAZY)) which includes family 43 (GH43) and 62 (GH62) families. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. The GH43 ABN enzymes hydrolyze alpha-1,5-L-arabinofuranoside linkages while the ABF enzymes cleave arabinose side chains so that the combined actions of these two enzymes reduce arabinan to L-arabinose and/or arabinooligosaccharides. Many of these enzymes such as the Bacillus subtilis arabinanase Abn2, that hydrolyzes sugar beet arabinan (branched), linear alpha-1,5-L-arabinan and pectin, are different from other arabinases; they are organized into two different domains with a divalent metal cluster close to the catalytic residues to guarantee the correct protonation state of the catalytic residues and consequently the enzyme activity. These arabinan-degrading enzymes are important in the food industry for efficient production of L-arabinose from agricultural waste; L-arabinose is often used as a bioactive sweetener. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.	0
NZ_AP014636.1\|WP_068718981.1\|185098_186067_-\|VWA-domain-containing-protein	gnl\|CDD\|238744	cd01467, vWA_BatA_type, VWA BatA type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF). Typically, the vWA domain is made up of approximately 200 amino acid residues folded into a classic a/b para-rossmann type of fold. The vWA domain, since its discovery, has drawn great interest because of its widespread occurrence and its involvement in a wide variety of important cellular functions. These include basal membrane formation, cell migration, cell differentiation, adhesion, haemostasis, signaling, chromosomal stability, malignant transformation and in immune defenses. In integrins these domains form heterodimers while in vWF it forms multimers. There are different interaction surfaces of this domain as seen by the various molecules it complexes with. Ligand binding in most cases is mediated by the presence of a metal ion dependent adhesion site termed as the MIDAS motif that is a characteristic feature of most, if not all A domains. Members of this subgroup are bacterial in origin. They are typified by the presence of a MIDAS motif.	6.38403e-63
NZ_AP014636.1\|WP_068716362.1\|179467_179944_-\|L,D-transpeptidase-family-protein	gnl\|CDD\|225577	COG3034, COG3034, Uncharacterized protein conserved in bacteria [Function unknown].	5.63205e-38
NZ_AP014636.1\|WP_156430571.1\|181525_183178_-\|BatD-family-protein	gnl\|CDD\|379280	pfam13584, BatD, Oxygen tolerance. This family of proteins carries up to three membrane spanning regions and is involved in tolerance to oxygen in in Bacteroides spp.	3.60831e-68
NZ_AP014636.1\|WP_068716355.1\|172160_173558_+\|aldehyde-dehydrogenase-family-protein	gnl\|CDD\|184426	PRK13968, PRK13968, putative succinate semialdehyde dehydrogenase; Provisional.	0
NZ_AP014636.1\|WP_068716371.1\|186547_187465_-\|DUF58-domain-containing-protein	gnl\|CDD\|224635	COG1721, COG1721, Uncharacterized conserved protein (some members contain a von Willebrand factor type A (vWA) domain) [General function prediction only].	4.45452e-43
NZ_AP014636.1\|WP_068716380.1\|191278_192496_+\|aldose-1-epimerase-family-protein	gnl\|CDD\|379620	pfam14486, DUF4432, Domain of unknown function (DUF4432).	3.72787e-130
NZ_AP014636.1\|WP_068716358.1\|177123_178491_-\|NADH-quinone-oxidoreductase-subunit-L	gnl\|CDD\|236171	PRK08168, PRK08168, NADH-quinone oxidoreductase subunit L.	2.06238e-117
NZ_AP014636.1\|WP_068716368.1\|183180_185106_-\|VWA-domain-containing-protein	gnl\|CDD\|184242	PRK13685, PRK13685, hypothetical protein; Provisional.	5.93701e-14
NZ_AP014636.1\|WP_068716360.1\|178590_179463_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	2.3493e-36
NZ_AP014636.1\|WP_068716373.1\|187474_188431_-\|MoxR-family-ATPase	gnl\|CDD\|223786	COG0714, COG0714, MoxR-like ATPases [General function prediction only].	3.95056e-93
NZ_AP014636.1\|WP_068718979.1\|173685_174657_-\|threonylcarbamoyl-AMP-synthase	gnl\|CDD\|223088	COG0009, SUA5, Putative translation factor (SUA5) [Translation, ribosomal structure and biogenesis].	2.09633e-80
NZ_AP014636.1\|WP_068716354.1\|171127_172015_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176133	cd08442, PBP2_YofA_SoxR_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators, YofA and SoxR, contains the type 2 periplasmic binding fold. YofA is a LysR-like transcriptional regulator of cell growth in Bacillus subtillis. YofA controls cell viability and the formation of constrictions during cell division. YofaA positively regulates expression of the cell division gene ftsW, and thus is essential for cell viability during stationary-phase growth of Bacillus substilis. YofA shows significant homology to SoxR from Arthrobacter sp. TE1826. SoxR is a negative regulator for the sarcosine oxidase gene soxA. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine, which is involved in the metabolism of creatine and choline. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	6.21619e-88
NZ_AP014636.1\|WP_068716375.1\|188745_190662_+\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|223910	COG0840, Tar, Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms].	1.75938e-76
NZ_AP014636.1\|WP_068716370.1\|186053_186542_-\|DUF4381-domain-containing-protein	gnl\|CDD\|379552	pfam14316, DUF4381, Domain of unknown function (DUF4381). This family of proteins is found in bacteria and eukaryotes. Proteins in this family are typically between 158 and 180 amino acids in length.	2.08032e-38

>NZ_AP014636.1|WP_068716364.1|180207_181170_+|transposase
MTTARSQLICPDITPYYHCVSRCVRRSYLCGVDNLTGKSYEHRRDWIEQRILNLASIYFIQICSYAVMSNHYHLVVRIDKEGALALSDLEVVERWHAEHQLPPIIQRWLAGEIKSDIEKEVCNQFINEWRERLYSLSWFMRELNYDIAVQANKEDQCTGRFWEGRFKSQALLDEKALLAAMAYVDLNPIRAKMADTPEQSDFTSIKARLTSLEKGDITTPSLANFMGYEHQNKTQGIPFKLSDYLELVDWLGRHIRPDKPGYIHDSHPNILIRLSLAQKDCLALCTKLEKKPRVWVGTTACLHHAKKALNKKRMVALHIA
>NZ_AP014636.1|WP_068716362.1|179467_179944_-|L,D-transpeptidase-family-protein
MKLVWFALLCLVALPTMAAVDWVKVDKSKRRMYLYEHGELVREYRIALGKEPKGHKHQEGDQRTPEGLYYLDNISAQTHFYKAFHISYPNKQDIAYAKLHDLDPGGDVKVHGLKNGTTARPEFVQSFDWTNGCIALTNDEMDEFITLVPVGTPISIEW
>NZ_AP014636.1|WP_068716360.1|178590_179463_+|LysR-family-transcriptional-regulator
MSRLNYHHLYYFWQVAKQGNLTQTAQKLHISQSALSSQIKQLEQSMGVDLFVRKGRSLSLTESGYHALSYAEEIFRNGEELETLLTSGKTLPGATIRIGILSTISRNFIEQFIQPLINQSDCRYVLQSMSQTGLLNALAELQLDVALTNIPVRGSNKQNWQSRVLARQAVAIIGPPDLDLKEELGESYRNRQWVLPYGENPLRAAFDAYAAQYQLQPNIIAESDDMAMLRLLTRDTGALAVMPEVVVKDELDHGTLKRYLLLPNVYENYYALTVKRRVVHPKLDMLLRPI
>NZ_AP014636.1|WP_068716358.1|177123_178491_-|NADH-quinone-oxidoreductase-subunit-L
MYSLFLVTPLKLMLLGLIAILGFTIVRYSWVAFSGEADRPRFLRSLLMTIAAVVLVIVSNHLLLFWAAWVAVSLSLHRLILFYPLRPRAQLAAHKKFLLARLSELLLAIAFSALYTQYQTPYINDILAQTSFTHSTTTTTIAAIMLALVALIKCAQLPMHGWLIQVVEAPTPVSALLHAGIVNLGGILLLFFAPILASSAFACWMIIILAGISTVIAGLVSTTRISIKVKLAWSTSSQMGLMLVEIALGLYEMALLHLFAHSFYKAYSFLNSGNTVNHYLAAKLAGEVKPKVRHWSIALSLGLIILAAAQWEFAVMTSFAATILVWLALSTLLLPTITRFDKGTPARLAISLGFAVILLTLYTTAKHHLAALVGLNAPLNLVADIVVACLFVSLFACSIALQYWPHVSWVKRLFIWLNAGAYLDEWATRLTLKLWPSESLLKLQHAHWQVETEVK
>NZ_AP014636.1|WP_068716356.1|174694_177124_-|DUF2309-domain-containing-protein
MILENIAVPFATLAQQAAQTIAPAWPLDQSIAVNPWWPQRHQTINDVFAQQAVLIGSTGLMKKSYYQSLWQKQIQPQHVEKALISLGSALSKEQVITDLQRPEQPTPRWKTLAMLLDDKVPSAQGHSWVQEIQQQVSQFIALYHQYPERFDSNGKNGEHLYQSWLEVVTRDKGIRTLLGVDLLPYFAQLPNELFTMLEIAGSEWQDVLANEQGALAFAQASLHQLSGWAGWQAWLDWQANLANTEVKVPHALGLTTILLAWDYVLWQWLQNEKNDEFNIIKRALVVQSSKVNHLYDLAKQQLEPLWVWQRAMELSIQTDWIAQVEHVQQAQQQIRPSLQAVFCIDVRSEPMRRALEAQNSGIETVGFAGFFGIPIAYQTRDDSILRPQLPGLLAPSMVAQQTRMRPERWLRMTKLGWQNSLEKPSSNLGMVEAGGLLKLVSLFKRAVMQEGTENPVNRDARPNDQWELKRNQMPLTAQEKAKLGAGILKAMGFSQRLAPIVLLTGHGSQTCNNHTSSSLDCGACGGQTGEVNVKVLASLLNDPVVRGHMPEFGVTVPDDTHFYAAMHNTTTDDFKVFDAPSAPWRQTLIQASQQARHARVQQFDGPTAPSSGEVNRFFKQRATNWAQMRPEWGLCNNAGVFIAPRALTRNLDFAGRAFLHEYHVDQDPNYTQLERIMTAPLLVMNWINLQYFASVTVPDKYGSGNKLLHNVVGGHIGVFEGNGGDLRIGLSNQSVHDGKQYRHQPVRLSTFIQAPKEAIEMILARHQDVASLVNNNWLFLYQVDAQQRIWQYVKNQWLPITNHNNEMVN
>NZ_AP014636.1|WP_068718979.1|173685_174657_-|threonylcarbamoyl-AMP-synthase
MNTLRLNANKAQDLQHAACLLKQGKLVALPTETVYGLAADATQPDAVKHIFAAKGRPANHPLIVHIGEMSQLTDWAEDIPSQAYALAKAFWPGPLTLLLPKGKQASSIVTGGLDTIAIRMPAHPVILSILKEHKLAVAAPSANPYKQLSPTTAEQVITGLDGKIDAVLDGSDCLFGLESTIVDLTTEQIRVLRAGPITAQELSQVLGEPVDYPKYHSMSVPGNVGSHYQPKTLLRLVDNIVQAVMNRDKNSTYAVIHTSELVDDNGIASFEMPLDAASYGKKLYRSLADADKLQLDEIWLERPPQGEAWNAVNDRLSRAALPL
>NZ_AP014636.1|WP_068716355.1|172160_173558_+|aldehyde-dehydrogenase-family-protein
MTQAIPMASQAKSINPANGETIATYTFDSNAQVIGTLEQSFQAQREWRELAVSERAQTLRNIGQAIRDHGEEMAQMMTREMGKPIAQARGEVAKSANLCDWYAEHGPAMLATKPTMVENRQAVLEYRPLGVILGIMPWNFPLWQVMRGAVPMLLAGNTYVLKHAPNVMGSAYLIEKILNSSGLVKGAFSVVNATNDDVAAVIADDRLAAVAFTGSVRAGKVIGALAGAALKKSVLELGGSDPFIVLADADIDEAVRAAVIGRYQNNGQVCAAAKRFIVESSIAQEFTDKFVAAVTALKMGEPTQEENYVGPMARFDLRDELDQQVQATIKQGATVLVGGKPLQGEGNYYEPTVLANVTPDMTAFREEMFGPVAAITVAKSAQHAIELANDSEFGLCATLYSGNEVYAEELAAQLECGGVFINGFCASDPRVTFGGVKKSGYGRELSEHGMYEFCNVQTVWKNRKG
>NZ_AP014636.1|WP_068716354.1|171127_172015_-|LysR-family-transcriptional-regulator
MNLSQLEMFNAVAETGSITDAAKRVHRVPSNVTTRIRQLEADLGTELFIRENQRLRLSPAGYNLLEYSHQILQLVEEAKAAVAGKAPKGRLHLGSLESTAAVRIPPLLARYNQTYPNIQLDLVTGPSGTMFDQVLEGELAAAFIDGPILHPAIDGMPVFTEELVLISPTSYTDIQRARDITGHNIYAFRSNCSYRRHFENWFLADHAKPGKIFEMESYHGMLACVIAGAGVAMMPLSLLNTMPGHDQVKIHSLGKEWDHLTTWLIWRRNSMTPQLRVMIELLPEYAHESIEISIR
>NZ_AP014636.1|WP_169795772.1|169894_170047_-|hypothetical-protein
MDQCDHKNQLIRQHRNVWDKLSGVKEVYMCKKCGEIIKLRGGKMTSNIPK
>NZ_AP014636.1|WP_156430570.1|169719_169887_-|hypothetical-protein
MQTSELHQRIQVKLNDGRNGHSLSTSLAAEMGLLMSSQRPSCIRFYAALPIFYVE
>NZ_AP014636.1|WP_156430571.1|181525_183178_-|BatD-family-protein
MKFLFSHLIRTLSLLALTLLSVNAFADNFYATVSKNRVVQNEVFQLEVTTDGKASSGDLDFSVLKKDFVMGQPSFSTSVSIINGSRSATAQWTVSLAAKHTGIITIPSFTLNGDKTQAIALQVQKDTNAPATKDLVEVTSHLDKTTLYPKEAALLKARLIVKTDPRRLQSTNIEPPKVDGMELKSTGEPKQYQAVLNGLQVTVVDQNFRITATKPGTFSLSEPKFEGSILYGNDYNGSTRIVSVETTPKTYQIHVQPQPKDYKGVWLPTSHLSLKQSWTDGQGNPIIQDTFKTKVGDSLNREITLEVSGVSQNELPDIIINNPVGVRTYAEKPHFKTQDNGDVVMTLKQVVIPSKTGNLELPSVSLNWWNSTAKREQTAKLSGLTLSVAPGDNAQPLPAVNPAPSAPAQVKVVTKQDAGFWPYLTGLFVVLWLATLGLAFYWKRKTPVAKQVDDKPTQASAQSLTLEQAIAAKNGIAISQALSQWRQTVTLTSEEEAELTQEKNALDQALYSNKGSDLDGKALLALIRRIEKRMKKKSKLSKDDSTLPPL
>NZ_AP014636.1|WP_068716368.1|183180_185106_-|VWA-domain-containing-protein
MSDFVFLSPYWLLTLLPLGLVLLWLSLSRHQQTLIAPHLAQAMGLGVQRKRSRTLSLLALVWTLAAVALAGPSIQKQARPTYSNGSARVLVMDMSMSQYATDISPNRLTQQRYKALDLLKGWRDGYTGLVAFAGGAYTVSPLTSDSATIANLVPNLAPQIMPTPGANVVAGVKKAIEMMTNARMGKGDIVLLTDDIDENQSAQLVSLLKGTHWKLMVLAMGTPQGAPIQLSDGSLMKDGQGDTIVAKVDFNTMRTLTQDLGGVFVPYRGDEQDVSTLLSATKAVQAIQGKNGTKTVTERINNGYWLLFPILLFALLLFRRGVLFIFIAMALPTLAPNHAYASPWLTPDQEGYQAYQNKDYNGAAQKFKDPKWLGAARYQAGDYQGAIDALSQVENPDEDTHYNLANAYAQAKQLDKAQELYESILKDDPNNADAKHNLQVVKQAKKQQQQQQQQQKNNQSSSKNNSSKPNEQQGDKHSQQNQKQSDKGENNNHGNKQGTQNQSSSAQGNNTSQADKQGGDQTKKNPKSGQVKQKQANKGQKSADKDAKNHGNNKQNSADKQGSNQQAIPSPQTAQDGAKPNGGKQQAQANVAQNSSAKEVDPELRKLDQVESVRDPSQLLRAQLYLQAQDQGETDTQGKKW
>NZ_AP014636.1|WP_068718981.1|185098_186067_-|VWA-domain-containing-protein
MANIEFVWWWAFCLLPLPLLVFKFAPSVKSKAAISLPYLPTQPAIAAPTNMFAKVLAVATWVFLVTALARPVWYGAPVNVSPKHRDMMLVVDLSYSMSQKDMQQGDDFIDRLTAVKQVLKEFVAKRKGDRLGLIYFADHAYLQTPLTFDLHTVEEQVNHAVLKLIGTQTAIGEGIGLATKNFIDGDAPQRVMILLSDGSNNSGVMDPIEAAKIAKKYHTTIYTIGVGAGEMVVRNFFGSQRVNTAKDLDEKTLTAIAKMTGGRYFRARDAKDLANIYDTINQLQPVEKASQTWRPQTEWFGLPLTIALVLSVVLFIVRRNHV
>NZ_AP014636.1|WP_068716370.1|186053_186542_-|DUF4381-domain-containing-protein
MQESSSAPLQLSDLHLPDVPSWVPLAWGWWATAASIVAFVVIVVLVIRWKRKRLAPKKTALRLLTPSLGIQTPSSAIELLRQAALCYYPREDIAHLTGKEWYAFLDDQIGRPLFVPNETQWQQALYKKQSAVDTKALVEDCYQWINDALPPKKRRHVSVGKH
>NZ_AP014636.1|WP_068716371.1|186547_187465_-|DUF58-domain-containing-protein
MNYSLPTHADGVHLCLDELLPYQQHTAKWLPPAKSLWSQMLGQHQSRQLGRGMDFAEVRQYQPGDDIRTIDWRVTARTGKPHTKLFTEEREKPVVLYIDLSASMQFGSTLLFKSVQAAHLASLLSWLAIAQKDRIGAVIDTGYKLVELKPTSRTKGPLTILAQLVALQKELLSGQTPPEQRDMKQAFVALNRLCPKGSEVVLISDFIRYRTELKPLFNQLHRRNRVRLIHIYDPLEQGNTLFRGTELVTDQKDERWLNFSLNSTRNGIKKAFESHKEKLELLCQSMKMDYHALSSDSPLLQQLAG
>NZ_AP014636.1|WP_068716373.1|187474_188431_-|MoxR-family-ATPase
MQSETFQTLKNYLNQQVIGQHALVEQLLVALLADGHILVEGPPGLAKTRAVKALAGCIEGKFHRIQFTPDLLPADLTGTDIYRPETGEFAFQPGPIFNSLVLADEINRAPAKVQAAMLEAMAEKQITAGRKTYALPKLFLVMATQNPIEQEGTYPLPEAQLDRFLLHLDVDYPDAEHELAILRLNRGEAKGQTAQEKPRISQDAIFAARQEVLNVHMAEAIENYLIRLIMATRKPAQYDAKLAEWLEMGVSPRATIALDRCARAHAWLNGRDFVSPEDIQTMIFPVLRHRLLLSYQAQAENVHPNQVIAHLLSLVGSA
>NZ_AP014636.1|WP_068716375.1|188745_190662_+|methyl-accepting-chemotaxis-protein
MMSLHKLSIKQKVIIGITLAVLASTMVVGMIAQRQTHEVLRHRLVDVELPSILNQIGDEVDGQVSVLLNAARQLANNEFIKQAVDDKNIDPTQESMVVKTLNNVRSQYSLNDASVANRQTAYYWNQNGFLRQLNHQQDGWFYGFVQSNNPTMVSMFQEANGDVKMFANYQNVSGSTLSGVSKSMDDMVKFLNGFHIEKTGYVFLTDAQGKVQIHRDTSKSHNTLSDFYGSSASQLLNKSGFNLIETQSNGRDVFVGSLYIKSMNWFVIGTVPVAEVFADVNSVTHRILLITLIVAVIFILGGIWLANSIVNPIRLLAQRFTELGRGDGDLSQRITVEGHDEIAQLSQGFNGFIEKIHVSMREVAETSNALQSAANRVAEKASTTHDNSQEQRDQTLQVVAAINEMGATISEIASNASTAAETATDASRNTDTGRDVVNKAKDVIGRLANDMESNGQVVKQLADTTQNIGSILEVIRGISEQTNLLALNAAIEAARAGEQGRGFAVVADEVRNLAGRTASSTDEIQAMINQLQSDAKDAVEAMLAGQLVTQDGVSAADEAVGVLANISERIHDISDRNIQVATATEEQSTVVHAINVNIEEINSINEMTTNTAEELADASHELQDLSSRLDRMVGSFKL
>NZ_AP014636.1|WP_068716378.1|190758_190959_+|chromosome-partitioning-protein-ParA
MSDFEKELELMSQELGDEPEVKLPSLDEQQAIVAELKQLEKEGKLTPEVLEKFFGKYYATAEKSVH
>NZ_AP014636.1|WP_068716380.1|191278_192496_+|aldose-1-epimerase-family-protein
MKVKLTLAAITLALASLNTQAAEFLLTDAATGSDVGNWQVTSSTLGMTSGPAFSVEKRRLHGGKQEGVDVLVVNNGELSVTLVPTRGMGIYQVTRQGHRILGWDSPVKEIVNPAYIDLESRNGLGWLDGFNEMMVRCGFEWTGHPGYDDDGHLLTLHGRAQNTPVSMVKVIIDDQPPHKITVLGQVAERTFKKTQLVTMTELQTVPGSNAFSIHDKLTNVSDYDDEYQIIYHSNFGRPILEKGAKVTIAASEISPFNDYAKAGLKEWQTYLGPTKGFDEMVFNLKSLGDSKGNTLAVLNNKAANSGVSIHYNVKQLPVIGLWKNTDTESQGYVTGIEPGTSYSYNTKLQRPLGLVPTIKAGESKHFDLTYTVLRSSAEVKGALKEVAKIMKGKEVKLVKEPLAKE
>NZ_AP014636.1|WP_068716382.1|192615_193638_-|arabinan-endo-1,5-alpha-L-arabinosidase
MRLFRTALLPLLVCCSASYNVLAKQVEVHDPVMAVDNGVYYAFSTGPGITFYASKDMKNWQLMGRAFATEPSWAKKVAPEFNGHLWAPDVVHHNGQFYLYYSVSAFGKNTSAIGVTTTPTLDPQAKNYQWVDQGIVLQSVPNRDDWNAIDPAVAFDKKGTPWLAFGSFWNGLKLVKLDPSLTKIAEPEEWYNLARRPNNESDEAKAGNGAIEAPFIFYKNGYYYLFVSFDLCCRGMDSTYNIRVGRSKDIQGPYYDKAGKSMLEGGGTLVLKGNKNWVALGHNAAYTFKGKDYMVFHAYETADNALQKLRILPIHWKQGWPTVVQSDLDTHKTNLVNKLP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_AP014636_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_AP014636_2

1626225-1626399

Orphan

Consensus_repeat	Method
CGCTACGAGGACACTCACCCAAAAT	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_AP014636_2

>merge|NZ_AP014636|2|1626225-1626399|CRISPRCasFinder
CGCTACGAGGACACTCGAAATCGCTACGAGGACACTCACCCAAAATTGCCGCCGCAAACGCTACAAGGACACTCACCCAAAATTGCCGCTGCTACAAAATCGCAAACGCTACGAGGACACTCACCCTAAAATGAGTCCTCCTTAAAAAATCGCTACGAGGACACTCACCTTAAAA

>NZ_AP014636|2|2|1626225-1626399|CRISPRCasFinder
CGCTACGAGGACACTCGAAATCGCT	ACGAGGACACTCACCCAAAATTGCCGCCGCAAA
CGCTACAAGGACACTCACCCAAAAT	TGCCGCTGCTACAAAATCGCAAA
CGCTACGAGGACACTCACCCTAAAA	TGAGTCCTCCTTAAAAAAT
CGCTACGAGGACACTCACCTTAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_AP014636.1\|WP_068718721.1\|1632974_1634081_+\|alkene-reductase	unknown	unknown	gnl\|CDD\|239243
NZ_AP014636.1\|WP_156430631.1\|1616066_1616240_-\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014636.1\|WP_068718719.1\|1631927_1632836_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176150
NZ_AP014636.1\|WP_068718689.1\|1613870_1614365_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014636.1\|WP_068718715.1\|1630088_1631078_-\|zinc-binding-dehydrogenase	unknown	unknown	gnl\|CDD\|176232
NZ_AP014636.1\|WP_068718695.1\|1619582_1619933_+\|DUF3316-domain-containing-protein	unknown	unknown	gnl\|CDD\|371718
NZ_AP014636.1\|WP_068718706.1\|1625506_1626223_+\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|365877
NZ_AP014636.1\|WP_068718710.1\|1627753_1628716_+\|transposase	unknown	unknown	unknown
NZ_AP014636.1\|WP_068718708.1\|1626533_1627478_-\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|223769
NZ_AP014636.1\|WP_068718693.1\|1616435_1619294_+\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223354
NZ_AP014636.1\|WP_068718691.1\|1614378_1616001_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226641
NZ_AP014636.1\|WP_068718713.1\|1629390_1629897_-\|polyketide-cyclase	unknown	unknown	gnl\|CDD\|176864
NZ_AP014636.1\|WP_068718723.1\|1634181_1634871_+\|type-1-glutamine-amidotransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|153235
NZ_AP014636.1\|WP_068718700.1\|1622164_1623433_+\|diguanylate-cyclase	unknown	unknown	gnl\|CDD\|143635
NZ_AP014636.1\|WP_068718698.1\|1620023_1621571_-\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|214599
NZ_AP014636.1\|WP_068718712.1\|1629029_1629320_+\|GTP-cyclohydrolase	unknown	unknown	gnl\|CDD\|225225
NZ_AP014636.1\|WP_068718717.1\|1631092_1631602_-\|lactoylglutathione-lyase-family-protein	unknown	unknown	gnl\|CDD\|132684
NZ_AP014636.1\|WP_068718725.1\|1634890_1635730_+\|type-1-glutamine-amidotransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|153235
NZ_AP014636.1\|WP_068718702.1\|1623529_1624363_-\|xanthosine-phosphorylase	unknown	unknown	gnl\|CDD\|236183
NZ_AP014636.1\|WP_082712455.1\|1624509_1625373_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176140

Protein	Function_ID	Function_description	E-value
NZ_AP014636.1\|WP_068718721.1\|1632974_1634081_+\|alkene-reductase	gnl\|CDD\|239243	cd02933, OYE_like_FMN, Old yellow enzyme (OYE)-like FMN binding domain. OYE was the first flavin-dependent enzyme identified, however its true physiological role remains elusive to this day. Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction. Members of OYE family include 12-oxophytodienoate reductase, pentaerythritol tetranitrate reductase, morphinone reductase, and related enzymes.	1.34755e-170
NZ_AP014636.1\|WP_068718723.1\|1634181_1634871_+\|type-1-glutamine-amidotransferase-domain-containing-protein	gnl\|CDD\|153235	cd03141, GATase1_Hsp31_like, Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein. Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein (EcHsp31). This group includes EcHsp31 and Saccharomyces cerevisiae Ydr533c protein. EcHsp31 has chaperone activity. Ydr533c is upregulated in response to various stress conditions along with the heat shock family. EcHsp31 coordinates a metal ion using a 2-His-1-carboxylate motif present in various ions that use iron as a cofactor such as Carboxypeptidase A. The catalytic triad typical of GATase1 domains is not conserved in this GATase1-like domain. However, in common with a typical GATase1 domain, a reactive Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. For EcHsp31, this Cys together with a different His and, an Asp (rather than a Glu) residue form a different catalytic triad from the typical GATase1 domain. For Ydr533c a catalytic triad forms from the conserved Cys together with a different His and Glu from that of the typical GATase1domain. Ydr533c protein and EcHsp31 are homodimers.	1.31355e-96
NZ_AP014636.1\|WP_068718715.1\|1630088_1631078_-\|zinc-binding-dehydrogenase	gnl\|CDD\|176232	cd08271, MDR5, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	2.65343e-96
NZ_AP014636.1\|WP_068718695.1\|1619582_1619933_+\|DUF3316-domain-containing-protein	gnl\|CDD\|371718	pfam11777, DUF3316, Protein of unknown function (DUF3316). This family of bacterial proteins has no known function. Several members are, however, annotated as being putative acyl-CoA synthetase, but this could not be confirmed.	1.55955e-19
NZ_AP014636.1\|WP_068718706.1\|1625506_1626223_+\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|365877	pfam00106, adh_short, short chain dehydrogenase. This family contains a wide variety of dehydrogenases.	1.97935e-44
NZ_AP014636.1\|WP_068718719.1\|1631927_1632836_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176150	cd08461, PBP2_DntR_like_3, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold. This CD includes an uncharacterized LysR-type transcriptional regulator similar to DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	8.04067e-92
NZ_AP014636.1\|WP_068718708.1\|1626533_1627478_-\|DMT-family-transporter	gnl\|CDD\|223769	COG0697, RhaT, Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only].	4.71238e-12
NZ_AP014636.1\|WP_068718693.1\|1616435_1619294_+\|FAD-binding-oxidoreductase	gnl\|CDD\|223354	COG0277, GlcD, FAD/FMN-containing dehydrogenases [Energy production and conversion].	3.065e-83
NZ_AP014636.1\|WP_068718691.1\|1614378_1616001_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226641	COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only].	0
NZ_AP014636.1\|WP_068718702.1\|1623529_1624363_-\|xanthosine-phosphorylase	gnl\|CDD\|236183	PRK08202, PRK08202, purine nucleoside phosphorylase; Provisional.	9.65554e-153
NZ_AP014636.1\|WP_068718700.1\|1622164_1623433_+\|diguanylate-cyclase	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	4.22849e-49
NZ_AP014636.1\|WP_068718698.1\|1620023_1621571_-\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|214599	smart00283, MA, Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer). Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.	9.11278e-60
NZ_AP014636.1\|WP_068718712.1\|1629029_1629320_+\|GTP-cyclohydrolase	gnl\|CDD\|225225	COG2350, COG2350, Uncharacterized protein conserved in bacteria [Function unknown].	2.29726e-17
NZ_AP014636.1\|WP_068718717.1\|1631092_1631602_-\|lactoylglutathione-lyase-family-protein	gnl\|CDD\|132684	TIGR03645, glyox_marine, lactoylglutathione lyase family protein. Members of this protein family share homology with lactoylglutathione lyase (glyoxalase I) and are found mainly in marine members of the gammaproteobacteria, including CPS_0532 from Colwellia psychrerythraea 34H. This family excludes a well-separated, more narrowly distributed paralogous family, exemplified by CPS_3492 from C. psychrerythraea. The function is of this protein family is unknown.	2.68371e-123
NZ_AP014636.1\|WP_068718725.1\|1634890_1635730_+\|type-1-glutamine-amidotransferase-domain-containing-protein	gnl\|CDD\|153235	cd03141, GATase1_Hsp31_like, Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein. Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein (EcHsp31). This group includes EcHsp31 and Saccharomyces cerevisiae Ydr533c protein. EcHsp31 has chaperone activity. Ydr533c is upregulated in response to various stress conditions along with the heat shock family. EcHsp31 coordinates a metal ion using a 2-His-1-carboxylate motif present in various ions that use iron as a cofactor such as Carboxypeptidase A. The catalytic triad typical of GATase1 domains is not conserved in this GATase1-like domain. However, in common with a typical GATase1 domain, a reactive Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. For EcHsp31, this Cys together with a different His and, an Asp (rather than a Glu) residue form a different catalytic triad from the typical GATase1 domain. For Ydr533c a catalytic triad forms from the conserved Cys together with a different His and Glu from that of the typical GATase1domain. Ydr533c protein and EcHsp31 are homodimers.	8.65372e-70
NZ_AP014636.1\|WP_068718713.1\|1629390_1629897_-\|polyketide-cyclase	gnl\|CDD\|176864	cd07822, SRPBCC_4, Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins. Uncharacterized group of the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands. SRPBCC domains include the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of mammalian STARD1-STARD15, the C-terminal catalytic domains of the alpha oxygenase subunit of Rieske-type non-heme iron aromatic ring-hydroxylating oxygenases (RHOs_alpha_C), Class I and II phosphatidylinositol transfer proteins (PITPs), Bet v 1 (the major pollen allergen of white birch, Betula verrucosa), CoxG, CalC, and related proteins. Other members of the superfamily include PYR/PYL/RCAR plant proteins, the aromatase/cyclase (ARO/CYC) domains of proteins such as Streptomyces glaucescens tetracenomycin, and the SRPBCC domains of Streptococcus mutans Smu.440 and related proteins.	1.85319e-17
NZ_AP014636.1\|WP_082712455.1\|1624509_1625373_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176140	cd08449, PBP2_XapR, The C-terminal substrate binding domain of LysR-type transcriptional regulator XapR involved in xanthosine catabolism, contains the type 2 periplasmic binding fold. In Escherichia coli, XapR is a positive regulator for the expression of xapA gene, encoding xanthosine phosphorylase, and xapB gene, encoding a polypeptide similar to the nucleotide transport protein NupG. As an operon, the expression of both xapA and xapB is fully dependent on the presence of both XapR and the inducer xanthosine. Expression of the xapR is constitutive but not auto-regulated, unlike many other LysR family proteins. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	9.44904e-82

>NZ_AP014636.1|WP_068718706.1|1625506_1626223_+|SDR-family-NAD(P)-dependent-oxidoreductase
MKQVNQLNFLVTGATSGIGKLLTQQLINMGANVAFCGRSPAKMDDLLQQIGATGNTLYHDSFDATDFAHVKQFVANAHAALGGIDVLVNCAGANTARSTVADLAITDLQNLITLNTVSPFVFMQEVYNLAMKPREQGTIINVLSTVCQFANENIGAYTAAKSGFDALTQVFRKEVRPMGVKVCALYPGGVDTPFRSAERPEYLDAQSVCDAILFMATQEGVATVDELTIRPLVERNFR
>NZ_AP014636.1|WP_082712455.1|1624509_1625373_+|LysR-family-transcriptional-regulator
MLRYFYQVAHTENFSLAAQQLNITKSPLSAQIRELEQLMEVELFLRDTRNVQLTPAGKQLQKECRLIFDVLDTSISRVKQRYRVDHQTINIGLMSSIFWAGFGDALYQLQQRYPATKYNLIEMSPEKQKLALEQGRIDIGLVRYADTVNVAPLTMTSLYREKMMVALPEHHPLANHKLLSLNHLSEQEFVMLSRENSSSTDWIIQRCQQSGFHPNIVQQVVEPNTLLAVISTRGILSIVPESYASLAWPHVRFIPLREMIAADICALTVQDTPLLRPTLNELKQALQ
>NZ_AP014636.1|WP_068718702.1|1623529_1624363_-|xanthosine-phosphorylase
MSADPVNQALETIYARKPGFAPKAGFILGSGLGVIADALEEKVVIPYEELAGFPVSTVEGHSGELVLGKLFGIEVACMKGRGHYYEHQTMKVMTNPVRTFKRLGCEFMLVTNAAGSLRPDRIDVGSLVVFNDHINTMPESPMTGPNDDEYGPRFFSVANAYDKDLRAEVLDVAQQQNIHLNQGVFVSYTGPNFETAAEIRMMQIIGGDVVGMSVVPEVISAAHCGLPVLAVCAITNMAEGLSDVVLSHEQTLKCAKLAEKDFIALINAFMRHHFNVA
>NZ_AP014636.1|WP_068718700.1|1622164_1623433_+|diguanylate-cyclase
MNNAELTRSIPNDQAQLIAQIVNQCPSSIAVAHTDGSLIYCNHTFSHTFGNQQGESILNIFPHTFAHYSLSHVVERLRANSEPIHVIESQSDNECLHDGERHDWCVIKISLLQIQDRTLLLFFIEELTSTVVNNLRVNIKLESIVDHLPVLIGHVDHQDRYIFANRTYEKFFDCSLNDVIGKKVEDLIGKDAYLERKPYLNRVKQGESVVFDNAFFMGDDIRLLQLKLVPGDSELKDYYIFAQDVTELRSFQKKLEYRAYHDSLTGLTNRTYFVRSLRQAIERKQTDIGLLFIDVDGLKNANDRFGHDVGDELLKRFAELLKNTLRPNDVVSRLAGDEFTVLLANLDRPETNLTDICERIQASLPSAMVIDNNIVPCSCSIGATYINTELEFDEEKWLSIADTAMYRVKKQGKGGFNIHLEL
>NZ_AP014636.1|WP_068718698.1|1620023_1621571_-|methyl-accepting-chemotaxis-protein
MTKTTSNKSYSESISFISTTDCSSYITYANKDFCDIAEYSADELRGNPHNIVRHPDMPKAAFAQLWSYVKRGDSWMGLVKNRCKGPRHYWVSAFVTPIKNADGKVVEYQSIRSKPTAEQVARAEALYAKMNNNQKVSSWRFSSLSLTQGLLVTSLLVSLVGSFMSSPWWLTAASTILGLGALLTSFYCKMRMNQVNKLACEAYDNPLMETVYTGHFDDFSAIELSLMMRKAELRAVVARCADTSERILSDANEELENMREVEQRLTSQQHETDQVATAVEELNYAINDIANNAAESSNFTEDAQSVSQVGLQKIDNTIEQIRVLDAELANSRAILTSLSEHTQKVDMILDVINTIAEQTNLLALNAAIEAARAGESGRGFAVVADEVRQLAAKTGHSTHEIQAMIGELQQLTDQVVASMNQGSELSERCKQRADETGQVIRSISDKLGLITDKSQQTAAAVEQQATVTKEIAANTMNIKLLTEKTSASSGESVDRTRDLVDNLEDLSRLIQQFKA
>NZ_AP014636.1|WP_068718695.1|1619582_1619933_+|DUF3316-domain-containing-protein
MKKTIFILAAMTVSAGAFAAQTHLNVGETTIDSGVYSTKQEAYDAGLQKIHDLQQLPGTKLKNKLVIYNPDMVYGSTRLRDMEVKVEPFMEESGKTQYRSTVDVNYHYKVHESKNS
>NZ_AP014636.1|WP_068718693.1|1616435_1619294_+|FAD-binding-oxidoreductase
MSANVVSSQSQTNRYPLLLERLKSQLEPEQIITDSTRRLAYGTDASFYRLIPELILRLDTLEQVIFTIKQCRELVIPYTFRAAGTSLSGQAISDSVLITLSDKWRSHQILDQGERIRLQPGVIGSDANQYLAPFQRKIGPDPASINACKIGGIAANNASGMCCGTAQNSYQTIDNMKIVFYDGTLLDTASSDSIEQFYQSHPALIAQLSTLVNQTQANSELSQLIKHKYRLKNTTGYALNALVDYHDPIDVIKHLMIGSEGTLGFIAEVTYRTVIEHSHKASCLIVFANIEQASQAVTALAKTEIAAIEMMDGRAMRSVADKAGMPDFIAELDLEAAALLMECRATEHEALVTQCEHVMALLNQDQMLHSIPFTSDAKTVETLWGIRKGMFPAVGAVREVGTTVIIEDVSFPIEQLAQGVRDLQTLFDKYHYSEAIIFGHALAGNLHFVFTQAFDDEKEITRYGAFMQDVAELVAVKYQGSLKAEHGTGRNMAPFIELEWGEEGYRLMQAIKALFDPERLLNPGVIINDDQSAHLKNLKPMPAADPLVNRCIECGFCEAVCPSRGLTLTPRQRIVLYRELQKRRRDNDIEGAKSLEKEFDYLGIETCAATGLCAQRCPVEINTGALIKQLRTAKYRRYTSIARWTSEHFSTTTKLVNASLKANQITTSLIGTKAVGAITSSMRRVSLDTIPKWIPELPTANRFPLKQEVQAMHQEGKKRVVYMPSCASRNMGQQQDNPDQRPITQVVLSVLNKAGYDVILPAALNDTCCGMPYDSKGMTEIATQKAQQLEAILWQASEQGRYPVLMDMSPCAKRSIELFHMPLEIYEQVGFITRYLLPYLTIEQKEETIMLHITCSTQHLGLAKEMRQIAEQCVSHVVIPEHITCCAWAGDKGFVTPELNAAAVATLREQVPADCHRGFSNSRTCEIGLSHHSGIPYQSLFYLLDEVAKPRF
>NZ_AP014636.1|WP_156430631.1|1616066_1616240_-|hypothetical-protein
MAPFFYFQIVFACLLGYWWFDEVPTHESLLGGVLIVFAGVLLMLKRAPAKSTATEQI
>NZ_AP014636.1|WP_068718691.1|1614378_1616001_+|ABC-transporter-ATP-binding-protein
MSQTPLLQVRNLSVSFTTNDGIVDAVRNVNFDLNIGETLAIVGESGSGKSVSTNAVMQLLPKNAILHEGASILFEGEELLNRSEAEMRKVRGNRMGMIFQEPMTSLNPYMRVGGQVSEAVMCHQNVTRSQAKQKVLELFELVKLPNPEGAYTKFPHEFSGGQLQRIMIAMALINEPDILIADEPTTALDVTVQAEVLNLIKEIQAKMGMAILFITHDLGVVKHVADRVLVMCTGDVIEEGQTEQLFRDPQKDYTRMLINSIPRGQKTPVEASAPLLLKADDIRVKFLVKPHFLESRNEYFEAVKGISLELKQGETLGIVGESGSGKSTLGRALIGLLPSTGNIEFKGQDYRALSNKQKLSLKKDIQMVFQDPYGSLSPRMTVGDIITEGLTVHRPEMGKHERMLKAKQALEEVRLDASAINRYPHEFSGGQRQRIAIARALILEPSFILLDEPTSALDRSVQLTVIDLLKDIQQRRNIGFLFISHDLSVVKALSDRVLVMQKGEVMEEGTASDIFYRPQHDYTKKLIAASFDVEDDEVAA
>NZ_AP014636.1|WP_068718689.1|1613870_1614365_+|hypothetical-protein
MDLQQCWSCFLKAEELLKQGHWPQAHYLLEDVLHDLPGHIHQAASHQDTKPCQFACLIAGLRDTAVYQSEILNNMGQQSRAFEVLNQSYGLLQFLAIESSDLIGSVSLVLEKHSEDLLKHMGAFCHAQRNAQWQLEYEQVERAHHHFSQLKRFNELQPSSVVIN
>NZ_AP014636.1|WP_068718708.1|1626533_1627478_-|DMT-family-transporter
MPAEPTHFFSRPIIVFCLATLCTLLWGSAYPAIKTGYVLLNIEAHDVASQMVFAGQRFLLAGLFLIILCVLFRKRFRSLTRQKMRQILVLGLTQTSLQYIFFYIGVAFATGVKASIMNSTGTFFSVLLAHFIYQNDRLTHRRTIGVIIGFLGVFIVNFNKSLLNFDFSLLGEGSVVFAAFILAAASIYGKKISQGIDAMVMTAWQLAIGGLALLLIGLILGGHSGEFDLASTVLLIYLAGLSSAAFALWSVLLKYNSVSKVTIFNFLVPVFGSSLSSLFLGEAILEAKNIIALILVCSGIYLVTLNKPVVSFKQ
>NZ_AP014636.1|WP_068718710.1|1627753_1628716_+|transposase
MTTARSQLICPDITPYYHCVSRCVRRSYLCGIDSLTGKSYEHRRDWIEQRILSLANVYLIQICSYAVMSNHYHLVVRIDKKSALALSDLEVVERWHAEHQLPPIIHRWLAGEIQSDTEKEVCNRFISEWRERLYSLSWFMRELNYGIAVQANKEDQCTGRFWEGRFKSQALLDEKALLAAMAYVDLNPIRAKMADTPEQSDFTSIKARLTSLEKGKTTTPSLANFMGYEHQDKTQGVPFRLSDYLELVDWLGRQIRPDKSGYINDSQPNILARLTLTQSDCLTLCTELEKKPIVWIGSTPRLHQVKTALNKKRMVALHIA
>NZ_AP014636.1|WP_068718712.1|1629029_1629320_+|GTP-cyclohydrolase
MFVVSLTYTNGIEQVNQHLEEHRRYLDEHYAKGHFIASGRKEPRTGGVILAHGMTRAELEEMITFDPFYRNQAASYQITEFVPSKTSEQLNFLQEA
>NZ_AP014636.1|WP_068718713.1|1629390_1629897_-|polyketide-cyclase
MSDIIWPEGFVPGFTDNFCSNEVIVVGLSAKEIWPLLNTPAQWPTYYANSANPRFYDDQGPELTDGVRFYFETFGFPVESQCVECVAPVAGQPARLAWHGWAGEGETRLDVHHAWLIEDLSENRVRILTQESQKGNPAKELANTKPNPMINGHQEWLDGLVAAARKAK
>NZ_AP014636.1|WP_068718715.1|1630088_1631078_-|zinc-binding-dehydrogenase
MKAIIYQPDNDIFCACDMATPQLESPYDVLIEVDAVGLNPVDAKVNYWFGIVSDGAREFVGGLDVSGTIIAKGKEVHQWQLGDRVLYHGNMRRRQGGFAQLAVQDSRTLTPHPEVNACEAAASPCAGWTAYRAINDKLHMASHKQSVAIYGASGGVGSYAVQLCRYFNVPQVIAICSERNFDYVRSLGATHCFDYRDEKLLEKLAMVVGLDGVDCALDCFGQKGQRVLSASLGFDGQLVELVNTIDSAQHERAFERGLTLHQLSLGSGHVYGDRGFRSIVNAGMTMNLLMEQQKIQAPKLTVIELADIPDALTEIRLGHTCGKYVAAIK
>NZ_AP014636.1|WP_068718717.1|1631092_1631602_-|lactoylglutathione-lyase-family-protein
MSNPTQYPRTFSHIGLSVPDLDKAVKFYTEVLGWYLIMEPTTIVEDESPIGEMCTDVFGQGWGSFRIAHLSTGDRIGVEIFQFENAQNPENNFEYWRTGVFHFCVQDPNVEELAEKIVAAGGKKRMQAPRFYYPGEKPYRMIYMEDPFGNILEIYSHSYELTYSSGAYN
>NZ_AP014636.1|WP_068718719.1|1631927_1632836_+|LysR-family-transcriptional-regulator
MNNDIRNLDLNLLKAFDALMDEGTVTHAAQRLSLTQPAVSAMLTRLRDYFNDPLFVRAQRGMIPTERALALAPPIKQVLTDINLLLQPVHFDPLTADMTYTIAATDYALKAVIVPLMSELKKQAPGIRVAVIAINPETMVKQMEQGDVDLALMTPETTPVDLHSRSLYQERYVCMMRAEHPAAQTGQITLEQFCALEHILVSNHGGFWGPTDDALEEIGVKRRIGLSVNSFLVLPEILRITDMIAVVPRRLACRHDHVVIMDTPLEVQGFTKSMAWHERSHRNPAHQWIRALCLEASQIHHL
>NZ_AP014636.1|WP_068718721.1|1632974_1634081_+|alkene-reductase
MTVLFDDYVLSGKPLKNRAVVAPMTRARAPGNVPNEATVRYYAQRTDAGLIVTEGTPISQQGSGFVDCPGIWNQPQIEAWRKVTQQVHDLGSVIFTQIWHVGRISHVSLQPNGQAPVSSTATQAIHSKAFGYDKQGQPGFVTASKPHQLTTEEVQAIVNEFAQAAENAMAAGFDGVEIHGANGYLVEQFINGAVNDRQDQYGSESIDNRVRFALEVVDACIARIGADKVGIRLSPFGRLHELGDFPQEAETFLHLAAELDKRQIAYVHIMDQASRGAPAMPEGFLARFRRAFTGPLILAGGLDLAKANQLLDSGVIDLAAFGASYIANPDLVERYRHGWPIAIPNQDLYYGGDEHGYTDYPTYSGPQS
>NZ_AP014636.1|WP_068718723.1|1634181_1634871_+|type-1-glutamine-amidotransferase-domain-containing-protein
MPAANLIKPVLFVLTSHKDLGQGHDDSGFYLPELTHPLHVLEQANIPTALASIQGGLPPVYGVDLSDPINEHYWNDETFQDQLRNSIALDQAKAEEYSAILFVGGHGTVWDFPQNPAVLTLTRTLFEADKIVAAVCHGPSALVNVKLSSGDYLVAGKKVAAFTDSEEQAVGMTELVPFLLETTLKQRGALHQSAPDWTNNVVVDGKLITGQNPQSALSVGEALRDALLA
>NZ_AP014636.1|WP_068718725.1|1634890_1635730_+|type-1-glutamine-amidotransferase-domain-containing-protein
MKGFKLSLLASLLMATSTWANAANVLVVLSDSDHLDLKNGVTYSTGFYLNELMQPVKALLDAGDTLTFATPLGKAPTLDQHSVNVKDFGGDQQAFDAHVKLLKDLKLTDPAHSPVISLSRVEQIGYNHFDAIFVPGGHAPMQDLSVSPAMGKLLQAFHAAGKPTALVCHGPIALVSALPDAQQYTQKLEQNPKATDAQWIYAGYKMTSFTNNEEEAAKGMFNGSQLKFTPQTALTNAGAKFSMGNQFKSHIVQDRELITGQNPQSALAVVQALEKQLTH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_AP014636_1	1.1\|181376\|31\|NZ_AP014636\|CRISPRCasFinder	181376-181406	31	NZ_AP014636.1	181322-181352	0	1.0

1. spacer 1.1|181376|31|NZ_AP014636|CRISPRCasFinder matches to position: 181322-181352, mismatch: 0, identity: 1.0

tctttggcagcttcgagtgcttttagggacg	CRISPR spacer
tctttggcagcttcgagtgcttttagggacg	Protospacer
*******************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_AP014636_1	1.1\|181376\|31\|NZ_AP014636\|CRISPRCasFinder	181376-181406	31	MF893340	Pseudomonas phage PPSC2, complete genome	34658-34688	6	0.806

1. spacer 1.1|181376|31|NZ_AP014636|CRISPRCasFinder matches to MF893340 (Pseudomonas phage PPSC2, complete genome) position: , mismatch: 6, identity: 0.806

tctttggcagcttcgagtgcttttagggacg	CRISPR spacer
tcgttggcagctacgagtgctttctggcgcg	Protospacer
** ********* **********. ** .**

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

591099 : 600087

environmental_halophage(14.29%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_068717041.1\|591099_592341_-	SufS family cysteine desulfurase	Q2XUY6	environmental_halophage	2.6e-88	44.1
WP_068717042.1\|592333_593605_-	SufD family Fe-S cluster assembly protein	NA	NA	NA	NA
WP_068717044.1\|593579_594326_-	Fe-S cluster assembly ATPase SufC	A0A285PWH2	Cedratvirus	2.2e-10	31.9
WP_068717046.1\|594331_595795_-	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
WP_068717048.1\|595797_596166_-	iron-sulfur cluster assembly accessory protein	A0A2H4N7N5	Lake_Baikal_phage	1.2e-09	34.6
WP_068717050.1\|596335_596560_+	glutaredoxin-like protein NrdH	V5UN81	Mycobacterium_phage	2.0e-12	52.9
WP_068717053.1\|596573_596987_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A2H4J6X7	uncultured_Caudovirales_phage	1.1e-14	42.4
WP_082712367.1\|596964_599097_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	1.9e-203	49.5
WP_068717058.1\|599112_600087_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A0N7CCA3	Skermania_phage	1.3e-127	71.2

DBSCAN-SWA_2

922240 : 932094

Vibrio_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_068717600.1\|922240_922609_-	antirepressor	Q9MCC3	Vibrio_phage	1.4e-29	54.5
WP_156430604.1\|922797_923115_+	hypothetical protein	NA	NA	NA	NA
WP_068719061.1\|923333_925067_+	replication endonuclease	A0A0F6YPA7	Vibrio_phage	5.1e-244	71.0
WP_068717604.1\|925131_925446_+	chemotaxis protein	Q2PZB5	Vibrio_virus	4.4e-29	56.4
WP_068717606.1\|925718_925940_+	hypothetical protein	R9TI50	Vibrio_phage	3.6e-09	49.3
WP_068717608.1\|926010_927489_+	hypothetical protein	NA	NA	NA	NA
WP_068717610.1\|927488_927854_+	DUF5455 family protein	R9TIT8	Vibrio_phage	1.8e-29	51.2
WP_068717612.1\|927855_928938_+	hypothetical protein	O80263	Vibrio_phage	3.6e-139	67.0
WP_068717614.1\|928918_930154_+	type II secretory pathway protein	R9TEZ5	Vibrio_phage	2.0e-133	61.9
WP_068717616.1\|930743_931697_+	hypothetical protein	NA	NA	NA	NA
WP_068717618.1\|931716_932094_-	phage protein	A0A1W6UG37	Vibrio_phage	3.3e-39	65.3

DBSCAN-SWA_3

1627753 : 1683654

Enterobacteria_phage(37.5%)

protease,transposase,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_068718710.1\|1627753_1628716_+\|transposase	transposase	NA	NA	NA	NA
WP_068718712.1\|1629029_1629320_+	GTP cyclohydrolase	NA	NA	NA	NA
WP_068718713.1\|1629390_1629897_-	polyketide cyclase	NA	NA	NA	NA
WP_068718715.1\|1630088_1631078_-	zinc-binding dehydrogenase	NA	NA	NA	NA
WP_068718717.1\|1631092_1631602_-	lactoylglutathione lyase family protein	NA	NA	NA	NA
WP_068718719.1\|1631927_1632836_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_068718721.1\|1632974_1634081_+	alkene reductase	NA	NA	NA	NA
WP_068718723.1\|1634181_1634871_+	type 1 glutamine amidotransferase domain-containing protein	NA	NA	NA	NA
WP_068718725.1\|1634890_1635730_+	type 1 glutamine amidotransferase domain-containing protein	NA	NA	NA	NA
WP_068718727.1\|1635751_1636219_+	DMT family transporter	NA	NA	NA	NA
WP_068718729.1\|1636304_1637309_-	substrate-binding domain-containing protein	C6ZCU4	Enterobacteria_phage	2.3e-31	29.3
WP_068718731.1\|1637324_1638251_-	ribokinase	NA	NA	NA	NA
WP_068718733.1\|1638400_1639279_-	ribose ABC transporter substrate-binding protein RbsB	C6ZCU4	Enterobacteria_phage	1.1e-05	23.9
WP_068718735.1\|1639335_1640319_-	ribose ABC transporter permease	NA	NA	NA	NA
WP_068718737.1\|1640315_1641857_-	ribose ABC transporter ATP-binding protein RbsA	A0A2H4PQG7	Staphylococcus_phage	2.7e-18	27.9
WP_068718738.1\|1641924_1642344_-	D-ribose pyranase	NA	NA	NA	NA
WP_068719139.1\|1642669_1642933_+	DUF3012 domain-containing protein	NA	NA	NA	NA
WP_068719141.1\|1642981_1644979_-	U32 family peptidase	Q6DW11	Phage_TP	2.2e-17	28.3
WP_068718740.1\|1645144_1645504_-	hypothetical protein	NA	NA	NA	NA
WP_068718743.1\|1645544_1646519_-	toxic anion resistance protein	NA	NA	NA	NA
WP_068718745.1\|1647005_1647356_-	hypothetical protein	NA	NA	NA	NA
WP_068718747.1\|1647522_1647918_+	TIGR01244 family phosphatase	NA	NA	NA	NA
WP_068718749.1\|1649153_1649504_-	hypothetical protein	NA	NA	NA	NA
WP_068718751.1\|1649592_1650264_-	peptidoglycan DD-metalloendopeptidase family protein	NA	NA	NA	NA
WP_068718753.1\|1650260_1651499_-	MFS transporter	NA	NA	NA	NA
WP_068718755.1\|1651774_1652119_+	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_068718757.1\|1652177_1652633_-\|protease	activity regulator of membrane protease YbbK	NA	NA	NA	NA
WP_068718759.1\|1652641_1653586_-	stomatin 2	L7RCW8	Acanthamoeba_polyphaga_moumouvirus	2.3e-20	29.3
WP_068718761.1\|1654055_1654493_+	hypothetical protein	NA	NA	NA	NA
WP_068718763.1\|1654516_1655032_-	endonuclease V	NA	NA	NA	NA
WP_068718766.1\|1655098_1655839_-	hypothetical protein	NA	NA	NA	NA
WP_068718768.1\|1655895_1656291_-	hypothetical protein	NA	NA	NA	NA
WP_068718771.1\|1657005_1657269_-	hypothetical protein	NA	NA	NA	NA
WP_068718773.1\|1657284_1662021_-	RHS domain-containing protein	A0A2H4JFP5	uncultured_Caudovirales_phage	1.1e-33	54.2
WP_068718775.1\|1662020_1662746_-	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_068718777.1\|1662733_1664788_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	7.4e-32	26.0
WP_068718779.1\|1665137_1666412_-	type VI secretion system ImpA family N-terminal domain-containing protein	NA	NA	NA	NA
WP_179946824.1\|1666475_1669973_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_068718783.1\|1670034_1671441_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_068718785.1\|1671449_1672106_-	type VI secretion system-associated protein TagO	NA	NA	NA	NA
WP_068718787.1\|1672102_1673689_-	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_068718789.1\|1673691_1676304_-	type VI secretion system ATPase TssH	H6X3M6	Enterobacteria_phage	9.5e-93	31.0
WP_068718791.1\|1676332_1677106_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_068718793.1\|1677108_1678443_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_068718796.1\|1678449_1678953_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_068718798.1\|1678955_1680458_-	type VI secretion system-associated FHA domain protein TagH	NA	NA	NA	NA
WP_068718800.1\|1680460_1681477_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_068718801.1\|1681440_1683210_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_068718803.1\|1683216_1683654_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_AP014635

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

529605 : 540681

uncultured_Mediterranean_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_068712064.1\|529605_530361_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.1e-65	52.0
WP_068712066.1\|530365_530992_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.0e-37	51.8
WP_156430543.1\|530994_531906_+	peptidoglycan DD-metalloendopeptidase family protein	A0A1P8CWQ1	Bacillus_phage	1.3e-09	35.0
WP_068712068.1\|531983_532985_+	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	2.9e-34	34.1
WP_068712069.1\|533063_535628_-	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	2.3e-30	21.7
WP_068715848.1\|535712_536198_+	CinA family protein	B5TK85	Pseudomonas_phage	6.0e-25	44.4
WP_068712071.1\|536354_537404_+	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	1.4e-111	60.3
WP_156430432.1\|537471_537942_+	recombination regulator RecX	NA	NA	NA	NA
WP_068712073.1\|538098_540681_+\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	4.5e-79	37.3

DBSCAN-SWA_2

721509 : 728020

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_068715866.1\|721509_722643_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	8.4e-62	42.1
WP_068712345.1\|722652_723903_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	1.5e-96	47.6
WP_068712348.1\|724006_724456_+	transcriptional regulator NrdR	NA	NA	NA	NA
WP_068712349.1\|724468_725569_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	2.5e-42	33.3
WP_068712351.1\|725581_726238_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	2.8e-33	36.4
WP_068712353.1\|726297_727407_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	5.7e-63	39.3
WP_068712355.1\|727549_728020_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.3e-29	47.3

DBSCAN-SWA_3

2767223 : 2774416

Megavirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_068714727.1\|2767223_2767652_-	nucleoside-diphosphate kinase	K7YW26	Megavirus	5.1e-20	39.8
WP_068714729.1\|2767848_2769132_-	aminopeptidase PepB	Q6GYZ8	Mycoplasma_phage	1.4e-33	37.9
WP_068714731.1\|2769327_2769522_-	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_068714733.1\|2769584_2769923_-	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_068714735.1\|2769934_2771788_-	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	3.2e-103	38.3
WP_068714737.1\|2771809_2772325_-	co-chaperone HscB	NA	NA	NA	NA
WP_068714739.1\|2772394_2772718_-	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	1.0e-25	51.4
WP_068714741.1\|2772783_2773164_-	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	3.4e-52	75.8
WP_068714743.1\|2773201_2774416_-	IscS subfamily cysteine desulfurase	A0A1X7C038	Faustovirus	2.6e-32	31.3

DBSCAN-SWA_4

2800563 : 2808132

Bacillus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_068714786.1\|2800563_2801880_-	phosphate regulon sensor histidine kinase PhoR	W8CYF6	Bacillus_phage	4.1e-28	29.5
WP_068714787.1\|2801898_2802588_-	phosphate regulon transcriptional regulator PhoB	W8CYM9	Bacillus_phage	8.2e-36	37.6
WP_068714788.1\|2802778_2803693_+	recombination-associated protein RdgC	A0A2I7RNT5	Vibrio_phage	3.4e-114	66.6
WP_068714789.1\|2803834_2805235_+\|tRNA	tRNA 5-hydroxyuridine modification protein YegQ	Q6DW11	Phage_TP	4.0e-162	75.1
WP_068714790.1\|2805238_2805493_+	YfhL family 4Fe-4S dicluster ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	4.4e-19	51.2
WP_068714791.1\|2805531_2806254_-	oxygen-insensitive NADPH nitroreductase	NA	NA	NA	NA
WP_068714793.1\|2806272_2806605_-	DUF1904 domain-containing protein	NA	NA	NA	NA
WP_068714795.1\|2806953_2808132_-	AAA family ATPase	A0A077SLJ9	Escherichia_phage	1.5e-66	38.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_AP014636

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_AP014635

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection