CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP014164	Aerococcus viridans strain CCUG4311 chromosome, complete genome	1 crisprs	cas14j,c2c10_CAS-V-U3,cas3,csa3,DinG,DEDDh,WYL	0	0	15	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP014164_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP014164_1

121696-121806

Orphan

Consensus_repeat	Method
TCGTTATAAGTACCAACTTTTGTCGTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP014164_1

>merge|NZ_CP014164|1|121696-121806|CRISPRCasFinder
TCGTTATAAGTACCAACTTTTGTCGTTATAACTATGCTAAAATATCAAACCTCCGCCCCTTATAACGACAACACCCACAATCAGTCGTTATAAGTGCCAACTTTTGTCGTT

>NZ_CP014164|1|1|121696-121806|CRISPRCasFinder
TCGTTATAAGTACCAACTTTTGTCGTT	ATAACTATGCTAAAATATCAAACCTCCGCCCCTTATAACGACAACACCCACAATCAG
TCGTTATAAGTGCCAACTTTTGTCGTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP014164.1\|WP_003143333.1\|114563_114806_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014164.1\|WP_050774130.1\|115735_116053_+\|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin	unknown	unknown	gnl\|CDD\|274102
NZ_CP014164.1\|WP_003143749.1\|120431_121604_+\|IS256-like-element-IS256-family-transposase	unknown	unknown	gnl\|CDD\|307151
NZ_CP014164.1\|WP_003142565.1\|131127_132453_+\|3-isopropylmalate-dehydrogenase	unknown	unknown	gnl\|CDD\|370821
NZ_CP014164.1\|WP_050774112.1\|126706_127183_+\|signal-peptidase-I	unknown	unknown	gnl\|CDD\|274044
NZ_CP014164.1\|WP_106427304.1\|129341_131144_+\|AAA-domain-containing-protein	unknown	unknown	gnl\|CDD\|224319
NZ_CP014164.1\|WP_003143327.1\|116042_116318_+\|type-II-toxin-antitoxin-system-YafQ-family-toxin	unknown	unknown	gnl\|CDD\|379750
NZ_CP014164.1\|WP_106427303.1\|132514_132613_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|178801
NZ_CP014164.1\|WP_003143698.1\|122030_122315_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014164.1\|WP_003143332.1\|114867_115227_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|377579
NZ_CP014164.1\|WP_003143330.1\|115219_115498_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|376540
NZ_CP014164.1\|WP_003142583.1\|126246_126645_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014164.1\|WP_003143700.1\|122903_123296_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014164.1\|WP_003142568.1\|128213_128834_+\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NZ_CP014164.1\|WP_060779293.1\|132760_134284_+\|IS1182-family-transposase	unknown	unknown	gnl\|CDD\|226192
NZ_CP014164.1\|WP_060779292.1\|116484_116820_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014164.1\|WP_003143325.1\|117390_117705_-\|type-II-toxin-antitoxin-system-MqsA-family-antitoxin	unknown	unknown	gnl\|CDD\|225495
NZ_CP014164.1\|WP_060779291.1\|113961_114375_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|143386
NZ_CP014164.1\|WP_039936024.1\|122352_122883_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014164.1\|WP_060779290.1\|113250_113934_-\|IS6-family-transposase	unknown	unknown	gnl\|CDD\|225853

Protein	Function_ID	Function_description	E-value
NZ_CP014164.1\|WP_050774130.1\|115735_116053_+\|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin	gnl\|CDD\|274102	TIGR02384, Putative_antitoxin_RelB, addiction module antitoxin, RelB/DinJ family. Plasmids may be maintained stably in bacterial populations through the action of addiction modules, in which a toxin and antidote are encoded in a cassette on the plasmid. In any daughter cell that lacks the plasmid, the toxin persists and is lethal after the antidote protein is depleted. Toxin/antitoxin pairs are also found on main chromosomes, and likely represent selfish DNA. Sequences in the seed for this alignment all were found adjacent to toxin genes. The resulting model appears to describe a narrower set of proteins than pfam04221, although many in the scope of this model are not obviously paired with toxin proteins. Several toxin/antitoxin pairs may occur in a single species. [Cellular processes, Toxin production and resistance, Mobile and extrachromosomal element functions, Other].	3.28362e-15
NZ_CP014164.1\|WP_060779291.1\|113961_114375_-\|hypothetical-protein	gnl\|CDD\|143386	cd00141, NT_POLXc, Nucleotidyltransferase (NT) domain of family X DNA Polymerases. X family polymerases fill in short gaps during DNA repair. They are relatively inaccurate enzymes and play roles in base excision repair, in non-homologous end joining (NHEJ) which acts mainly to repair damage due to ionizing radiation, and in V(D)J recombination. This family includes eukaryotic Pol beta, Pol lambda, Pol mu, and terminal deoxyribonucleotidyl transferase (TdT). Pol beta and Pol lambda are primarily DNA template-dependent polymerases. TdT is a DNA template-independent polymerase. Pol mu has both template dependent and template independent activities. This subgroup belongs to the Pol beta-like NT superfamily. In the majority of enzymes in this superfamily, two carboxylates, Dx[D/E], together with a third more distal carboxylate, coordinate two divalent metal cations involved in a two-metal ion mechanism of nucleotide addition. These three carboxylate residues are fairly well conserved in this family.	0.00088709
NZ_CP014164.1\|WP_003142565.1\|131127_132453_+\|3-isopropylmalate-dehydrogenase	gnl\|CDD\|370821	pfam10117, McrBC, McrBC 5-methylcytosine restriction system component. Members of this family of bacterial proteins modify the specificity of mcrB restriction by expanding the range of modified sequences restricted.	2.6936e-68
NZ_CP014164.1\|WP_050774112.1\|126706_127183_+\|signal-peptidase-I	gnl\|CDD\|274044	TIGR02227, Inactive_signal_peptidase_IA., signal peptidase I, bacterial type. This model represents signal peptidase I from most bacteria. Eukaryotic sequences are likely organellar. Several bacteria have multiple paralogs, but these represent isozymes of signal peptidase I. Virtually all known bacteria may be presumed to A related model finds a simlar protein in many archaea and a few bacteria, as well as a microsomal (endoplasmic reticulum) protein in eukaryotes. [Protein fate, Protein and peptide secretion and trafficking].	2.4123e-36
NZ_CP014164.1\|WP_106427304.1\|129341_131144_+\|AAA-domain-containing-protein	gnl\|CDD\|224319	COG1401, McrB, GTPase subunit of restriction endonuclease [Defense mechanisms].	7.75636e-23
NZ_CP014164.1\|WP_003143327.1\|116042_116318_+\|type-II-toxin-antitoxin-system-YafQ-family-toxin	gnl\|CDD\|379750	pfam15738, YafQ_toxin, Bacterial toxin of type II toxin-antitoxin system, YafQ. YafQ is a family of bacterial toxin ribonucleases of type II toxin-antitoxin systems. The E.coli gene is expressed from the dinB operon. The cognate antitoxin for the E. coli protein is DinJ, in family RelB_antitoxin, pfam02604.	3.19447e-35
NZ_CP014164.1\|WP_106427303.1\|132514_132613_+\|hypothetical-protein	gnl\|CDD\|178801	PRK00024, PRK00024, DNA repair protein RadC.	1.3323e-09
NZ_CP014164.1\|WP_003143332.1\|114867_115227_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|377579	pfam05973, Gp49, Phage derived protein Gp49-like (DUF891). This family consists of hypothetical bacterial proteins of unknown function as well as phage Gp49 proteins.	2.40985e-16
NZ_CP014164.1\|WP_003143330.1\|115219_115498_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|376540	pfam01381, HTH_3, Helix-turn-helix. This large family of DNA binding helix-turn helix proteins includes Cro and CI. Within Neisseria gonorrhoeae NGO_0477, the full protein fold incorporates a helix-turn-helix motif, but the function of this member is unlikely to be that of a DNA-binding regulator, the function of most other members, so is not necessarily characteristic of the whole family.	4.99802e-10
NZ_CP014164.1\|WP_060779293.1\|132760_134284_+\|IS1182-family-transposase	gnl\|CDD\|226192	COG3666, COG3666, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.04368e-25
NZ_CP014164.1\|WP_003142568.1\|128213_128834_+\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	2.87344e-42
NZ_CP014164.1\|WP_003143325.1\|117390_117705_-\|type-II-toxin-antitoxin-system-MqsA-family-antitoxin	gnl\|CDD\|225495	COG2944, COG2944, Predicted transcriptional regulator [Transcription].	1.37059e-13
NZ_CP014164.1\|WP_003143749.1\|120431_121604_+\|IS256-like-element-IS256-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	0
NZ_CP014164.1\|WP_060779290.1\|113250_113934_-\|IS6-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.45476e-92

>NZ_CP014164.1|WP_003143749.1|120431_121604_+|IS256-like-element-IS256-family-transposase
MTQVHFTLKSEEIQSIIEYSVKDDVSKNILTTVFNQLMENQRTEYIQAKEYERTENRQSQRNGYYERSFTTRVGTLELKVPRTRDGHFLPTVFERYQRNEKALMASMLEMYVSGVSTRKVSKIVEELCGKSVSKSFVSSLTEQLEPMVNEWQNRLLSEKNYPYLMTDVLYIKVREENRVLSKSCHIAIGITKDGDREIIGFMIQSGESEETWTTFFEYLKERGLQGTELVISDAHKGLVSAIRKSFTNVSWQRCQVHFLRNIFTTIPKKNSKSFREAVKGIFKFTDINLAREAKNRLIHDYIDQPKYSKACASLDDGFEDAFQYTVQGNSHNRLKSTNLIERLNQEVRRREKIIRIFPNQTSANRLIGAVLMDLHDEWIYSSRKYINFDK
>NZ_CP014164.1|WP_003143325.1|117390_117705_-|type-II-toxin-antitoxin-system-MqsA-family-antitoxin
MRDTLKDSMSELIKFTHNKPNKVMVRKYTLNNLPEYNPSAVKTVRNKTQMTQKVFSDLLVVSVRTVEAWETGKSHPNGSARRLLQLIEQNPEMVEEIEYASAKG
>NZ_CP014164.1|WP_060779292.1|116484_116820_-|hypothetical-protein
MIEKRNQKYIERGEHKKVDGNIDNFFTKKNKNTRIKHFQSNNFPLVITASNYDDYENFAQALGDSGVTENDLRHAHVKTLKKSVEDINGLSIVGLEIDEYYIHANQKGVPH
>NZ_CP014164.1|WP_003143327.1|116042_116318_+|type-II-toxin-antitoxin-system-YafQ-family-toxin
MKISRTSNFKRDYKKFKKKHYDMDKLAQVIKLIINGEKETLRTQYHDHMLKGQYAGFRELHIEKDWLLVYKVDNDQLILTLIRTGTHDDLF
>NZ_CP014164.1|WP_050774130.1|115735_116053_+|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin
MEKARKTRTSPKRVTKGKSNKSESSTITIRVDKDLKEEAAELFEDLGMNTSTAINTFLRQSVRENKVPFEIKRNIETENALREVKEGHLETFENFDEFWEDLNED
>NZ_CP014164.1|WP_003143330.1|115219_115498_+|helix-turn-helix-transcriptional-regulator
MNRVLEEYAAERELKEPGFAEEWENEKVQNRIADQIYNIRKNLGLSQREFAKLVGKPQSTIGRIESREVNASLDTIVSIANATNKKLIVELV
>NZ_CP014164.1|WP_003143332.1|114867_115227_+|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MVNKKIEFEFFDEEEFKKFLDKLPSKDAIKVMSMIDNIEIRGIQSSIKNQWVKKLDDNLFEIRSKSSNNIQRGIYFHVKDSRYIITHFFTKKDQKTPKREIERGKNRRKLYFVRRKSDE
>NZ_CP014164.1|WP_003143333.1|114563_114806_+|hypothetical-protein
MDCFSTRSNFSSFSVTTVVDADEISADNIDFAYWNELEQTYDSEFKVGNKRILLREIKDDPKIIKQAVAEALDSDLEGVD
>NZ_CP014164.1|WP_060779291.1|113961_114375_-|hypothetical-protein
MNIYDSTSNEYLSYVEYHDLTKDYLGNGEYTTINLARDTEIYVLDQMASNEEYAEEQALSVFQKVSNAVRQLPNKIKELTNRIITKDIGKHINKRIDEYFKHHVSPQKEQVKSGIDTDMKDIRFCCKVLNLLSNKVE
>NZ_CP014164.1|WP_060779290.1|113250_113934_-|IS6-family-transposase
MNHFKGKQFQQDVIIIAVGYYLRYNLSYREVQEILYDRGINVSHTTIYRWVQEYGKLLYQIWKKKNKKSFYSWKMDETYIKIKGKWHYLYRAIDADGLTLDIWLRKKRDTQAAYAFLKRLVKQFDEPKVVVTDKAPSITSAFNKLKEYGGFYQGTEHRTIKYLNNLIEQDHRPVKRRNKFYRSLRTASTTIKGMEAIRGLYKKTRKEGTLFGFSVCTEIKVLLGIPA
>NZ_CP014164.1|WP_003143698.1|122030_122315_+|hypothetical-protein
MNSLKLASGETIEVTSEEIIAAQAENGTLKLSGEQVSERAEDAYSNTANEDTNGEPSTGTNLAPTGSIVVNGVEVPISLDMLVTRLNPSADNVS
>NZ_CP014164.1|WP_039936024.1|122352_122883_+|hypothetical-protein
MTFGAIDRSAIMTNKENAVAQLEAAKESMEEYHERLNDDPNISDDDAKKIIEADNIALNSIGDGETNKQIEKLLSETSISSSDSSGTVEETKPIEEMTAEEREAALLAEVNEESLGITQDTSTVVALESLRASIIDLNYQIALYDVELDYIDEVSIKQDSIGREAVRYNLLSPFDI
>NZ_CP014164.1|WP_003143700.1|122903_123296_+|hypothetical-protein
MARKIEPLQKRWASLATTLKDSKNDLDFGKIDVQLTASEQEPLNELATSIKEMAKEMREIANQLDKEFDHYVNSKRNDAIDSAMSDSEVRELVLAMALEKGLVKTLDLSSEVEVENEEPVANNSEQRQAI
>NZ_CP014164.1|WP_003142583.1|126246_126645_+|hypothetical-protein
MEEAIVAADRSIATGTLSPLEELVEPELMPQLEEAFEDVLATKDFDTSNVDAGREYVMNYVTFTHLAEGEEHEEADLHPTAQTDDLHEVENAKAAGEHIEPETEETKASWLPWGLAGTFFVTTIAGFLKRRV
>NZ_CP014164.1|WP_050774112.1|126706_127183_+|signal-peptidase-I
MSGLLYFLITRFLFFFISVPTPSMYPAIQPGDRILTTRLYDTGEITRGDILVFQSEELDEVLVKRVIGLPGDGIVIKETGEVFVNGERLAEEYVEYPDSLAGQYLVPEDSYYFLGDFRVHSFDSRKWNQPYIPEGAILGEGQWVVTPLPRFGQVDEGI
>NZ_CP014164.1|WP_003142568.1|128213_128834_+|recombinase-family-protein
MKVGYARVSTTNQNLDRQIEALEQAGAEKIFQEKMSGKSMTERLELQKALQFLREKDTLIVESLDRLGRNYDDIVQTVQKLDQKEVGLIVLNLPILNQEMGDPNLQKLIRNMIVQLLSWTAQNEREEIKRKQRQGIEIAQRKGHYKGRPVKYSAEAKNPRDRMIYHVIVNKLKQEEPIKKIAEETGVTRDTVYRIKNEISLTDQSM
>NZ_CP014164.1|WP_106427304.1|129341_131144_+|AAA-domain-containing-protein
MPSEEKLLSDLSSLLDDYSELKQFFVDNDNDLEKFYSAIIGNGTSDKYKEFKYLLSRFVEQANSNLQNKNNRKTSLGIEGFEDNNFRYSTGYDQLTIDGVEYHIHLFSTGSYGPNNGEGSTMVPYICHRLANGNWSNIRVTFQNSHMTSLRLVEWNQNSKTNKERNISFFVDDLDLFSNAEPNDNLKKLYKEFVFPKVEEKNMRGNDKINELADKLEKSKNIILRGAPGTGKTYLARQIAALLIGEDEDKLNESEQFGFVQFHPSYDYTDFVEGLRPVADDDQEQVSFKLRDGIFKRFCKEAKKSGISGEVDNFDDAWEQLINAINESEEDYMMTGSTVPATLNSKKSIKFKTPVATKETVYKLYRGEDTNLKYETYQKIVLNHLTDSFGLKPFKEGETTRNEKKKYVFVIDEINRGEISKIFGELFFSIDPGYRGKEEYGVYTQYSNLHIDSNEKFYIPDSVYIIGTMNDIDRSVDSFDFAMRRRFRFIELQAEDTTYMWQGQLDETKIEEATDRLVSLNKQISNTDDLDSNYHIGPSYFLKLPELDYDYNVLWADYLQPLLEEYLRGSYEEQEKLEAMKNAYDLIHQTDEEFADEDRR
>NZ_CP014164.1|WP_003142565.1|131127_132453_+|3-isopropylmalate-dehydrogenase
MRIEDNQTYSRSEFVAAYPKLSTKLVDKTLATLSENENLLIFPSVFLDVDDLDHDSKIIETVNDSLKFQNVIGFIGYGDEQLEIHSRFSPGENNYFLHYMLQRVLNINIVDLDSTLSLREQLYQLSIYLFPRYLDAAMRKGIFRQYRRFEYNNANIKGNIDIARHIKLNTPFTGKVAYSTREFTQDNELMQLVRHTIEFIRLSTKNGRRILNSSELTKQNVSAVTIATPSYNRGNRRKVIIANKNTPVRHAYYTEYLALQKLCLMILTHRRHSFGENRKNIYGILFDVAWLWEEYLNTLLKDNFIHPRNKQSKEGISLFADRIRTVYPDFYNQDSGAVIDAKYKKLEYTAKGINREDLYQIISYSYILKSKKAGVVYPSTSETEYKKVGTLSGYGADIFKQSIHIPQQVDSYKEFDLLIKKSEYKFKKEIESFSHGEIEKH
>NZ_CP014164.1|WP_106427303.1|132514_132613_+|hypothetical-protein
MMEAGDVLGIELLDHFIVSEKNWLSFKEIGLL
>NZ_CP014164.1|WP_060779293.1|132760_134284_+|IS1182-family-transposase
MYTQYNMNQAFLPLELSDYLAPNHIVFQVNNFVEQLDEHILDQFYKHEGRPAYHPLILLKALLFAYIEKTFSGRTIEKMMQENIPMKWLVADTEISYRTINRFRSSELCASILENLFVEFKLFLVQQELISDNVVFIDGTKIEADANKYSFVWKRATDKFYASLKAKEMAYYRNEILPTVEKEIIKDEIDSMSLNDVEILKDFLEEAVAEVNEEIESTPKKGADPRKQKRRKLKKHLRKVKGDFLQREIKYENYYRTFEGRNSFSKTDTDATFMRMKEDPMLNGQLKPGYNLQIATENQFVIAYNIFPNPTDTRTLLPFIESMPTLPKIVVADAGYGSQENLETLDNLGIDHLIKYNMFDKEQTKKFQKSSKNLNNWDYDAENQIFIHPDGTQYHFHHVYHPKTTTGYRLEKEMYYPVNRETAPQKSFSFNRKYQYLKENESAKLLSEDGSALFACRKIDVEPVFGQIKQNLGFRRTHLRGKDKVKTDIGLVLMANNIIKVQKRLIN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

89082 : 204773

109

Streptococcus_phage(21.43%)

transposase,tRNA,integrase

attL 83400:83416|attR 172155:173479

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
83400:83416	attL	NA	NA	NA	NA
WP_003142863.1\|89082_90249_+\|integrase	site-specific integrase	A0A1S5S7K9	Streptococcus_phage	1.0e-54	34.0
83400:83416	attL	NA	NA	NA	NA
WP_003142862.1\|90766_91333_+	cobalt ABC transporter permease	NA	NA	NA	NA
WP_003142861.1\|91329_92685_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-10	26.1
WP_003142860.1\|92691_93354_+	ABC transporter permease	NA	NA	NA	NA
WP_003142859.1\|93353_94049_+	thiaminase II	NA	NA	NA	NA
WP_039935873.1\|94038_94542_+	energy coupling factor transporter S component ThiW	NA	NA	NA	NA
WP_003142857.1\|94660_95176_-	type 1 glutamine amidotransferase	NA	NA	NA	NA
WP_039935827.1\|95457_96102_-	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	1.7e-38	37.1
WP_039935824.1\|96271_97048_+	threonine/serine exporter family protein	NA	NA	NA	NA
WP_003142853.1\|97047_97572_+	threonine/serine exporter family protein	NA	NA	NA	NA
WP_003142851.1\|97695_98877_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_039935821.1\|98967_99792_+	DUF2185 domain-containing protein	NA	NA	NA	NA
WP_003142848.1\|99831_100206_+	CidA/LrgA family protein	NA	NA	NA	NA
WP_039935817.1\|100198_100891_+	LrgB family protein	NA	NA	NA	NA
WP_081453835.1\|101146_102175_+	branched-chain amino acid aminotransferase	NA	NA	NA	NA
WP_003142845.1\|102335_102839_-	nucleoside deoxyribosyltransferase	K4I206	Lactobacillus_phage	4.3e-18	37.0
WP_003142844.1\|102908_103574_-	phosphohydrolase	S4W232	Pandoravirus	8.3e-09	27.9
WP_003142843.1\|103602_104277_-	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	1.8e-43	43.9
WP_106427309.1\|104398_105088_-	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A288TZV3	Enterococcus_phage	3.7e-52	57.8
WP_003142840.1\|105149_107420_-	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	3.7e-258	60.1
WP_003142838.1\|107698_109708_-	DUF438 domain-containing protein	NA	NA	NA	NA
107785:107801	attR	NA	NA	NA	NA
WP_147291237.1\|109688_109964_-	DUF1858 domain-containing protein	NA	NA	NA	NA
107785:107801	attR	NA	NA	NA	NA
WP_003142835.1\|110179_110539_+	metal-sulfur cluster assembly factor	NA	NA	NA	NA
WP_060779288.1\|110809_111082_+	hypothetical protein	NA	NA	NA	NA
WP_060779289.1\|111111_111795_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.1e-125	98.7
WP_003143671.1\|112138_113134_+	two pore domain potassium channel family protein	NA	NA	NA	NA
WP_060779290.1\|113250_113934_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.1e-125	98.2
WP_060779291.1\|113961_114375_-	hypothetical protein	NA	NA	NA	NA
WP_003143333.1\|114563_114806_+	hypothetical protein	NA	NA	NA	NA
WP_003143332.1\|114867_115227_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_003143330.1\|115219_115498_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_050774130.1\|115735_116053_+	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_003143327.1\|116042_116318_+	type II toxin-antitoxin system YafQ family toxin	NA	NA	NA	NA
WP_060779292.1\|116484_116820_-	hypothetical protein	NA	NA	NA	NA
WP_003143325.1\|117390_117705_-	type II toxin-antitoxin system MqsA family antitoxin	NA	NA	NA	NA
WP_003143749.1\|120431_121604_+\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	1.7e-134	99.6
WP_003143698.1\|122030_122315_+	hypothetical protein	NA	NA	NA	NA
WP_039936024.1\|122352_122883_+	hypothetical protein	NA	NA	NA	NA
WP_003143700.1\|122903_123296_+	hypothetical protein	NA	NA	NA	NA
WP_003142583.1\|126246_126645_+	hypothetical protein	NA	NA	NA	NA
WP_050774112.1\|126706_127183_+	signal peptidase I	NA	NA	NA	NA
WP_003142568.1\|128213_128834_+	recombinase family protein	E5FFF9	Burkholderia_phage	5.0e-16	34.2
WP_106427304.1\|129341_131144_+	AAA domain-containing protein	K4I1H4	Acidithiobacillus_phage	1.9e-15	26.1
WP_003142565.1\|131127_132453_+	3-isopropylmalate dehydrogenase	NA	NA	NA	NA
WP_106427303.1\|132514_132613_+	hypothetical protein	NA	NA	NA	NA
WP_060779293.1\|132760_134284_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	6.4e-89	36.9
WP_003142217.1\|134564_135599_+	R3H domain protein	NA	NA	NA	NA
WP_003142216.1\|135811_136387_+	recombinase family protein	A0A0A8WIK3	Clostridium_phage	3.6e-37	45.2
WP_003142215.1\|136367_136646_+	hypothetical protein	NA	NA	NA	NA
WP_003142213.1\|136747_137164_-	hypothetical protein	NA	NA	NA	NA
WP_003142211.1\|137181_137427_-	hypothetical protein	NA	NA	NA	NA
WP_003142210.1\|137438_137699_-	hypothetical protein	NA	NA	NA	NA
WP_060779294.1\|138105_138333_-	hypothetical protein	NA	NA	NA	NA
WP_060779295.1\|138394_139078_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.5e-125	98.2
WP_039935802.1\|139284_140655_-	sodium:alanine symporter family protein	NA	NA	NA	NA
WP_082702790.1\|141173_142061_-\|transposase	IS3 family transposase	A0A0C5AEA5	Paenibacillus_phage	4.1e-40	48.7
WP_003143773.1\|142416_142818_+	Hg(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_039936041.1\|142831_143053_+	mercury resistance system transport protein MerF	NA	NA	NA	NA
WP_003143769.1\|143010_143217_-	hypothetical protein	NA	NA	NA	NA
WP_002360746.1\|143359_143515_+	hypothetical protein	NA	NA	NA	NA
WP_002360745.1\|143533_143683_+	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_003143766.1\|143715_145356_+	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	4.1e-49	29.8
WP_039936039.1\|145639_146203_-	recombinase family protein	A0A219Y9V9	Aeromonas_phage	4.2e-38	47.5
WP_060779296.1\|146592_147933_+\|transposase	ISL3 family transposase	A0A2D1GQC1	Lysinibacillus_phage	5.0e-13	24.4
WP_060779297.1\|148276_150202_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	8.9e-96	35.9
WP_003143894.1\|150569_150884_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_060779298.1\|150907_151831_+	cation transporter	NA	NA	NA	NA
WP_003143749.1\|152161_153334_+\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	1.7e-134	99.6
WP_003143859.1\|153637_154720_+	SAM-dependent DNA methyltransferase	A0A2H4PQP4	Staphylococcus_phage	1.8e-77	47.8
WP_003140916.1\|155318_156473_+	SIR2 family protein	NA	NA	NA	NA
WP_003140915.1\|156489_158274_+	ATP-binding protein	NA	NA	NA	NA
WP_003140914.1\|158306_159740_+	TIR domain-containing protein	NA	NA	NA	NA
WP_003140913.1\|160363_160951_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_003140912.1\|160952_161342_+	cytidine deaminase	NA	NA	NA	NA
WP_005232990.1\|161521_162841_+\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	1.0e-223	88.4
WP_050774100.1\|163052_163706_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_147291236.1\|164362_164557_+	hypothetical protein	NA	NA	NA	NA
WP_003141396.1\|164916_166308_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_003141395.1\|166304_168872_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_039934828.1\|168881_170759_+	hypothetical protein	NA	NA	NA	NA
WP_060779302.1\|170737_170956_+	hypothetical protein	NA	NA	NA	NA
WP_003143749.1\|170939_172112_-\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	1.7e-134	99.6
WP_060779303.1\|172174_172513_+	hypothetical protein	NA	NA	NA	NA
WP_004262250.1\|173230_174439_+	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	1.7e-07	26.5
WP_039935337.1\|174564_177588_+	type I restriction endonuclease subunit R	NA	NA	NA	NA
WP_003140767.1\|177766_178342_-	dihydroxyacetone kinase subunit L	NA	NA	NA	NA
WP_003140768.1\|178366_179359_-	dihydroxyacetone kinase subunit DhaK	NA	NA	NA	NA
WP_003140769.1\|179434_179821_-	PTS-dependent dihydroxyacetone kinase phosphotransferase subunit DhaM	NA	NA	NA	NA
WP_003140770.1\|180134_181319_+	putative C-S lyase	NA	NA	NA	NA
WP_003140771.1\|181422_182316_-	cation transporter	NA	NA	NA	NA
WP_003140773.1\|182563_182938_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_003140774.1\|183040_184261_+	LL-diaminopimelate aminotransferase	NA	NA	NA	NA
WP_003140775.1\|184880_185873_+	PTS mannose transporter subunit IIAB	NA	NA	NA	NA
WP_003140776.1\|185892_186702_+	mannose/fructose/sorbose family PTS transporter subunit IIC	NA	NA	NA	NA
WP_003140778.1\|186714_187662_+	PTS mannose/fructose/sorbose transporter family subunit IID	NA	NA	NA	NA
WP_003140779.1\|187663_188047_+	DUF956 family protein	NA	NA	NA	NA
WP_003140781.1\|188052_189003_+	mannose-6-phosphate isomerase, class I	NA	NA	NA	NA
WP_039934523.1\|189165_189957_-	formate/nitrite transporter family protein	NA	NA	NA	NA
WP_039934525.1\|190238_190730_+	cupin domain-containing protein	NA	NA	NA	NA
WP_039934528.1\|191320_192085_-	peptidoglycan editing factor PgeF	NA	NA	NA	NA
WP_003140788.1\|192201_195126_+	peptidase M16	NA	NA	NA	NA
WP_003140790.1\|195453_195642_-	hypothetical protein	NA	NA	NA	NA
WP_003140791.1\|195656_196328_-	hypothetical protein	NA	NA	NA	NA
WP_003140794.1\|196751_198347_+	alpha-amylase	NA	NA	NA	NA
WP_039934533.1\|198449_198989_+	dUTP diphosphatase	J9PV85	Bacillus_phage	3.3e-32	43.8
WP_003140797.1\|199036_200419_+	DNA repair protein RadA	NA	NA	NA	NA
WP_003140798.1\|200634_201828_+	PIN/TRAM domain-containing protein	NA	NA	NA	NA
WP_039934536.1\|201916_203392_+\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_060779304.1\|203534_204773_+\|transposase	IS21 family transposase	A0A059NT83	Lactococcus_phage	1.4e-105	49.5

DBSCAN-SWA_2

211988 : 277245

Lactobacillus_phage(18.18%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060779305.1\|211988_212990_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.0e-55	39.6
WP_003143704.1\|213154_214111_+	hypothetical protein	NA	NA	NA	NA
WP_060779306.1\|214363_214786_-\|transposase	IS200/IS605 family transposase	A0A0P0IQC6	Lactobacillus_phage	1.1e-46	62.6
WP_060779307.1\|214886_216029_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	C1KFJ5	Lactobacillus_virus	1.2e-95	47.6
WP_039934929.1\|216168_217707_+	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_003141522.1\|217706_218645_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.3e-27	33.5
WP_003141520.1\|218684_219233_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_039934926.1\|219693_220614_+	cysteine synthase A	A0A1X9I5F1	Streptococcus_phage	3.4e-85	55.2
WP_003141957.1\|220794_221787_-	aliphatic sulfonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003141956.1\|221806_222556_-	ABC transporter permease	NA	NA	NA	NA
WP_003141954.1\|222555_223326_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.0e-34	38.4
WP_060779308.1\|224167_225493_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	5.1e-50	33.2
WP_003143749.1\|225663_226836_+\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	1.7e-134	99.6
WP_003141000.1\|226893_228381_+	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase	NA	NA	NA	NA
WP_039934622.1\|228758_229583_+	methionine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003140998.1\|230301_231723_+\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	3.5e-49	31.6
WP_003140996.1\|231769_232207_+	Mini-ribonuclease 3	NA	NA	NA	NA
WP_003140994.1\|232199_233015_+	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	NA	NA	NA	NA
WP_003140992.1\|233062_233602_+	NYN domain-containing protein	NA	NA	NA	NA
WP_016897297.1\|233667_234294_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_167541423.1\|234413_234860_-\|transposase	IS200/IS605 family transposase	A0A0P0IQC6	Lactobacillus_phage	2.3e-47	62.6
WP_060779310.1\|234937_236080_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0P0ICY9	Lactobacillus_phage	8.1e-97	49.1
WP_003142585.1\|236314_237646_+	GntP family permease	NA	NA	NA	NA
WP_003142586.1\|237803_237956_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_003142588.1\|237996_238170_+	preprotein translocase subunit SecE	NA	NA	NA	NA
WP_003142589.1\|238314_238869_+	transcription termination/antitermination protein NusG	NA	NA	NA	NA
WP_106427305.1\|239222_239891_-	phosphate signaling complex protein PhoU	NA	NA	NA	NA
WP_029315747.1\|240167_240593_+	50S ribosomal protein L11	NA	NA	NA	NA
WP_003142595.1\|240692_241382_+	50S ribosomal protein L1	NA	NA	NA	NA
WP_003142597.1\|241606_242110_+	50S ribosomal protein L10	NA	NA	NA	NA
WP_003142599.1\|242166_242535_+	50S ribosomal protein L7/L12	NA	NA	NA	NA
WP_003142601.1\|242842_243778_+	zinc ABC transporter solute-binding protein	NA	NA	NA	NA
WP_039935644.1\|243834_244572_+	metal ABC transporter ATP-binding protein	W5SAS9	Pithovirus	2.7e-13	26.9
WP_003142604.1\|244555_245470_+	metal ABC transporter permease	NA	NA	NA	NA
WP_003142605.1\|245469_246327_+	metal ABC transporter permease	NA	NA	NA	NA
WP_106427306.1\|246535_247153_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_016897314.1\|247442_248687_+	glycine betaine/L-proline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-31	38.5
WP_003142612.1\|248679_249537_+	proline/glycine betaine ABC transporter permease	NA	NA	NA	NA
WP_003142613.1\|249559_250465_+	glycine betaine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003142617.1\|251743_253108_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003142618.1\|253588_257170_+	DNA-directed RNA polymerase subunit beta	A0A1B1ISA9	uncultured_Mediterranean_phage	8.9e-49	24.7
WP_003142619.1\|257202_260859_+	DNA-directed RNA polymerase subunit beta'	A0A2I7QNZ7	Vibrio_phage	3.7e-58	24.6
WP_003142621.1\|260922_261762_-	hypothetical protein	NA	NA	NA	NA
WP_003142623.1\|261793_262510_-	prepilin peptidase	NA	NA	NA	NA
WP_039935652.1\|263110_265456_+	HAD-IC family P-type ATPase	M1HBF8	Paramecium_bursaria_Chlorella_virus	3.2e-39	26.0
WP_003142625.1\|265552_266728_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	3.5e-143	67.4
WP_060779311.1\|267182_268418_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0P0IJS6	Lactobacillus_phage	1.6e-90	45.9
WP_039934987.1\|268621_270469_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.6e-54	40.0
WP_003141629.1\|270544_270859_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_003141630.1\|271072_271672_+	recombination protein RecR	NA	NA	NA	NA
WP_003141632.1\|271702_272362_+	dTMP kinase	M1PSC7	Streptococcus_phage	3.0e-51	52.2
WP_003141634.1\|272419_273433_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	4.1e-36	34.0
WP_003141636.1\|273593_274448_+	Rgg/GadR/MutR family transcriptional regulator	NA	NA	NA	NA
WP_003141638.1\|274799_275375_+	hypothetical protein	NA	NA	NA	NA
WP_060779312.1\|275904_277245_-\|transposase	ISL3 family transposase	A0A2D1GQC1	Lysinibacillus_phage	5.0e-13	24.4

DBSCAN-SWA_3

449720 : 514596

Staphylococcus_phage(26.32%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004262636.1\|449720_451835_-\|protease	ATP-dependent Clp protease ATP-binding subunit	K4FB40	Cronobacter_phage	3.7e-119	39.1
WP_004262638.1\|452080_452290_-	helix-turn-helix transcriptional regulator	A0A097PBE6	Streptococcus_pyogenes_phage	3.6e-11	58.6
WP_004262641.1\|452576_453755_-	hypothetical protein	A0A218MNE0	uncultured_virus	6.7e-38	29.5
WP_004262652.1\|454494_455376_-	methylenetetrahydrofolate reductase [NAD(P)H]	NA	NA	NA	NA
WP_039935901.1\|455379_457632_-	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	NA	NA	NA	NA
WP_039935902.1\|458116_459028_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004262667.1\|459180_459624_+	50S ribosomal protein L13	NA	NA	NA	NA
WP_004262670.1\|459638_460031_+	30S ribosomal protein S9	NA	NA	NA	NA
WP_004262678.1\|460880_461834_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	2.7e-93	52.9
WP_039935904.1\|461941_462895_-	ribonucleoside-triphosphate reductase	A0A096XT60	Enterococcus_phage	3.3e-35	32.0
WP_004262686.1\|462936_463398_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	NA	NA	NA	NA
WP_004262691.1\|463544_464210_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_106427320.1\|464569_464845_-	DUF4298 domain-containing protein	NA	NA	NA	NA
WP_039935905.1\|465294_465729_+	cupin domain-containing protein	Q2I8C5	Bacillus_phage	3.7e-34	50.4
WP_004262703.1\|465969_466353_+	tautomerase family protein	NA	NA	NA	NA
WP_004262705.1\|466452_466980_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	3.7e-28	40.5
WP_106427319.1\|467067_467703_+	deoxyribonuclease I	NA	NA	NA	NA
WP_004262713.1\|468040_469135_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	1.0e-48	37.7
WP_004262717.1\|469135_469738_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.7e-37	41.2
WP_060779318.1\|469738_470935_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	2.5e-112	51.8
WP_060779319.1\|471017_472160_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0P0ICY9	Lactobacillus_phage	2.0e-95	48.0
WP_060779320.1\|472261_472681_+\|transposase	IS200/IS605 family transposase	A0A0P0IQC6	Lactobacillus_phage	2.6e-45	61.9
WP_039935099.1\|472750_473224_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.3e-35	53.0
WP_003141824.1\|473369_474749_+	hypothetical protein	NA	NA	NA	NA
WP_060779321.1\|474889_475312_+\|transposase	IS200/IS605 family transposase	A0A0P0IQC6	Lactobacillus_phage	1.4e-46	61.9
WP_039936020.1\|475384_476221_+	glycosyltransferase family 8 protein	NA	NA	NA	NA
WP_003143680.1\|476379_480333_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_039936019.1\|480346_481048_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-33	36.1
WP_003143683.1\|481227_481812_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_106427291.1\|482615_482903_-	DUF1232 domain-containing protein	NA	NA	NA	NA
WP_003142197.1\|482977_483475_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003142195.1\|483983_484823_+	hydroxyethylthiazole kinase	NA	NA	NA	NA
WP_039935308.1\|484822_485449_+	thiamine phosphate synthase	NA	NA	NA	NA
WP_003142193.1\|485449_486274_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_003142191.1\|486750_487929_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_106427290.1\|488240_489374_+	N-acetylglucosamine-6-phosphate deacetylase	NA	NA	NA	NA
WP_003142187.1\|489814_491041_+	amidohydrolase	NA	NA	NA	NA
WP_003142185.1\|491012_492299_+	amidohydrolase	NA	NA	NA	NA
WP_003142184.1\|492291_493242_+	ABC transporter permease	NA	NA	NA	NA
WP_003142183.1\|493327_494272_+	ABC transporter permease	NA	NA	NA	NA
WP_003142182.1\|494292_495921_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003142181.1\|495905_497129_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-15	30.0
WP_003142180.1\|497140_498088_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.4e-17	31.0
WP_157832729.1\|498164_498326_-	hypothetical protein	NA	NA	NA	NA
WP_003142176.1\|499306_500113_+	ATP phosphoribosyltransferase regulatory subunit	NA	NA	NA	NA
WP_003142175.1\|500109_500718_+	ATP phosphoribosyltransferase	NA	NA	NA	NA
WP_003142174.1\|500718_501969_+	histidinol dehydrogenase	NA	NA	NA	NA
WP_003142173.1\|501972_503013_+	histidinol-phosphate aminotransferase family protein	NA	NA	NA	NA
WP_003142172.1\|503002_503587_+	imidazoleglycerol-phosphate dehydratase HisB	NA	NA	NA	NA
WP_003142171.1\|503652_504351_+	1-(5-phosphoribosyl)-5-((5- phosphoribosylamino)methylideneamino)imidazole-4- carboxamide isomerase	NA	NA	NA	NA
WP_003142169.1\|504354_505101_+	imidazole glycerol phosphate synthase subunit HisF	NA	NA	NA	NA
WP_003142166.1\|505104_505743_+	bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE	NA	NA	NA	NA
WP_003142165.1\|506232_506427_+	hypothetical protein	NA	NA	NA	NA
WP_003142162.1\|506423_507146_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003142160.1\|507477_507942_+	glutathione peroxidase	NA	NA	NA	NA
WP_060779322.1\|508299_509472_-\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	5.4e-120	87.6
WP_003141351.1\|509764_510826_-	AI-2E family transporter	NA	NA	NA	NA
WP_003141349.1\|510876_511860_-	type I restriction endonuclease subunit R	NA	NA	NA	NA
WP_048726159.1\|511875_512262_-	hypothetical protein	NA	NA	NA	NA
WP_060779323.1\|513360_514596_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0P0IJS6	Lactobacillus_phage	4.2e-91	45.9

DBSCAN-SWA_4

570355 : 632050

Lactobacillus_phage(25.0%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060779331.1\|570355_571696_-\|transposase	ISL3 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.2e-13	24.6
WP_003140895.1\|571947_572115_+	hypothetical protein	NA	NA	NA	NA
WP_081453817.1\|572114_572285_+	hypothetical protein	NA	NA	NA	NA
WP_003140897.1\|572298_572709_+	hypothetical protein	NA	NA	NA	NA
WP_050774094.1\|572888_573332_-	hypothetical protein	NA	NA	NA	NA
WP_115609885.1\|573388_573520_-	HAD hydrolase family protein	NA	NA	NA	NA
WP_016897805.1\|573665_574253_+	chromate transporter	NA	NA	NA	NA
WP_003140902.1\|574249_574822_+	chromate transporter	NA	NA	NA	NA
WP_039934580.1\|574911_575916_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_003140906.1\|576663_577500_+	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_039934582.1\|577619_578648_-	3-deoxy-7-phosphoheptulonate synthase	A0A067ZJG7	Escherichia_phage	2.2e-45	35.7
WP_060779332.1\|579291_580434_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0P0ICY9	Lactobacillus_phage	6.2e-97	49.1
WP_003142791.1\|580813_581152_+	hypothetical protein	NA	NA	NA	NA
WP_003142793.1\|581339_582725_+	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_003142795.1\|582952_583699_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	9.2e-25	34.5
WP_003142796.1\|583691_584375_+	ABC transporter permease	NA	NA	NA	NA
WP_003142798.1\|584486_585338_+	hypothetical protein	NA	NA	NA	NA
WP_039935775.1\|586378_586945_+	FMN reductase	NA	NA	NA	NA
WP_003142802.1\|586926_587487_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_060779333.1\|587570_588359_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_003140845.1\|588468_589788_+\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	6.9e-241	94.3
WP_003142362.1\|590030_590861_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_003142361.1\|590885_591716_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_060779334.1\|591734_592448_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_003142358.1\|592444_593188_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.2e-32	38.3
WP_003142357.1\|593552_594665_-	alanine dehydrogenase	NA	NA	NA	NA
WP_039935449.1\|594742_595804_-	hypothetical protein	NA	NA	NA	NA
WP_003142355.1\|595834_596074_+	hypothetical protein	NA	NA	NA	NA
WP_003142354.1\|596088_596604_+\|tRNA	tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL	NA	NA	NA	NA
WP_106427297.1\|596761_598525_+	DUF4153 domain-containing protein	NA	NA	NA	NA
WP_003142352.1\|598799_600893_+	PBP1A family penicillin-binding protein	NA	NA	NA	NA
WP_039935445.1\|601070_601445_+	hypothetical protein	NA	NA	NA	NA
WP_039935443.1\|601691_602969_+	DNA repair exonuclease	NA	NA	NA	NA
WP_003142349.1\|602971_605719_+	AAA family ATPase	NA	NA	NA	NA
WP_003142348.1\|605743_606787_+	HD domain-containing protein	NA	NA	NA	NA
WP_106427296.1\|607266_607689_+	hypothetical protein	NA	NA	NA	NA
WP_039935441.1\|607702_609289_+	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
WP_060779335.1\|609372_610896_-\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	1.1e-88	36.9
WP_003141613.1\|611366_612497_-	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_003141611.1\|612610_612976_-	YtxH domain-containing protein	NA	NA	NA	NA
WP_003141609.1\|612977_613412_-	HIT family protein	D7NW73	Streptomyces_phage	2.7e-08	30.2
WP_039934976.1\|613627_614374_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.4e-20	27.2
WP_106427272.1\|614360_615608_+	ABC transporter permease	NA	NA	NA	NA
WP_039934974.1\|615753_616566_+	phosphotransferase family protein	NA	NA	NA	NA
WP_003141604.1\|616919_617561_+\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
WP_003141603.1\|617608_617959_-	hypothetical protein	NA	NA	NA	NA
WP_039934972.1\|618356_618992_+\|tRNA	DUF4479 and tRNA-binding domain-containing protein	NA	NA	NA	NA
WP_106427271.1\|619167_619917_+	hypothetical protein	NA	NA	NA	NA
WP_003141600.1\|619909_621253_+	UDP-N-acetylmuramate--L-alanine ligase	NA	NA	NA	NA
WP_003141599.1\|621334_622312_+	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_003141598.1\|622409_623312_+	UTP--glucose-1-phosphate uridylyltransferase	A0A127AW70	Bacillus_phage	8.2e-60	43.9
WP_003141597.1\|623368_624679_-	alkaline phosphatase	NA	NA	NA	NA
WP_039934968.1\|624811_625819_+	nucleoid-associated protein	NA	NA	NA	NA
WP_003141595.1\|625868_626051_+	hypothetical protein	NA	NA	NA	NA
WP_003141594.1\|626466_628269_+	M3 family oligoendopeptidase	NA	NA	NA	NA
WP_003141593.1\|628413_629232_+	ADP-ribosylglycohydrolase	NA	NA	NA	NA
WP_003141592.1\|629253_629844_+	uracil-DNA glycosylase family protein	NA	NA	NA	NA
WP_158320207.1\|630214_630367_+	hypothetical protein	NA	NA	NA	NA
WP_060779336.1\|630384_630807_-\|transposase	IS200/IS605 family transposase	A0A0P0IQC6	Lactobacillus_phage	1.8e-46	61.2
WP_060779337.1\|630907_632050_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0P0ICY9	Lactobacillus_phage	4.0e-96	48.5

DBSCAN-SWA_5

651324 : 709004

Tupanvirus(20.0%)

transposase,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_039935182.1\|651324_653253_+\|tRNA	threonine--tRNA ligase	A0A2K9L6B6	Tupanvirus	6.8e-112	35.8
WP_003142010.1\|653613_654804_-	hypothetical protein	NA	NA	NA	NA
WP_003142011.1\|654920_655454_-	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
WP_060779338.1\|655650_656466_+	hypothetical protein	NA	NA	NA	NA
WP_003142014.1\|656563_657004_+	hypothetical protein	NA	NA	NA	NA
WP_081453827.1\|657274_657796_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	8.2e-12	36.8
WP_003142016.1\|657821_658022_+	50S ribosomal protein L35	NA	NA	NA	NA
WP_003142018.1\|658075_658435_+	50S ribosomal protein L20	NA	NA	NA	NA
WP_003142019.1\|658772_659846_+	methionine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.4e-28	38.7
WP_003142020.1\|659845_660523_+	ABC transporter permease	NA	NA	NA	NA
WP_003142022.1\|660561_661476_+	methionine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003142024.1\|661509_662424_+	methionine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_060779308.1\|662638_663964_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	5.1e-50	33.2
WP_003141392.1\|664508_665045_+	hypothetical protein	NA	NA	NA	NA
WP_003141391.1\|665103_666126_+	lipoate--protein ligase	NA	NA	NA	NA
WP_003141390.1\|666253_666955_-	adapter protein MecA	NA	NA	NA	NA
WP_003141389.1\|667084_667501_-	transcriptional regulator Spx	NA	NA	NA	NA
WP_003141388.1\|667715_668711_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_003141387.1\|669044_669218_+	hypothetical protein	NA	NA	NA	NA
WP_003141386.1\|669506_670604_+	hypothetical protein	NA	NA	NA	NA
WP_039934813.1\|670672_672469_+	oligoendopeptidase F	NA	NA	NA	NA
WP_003141382.1\|672591_673287_-	hypothetical protein	NA	NA	NA	NA
WP_003141380.1\|673501_674092_-	CYTH domain-containing protein	NA	NA	NA	NA
WP_039934810.1\|674300_675002_+	GTP pyrophosphokinase family protein	NA	NA	NA	NA
WP_003141377.1\|675094_675934_+	NAD kinase	NA	NA	NA	NA
WP_039934821.1\|676017_676899_+	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_039934818.1\|677075_678437_+	magnesium transporter	NA	NA	NA	NA
WP_039934806.1\|678893_679829_+	homoserine O-succinyltransferase	NA	NA	NA	NA
WP_003141369.1\|679871_680360_+	redoxin family protein	NA	NA	NA	NA
WP_003141366.1\|680453_680867_-	nucleoside-diphosphate kinase	D2E8E1	Anguillid_herpesvirus	3.5e-18	35.4
WP_003141365.1\|681026_681827_+	glutathione-dependent disulfide-bond oxidoreductase	NA	NA	NA	NA
WP_003141363.1\|682035_682488_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_039934801.1\|682718_684293_+	peptide chain release factor 3	A0A2K9L6L3	Tupanvirus	1.1e-14	35.0
WP_003141359.1\|684465_684984_-	transcriptional regulator	NA	NA	NA	NA
WP_039934798.1\|685450_686467_+	YeiH family putative sulfate export transporter	NA	NA	NA	NA
WP_107127075.1\|686592_686781_-\|transposase	transposase	A0A0C5AEA5	Paenibacillus_phage	2.9e-12	54.1
WP_003142310.1\|687382_687730_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003142311.1\|687729_688137_-\|transposase	transposase	NA	NA	NA	NA
WP_039935390.1\|688255_690445_-\|protease	ATP-dependent Clp protease ATP-binding subunit	K4FB40	Cronobacter_phage	2.2e-127	41.2
WP_003140845.1\|690731_692051_-\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	6.9e-241	94.3
WP_039935992.1\|692449_692716_+	phosphocarrier protein HPr	NA	NA	NA	NA
WP_003143593.1\|692717_694451_+	phosphoenolpyruvate--protein phosphotransferase	NA	NA	NA	NA
WP_003143594.1\|694662_695919_+	glycosyltransferase	NA	NA	NA	NA
WP_039935993.1\|696055_696283_+	YkuJ family protein	NA	NA	NA	NA
WP_003143596.1\|696410_697955_+	UDP-N-acetylmuramyl-tripeptide synthetase	NA	NA	NA	NA
WP_039935995.1\|698026_699331_+	homoserine dehydrogenase	NA	NA	NA	NA
WP_003143599.1\|699340_700228_+	homoserine kinase	NA	NA	NA	NA
WP_039935996.1\|700445_700976_+	YqeG family HAD IIIA-type phosphatase	NA	NA	NA	NA
WP_003143601.1\|700968_702096_+	ribosome biogenesis GTPase YqeH	NA	NA	NA	NA
WP_003143603.1\|702209_702518_+	ribosome assembly RNA-binding protein YhbY	NA	NA	NA	NA
WP_050774134.1\|702573_703197_+	nicotinate-nucleotide adenylyltransferase	NA	NA	NA	NA
WP_003143607.1\|703186_703813_+	HD domain-containing protein	NA	NA	NA	NA
WP_003143608.1\|703842_704202_+	ribosome silencing factor	NA	NA	NA	NA
WP_003143610.1\|704211_704979_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_003143612.1\|705012_706284_+	nucleotidyltransferase	NA	NA	NA	NA
WP_003143613.1\|706483_707041_+	nucleic acid-binding protein	NA	NA	NA	NA
WP_016897670.1\|707067_707253_+	50S ribosomal protein L32	NA	NA	NA	NA
WP_060779335.1\|707480_709004_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	1.1e-88	36.9

DBSCAN-SWA_6

913788 : 983221

Streptococcus_phage(11.76%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_107127077.1\|913788_915078_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.8e-50	33.0
WP_003142153.1\|915351_916290_-	nucleoside hydrolase	NA	NA	NA	NA
WP_003142151.1\|916428_917628_-	pyrimidine nucleoside transporter NupC	NA	NA	NA	NA
WP_003142149.1\|917871_919128_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	3.8e-140	59.2
WP_003142147.1\|919213_919819_+	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_106427289.1\|919919_921815_+	DNA primase	A0A1S5RH70	Helicobacter_phage	5.0e-43	29.9
WP_003142143.1\|921852_922977_+	RNA polymerase sigma factor RpoD	F4YCU2	Synechococcus_phage	7.6e-39	38.6
WP_060779331.1\|923110_924451_+\|transposase	ISL3 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.2e-13	24.6
WP_003141106.1\|925838_929018_+	carbamoyl-phosphate synthase large subunit	NA	NA	NA	NA
WP_167541429.1\|929706_930546_+	acetylglutamate kinase	NA	NA	NA	NA
WP_003141103.1\|930561_931587_+	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_003141101.1\|931587_932628_+	N-acetyl-gamma-glutamyl-phosphate reductase	NA	NA	NA	NA
WP_003141099.1\|932653_933925_+	bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ	NA	NA	NA	NA
WP_003141097.1\|933934_935134_+	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	1.5e-29	28.0
WP_003141096.1\|935571_937113_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2H4UUX5	Bodo_saltans_virus	1.5e-29	22.5
WP_060779346.1\|937275_937698_-\|transposase	IS200/IS605 family transposase	A0A0P0IQC6	Lactobacillus_phage	1.1e-43	59.0
WP_003141055.1\|939273_939978_+	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_003141054.1\|939990_940806_+	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
WP_003141053.1\|940819_942076_+	peptidase T	NA	NA	NA	NA
WP_003141050.1\|942208_945937_+	ATP-dependent deoxyribonuclease subunit B	NA	NA	NA	NA
WP_003141049.1\|945926_949790_+	helicase-exonuclease AddAB subunit AddA	G3MA40	Bacillus_virus	1.1e-12	22.8
WP_003141048.1\|950111_950774_+	reverse transcriptase-like protein	A0A220BZ00	Staphylococcus_phage	1.3e-17	37.2
WP_003141047.1\|950832_951306_+	signal peptidase II	NA	NA	NA	NA
WP_039934639.1\|951317_952271_+	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_003141045.1\|952349_952580_+	YneF family protein	NA	NA	NA	NA
WP_003141044.1\|952754_954524_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	4.2e-44	28.8
WP_003141043.1\|954510_956322_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.8e-43	26.7
WP_039934635.1\|956311_956977_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_003141040.1\|957038_957530_+	AI-2E family transporter	NA	NA	NA	NA
WP_050774096.1\|957857_961058_+	DEAD/DEAH box helicase family protein	A0A0P0YMN2	Yellowstone_lake_phycodnavirus	1.4e-48	33.6
WP_039934631.1\|961256_962015_+	30S ribosomal protein S2	NA	NA	NA	NA
WP_003141035.1\|962168_963047_+	elongation factor Ts	NA	NA	NA	NA
WP_003141034.1\|963166_963886_+	UMP kinase	NA	NA	NA	NA
WP_003141032.1\|963899_964460_+	ribosome recycling factor	NA	NA	NA	NA
WP_003141030.1\|964713_965460_+	isoprenyl transferase	R9W0U9	Flavobacterium_phage	4.7e-21	41.6
WP_003141028.1\|965474_966272_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_003141026.1\|966321_967587_+\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_003141024.1\|967677_971997_+	PolC-type DNA polymerase III	A0A0A8WJ41	Clostridium_phage	8.5e-22	37.0
WP_003141022.1\|972222_973698_+	DUF1538 domain-containing protein	NA	NA	NA	NA
WP_003141020.1\|973710_974364_+	P-II family nitrogen regulator	NA	NA	NA	NA
WP_026465958.1\|974507_974984_+	ribosome maturation factor RimP	NA	NA	NA	NA
WP_003141016.1\|975014_976358_+	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_003141014.1\|976376_976676_+	YlxR family protein	NA	NA	NA	NA
WP_003141013.1\|976665_976953_+	hypothetical protein	NA	NA	NA	NA
WP_003141012.1\|977033_979295_+	translation initiation factor IF-2	E3T4N3	Cafeteria_roenbergensis_virus	1.0e-18	23.1
WP_003141011.1\|979307_979703_+	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_060779347.1\|980144_980990_+	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_003140845.1\|981901_983221_-\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	6.9e-241	94.3

DBSCAN-SWA_7

1146484 : 1155946

Thermus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_106427257.1\|1146484_1147405_-	DNA-protecting protein DprA	S6BFL3	Thermus_phage	3.9e-25	38.0
WP_039934570.1\|1147472_1148228_-	ribonuclease HII	G9E3X7	Emiliania_huxleyi_virus	2.5e-22	34.4
WP_003140861.1\|1148282_1149158_-	ribosome biogenesis GTPase YlqF	NA	NA	NA	NA
WP_003140863.1\|1149244_1149805_-	signal peptidase I	NA	NA	NA	NA
WP_003140864.1\|1149899_1151471_-	S41 family peptidase	A0A0R6PIZ1	Moraxella_phage	2.3e-25	29.9
WP_003140866.1\|1151529_1151763_-	D-Ala-D-Ala carboxypeptidase	NA	NA	NA	NA
WP_106427258.1\|1151787_1152441_-	DUF2140 family protein	NA	NA	NA	NA
WP_003140871.1\|1152458_1152962_-	dihydrofolate reductase	A0A1Q2U372	Vibrio_phage	4.6e-20	36.9
WP_003140872.1\|1153017_1153971_-	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	7.2e-115	60.8
WP_003140874.1\|1154032_1155946_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	2.5e-58	30.7

DBSCAN-SWA_8

1329440 : 1381679

Staphylococcus_phage(29.41%)

transposase,tRNA,integrase

attL 1325038:1325053|attR 1366422:1366437

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1325038:1325053	attL	NA	NA	NA	NA
WP_060779340.1\|1329440_1330442_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.8e-55	39.9
WP_039934722.1\|1330705_1330927_-	hypothetical protein	NA	NA	NA	NA
WP_039934724.1\|1331530_1331692_-	hypothetical protein	NA	NA	NA	NA
WP_003141212.1\|1331684_1331894_-	helix-turn-helix transcriptional regulator	A0A1S5SDM7	Streptococcus_phage	1.6e-14	61.7
WP_003141211.1\|1332139_1332445_+	helix-turn-helix transcriptional regulator	A0A1S5SDR1	Streptococcus_phage	7.6e-10	44.6
WP_003141210.1\|1332474_1332843_+	ImmA/IrrE family metallo-endopeptidase	A0A223LGM3	Staphylococcus_phage	8.0e-06	31.8
WP_003141209.1\|1332858_1333236_+	TM2 domain-containing protein	NA	NA	NA	NA
WP_003141208.1\|1333322_1333904_+	DUF5067 domain-containing protein	NA	NA	NA	NA
WP_003141206.1\|1333993_1334908_+	hypothetical protein	NA	NA	NA	NA
WP_003141203.1\|1335225_1336341_+\|integrase	site-specific integrase	A0A0A8WF08	Clostridium_phage	2.3e-88	48.4
WP_039934718.1\|1336394_1337954_-	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	4.6e-18	32.4
WP_003141201.1\|1338157_1339156_+	mevalonate kinase	NA	NA	NA	NA
WP_003141200.1\|1339218_1340232_+	diphosphomevalonate decarboxylase	NA	NA	NA	NA
WP_003141199.1\|1340215_1341400_+	phosphomevalonate kinase	NA	NA	NA	NA
WP_039934716.1\|1341401_1342451_+	type 2 isopentenyl-diphosphate Delta-isomerase	NA	NA	NA	NA
WP_003141197.1\|1342857_1343169_-	AzlD domain-containing protein	NA	NA	NA	NA
WP_003141196.1\|1343179_1343890_-	AzlC family ABC transporter permease	NA	NA	NA	NA
WP_003141195.1\|1343929_1345606_-	ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	1.8e-12	27.2
WP_003141193.1\|1345678_1346614_-	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_003141192.1\|1346841_1347081_+	hypothetical protein	NA	NA	NA	NA
WP_003141190.1\|1347141_1347681_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003141188.1\|1347728_1348196_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_158320208.1\|1348284_1348383_-	hypothetical protein	NA	NA	NA	NA
WP_060779331.1\|1349190_1350531_-\|transposase	ISL3 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.2e-13	24.6
WP_039936052.1\|1350672_1351656_-	phosphate acetyltransferase	NA	NA	NA	NA
WP_003143822.1\|1351813_1353298_-	gluconokinase	NA	NA	NA	NA
WP_003143823.1\|1353479_1355909_-\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_003143824.1\|1355915_1356962_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2K9L3A8	Tupanvirus	1.6e-30	37.3
WP_003143825.1\|1357317_1357662_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003143827.1\|1357645_1358278_-	HD domain-containing protein	NA	NA	NA	NA
WP_003143829.1\|1358390_1359185_-	RNA methyltransferase	NA	NA	NA	NA
WP_003143830.1\|1359189_1360593_-	dipeptidase PepV	NA	NA	NA	NA
WP_003143832.1\|1361205_1361982_-	rRNA pseudouridine synthase	NA	NA	NA	NA
WP_003143833.1\|1361971_1363792_-	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_050774136.1\|1364185_1365049_-	pyridoxamine kinase	NA	NA	NA	NA
WP_039936056.1\|1365112_1367527_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	69.9
1366422:1366437	attR	NA	NA	NA	NA
WP_003143838.1\|1367855_1368758_-	shikimate dehydrogenase	NA	NA	NA	NA
WP_106427344.1\|1368761_1369895_-	3-dehydroquinate synthase	E5ERI4	Ostreococcus_lucimarinus_virus	3.3e-26	31.3
WP_039936058.1\|1369956_1370826_-	3-deoxy-7-phosphoheptulonate synthase	E3T537	Cafeteria_roenbergensis_virus	5.3e-16	31.7
WP_003143842.1\|1371248_1373570_-	LysM peptidoglycan-binding domain-containing protein	Q9ZXE4	Bacillus_phage	3.1e-18	42.4
WP_003143844.1\|1373766_1374333_+	methyltransferase domain-containing protein	A0A2H4PQV0	Staphylococcus_phage	4.8e-26	36.6
WP_003143846.1\|1374333_1375062_+	hypothetical protein	NA	NA	NA	NA
WP_060779326.1\|1377390_1377813_-\|transposase	IS200/IS605 family transposase	A0A0P0IQC6	Lactobacillus_phage	1.8e-46	61.9
WP_060779361.1\|1377914_1379057_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0P0ICY9	Lactobacillus_phage	2.0e-95	48.0
WP_003141880.1\|1379343_1380459_-	AI-2E family transporter	NA	NA	NA	NA
WP_060779340.1\|1380677_1381679_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.8e-55	39.9

DBSCAN-SWA_9

1427373 : 1434885

Staphylococcus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003141800.1\|1427373_1427694_-	thioredoxin	A0A1X9I9P5	Staphylococcus_phage	7.7e-21	46.3
WP_003141803.1\|1428668_1429922_-	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
WP_003141804.1\|1429952_1431473_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	7.3e-61	42.7
WP_003141805.1\|1431525_1432089_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	5.0e-23	37.4
WP_003141806.1\|1432085_1433111_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SR00	Cyanophage	3.3e-65	44.5
WP_003141807.1\|1433141_1434392_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.4e-30	28.1
WP_003141809.1\|1434405_1434885_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.6e-28	49.0

DBSCAN-SWA_10

1487657 : 1526718

Enterobacteria_phage(38.46%)

transposase,integrase

attL 1479225:1479241|attR 1520577:1520593

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1479225:1479241	attL	NA	NA	NA	NA
WP_060779365.1\|1487657_1488893_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0P0IJS6	Lactobacillus_phage	2.1e-90	45.7
WP_060779366.1\|1489043_1489487_+	hypothetical protein	NA	NA	NA	NA
WP_003141443.1\|1489476_1490151_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_003141445.1\|1490201_1490450_+	hypothetical protein	NA	NA	NA	NA
WP_003141446.1\|1490454_1490721_+	hypothetical protein	NA	NA	NA	NA
WP_081453820.1\|1490721_1490985_+	ATP-binding protein	NA	NA	NA	NA
WP_147291243.1\|1490965_1491205_+	ATP-binding protein	U5N3V8	Enterobacteria_phage	1.5e-08	41.2
WP_003141452.1\|1491459_1492041_-	YdcF family protein	NA	NA	NA	NA
WP_003141454.1\|1492281_1492647_-	hypothetical protein	NA	NA	NA	NA
WP_003141644.1\|1494065_1494806_+	hypothetical protein	NA	NA	NA	NA
WP_106427274.1\|1494912_1495212_-	hypothetical protein	NA	NA	NA	NA
WP_003141646.1\|1495245_1495722_-	hypothetical protein	NA	NA	NA	NA
WP_003141647.1\|1495712_1495970_-	hypothetical protein	NA	NA	NA	NA
WP_050774102.1\|1496036_1496909_-	hypothetical protein	A0A2H4J8H9	uncultured_Caudovirales_phage	2.9e-30	30.4
WP_003141651.1\|1498946_1499993_-	pseudaminic acid synthase	NA	NA	NA	NA
WP_003141652.1\|1499982_1500960_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_003141654.1\|1500949_1501654_-	metallophosphoesterase family protein	NA	NA	NA	NA
WP_003141656.1\|1501658_1502429_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_003141657.1\|1502433_1503417_-	hypothetical protein	NA	NA	NA	NA
WP_003141658.1\|1503429_1504164_-	glycosyltransferase family protein	NA	NA	NA	NA
WP_003141660.1\|1504172_1505363_-	UDP-4-amino-4, 6-dideoxy-N-acetyl-beta-L-altrosamine transaminase	A0A0F7LAY0	uncultured_marine_virus	1.3e-33	26.9
WP_003141661.1\|1505378_1506383_-	UDP-N-acetylglucosamine 4,6-dehydratase (inverting)	A0A2P1ELS8	Moumouvirus	1.5e-41	35.6
WP_003141663.1\|1506412_1507690_-	flippase	NA	NA	NA	NA
WP_003141665.1\|1507776_1509129_-	hypothetical protein	NA	NA	NA	NA
WP_003141667.1\|1509133_1510120_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_003141668.1\|1510109_1510949_-	dTDP-4-dehydrorhamnose reductase	I7HXC9	Enterobacteria_phage	5.1e-40	39.5
WP_039935001.1\|1510948_1511980_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	2.5e-81	46.8
WP_003141670.1\|1511999_1512551_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	8.5e-44	48.6
WP_003141671.1\|1512567_1513452_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	2.3e-107	66.0
WP_003141672.1\|1513448_1514174_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_003141674.1\|1514170_1514986_-	glycosyltransferase	NA	NA	NA	NA
WP_039935004.1\|1515059_1515410_-	hypothetical protein	NA	NA	NA	NA
WP_039935006.1\|1515436_1516345_-	hypothetical protein	NA	NA	NA	NA
WP_003141678.1\|1516384_1517512_-	glycosyltransferase	NA	NA	NA	NA
WP_039935019.1\|1517511_1518381_-	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_003141683.1\|1519773_1520502_-	CpsD/CapB family tyrosine-protein kinase	NA	NA	NA	NA
WP_003141685.1\|1520505_1521243_-	LPS chain length-determining protein	NA	NA	NA	NA
1520577:1520593	attR	NA	NA	NA	NA
WP_060779369.1\|1521483_1522656_-\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	6.3e-121	88.4
WP_082702807.1\|1523661_1523796_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_003141336.1\|1523843_1524581_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	3.2e-62	50.8
WP_060779370.1\|1524570_1525809_-\|transposase	IS21 family transposase	A0A059NT83	Lactococcus_phage	6.7e-105	49.3
WP_107127079.1\|1525899_1526718_-\|transposase	IS3 family transposase	A0A0C5AC89	Paenibacillus_phage	8.0e-46	51.2

DBSCAN-SWA_11

1541629 : 1596689

Lactobacillus_phage(33.33%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003140845.1\|1541629_1542949_-\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	6.9e-241	94.3
WP_003141966.1\|1543381_1543903_-	DUF3324 domain-containing protein	NA	NA	NA	NA
WP_039935165.1\|1545060_1545573_-	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	4.7e-36	49.1
WP_003141972.1\|1545652_1545976_-	hypothetical protein	NA	NA	NA	NA
WP_107127080.1\|1547446_1547941_-	helix-turn-helix domain-containing protein	A0A1B1P776	Bacillus_phage	8.8e-08	35.6
WP_060779369.1\|1548002_1549175_+\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	6.3e-121	88.4
WP_003143296.1\|1549398_1550094_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.4e-28	35.3
WP_039935926.1\|1550103_1551219_-	ABC transporter permease	NA	NA	NA	NA
WP_039935927.1\|1551325_1551556_-	NAD(P)-binding protein	NA	NA	NA	NA
WP_003143299.1\|1551722_1552286_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_157832732.1\|1552376_1552481_-	putative metal homeostasis protein	NA	NA	NA	NA
WP_060779374.1\|1553034_1562742_-	Cna B-type domain-containing protein	NA	NA	NA	NA
WP_060779375.1\|1562809_1563046_-	hypothetical protein	NA	NA	NA	NA
WP_003143301.1\|1563598_1563826_+	hypothetical protein	NA	NA	NA	NA
WP_157832733.1\|1564019_1564976_+	hypothetical protein	NA	NA	NA	NA
WP_003143304.1\|1565049_1566732_-	DAK2 domain-containing protein	NA	NA	NA	NA
WP_003143306.1\|1566758_1567124_-	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_039935929.1\|1567344_1567536_-	50S ribosomal protein L28	NA	NA	NA	NA
WP_003143308.1\|1567632_1568304_-	thiamine diphosphokinase	NA	NA	NA	NA
WP_039935930.1\|1568357_1569008_-	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
WP_003143312.1\|1569023_1569956_-	ribosome small subunit-dependent GTPase A	NA	NA	NA	NA
WP_060779376.1\|1570094_1571237_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0P0ICY9	Lactobacillus_phage	9.0e-96	48.3
WP_060779320.1\|1571337_1571757_+\|transposase	IS200/IS605 family transposase	A0A0P0IQC6	Lactobacillus_phage	2.6e-45	61.9
WP_003142448.1\|1571959_1574161_-	serine/threonine-protein kinase	A0A1V0SH95	Hokovirus	1.1e-20	27.1
WP_003142449.1\|1574160_1574964_-	Stp1/IreP family PP2C-type Ser/Thr phosphatase	NA	NA	NA	NA
WP_003142450.1\|1574983_1576432_-	16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB	NA	NA	NA	NA
WP_003142452.1\|1576421_1577405_-\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	4.2e-09	31.7
WP_039935517.1\|1577511_1579929_-	primosomal protein N'	NA	NA	NA	NA
WP_003142454.1\|1580188_1581553_+	guanine deaminase	NA	NA	NA	NA
WP_003142455.1\|1581717_1581930_-	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_039935521.1\|1581929_1582562_-	guanylate kinase	A0A0M5KCK5	Mollivirus	2.0e-12	30.3
WP_003142457.1\|1582852_1583245_+	hypothetical protein	NA	NA	NA	NA
WP_003142458.1\|1583324_1584773_-	cardiolipin synthase	NA	NA	NA	NA
WP_003142459.1\|1584884_1585490_-	hypothetical protein	NA	NA	NA	NA
WP_003142460.1\|1585501_1587205_-	ribonuclease J	NA	NA	NA	NA
WP_003142462.1\|1587394_1588438_-	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_003142463.1\|1588623_1590732_-	polyribonucleotide nucleotidyltransferase	NA	NA	NA	NA
WP_003142464.1\|1590942_1591212_-	30S ribosomal protein S15	NA	NA	NA	NA
WP_003142465.1\|1591866_1592562_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_003142466.1\|1592669_1594664_-	excinuclease ABC subunit UvrB	NA	NA	NA	NA
WP_060779377.1\|1595023_1595446_-\|transposase	IS200/IS605 family transposase	A0A0P0IQC6	Lactobacillus_phage	1.6e-45	60.4
WP_060779378.1\|1595546_1596689_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0P0ICY9	Lactobacillus_phage	1.2e-95	48.0

DBSCAN-SWA_12

1611121 : 1651480

Streptococcus_phage(20.0%)

transposase,integrase

attL 1610968:1611027|attR 1622054:1623729

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1610968:1611027	attL	NA	NA	NA	NA
WP_003141076.1\|1611121_1612435_+\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	1.2e-157	62.4
WP_003143621.1\|1613143_1613674_-	hypothetical protein	NA	NA	NA	NA
WP_039936000.1\|1613951_1614311_-	hypothetical protein	NA	NA	NA	NA
WP_003143623.1\|1614325_1614790_-	replication initiation protein	NA	NA	NA	NA
WP_060779379.1\|1614851_1615184_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	A0A1B1P773	Bacillus_phage	6.3e-18	46.2
WP_158320209.1\|1615128_1615278_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_003143785.1\|1615562_1616513_-	class A sortase	NA	NA	NA	NA
WP_106427342.1\|1616670_1618029_+\|transposase	ISL3 family transposase	A0A2R2ZGN7	Clostridioides_phage	1.3e-08	23.6
WP_082702799.1\|1618100_1620806_-	choice-of-anchor A family protein	NA	NA	NA	NA
WP_003143791.1\|1620845_1621151_-	hypothetical protein	NA	NA	NA	NA
WP_016896373.1\|1621471_1621951_-	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
WP_003141076.1\|1622207_1623521_+\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	1.2e-157	62.4
WP_060779380.1\|1624203_1625271_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.3e-27	29.1
1622054:1623729	attR	NA	NA	NA	NA
WP_003141859.1\|1625496_1626333_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003141860.1\|1626426_1626750_-	YlbG family protein	NA	NA	NA	NA
WP_039935128.1\|1626880_1630306_-	pyruvate carboxylase	NA	NA	NA	NA
WP_003141862.1\|1630609_1632103_-	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_003141863.1\|1632158_1633061_-	hypothetical protein	NA	NA	NA	NA
WP_003141864.1\|1633691_1635068_-	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_039935123.1\|1635341_1637177_-	translational GTPase TypA	NA	NA	NA	NA
WP_003141866.1\|1637413_1638193_-	inositol monophosphatase family protein	NA	NA	NA	NA
WP_003141868.1\|1638238_1638514_-	UPF0223 family protein	NA	NA	NA	NA
WP_003141870.1\|1638931_1640344_-	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	1.7e-43	27.0
WP_003141871.1\|1640351_1642010_-	biotin/lipoyl-binding protein	NA	NA	NA	NA
WP_003141872.1\|1642102_1643080_-	alpha-ketoacid dehydrogenase subunit beta	NA	NA	NA	NA
WP_003141873.1\|1643082_1644186_-	pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha	NA	NA	NA	NA
WP_039935126.1\|1644575_1645148_+	peptide deformylase	A0A067XQZ3	Caulobacter_phage	9.0e-12	35.5
WP_060779340.1\|1645274_1646276_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.8e-55	39.9
WP_060779381.1\|1646333_1647545_-	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	3.9e-41	30.5
WP_039936036.1\|1647569_1649060_-	threonine synthase	NA	NA	NA	NA
WP_003143761.1\|1649328_1649964_+	50S ribosomal protein L25	NA	NA	NA	NA
WP_039936035.1\|1650135_1650699_-	energy-coupled thiamine transporter ThiT	NA	NA	NA	NA
WP_060779382.1\|1651057_1651480_-\|transposase	IS200/IS605 family transposase	A0A0P0IQC6	Lactobacillus_phage	1.2e-45	60.4

DBSCAN-SWA_13

1735795 : 1848741

Lactobacillus_phage(26.67%)

transposase,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003143073.1\|1735795_1737814_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	3.8e-97	38.3
WP_003143074.1\|1738028_1738550_-	C40 family peptidase	A0A2H4PQY6	Streptomyces_phage	3.0e-14	46.3
WP_003143076.1\|1738736_1740002_-\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	1.1e-81	41.2
WP_003143078.1\|1740420_1740633_-	hypothetical protein	NA	NA	NA	NA
WP_003143079.1\|1740647_1741328_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_060779384.1\|1741428_1741851_-\|transposase	IS200/IS605 family transposase	A0A0P0IQC6	Lactobacillus_phage	5.3e-46	61.2
WP_060779385.1\|1741951_1743094_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0P0ICY9	Lactobacillus_phage	1.4e-96	48.8
WP_060779386.1\|1743176_1744712_-	AbgT family transporter	NA	NA	NA	NA
WP_003140818.1\|1745077_1745683_-	cyclodeaminase/cyclohydrolase family protein	NA	NA	NA	NA
WP_003140820.1\|1745750_1746338_-	DUF554 domain-containing protein	NA	NA	NA	NA
WP_106427256.1\|1746645_1747986_+	type I glutamate--ammonia ligase	NA	NA	NA	NA
WP_003140823.1\|1748199_1749033_-	DUF975 family protein	NA	NA	NA	NA
WP_003140825.1\|1749265_1749964_-	zinc metallopeptidase	NA	NA	NA	NA
WP_003140826.1\|1750025_1751039_-	alpha/beta hydrolase fold domain-containing protein	NA	NA	NA	NA
WP_003140828.1\|1751343_1751970_+	hypothetical protein	NA	NA	NA	NA
WP_003140830.1\|1751996_1753421_+	putative glycoside hydrolase	NA	NA	NA	NA
WP_003140832.1\|1753645_1754188_-	cysteine hydrolase family protein	G3MA16	Bacillus_virus	5.6e-56	57.2
WP_003140835.1\|1754268_1755438_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_039934560.1\|1755434_1755929_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_060779387.1\|1756222_1757458_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0P0IJS6	Lactobacillus_phage	1.6e-90	45.9
WP_003143318.1\|1757940_1758921_+	DUF1002 domain-containing protein	NA	NA	NA	NA
WP_102950041.1\|1759106_1759781_+	hypothetical protein	NA	NA	NA	NA
WP_003143320.1\|1759867_1761358_-	carbon starvation protein A	NA	NA	NA	NA
WP_003143321.1\|1761716_1762424_-	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
WP_060779388.1\|1763795_1764218_+\|transposase	IS200/IS605 family transposase	A0A0P0IQC6	Lactobacillus_phage	7.2e-43	58.3
WP_158320210.1\|1764510_1768863_-	VWA domain-containing protein	NA	NA	NA	NA
WP_003143745.1\|1768940_1769237_-	hypothetical protein	NA	NA	NA	NA
WP_147291240.1\|1769315_1769780_-	hypothetical protein	NA	NA	NA	NA
WP_060779389.1\|1770076_1770556_-	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
WP_003143502.1\|1770786_1772124_+	potassium transporter	NA	NA	NA	NA
WP_039935970.1\|1772133_1772808_+	TrkA family potassium uptake protein	NA	NA	NA	NA
WP_003143507.1\|1773240_1774599_-	PDZ domain-containing protein	W5SAB9	Pithovirus	8.1e-11	28.7
WP_003143508.1\|1774710_1775526_-	MBL fold metallo-hydrolase	A0A0B5A2C7	Paenibacillus_phage	1.1e-39	39.0
WP_003143509.1\|1775591_1777370_-	DUF2207 domain-containing protein	NA	NA	NA	NA
WP_003143510.1\|1777388_1778210_-	hypothetical protein	NA	NA	NA	NA
WP_003143511.1\|1778212_1779775_-	hypothetical protein	NA	NA	NA	NA
WP_003143512.1\|1779761_1781657_-	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	8.9e-40	36.7
WP_003143513.1\|1781666_1782383_-	response regulator transcription factor	W8CYM9	Bacillus_phage	2.6e-40	38.8
WP_060779390.1\|1782597_1784154_-	peptidoglycan endopeptidase	D2KRB9	Lactobacillus_phage	1.5e-13	38.3
WP_003143515.1\|1784533_1785283_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_060779391.1\|1785441_1786584_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0P0ICY9	Lactobacillus_phage	5.3e-96	48.5
WP_060779392.1\|1786684_1787107_+\|transposase	IS200/IS605 family transposase	A0A0P0IQC6	Lactobacillus_phage	3.1e-46	61.2
WP_003141694.1\|1787711_1788140_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_039935037.1\|1788831_1789575_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_003141700.1\|1789661_1790999_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003141701.1\|1791413_1792634_-	AI-2E family transporter	NA	NA	NA	NA
WP_003141703.1\|1792681_1793707_-	lipoate--protein ligase	NA	NA	NA	NA
WP_003141706.1\|1793703_1794588_-	hypothetical protein	NA	NA	NA	NA
WP_003141708.1\|1794662_1795496_-	protein-ADP-ribose hydrolase	A0A2K9L8X2	Tupanvirus	1.8e-32	38.1
WP_003141710.1\|1795500_1795839_-	glycine cleavage system protein H	NA	NA	NA	NA
WP_003141711.1\|1795974_1796985_-	MsnO8 family LLM class oxidoreductase	NA	NA	NA	NA
WP_003141713.1\|1797226_1798423_+	NADH-dependent flavin oxidoreductase	NA	NA	NA	NA
WP_003141714.1\|1798467_1798761_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_003141716.1\|1798899_1800081_-	potassium transporter	NA	NA	NA	NA
WP_039935029.1\|1800711_1801401_+	2,3-diphosphoglycerate-dependent phosphoglycerate mutase	NA	NA	NA	NA
WP_003141718.1\|1801464_1801965_-	hypothetical protein	NA	NA	NA	NA
WP_003141722.1\|1802827_1804030_-	dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
WP_039935031.1\|1804137_1804833_-	M48 family metallopeptidase	NA	NA	NA	NA
WP_003141726.1\|1804887_1805592_-	acetolactate decarboxylase	NA	NA	NA	NA
WP_003141728.1\|1805789_1806305_+	hypothetical protein	NA	NA	NA	NA
WP_039935035.1\|1806486_1807827_+	amino acid permease	NA	NA	NA	NA
WP_060779393.1\|1808069_1809374_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	9.7e-46	30.8
WP_003143289.1\|1810306_1812397_-	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	6.5e-60	29.4
WP_002294571.1\|1812535_1812742_-	copper chaperone TcrZ	NA	NA	NA	NA
WP_060779394.1\|1813240_1814242_-	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_060779396.1\|1815875_1816202_-\|transposase	transposase family protein	NA	NA	NA	NA
WP_060779397.1\|1816506_1817742_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0P0IJS6	Lactobacillus_phage	8.8e-89	45.2
WP_039935897.1\|1817932_1818136_-	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_004262484.1\|1818500_1820969_-	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.3e-102	34.7
WP_004262479.1\|1820981_1821437_-	copper-responsive transcriptional repressor TcrY	A3QSD4	Clostridium_virus	4.6e-11	35.4
WP_107127085.1\|1821649_1821769_+	hypothetical protein	NA	NA	NA	NA
WP_039935896.1\|1822592_1823483_-	DegV family protein	NA	NA	NA	NA
WP_158320212.1\|1823509_1823707_-	hypothetical protein	NA	NA	NA	NA
WP_005232990.1\|1823877_1825197_+\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	1.0e-223	88.4
WP_039934709.1\|1825851_1826742_-	fructose bisphosphate aldolase	NA	NA	NA	NA
WP_003141178.1\|1826931_1827126_-	hypothetical protein	NA	NA	NA	NA
WP_060779398.1\|1827157_1828162_-	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_003143498.1\|1828570_1829929_-	DUF1541 domain-containing protein	NA	NA	NA	NA
WP_060779417.1\|1831607_1832459_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	2.3e-48	43.8
WP_060779399.1\|1832844_1833753_-	cation transporter	NA	NA	NA	NA
WP_003143660.1\|1833791_1834106_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_060779400.1\|1834471_1836397_+	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.5e-95	35.8
WP_039935500.1\|1836655_1837219_+	recombinase family protein	A0A219Y9V9	Aeromonas_phage	1.6e-37	46.4
WP_039935508.1\|1838121_1838805_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.0e-38	37.6
WP_003142441.1\|1838801_1840211_+	HAMP domain-containing protein	W8CYF6	Bacillus_phage	4.1e-42	34.9
WP_003142439.1\|1840755_1840989_-	hypothetical protein	NA	NA	NA	NA
WP_003142438.1\|1841033_1841873_-	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_003142437.1\|1841916_1842309_-	peptidoglycan DD-metalloendopeptidase family protein	D7RWE0	Brochothrix_phage	3.8e-06	52.8
WP_003142436.1\|1842625_1842829_+	hypothetical protein	NA	NA	NA	NA
WP_003142434.1\|1842845_1843493_+	TIGR01906 family membrane protein	NA	NA	NA	NA
WP_039934596.1\|1845307_1847170_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.8e-98	35.0
WP_060779355.1\|1847421_1848741_-\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	1.2e-224	88.6

DBSCAN-SWA_14

1968649 : 1980222

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003143348.1\|1968649_1969870_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	6.6e-89	47.2
WP_003143349.1\|1969862_1970513_-	VanZ family protein	NA	NA	NA	NA
WP_003143350.1\|1970554_1971997_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	4.7e-33	33.8
WP_003143352.1\|1971999_1972725_-	response regulator transcription factor	W8CYM9	Bacillus_phage	2.4e-30	34.5
WP_003143353.1\|1972986_1973367_+	single-stranded DNA-binding protein	A0A097BYB0	Leuconostoc_phage	7.5e-07	30.4
WP_039935936.1\|1973564_1973990_+	DUF1772 domain-containing protein	NA	NA	NA	NA
WP_003143355.1\|1974377_1975322_-	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	1.3e-52	38.2
WP_003143356.1\|1975346_1976378_-	uridine diphosphate-N-acetylglucosamine-binding protein YvcK	A1IMD5	Streptococcus_phage	1.2e-86	49.5
WP_003143357.1\|1976374_1977262_-	RNase adapter RapZ	NA	NA	NA	NA
WP_003143358.1\|1977334_1979059_-	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	8.0e-181	55.7
WP_081453839.1\|1979283_1980222_-	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	3.1e-86	49.2

DBSCAN-SWA_15

2171661 : 2180430

Prochlorococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003142083.1\|2171661_2172150_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	1.0e-24	43.1
WP_003142084.1\|2172194_2173463_-	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
WP_003142086.1\|2173538_2175077_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	1.3e-76	50.8
WP_039935260.1\|2175079_2175661_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	6.9e-28	38.3
WP_003142090.1\|2175671_2176706_-	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	8.2e-64	47.9
WP_003142092.1\|2176771_2178223_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.1e-53	33.3
WP_003142093.1\|2178198_2180430_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.2e-149	39.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP014164

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection