CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Prophage number
NZ_CP013373	Burkholderia sp. NRF60-BP8 chromosome 1, complete sequence	1 crisprs	WYL,csa3,cas3,RT,DEDDh,Cas14u_CAS-V,DinG	0	3
NZ_CP013372	Burkholderia sp. NRF60-BP8 chromosome 2, complete sequence	1 crisprs	cas3,csa3,DinG	1	1
NZ_CP013374	Burkholderia sp. NRF60-BP8 chromosome 3, complete sequence	0 crisprs	RT	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013373_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013373_1

1226914-1227027

Orphan

Consensus_repeat	Method
GCGAACGAAGTGAGCGTGGGGGTTGTTTCAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013373_1

>merge|NZ_CP013373|1|1226914-1227027|CRISPRCasFinder
GCGAACGAAGTGAGCGTGGGGGTTGTTTCATGTCGGCACTCGCTGGGCCGCCCCAAGGGTGCCGACCGCCCCCTTGGGGGGCAGCGAACGAAGTGAGCGTGGGGGTTGTTTCAT

>NZ_CP013373|1|1|1226914-1227027|CRISPRCasFinder
GCGAACGAAGTGAGCGTGGGGGTTGTTTCAT	GTCGGCACTCGCTGGGCCGCCCCAAGGGTGCCGACCGCCCCCTTGGGGGGCA
GCGAACGAAGTGAGCGTGGGGGTTGTTTCAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013373.1\|WP_059782538.1\|1223531_1226840_-\|efflux-RND-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|182589
NZ_CP013373.1\|WP_059782533.1\|1221421_1222912_+\|NYN-domain-containing-protein	unknown	unknown	gnl\|CDD\|350237
NZ_CP013373.1\|WP_059782548.1\|1236330_1237524_-\|ammonium-transporter	unknown	unknown	gnl\|CDD\|223083
NZ_CP013373.1\|WP_034206833.1\|1217857_1219693_-\|sensor-domain-containing-phosphodiesterase	unknown	unknown	gnl\|CDD\|238923
NZ_CP013373.1\|WP_034206850.1\|1239490_1240132_+\|NAD(P)H-binding-protein	unknown	unknown	gnl\|CDD\|225462
NZ_CP013373.1\|WP_034206849.1\|1238830_1239286_+\|Rrf2-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224870
NZ_CP013373.1\|WP_159086694.1\|1233767_1234103_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013373.1\|WP_034206844.1\|1231774_1232599_-\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
NZ_CP013373.1\|WP_034206834.1\|1220512_1221142_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187554
NZ_CP013373.1\|WP_059782525.1\|1214021_1215065_+\|succinylglutamate-desuccinylase	unknown	unknown	gnl\|CDD\|235408
NZ_CP013373.1\|WP_059782754.1\|1238311_1238740_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013373.1\|WP_059782544.1\|1233275_1233653_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013373.1\|WP_059782531.1\|1219878_1220427_+\|peroxiredoxin	unknown	unknown	gnl\|CDD\|239315
NZ_CP013373.1\|WP_006490898.1\|1215418_1216213_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270421
NZ_CP013373.1\|WP_059782535.1\|1223041_1223425_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319939
NZ_CP013373.1\|WP_059782546.1\|1234173_1236138_-\|DUF839-domain-containing-protein	unknown	unknown	gnl\|CDD\|225752
NZ_CP013373.1\|WP_059782528.1\|1216303_1217830_-\|HDOD-domain-containing-protein	unknown	unknown	gnl\|CDD\|370050
NZ_CP013373.1\|WP_059782550.1\|1237778_1238114_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013373.1\|WP_034206829.1\|1212673_1214014_+\|N-succinylarginine-dihydrolase	unknown	unknown	gnl\|CDD\|237332
NZ_CP013373.1\|WP_059782542.1\|1230162_1231527_-\|MdtA/MuxA-family-multidrug-efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|183194

Protein	Function_ID	Function_description	E-value
NZ_CP013373.1\|WP_059782538.1\|1223531_1226840_-\|efflux-RND-transporter-permease-subunit	gnl\|CDD\|182589	PRK10614, PRK10614, multidrug efflux system subunit MdtC; Provisional.	0
NZ_CP013373.1\|WP_059782533.1\|1221421_1222912_+\|NYN-domain-containing-protein	gnl\|CDD\|350237	cd11297, PIN_LabA-like_N_1, uncharacterized subfamily of N-terminal LabA-like PIN domains. This N-terminal LabA-like PIN domain is found in a well conserved group of mainly bacterial proteins with no defined function, which contain a C-terminal LabA_like_C domain. LabA from Synechococcus elongatus PCC 7942, (which does not contain this C-terminal domain), has been shown to play a role in cyanobacterial circadian timing. The LabA-like C-terminal domains characteristic of this subfamily may be related to the LOTUS domain family (which also co-occurs with LabA-like N-terminal domains). The function of the N-terminal domain is unknown. The LabA-like PIN domain family also includes the N-terminal domain of limkain b1, a human autoantigen localized to a subset of ABCD3 and PXF marked peroxisomes. Other members are the LabA-like PIN domains of human ZNF451, uncharacterized Bacillus subtilis YqxD and Escherichia coli YaiI. Curiously, a gene labeled NicB from Pseudomonas putida S16, which is described as a putative NADH-dependent hydroxylase involved in the microbial degradation of nicotine also falls into the LabA-like PIN family. The PIN (PilT N terminus) domain belongs to a large nuclease superfamily. The structural properties of the PIN domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions; in some members, additional metal coordinating residues can be found while some others lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	8.79212e-45
NZ_CP013373.1\|WP_059782548.1\|1236330_1237524_-\|ammonium-transporter	gnl\|CDD\|223083	COG0004, AmtB, Ammonia permease [Inorganic ion transport and metabolism].	1.9106e-101
NZ_CP013373.1\|WP_034206833.1\|1217857_1219693_-\|sensor-domain-containing-phosphodiesterase	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	6.44718e-109
NZ_CP013373.1\|WP_034206849.1\|1238830_1239286_+\|Rrf2-family-transcriptional-regulator	gnl\|CDD\|224870	COG1959, COG1959, Predicted transcriptional regulator [Transcription].	2.81312e-31
NZ_CP013373.1\|WP_034206850.1\|1239490_1240132_+\|NAD(P)H-binding-protein	gnl\|CDD\|225462	COG2910, COG2910, Putative NADH-flavin reductase [General function prediction only].	3.51564e-73
NZ_CP013373.1\|WP_034206844.1\|1231774_1232599_-\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	1.29698e-52
NZ_CP013373.1\|WP_034206834.1\|1220512_1221142_-\|SDR-family-oxidoreductase	gnl\|CDD\|187554	cd05243, SDR_a5, atypical (a) SDRs, subgroup 5. This subgroup contains atypical SDRs, some of which are identified as putative NAD(P)-dependent epimerases, one as a putative NAD-dependent epimerase/dehydratase. Atypical SDRs are distinct from classical SDRs. Members of this subgroup have a glycine-rich NAD(P)-binding motif that is very similar to the extended SDRs, GXXGXXG, and binds NADP. Generally, this subgroup has poor conservation of the active site tetrad; however, individual sequences do contain matches to the YXXXK active site motif, the upstream Ser, and there is a highly conserved Asp in place of the usual active site Asn throughout the subgroup. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	5.90727e-48
NZ_CP013373.1\|WP_059782525.1\|1214021_1215065_+\|succinylglutamate-desuccinylase	gnl\|CDD\|235408	PRK05324, PRK05324, succinylglutamate desuccinylase; Provisional.	0
NZ_CP013373.1\|WP_059782531.1\|1219878_1220427_+\|peroxiredoxin	gnl\|CDD\|239315	cd03017, PRX_BCP, Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides. The protein was named BCP based on its electrophoretic mobility before its function was known. BCP shows substrate selectivity toward fatty acid hydroperoxides rather than hydrogen peroxide or alkyl hydroperoxides. BCP contains the peroxidatic cysteine but appears not to possess a resolving cysteine (some sequences, not all, contain a second cysteine but its role is still unknown). Unlike other PRXs, BCP exists as a monomer. The plant homolog of BCP is PRX Q, which is expressed only in leaves and is cellularly localized in the chloroplasts and the guard cells of stomata. Also included in this subfamily is the fungal nuclear protein, Dot5p (for disrupter of telomere silencing protein 5), which functions as an alkyl-hydroperoxide reductase during post-diauxic growth.	9.78852e-48
NZ_CP013373.1\|WP_006490898.1\|1215418_1216213_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270421	cd13703, PBP2_HisJ_LAO, Substrate binding domain of ABC-type histidine- and lysine/arginine/ornithine transporters; the type 2 periplasmic-binding protein fold. This subgroup includes the periplasmic-binding proteins, HisJ and LAO, that serve as initial receptors in the ABC transport of histidine and lysine-arginine-ornithine amino acids. They are belong to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.43385e-127
NZ_CP013373.1\|WP_059782535.1\|1223041_1223425_-\|VOC-family-protein	gnl\|CDD\|319939	cd08351, ChaP_like, ChaP, an enzyme involved in the biosynthesis of the antitumor agent chartreusin (cha), and similar proteins. ChaP is an enzyme involved in the biosynthesis of the potent antitumor agent chartreusin (cha). Cha is an aromatic polyketide glycoside produced by Streptomyces chartreusis. ChaP may play a role as a meta-cleavage dioxygenase in the oxidative rearrangement of the anthracyclic polyketide. ChaP belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases.	1.3801e-63
NZ_CP013373.1\|WP_059782546.1\|1234173_1236138_-\|DUF839-domain-containing-protein	gnl\|CDD\|225752	COG3211, PhoX, Predicted phosphatase [General function prediction only].	9.62224e-11
NZ_CP013373.1\|WP_059782528.1\|1216303_1217830_-\|HDOD-domain-containing-protein	gnl\|CDD\|370050	pfam08668, HDOD, HDOD domain.	5.83136e-30
NZ_CP013373.1\|WP_034206829.1\|1212673_1214014_+\|N-succinylarginine-dihydrolase	gnl\|CDD\|237332	PRK13281, PRK13281, N-succinylarginine dihydrolase.	0
NZ_CP013373.1\|WP_059782542.1\|1230162_1231527_-\|MdtA/MuxA-family-multidrug-efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|183194	PRK11556, PRK11556, MdtA/MuxA family multidrug efflux RND transporter periplasmic adaptor subunit.	2.57347e-141

>NZ_CP013373.1|WP_059782538.1|1223531_1226840_-|efflux-RND-transporter-permease-subunit
MNLSRPFINRPVATTLLALGVALAGLFAFIKLPVSPLPQVDFPTISVQASLPGASPETVATSVTSPLERHLGSIADVSEMTSTSTVGNARIILQFGLNRDIDGAARDVQAAINAARADLPAALKSNPTYRKVNPADSPIMVVSLTSETASPAKVYDAASTVLQQSLSQIDGIGQVTVSGSANPAVRVELEPQSLFHYGIGLEDVRAALASANANAPKGAIEFGPQRFQLYTNDQASEASQYRDLVVAYRNGSAVRLSDLSDVVDSVEDLRNLGLSNGKRAVLVILYRSPGANIIETLDRVRAALPQLTASLPADITVTPVLDRSTTIRASLKDTEHTLLIAISLVVMVVFLFLRNWRATLIPSVAVPISIIGTFGAMYLLGFSIDNLSLMALIVATGFVVDDAIVVLENIARHIENGKSRMQAALDGAREVGFTVLSMSISLVAVFLPILLMGGIVGRLFREFALTLSLAIAVSLAVSLTVTPMMCARLLPDKRDPRDEGRFGRFLERGFARMQRGYERSLSWALRRPLLILLTLFATIGLNVYLYVVVPKGFFPQQDTGLMIGGIRADQATSFQAMKLKFSEMMRIVQANPNVKSVAGFTGGTQTNSGFMFVTLKDRTERKLSADQVIQQLRPRLADVAGASTFLQAAQDIRVGGRQSNAQYQFTLLGDSSADLYKWGPILTEALQKRPELTDVNSDQQQGGMEAMVTIDRATAARFGIKPAQIDNTLYDAFGQRQVSTIYNPLNQYHVVMEVAPKYWQSPEMLNQVWISTSGGSANGSQTTNAAAGTFVATAAGTSSAGTAAQSAAAIASDSARNQALNAIAASGKSSASSGASVSTSKSTMIPLSAIATFGPSTTPLSVNHQGLFVATTISFNLPPGVSLSQATQVIYQTMAQIGVPPTIVGSFQGTAQAFQQSMNDQPILILAALLAVYIVLGILYESYIHPITILSTLPSAGVGALLALLLFKTEFSIIALIGVILLIGIVKKNAIMMVDFAIDQTRNNRKSSFDAIHEACLLRFRPIMMTTMAALLGALPLAFGSGDGAELRAPLGIAIAGGLIVSQVLTLYTTPVVYLYMDRLRVWAEKRRNRRGNTGGPAVAGE
>NZ_CP013373.1|WP_059782535.1|1223041_1223425_-|VOC-family-protein
MNVQLNHTIVWCRDKHASSRFLTELLELPPPTPFGAMLVVALDNGVSLDFYEQAREIRSQHYAFLIDEAGFDRVLARIRERGLPHWADPAKRQADDIYRHNGGRGVYFDDPDGHFLEVMTRPYVLNG
>NZ_CP013373.1|WP_059782533.1|1221421_1222912_+|NYN-domain-containing-protein
MALPLDNVSMAVFCDFENVALGVRDAKYEKFDIKPVLERLLLKGSIVVKKAYCDWDRYKGFKASMHEASFELIEIPHVRQSGKNSADIRLVVDALDLCYTKSHVDTFVIISGDSDFSPLVSKLRENAKKVIGVGVKKSTSDLLVANCDEFIFYDDLVREQQRALAKREQQQRAGNGGAKRPDEPSRKHDMDARKAEAIALAVETFDALASERDDVGKIWASVLKSAIKRRKPDFNESYYGFRAFGNLLDEAQARGLLEVGRDDKSGAFVSRARQSVAAEPVAAGGEGGAAYHGAQRGTRAAEPAPTDRGARRRGERAEAVVHESVQVDTEDAALAEVADAAPAETRDTSEMAEVADAQGDAKDGRKRARKSAAKKTGTKKGAAAKGAGRHAAGKPDAAAHGDAKQSGDAQAHGQHADEPNRDAAHDERHAAAAPAEPASHASGARSEAVQPSHDVAPVEAAADEAAEASAAAKPKKPARKAAPRARRPRKTTVAAE
>NZ_CP013373.1|WP_034206834.1|1220512_1221142_-|SDR-family-oxidoreductase
MTTKVLLIGATGRTGRACADLLLEQPEFELTALVRRHGYALPGARVVEADLTNDFSHAFQGITHVIYAAGSAESEGATEEEQVDRDAVARAAEYALAYNAQKLVVVSSLSAYRPEQGPDALHHYSQMKREGDDRVIASGVDYVILRPGPLTDDPGVGKIALTDTWLEPAPPVSRQDVAWAAIEAIKLGISRKVVGFVGGSVPIEQALRA
>NZ_CP013373.1|WP_059782531.1|1219878_1220427_+|peroxiredoxin
MKRKLLLGAMAALVAGHALLAQAELKPGAAAPDFTTQASLGGKTYTYSLADALKQGPVVLYFYPAAFTKGCTIEAHAFADAVDRYKAYGATVIGVSADNIDTLTKFSVSECRSKFPVAADPDAKIIREYDAKLPALDRANRVSYVISPEGRILYEYTSLSPDKHVENTLAAVKAWADAHPKQ
>NZ_CP013373.1|WP_034206833.1|1217857_1219693_-|sensor-domain-containing-phosphodiesterase
MEANRKQTSRKGSWRSALHTLRRFARSGGALMPARAVAPRRDDSVRNWLEQTVGTVDFLAHVDRELRFLYVSDASLRFIGYHRDYLHTLTLRDLIAEQDTPALEGLLARAARSGQVEKATMCIVKSLTYPLDVEVRAFKSRHHGVDGFAIAAFDVSSWRALEARLTYEMHHDPMTGLDNLSALVPALMRAQQTADEDGTCAALLLLDLDDYQRINRALGYDAGDMLLRETAQRLKTLVTPNERLARVASDKFAVVLGAPDRTQASQTADALARRLQAAVREPYVYQGQTVHLSASIGIALYPDERAAPHRAQHHSPLLRRADHALAQAKASGGNALAFHAPVDDPADAERLKLEADLYDGVRNGEFSLHFQPITRSQSGAVVGVEALIRWRHPVHGLVPPATFIPLAESIGLINYLGNWVLKAACMQLVAWDGQGLALQYVAVNVSPQQFRDPRFTQSVREAIALTGIDPRRIVLEITESLLMHDPAHAKMLLEELTGLGIRFAIDDFGTGYSSLAYLQRFPLAKLKIDRSFVENLLTSRNDRAIVSAVVGLAQTLDLELVAEGVETEAQRELLTEMGCNHIQGWLVCQALPSEELARRFEAQQLHLHAAA
>NZ_CP013373.1|WP_059782528.1|1216303_1217830_-|HDOD-domain-containing-protein
MSITEHLPRTALLDKLWARMNERGDFPLLSESLRATMAAMKNDDLDFTALVRVVLSDFALTQKVLRLANSAMYMAFGGNITTVTRALMVLGMDAVGHLVVGLKLVDHFHQSTPRRIDAKLELNRALLSGCVARKLTERVELRAGEEAVVCTLMRQVGKLLVVCYLDSEWDRIRRRASELNGDESAACAEVLGVGFDEIGLEAAARWRLPDVIRAGMANDDGHATCADAFDDDGVGCCPAVAADDGPADRGPADRIRWLRAVSRCSTDVAGALALPAGPQRDARVAALALHCSPTLGMEPAALVEIAERLAREEASDTVMREIVELRANADAIARAQAEPEACLEAGLADLRALPSEHVLTPVLALASESLLAGLAFTRTVMFVRHDDGTFAARLGFGPGVDTALDRLRFDERFEPDVFHLAISNSVGIFIEQAQEPKMMKRLPAWYLDAFDDTRAFVLLPVRVGATSVALLYGDWAGVQPARKISQQEMAVLNELARELGRFFPAPPG
>NZ_CP013373.1|WP_006490898.1|1215418_1216213_+|ABC-transporter-substrate-binding-protein
MKLDWRKVAAHAVVAASAVAAGSAFAADLKEIRFGVEASYAPFEYKTPDGKLTGFDIDIGNAVCAKLKTKCVWVENDFDGLIPALQARKFDAINSDMTITDQRKHAIAFTDPIYTIPNQLIAKQGSGLLPTPQSLKGKRVGVLQGTIQEAYAKKKWAPAGVEVVPYQTQDLAYADLKSGRLDATFQDSEAGSKGFLTKPQGQGFAFAGGTVSDTEILGSGVGFGLRKNDAALKTALDQALKELKADGTIDNLAKKYFSVPVTLK
>NZ_CP013373.1|WP_059782525.1|1214021_1215065_+|succinylglutamate-desuccinylase
MPAVALLDDFLAFTLAGEAPADQGGVCAGGAVRWQWLGDGLLAFEPAAAGAAARASVLVSAGVHGDETAPIELLSLLVRDLASGALPLACRLLVVLGNVPAMRAGQRYFDDDLNRLFGGRHAQAPASREAPRAAQLEAAASAFFAAAPAAGARWHIDMHTAIRASVFEQFALLPYTGTPPTRAMVEWLGDARIAAVLLHTAKGNTYSHFTAEHCGALACTLELGKVRPFGQNDLTRFAPADRAVRKLVSAGATDVDAAGGHPSLPRVFTVIDQITKQSDALELFVAADVANFTAFPRGTVLAQDGDYRYTVQHDEERIVFPNPTVKPGLRAGLLVVDTTHDTLAALV
>NZ_CP013373.1|WP_034206829.1|1212673_1214014_+|N-succinylarginine-dihydrolase
MNAQEANFDGLVGPTHNYAGLSFGNVASLNNEKSAANPKAAAKQGLRKMKQLADLGFAQGVLPPQERPSLRLLRELGFSGKDADVIAKAAKQAPELLAAASSASAMWTANAATVSPSADTSDGRVHFTPANLCSKLHRAIEHEATRRTLSTLFADPAHFAVHEALTGTPALGDEGAANHTRFCAEYGKPGIEFFVYGRAEYRRGPEPKRFPARQTFEASRAVAHRHGLAEEATVYAQQDPDVIDAGVFHNDVISVGNRDTLFTHERAFVNKQAIYDTLTAALDARGARLNVIEVPDAAVSVNDAVTSYLFNSQLLSRADGSQVLVVPQECRENARVAAYLDQLAAGNGPIRDVLVFDLRESMKNGGGPACLRLRVVLTEAERAAVTSNVWINDTLFASLDAWIDKHYRDRLAPEDLADPALLAESRTALDELTQILRVGSLYDFQR
>NZ_CP013373.1|WP_059782542.1|1230162_1231527_-|MdtA/MuxA-family-multidrug-efflux-RND-transporter-periplasmic-adaptor-subunit
MDNEQKPTPPSKDPAPTVARRPRRTLLLGTVAVVVIGGLLWWHPWNRTPAAGSTAKSAGASAAAGSHRGRGGPAAMANVPQPVQVATATQGEMPIVLSALGTVTPLANVTVKTQLSGYLQSVSFQEGQIVKKGDVLAQIDPRPYQVALENAEGTHARDAALLATARLDLKRYQTLLAQDSIASQTVDTQASLVKQYEGAVKTDQAAIDSAKLNLTYARITAPVSGRVGLRQVDPGNYVTPGDTNGIVVITQLQPMSVIFTTSEDNLPQILKQVNAGQKLSVTAYNRNNTVPLETGSLATLDNQIDTSTGTVKLRANFDNKEGMLFPNQFVNTRLLVDVIRNATIVPTSAVLTGSIGQFVYVVKPDNTVTVRKVTVGPVDGERTSIVSGVALGERVVTDGSDRLREGAKISIPADKPKGASGARGAGAASGASGAGGHRGGHRHGASQAAAPAAQ
>NZ_CP013373.1|WP_034206844.1|1231774_1232599_-|IclR-family-transcriptional-regulator
MSTTVTSPASRDRESSPDEITALARGLAVLRRIAAADAPVSNRELTELTGIPKPTVSRITATLVSAGFLFQLPDSERFVLTASVLELSHGFLRNFDIRARSRPFMIELAERTSLSVHLAVRDRLDMVAIDVIRPRSAVLVTRLEIGSRMDIARTAVGRAYLAALEDDERRQLLESLRTTAGDDWPHVSARLTPALDEAMRDGHAIAIGEWREGLNAVAAGFVGPSGQRYSVNCGGASHQCPPEWLQEHVVPALHECIAKITREIGGAPARRIGP
>NZ_CP013373.1|WP_059782544.1|1233275_1233653_-|hypothetical-protein
MLSSIAFHRAYLAANFPAWLVHVAMFWVFAEDYVADYVFGSVVGMTCIAMYCHFSTAHQQRIDAIPYYSRALLVSASAISIGTCSIGLISKLNGGAATFSFALPIMLGRVGYDYLRKIRFKNPHR
>NZ_CP013373.1|WP_159086694.1|1233767_1234103_+|hypothetical-protein
MSDAHSSGGAEAVLTVQSPNGCWNEAFASRKGTEESGGKLRLTEREGALRVARRYGRLCDLVRIAVAAHGGRPGFEQACRSSSGAGAHRSEKKSAMPAMGIARETAWSADE
>NZ_CP013373.1|WP_059782546.1|1234173_1236138_-|DUF839-domain-containing-protein
MPALPNASRRQALKILAGAPMLPLSGLALPALLTGCGGDDDPASTPAPVAAAYTSAAFSTMAAPTLDNAAAMATTTVGSTLSVSFSDGSSRNFKLAYRPFFVTGDMVPDGNGGTTLAGGYYDINNQPIIDRSVAGKERQFYSDCPDGSSLLTLKNANVPGVKGNTVFAVVQFEYTTRDQASASQYGQLPSPIAVLTLDQDPATGALKVVKYHNVDTSKAHGLWITCGASLSPWGTHLSSEEYEPDATKAATDAQFKAFSKNTFGDETKANPYHYGHLPEITVNPDGTGTVKKHYCLGRISHELIQVMPDQRTVMMGDDATNGGLFMFVADKAADLSAGTLYVAKWTQTSSAGAGTATLTWIKIGHATSSEIETLANTLKASDIMDLATADPNDASYTKIHFGGKFNWMRVKPGMEKAAAFLETHRYAALLGGSMAFTKLEGTTVNAKDKIVYTAMSRIETSMVKGNAVSRDVAVDKKIAAGAVYALNLKAGQRDTTGGAIDSEWVPVDMGAPAALVGEDLAAADALGNLANPDKIANPDNLKFSEKLRTLFIGEDSGMHVNNFLWAYNVDTKSLARVLSCPAGAESTGLHAVDEINGWTYIMSNFQHAGDWESPLHDKVKPTLDPLVRANYKDRFGASVGYLTAEQTSIKLAKG
>NZ_CP013373.1|WP_059782548.1|1236330_1237524_-|ammonium-transporter
MDGLKSGVDTLFLLIGAVMVLAMHAGFAFLELGTVRKKNQVNALVKILVDFSVSTLAYFFIGYTIAYGVEFFDDIGTLSQHNGYALVRFFFLLTFAAAIPAIVSGGIAERAKFNPQLVATLIIVGFIYPFFEGIAWNERFGVQAWLTHAFGAPFHDFAGSVVVHAFGGWVALPAVLLLGARHGRYAKDGRIAAHPPSNIPFLALGAWVLAVGWFGFNVMSAQTLDKISGLVAVNSLMAMVGGTLAAWMAGRNDPGFTYNGPLAGLVAVCAGSDVMHPIGALVTGAAAGALFVAMFTCVQNRWRIDDVLGVWPLHGMCGALGGLAAGVFGLPALGGLGGVSFLSQLVGTLGGIALATAGGTLVYGALKATVGLRLDREAEFDGADLSIHRISATPERD
>NZ_CP013373.1|WP_059782550.1|1237778_1238114_-|hypothetical-protein
MAFLVDWLIALAALLAGTLFMCLRAPSARRLAESGRPRRIACARLLAQAVIGFWTAALIVAQGILGADGDGQSVAGFAALAFAALGLATVAAYWSACALRLRRPPALFARH
>NZ_CP013373.1|WP_059782754.1|1238311_1238740_+|hypothetical-protein
MNMKTSRARRVPGSVLAAVTAGALLLLAGCEKSGTPAAQPDTAASAAADAANNAAKALDQVASTVNQQINAAKAGIASAASAVPPLSASGLASAAQAQIDAAASAVVAHAASEAGAKIAEAGKKLQQWSQQNAAGAKPASGE
>NZ_CP013373.1|WP_034206849.1|1238830_1239286_+|Rrf2-family-transcriptional-regulator
MNTSSRFAFAVHVLALLSMQEGVPLSSDIIAGSVNTNPALIRRLLSMLAAAGLTTSQLGAGGGALLAREPGEITLLDVYRAVDDAQLFALHREAPNPACLVGRHIQGVLTGYIGDAQRAMEASLATRTLVDVTADMLDLEQRTQRAARAGG
>NZ_CP013373.1|WP_034206850.1|1239490_1240132_+|NAD(P)H-binding-protein
MTQRSLNIALFGATGMIGSRIAAEAVRRGHRVTALSRHPGASGDGITAKAADLFDAASIAAALPGHDVVASAYGPKQEDAAQVVAVAKALVAGTRQAGLKRLVVVGGAGSLEVAPGKQLVDTEGFPDAYKPQALAHRDALGYLKTVADLDWTFFAPAALIAPGERTGTFRTGIGKLIVDAQGNSKISAEDYAVAFVDALEQDSFVREIATVAY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

410074 : 428921

Pseudomonas_phage(50.0%)

protease,integrase,plate

attL 410646:410684|attR 415212:415250

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027809263.1\|410074_410596_+\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	9.6e-21	52.0
410646:410684	attL	NA	NA	NA	NA
WP_043887533.1\|410808_411453_-	hypothetical protein	NA	NA	NA	NA
WP_155646976.1\|411449_411866_-	hypothetical protein	NA	NA	NA	NA
WP_059780298.1\|411871_412954_-	hypothetical protein	NA	NA	NA	NA
WP_082725024.1\|413166_413562_-\|integrase	tyrosine-type recombinase/integrase	C8CLF4	Xylella_phage	1.7e-25	61.6
WP_159086676.1\|414151_414964_+	hypothetical protein	NA	NA	NA	NA
WP_027783368.1\|415929_416133_+	hypothetical protein	NA	NA	NA	NA
415212:415250	attR	NA	NA	NA	NA
WP_011546588.1\|416192_416993_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_059780297.1\|417227_417608_+	hypothetical protein	NA	NA	NA	NA
WP_059780296.1\|417713_418031_+	hypothetical protein	NA	NA	NA	NA
WP_159086677.1\|418045_418450_+	histidine kinase	NA	NA	NA	NA
WP_059780294.1\|418478_418814_+	hypothetical protein	NA	NA	NA	NA
WP_034209792.1\|418928_419711_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_034209793.1\|419707_421054_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_034209794.1\|421156_421768_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_059780293.1\|422142_422769_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_059780292.1\|422815_423331_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_034209797.1\|423346_424837_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_059780291.1\|424907_425411_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_034209799.1\|425459_425945_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_059780290.1\|426021_427857_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_059780289.1\|427820_428921_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA

DBSCAN-SWA_2

727388 : 736454

Hokovirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034206477.1\|727388_729341_+	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	1.9e-146	50.3
WP_034206478.1\|729594_730731_+	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	8.5e-22	26.9
WP_059779266.1\|730735_732643_+	bifunctional anthranilate synthase component I family protein/class IV aminotransferase	S4VNU7	Pandoravirus	1.2e-55	37.9
WP_034206480.1\|732786_733602_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	6.7e-37	33.3
WP_059501043.1\|733645_734332_-	deoxynucleoside kinase	A0A0M3UL55	Enterococcus_phage	5.5e-08	26.4
WP_059779268.1\|734328_734871_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_059779271.1\|734906_736454_-	polynucleotide adenylyltransferase PcnB	A0A172Q0J1	Acinetobacter_phage	1.1e-16	30.3

DBSCAN-SWA_3

1077358 : 1085641

Bacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059779702.1\|1077358_1078759_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	7.2e-79	38.8
WP_052100257.1\|1078766_1079717_+	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	1.5e-16	28.1
WP_006496538.1\|1079780_1080773_+	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	4.1e-28	31.2
WP_059779708.1\|1080847_1081189_+	helix-hairpin-helix domain-containing protein	NA	NA	NA	NA
WP_034206721.1\|1081402_1082305_+	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	2.4e-51	39.5
WP_082725001.1\|1082379_1083723_-	lytic murein transglycosylase B	NA	NA	NA	NA
WP_034206723.1\|1083766_1084690_+	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	3.3e-40	34.3
WP_059779813.1\|1084720_1085641_-	alpha/beta hydrolase	Q6TUZ7	Yaba_monkey_tumor_virus	2.5e-16	27.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP013372

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013372_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013372_1

1235879-1235950

Orphan

Consensus_repeat	Method
CTAAAGCGCTAACTCCGGTCGAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013372_1

>merge|NZ_CP013372|1|1235879-1235950|CRISPRCasFinder
CTAAAGCGCTAACTCCGGTCGACCGCGAAGCATGGGACCGGAGTAACCGCTAAAGCGCTAACTCCGGTCGAC

>NZ_CP013372|1|1|1235879-1235950|CRISPRCasFinder
CTAAAGCGCTAACTCCGGTCGAC	CGCGAAGCATGGGACCGGAGTAACCG
CTAAAGCGCTAACTCCGGTCGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013372.1\|WP_034204955.1\|1236858_1237251_+\|5-carboxymethyl-2-hydroxymuconate-Delta-isomerase	unknown	unknown	gnl\|CDD\|376972
NZ_CP013372.1\|WP_034204958.1\|1233549_1234314_+\|fumarylacetoacetate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|131356
NZ_CP013372.1\|WP_034204951.1\|1239856_1240108_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013372.1\|WP_059783676.1\|1238087_1238894_+\|4-hydroxy-2-oxoheptanedioate-aldolase	unknown	unknown	gnl\|CDD\|131364
NZ_CP013372.1\|WP_034204963.1\|1227688_1229584_-\|penicillin-binding-protein-2	unknown	unknown	gnl\|CDD\|223839
NZ_CP013372.1\|WP_059783680.1\|1234336_1235800_+\|5-carboxymethyl-2-hydroxymuconate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143412
NZ_CP013372.1\|WP_059783686.1\|1231003_1232215_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|369640
NZ_CP013372.1\|WP_059783684.1\|1232270_1232711_-\|homoprotocatechuate-degradation-operon-regulator-HpaR	unknown	unknown	gnl\|CDD\|188209
NZ_CP013372.1\|WP_059783674.1\|1238969_1239761_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380379
NZ_CP013372.1\|WP_059783689.1\|1222459_1223887_+\|cytochrome-c	unknown	unknown	gnl\|CDD\|365823
NZ_CP013372.1\|WP_059783668.1\|1243548_1245321_-\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224099
NZ_CP013372.1\|WP_059783670.1\|1241238_1242330_-\|porin	unknown	unknown	gnl\|CDD\|238208
NZ_CP013372.1\|WP_034204956.1\|1235965_1236814_+\|3,4-dihydroxyphenylacetate-2,3-dioxygenase	unknown	unknown	gnl\|CDD\|131351
NZ_CP013372.1\|WP_059783682.1\|1232863_1233553_+\|fumarylacetoacetate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|131358
NZ_CP013372.1\|WP_159086633.1\|1226384_1227470_+\|fimbrial-protein	unknown	unknown	gnl\|CDD\|226069
NZ_CP013372.1\|WP_059783678.1\|1237271_1238075_+\|2-oxo-hepta-3-ene-1,7-dioic-acid-hydratase	unknown	unknown	gnl\|CDD\|131365
NZ_CP013372.1\|WP_034204962.1\|1230005_1230353_-\|DUF3564-domain-containing-protein	unknown	unknown	gnl\|CDD\|378807
NZ_CP013372.1\|WP_059783688.1\|1224086_1225802_+\|cation:proton-antiporter	unknown	unknown	gnl\|CDD\|182633
NZ_CP013372.1\|WP_059783672.1\|1240139_1241102_+\|zinc-binding-alcohol-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|223677
NZ_CP013372.1\|WP_034204948.1\|1242488_1243556_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226361

Protein	Function_ID	Function_description	E-value
NZ_CP013372.1\|WP_034204955.1\|1236858_1237251_+\|5-carboxymethyl-2-hydroxymuconate-Delta-isomerase	gnl\|CDD\|376972	pfam02962, CHMI, 5-carboxymethyl-2-hydroxymuconate isomerase.	2.32301e-75
NZ_CP013372.1\|WP_034204958.1\|1233549_1234314_+\|fumarylacetoacetate-hydrolase-family-protein	gnl\|CDD\|131356	TIGR02303, decarboxylase_divided_with_OB2865, 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase, C-terminal subunit. This model represents one of two subunits/domains of the bifunctional isomerase/decarboxylase involved in 4-hydroxyphenylacetate degradation. In E. coli and some other species this enzyme is encoded by a single polypeptide containing both this domain and the closely related N-terminal domain (TIGR02305). In other species such as Pasteurella multocida these domains are found as two separate proteins (usually as tandem genes). Together, these domains carry out the decarboxylation of 5-oxopent-3-ene-1,2,5-tricarboxylic acid (OPET) to 2-hydroxy-2,4-diene-1,7-dioate (HHDD) and the subsequent isomerization to 2-oxohept-3-ene-1,7-dioate (OHED).	1.60348e-132
NZ_CP013372.1\|WP_059783676.1\|1238087_1238894_+\|4-hydroxy-2-oxoheptanedioate-aldolase	gnl\|CDD\|131364	TIGR02311, 24-dihydroxyhept-2-ene-17-dioic_acid_aldolase, 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase. This model represents the aldolase which performs the final step unique to the 4-hydroxyphenylacetic acid catabolism pathway in which 2,4-dihydroxyhept-2-ene-1,7-dioic acid is split into pyruvate and succinate-semialdehyde. The gene for enzyme is generally found adjacent to other genes for this pathway organized into an operon.	1.45106e-140
NZ_CP013372.1\|WP_034204963.1\|1227688_1229584_-\|penicillin-binding-protein-2	gnl\|CDD\|223839	COG0768, FtsI, Cell division protein FtsI/penicillin-binding protein 2 [Cell envelope biogenesis, outer membrane].	1.2955e-159
NZ_CP013372.1\|WP_059783680.1\|1234336_1235800_+\|5-carboxymethyl-2-hydroxymuconate-semialdehyde-dehydrogenase	gnl\|CDD\|143412	cd07093, ALDH_F8_HMSADH, Human aldehyde dehydrogenase family 8 member A1-like. In humans, the aldehyde dehydrogenase family 8 member A1 (ALDH8A1) protein functions to convert 9-cis-retinal to 9-cis-retinoic acid and has a preference for NAD+. Also included in this CD is the 2-hydroxymuconic semialdehyde dehydrogenase (HMSADH) which catalyzes the conversion of 2-hydroxymuconic semialdehyde to 4-oxalocrotonate, a step in the meta cleavage pathway of aromatic hydrocarbons in bacteria. Such HMSADHs seen here are: XylG of the TOL plasmid pWW0 of Pseudomonas putida, TomC of Burkholderia cepacia G4, and AphC of Comamonas testosterone.	0
NZ_CP013372.1\|WP_059783686.1\|1231003_1232215_+\|SDR-family-oxidoreductase	gnl\|CDD\|369640	pfam07993, NAD_binding_4, Male sterility protein. This family represents the C-terminal region of the male sterility protein in a number of arabidopsis and drosophila. A sequence-related jojoba acyl CoA reductase is also included.	9.77854e-26
NZ_CP013372.1\|WP_059783684.1\|1232270_1232711_-\|homoprotocatechuate-degradation-operon-regulator-HpaR	gnl\|CDD\|188209	TIGR02337, Homoprotocatechuate_degradative_operon_repressor., homoprotocatechuate degradation operon regulator, HpaR. This Helix-Turn-Helix transcriptional regulator is a member of the MarR family (pfam01047) and is found in association with operons for the degradation of 4-hydroxyphenylacetic acid via homoprotocatechuate.	1.93827e-44
NZ_CP013372.1\|WP_059783674.1\|1238969_1239761_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|380379	cd06124, cupin_NimR-like_N, AraC/XylS family transcriptional regulators similar to NimR, N-terminal cupin domain. This family contains mostly bacterial proteins containing an AraC/XylS family helix-turn-helix (HTH) DNA-binding domain C-terminal to a cupin domain, and may be possible transcriptional regulators. Included in this family is Escherichia coli HTH-type transcriptional regulator NimR (also called YeaM) that negatively regulates expression of the nimT operon and its own expression. Proteins in this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	7.02718e-29
NZ_CP013372.1\|WP_059783689.1\|1222459_1223887_+\|cytochrome-c	gnl\|CDD\|365823	pfam00034, Cytochrom_C, Cytochrome c. The Pfam entry does not include all Prosite members. The cytochrome 556 and cytochrome c' families are not included. All these are now in a new clan together. The C-terminus of DUF989, pfam06181, has now been merged into this family.	6.56237e-11
NZ_CP013372.1\|WP_059783668.1\|1243548_1245321_-\|iron-ABC-transporter-permease	gnl\|CDD\|224099	COG1178, ThiP, ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism].	1.6838e-96
NZ_CP013372.1\|WP_059783670.1\|1241238_1242330_-\|porin	gnl\|CDD\|238208	cd00342, gram_neg_porins, Porins form aqueous channels for the diffusion of small hydrophillic molecules across the outer membrane. Individual 16-strand anti-parallel beta-barrels form a central pore, and trimerizes thru mainly hydrophobic interactions at the interface. Trimers are stabilized by hytrophillic clamping of Loop L2. Loop 3 bends into the pore, creating an elliptical constriction of about 7 x 11A, large enough to allow passage of a glucose molecule without steric hindrance. Removal of the C-terminal residue (usuallly F) destabilizes the trimer and removal of the 16th beta-sheet abolishes trimerization. Unlike typical membrane proteins, porins lack long hydrophobic stretches. Short turns are found at the smooth, periplasmic end, longer irregular loops are found at the rough, extracellular end. C-terminal residue forms salt bridge with N-terminus.	2.66271e-88
NZ_CP013372.1\|WP_034204956.1\|1235965_1236814_+\|3,4-dihydroxyphenylacetate-2,3-dioxygenase	gnl\|CDD\|131351	TIGR02298, putative_34-dihydroxyphenylacetate_23-dioxygenase, 3,4-dihydroxyphenylacetate 2,3-dioxygenase. This enzyme catalyzes the ring-opening step in the degradation of 4-hydroxyphenylacetate.	2.41603e-172
NZ_CP013372.1\|WP_059783682.1\|1232863_1233553_+\|fumarylacetoacetate-hydrolase-family-protein	gnl\|CDD\|131358	TIGR02305, HpaG-N-term, 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase, N-terminal subunit. This model represents one of two subunits/domains of the bifunctional isomerase/decarboxylase involved in 4-hydroxyphenylacetate degradation. In E. coli and some other species this enzyme is encoded by a single polypeptide containing both this domain and the closely related C-terminal domain (TIGR02303). In other species such as Pasteurella multocida these domains are found as two separate proteins (usually as tandem genes). Together, these domains carry out the decarboxylation of 5-oxopent-3-ene-1,2,5-tricarboxylic acid (OPET) to 2-hydroxy-2,4-diene-1,7-dioate (HHDD) and the subsequent isomerization to 2-oxohept-3-ene-1,7-dioate (OHED).	3.0313e-75
NZ_CP013372.1\|WP_159086633.1\|1226384_1227470_+\|fimbrial-protein	gnl\|CDD\|226069	COG3539, FimA, P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion].	4.53463e-16
NZ_CP013372.1\|WP_059783678.1\|1237271_1238075_+\|2-oxo-hepta-3-ene-1,7-dioic-acid-hydratase	gnl\|CDD\|131365	TIGR02312, 2-keto-4-pentenoate_hydratase, 2-oxo-hepta-3-ene-1,7-dioic acid hydratase. This model represents the enzyme which hydrates the double bond of 2-oxo-hepta-3-ene-1,7-dioic acid to form 4-hydroxy-2-oxo-heptane-1,7-dioic acid in the catabolism of 4-hydroxyphenylacetic acid. The gene for this enzyme is generally found adjacent to other genes of this pathway in an apparent operon.	1.10764e-168
NZ_CP013372.1\|WP_034204962.1\|1230005_1230353_-\|DUF3564-domain-containing-protein	gnl\|CDD\|378807	pfam12087, DUF3564, Protein of unknown function (DUF3564). This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 118 to 142 amino acids in length. This protein has a conserved WSRE sequence motif.	1.35529e-52
NZ_CP013372.1\|WP_059783688.1\|1224086_1225802_+\|cation:proton-antiporter	gnl\|CDD\|182633	PRK10669, PRK10669, putative cation:proton antiport protein; Provisional.	0
NZ_CP013372.1\|WP_059783672.1\|1240139_1241102_+\|zinc-binding-alcohol-dehydrogenase-family-protein	gnl\|CDD\|223677	COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only].	7.93527e-32
NZ_CP013372.1\|WP_034204948.1\|1242488_1243556_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226361	COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism].	2.48369e-134

>NZ_CP013372.1|WP_059783680.1|1234336_1235800_+|5-carboxymethyl-2-hydroxymuconate-semialdehyde-dehydrogenase
MTIKHWIDGREVESRETFTTLNPATGDVITDVASGGEAEVDAAVRAAKEAFPKWANTPAKERAKLMRKLGELIERNVPMLAALETQDTGLPIAQTSKQLIPRASENFNFFAEVCVQMNGRTYPVDDQMLNYTLYQPVGVCALVSPWNVPFMTATWKTAPCLALGNTAVLKMSELSPLTADQLGRLALEAGIPPGVLNVVQGYGATAGDALVRHPDVRAVSFTGGTVTGKRIMERAGLKKYSMELGGKSPVLIFDDADFDRALDASLFTIFSINGERCTAGSRIFVQRTIYDRFVQEFARRANNLVVGDPADPGTHLGAMITRQHWEKVTGYIRIGEQEGARVVAGGADKPAGLPDRLRNGNFVRPTVFADVDNRMRIAQEEIFGPVACIIPFENEEEGLRLANDTAYGLASYIWTQDVGKVHRLARGIEAGMVFVNSQNVRDLRQPFGGVKESGTGREGGEYSFEVFAEIKNVCISMGSHHIPRWGV
>NZ_CP013372.1|WP_034204958.1|1233549_1234314_+|fumarylacetoacetate-hydrolase-family-protein
MKTARVIYNGALHAAEPAGDGAIRLDTGRVLAEDAVAWLPPVAPRTTFALGLNYADHAKELAFNAPSEPLIFLKGPNTFVGHRSRTVRPADATHMHYECELAVVIGRPARRVSRAQAIDYVAGYTVANDYAIRDYLENYYRPNLRVKNRDTCTPLGPWFVSRDEIGDAGDLTLRTTVNGRQTQRGSTRDMVFDVPALIEHISSFMTLAPGDLILTGTPEGLADTQPGDEVVTEIEGIGRLVNTIVAEADYYRAG
>NZ_CP013372.1|WP_059783682.1|1232863_1233553_+|fumarylacetoacetate-hydrolase-family-protein
MELSCTTAAAPPLPVAIGTVYGALLNERAALAALGDAVNAPPYGRPPQAPILYIKSANTHVADGAAVVVPAGVDALEIGASVAVVFARRATRVAAAQALDYVHGFTLASDVSVPHPDYYRPAVRFRCRDGFCPLGPAIVPAAALADVDEIGLTVRIDGEVAASASTATLIRPVRELIADVTAFMSFDAGDVLLLGVAGGAPRARAGSTIEIAAAGIGALRHTLIAEEAR
>NZ_CP013372.1|WP_059783684.1|1232270_1232711_-|homoprotocatechuate-degradation-operon-regulator-HpaR
MNRTLDHRNLAMLLLEARETLMGLFRPILKEFSLTEQQWRIIRVLDGEPAQALEAGQIAKRCCILSPSLTGVLERMERDGLITRTRAQEDQRRLLVSLTPQSRKLVTEIGPRIDEQYRQLESRFGEDGLDDIYRALDRLIELGSHA
>NZ_CP013372.1|WP_059783686.1|1231003_1232215_+|SDR-family-oxidoreductase
MLIWKTALSLNWRTSLVSPASAPVAAANVGRLVLTGATGFIGSTVLTALVNAGLLERIVCVVRAQDRGHAVARLREAALRAGLAPYWASRLTDANVIVGALADVWHGADAPRLAGATHVIHCAGHASPADGAHLRADIADAVCFAERFARSPHLQRFVYVGTAYAHAGRGGIVQEEAERDAGNDAAPGDEGLPGAVLAAGYLHAKAETEQRLRALGLPLVVVRPSHVVGHTVLGTRPAPNSFWMFRLAHAARRFTARPMTRIDIVSVDDVARATMLLAVKPTLAHDVYHVSAGDEAPQVAQIVRAMDEAAGMTGAPRYAACAPADLPLVVRDVLGRRDPALERVIGRALQRCGEFATVDRVFDNRRVRDEIDFEPLPFIDYVEECMRTSRGVAVTELMRGAIH
>NZ_CP013372.1|WP_034204962.1|1230005_1230353_-|DUF3564-domain-containing-protein
MRLTIRINGSESATRQSFAVLWVDTDEGLWSREAHQGIDLPTWGKVRDVEGAMALCAADGSHAVCQLKGLSFDATRREQGPAVLAGEHPDGAWRLQAVDTCTTPPEYREFISVAR
>NZ_CP013372.1|WP_034204963.1|1227688_1229584_-|penicillin-binding-protein-2
MSVKKKTHPADPYAAATKNPMLASRLPMWRSRLIVVVVFLAFAALIARAFWVQVANQDFYVGQGQKRYQRTIELDAMRGPIVDRNGAMLAVSLATYEIWANPKQVADTDYPQIAKLLDMPLVEVKRRLGNDKTFVLLKRQVDADTASRLDKLAIDGITQIADSKRFYPEGESAAHVVGFTNVEDSGQEGVELAANARLQGTSGQREVIRDRLGRIVSDTRPLVPAQHGATIELTIDRRIQQLAFSQLKAAVIENNAVAGSVVVLDAQNGEILALANYPTFDPNDRARLTGQQLRNRAVIDTFEPGSTIKPLVVALSIDERKVTPNTIINTSPGTYKIGPAVIHDTSNHGSLTVAQALQKSSNVALAKLALNLPAETIWNKYQEYGIGRAPELTFPGVASGRLRGYKRWRPIEQATMAYGYGLSMSLLQIAQTYTAYAGDGTLHPVSLLKNGTDQQTIDAHRGHRVTSPQTAAAIRSMLEMAVGEGGTGRRARVDGYRIGGKTGTARKQVGATYAKGKYRALFAGMAPMSDPRLIVAVMIDEPRGKGYYGGTVAGPVFASVTSGSLQLLGVPPDAPVEAEKPQPDKAITPPKKVAASTAVAQPKTASARKAAVPVETAAQSDTTVPTKVPAS
>NZ_CP013372.1|WP_159086633.1|1226384_1227470_+|fimbrial-protein
MIQISRNLLKTACRAASVVLSGLLLTVALPVQGQTVMKCQSVPPSEGPGIHHYVDINFPASIRVAPGTPNGAVIATVTAEFPYACPANPNSPPGYDYWFIFPGQSWLTTNYPNVGKLTTLQNYREFETFGFRVTNLDTGRVMAVHHSLQEWAPSHTNAEPLSKVLRLKIEMIKLNDNIYNFAKIRNPNAAVGIEVRNRGKAARAITVDFKFFKSGGSLVVTPNSCTVTTPNVNVTLPPVSAGKLNQAGATAGDTGFNIGLSCQSGSNVYVTLTDLTDPSNTSTNLSLVPGSTASDVKLRILRNGNPVGFGPDSADPGNPNQWLVGPSSSTSSIPLSAQYVSTGRVTPGTVKGAATFTLSYQ
>NZ_CP013372.1|WP_059783688.1|1224086_1225802_+|cation:proton-antiporter
MPHDVSLIALLAAGFGLAMIFGYLASLLKMPPLVGYLLAGIVIGPGTPGFVGDLSLAQQLAEVGVMLLMFGVGLHFSLGDLLAVRKIALPGAIVQITVATLLGGGLALTWGWSLGAALVFGLALSVASTVVLLRALEGRGLVETVNGRIAVGWLVVEDLVMVLVLVLLPPVAGLLGGTPPGDAHAAGGSVWGTLGVTMLKVAAFIALMLVVGKRVFPRILWLVARTGSRELFTLCMIAAAVGIAFGAAKLFDVSFALGAFFAGMMMRESEFSRRAADETLPLRDAFSVLFFISVGMLFDPKVLLDEPLHVIEVAAIVLIGKTLAAVALVIAFRYPLNTALTVGAGLAQIGEFSFILAGLGRALGLLSAEGQSLILAVALISIAMNTLLFALIDPALAWIRKHSAFARKLEARDDPLAALPMSTPQTHLTGQVVIVGYGKVGTRIAHALDERGIAYVVVEQNRELVEKLRADGIAAVSGDAIEPIVLVQAHIARAGMLVVTLPDVFDVRQIVEISRTLNPTLEVVLCTNSGDEAALLSSEGVGTVFMGESELARAMTAHVLGRMTRPAAASH
>NZ_CP013372.1|WP_059783689.1|1222459_1223887_+|cytochrome-c
MKRTMNHHNAARSVSPLRRALAIGTAWAAFGLSGGAAFAQPASAPAAASGPAAAPAALSADAALVKRGEYLARAGDCIACHTASGGKPFAGGLKFDTPIGGIYSTNITPDPKTGLGGWTYEDFTRAVREGVRKNGDTMYPAMPFPSYSRLTDDDMKALYAYFMHGVAPVEHENRAVDIVWPLSMRWPLGIWRKMFAPSPKPFDAAPYTDPVVARGAYLVQGLGHCGACHTPRAPTMQERGLTDADGPDFLAGGAAIDGWVPTSLRGEPRTGLGTWNEAEIVQFLKTGRTLRTAAFGGMTDVVGHSMQHMTDDDLNAIARYLKTLPPRVQGEQPHVYDAAAAKALQTGDASKPGAAVYRDNCMACHRSDGHGYTRVFPALAGNPVVQGDDPTSLIHVVLEGSALQGTRTAPSTFTMPPFGWRLSDQEVADVSNFVRTSWGNTGAPVTAAQVAKVRKSVPSTRPEPPPGARFPQASR
>NZ_CP013372.1|WP_034204956.1|1235965_1236814_+|3,4-dihydroxyphenylacetate-2,3-dioxygenase
MGKLSLAAKITHVPSMYLSELPGRHHGCRDAAIRGHQLIGERCRALGVDTIVVSDVHWLVNAGYHVNCNARFAGTYTSNELPHFIRDMQYAYPGNPALGRLIAETATARGVATRAHEIDSLELEYGTLVPMRYMNGDQHFKVVSIAGWCMWHTLDESRRFGEALLEAIEKSDSNVAFLASGSLSHRFNDNGSPEESIHEISREFFRQVDLRVVELWKQGDFKTFCAMLPEYNVHCHGEGGMHDTAMLLGLLGWDRYDRPVEIVTDYFASSGTGQINAIFPLP
>NZ_CP013372.1|WP_034204955.1|1236858_1237251_+|5-carboxymethyl-2-hydroxymuconate-Delta-isomerase
MPHIVVEYTANIRDDARIPVLLHTINATLIAQGGVFPTGGIRSRAIELRDYCVADGTEDDAFVHVTLKIGSGRTDAQKKAACDALFDAIKVHFAELYATRYLALSMELTEFSESGSYKHNNIHARYKRAG
>NZ_CP013372.1|WP_059783678.1|1237271_1238075_+|2-oxo-hepta-3-ene-1,7-dioic-acid-hydratase
MLEPAIIDQLAHRLHDAERARAQIRQISLDHPDITIDDAYAIQRAWVALKLAEGRTLKGHKIGLTSKAMQNTSQIDEPDYGALLDDMFFEDGGTIPTSRFIVPRVEVELAFVLGKRLAGPNCTIFDVYDAVDYVVPALEIIDARSQSIDPDTKRPRKVFDTIADNAANAGVVIGGRPVRPQDVDLRWVAAIMSRNGVVEETGVAAGVLNHPANGVAWLANRLSRFDVALEPGQIVLGGSFTRPCAARSGDTFSVDYGPLGTIQCYFE
>NZ_CP013372.1|WP_059783676.1|1238087_1238894_+|4-hydroxy-2-oxoheptanedioate-aldolase
MQISSNVFKAALAHGDAQIGLWLGLANPYSAEVVAGAGFDWLLIDGEHAPNTVPTILAQLQAIAPYPSHPVVRVPWNDPVIVKQVLDLGAQTLLVPMVQSADEARAAVAATRYPPHGIRGVGSALARASRWNRVGEYLHRANDEMAVLVQVETRAGLDAIDAIARVDGVDGVFIGPADLAADLGHLGDPGHPDVQAAIDGAIRAIQAAGKAAGILSADEAAARRYLEAGALFVAVGVDTTLLARSAERLAAQFKRAGGDAAKQGDGTY
>NZ_CP013372.1|WP_059783674.1|1238969_1239761_-|helix-turn-helix-transcriptional-regulator
MSDPLLPARFVTSDDGPFVVAAILSQRDPRITASHSHARGQLVGALSGLVTIGLDDQEWVVPAIHAIWIPPHYRHSLRSFGPIAGWSAFVAEARCAALPATPRAIRTTPLLREAVQRAASWGDAELDAAQARIADVILDEIAASEAEALGLVRPRDPRLVKITDALAADLANDRRLEEWAEWAGIGARTMSRRFVAETGLTFAQWRQQARLLRALERIADGVPVTTIALDLGYDNVSAFIDMFRRALGTTPGRYMEAGRGTKG
>NZ_CP013372.1|WP_034204951.1|1239856_1240108_+|hypothetical-protein
MRAEQMLPDHADRVDAGGTTIRKGTVGAFLVNARVLTDPNAAPAERARAEADAIDALPALRALGLFDVLEVRDPALRAWLDAR
>NZ_CP013372.1|WP_059783672.1|1240139_1241102_+|zinc-binding-alcohol-dehydrogenase-family-protein
MKAAVVTGAGARPVHMEFDAPPAMPGHRLIDVTASALSRLAQGRAAGTHYSSDRRYPFVVGVDGVGRLDDGRRVYFFGAPAPFGAMAERTIVPDPQCVPLPDALDDVTAAAIAIPGMSSWAALTERARLVAGETVLVNGATGTSGRLAVRIAKHLGAAKVVATGRNAAALQALLNAGADAVVSLQQDDAHLVRALEPHFRAGVDVVLDYLWGASARTLLVAGAKATPDGRRLRFVQIGSIGGADVLVPGAVLRATAIELMGSGIGSVSLPRLLASVRGVFEAAGPAGLTIDTREVPLSAVGEHWGDTSSVVRPVFTMRGD
>NZ_CP013372.1|WP_059783670.1|1241238_1242330_-|porin
MKSRAERSIRTVVLISSAAVACIAVPAAHAQSSVTMYGIMDAGIEFTNHAAPEGGNSVKLKSGNKNTSRWGLRGVEDLGGGLKAVFRLESGIDLANGAFDDGPDSIFARRATVGLKSKWGELTLGRNYTVTYDYMLPFDPMGYAQNYSWASSSMATGGRKDGMFTRSSNAVRYDGEFGGFKFGALYGFGNVPGSMKTSSKYDFAVGYEKGPFAAVVTFDRQNGAADSVTPADTVDYIQGIHAGLSYDFGNLKTMAGYRNYKRTFRTTAANQLSDMVWLGGSYQFTPAFSLIAAVYHQNIKGGSDADPTLVSMRANYALSKRTVLYAAGAFAIAKHDQKVGVSRDFAGYGTTQVGVTAGIQQRF
>NZ_CP013372.1|WP_034204948.1|1242488_1243556_-|ABC-transporter-ATP-binding-protein
MDKLIVDDLHLSYGANPILKGVSFELKAGEVVCLLGASGSGKTTLLRAVAGLEQPSDGRIQLDDRVFFDGAQRVDLPVEQRSLGLVFQSYALWPHRTVADNVGYGLKLRRVAPAEQKRRVQTALDQLGLGHLAERFPHQLSGGQQQRVAIARALVYNPPVILLDEPLSNLDAKLREEARAWLRELIVSLGLSALCVTHDQTEAMAMSDRILLLRNGRIEQEGTPAELYGAPRSLYTAEFMGSNNRIDARVAAIDGECVTLAGDGWELRAVARDTLAPGQDAQAVIRLERVQVADGPGANRLQADLVTSMYLGDRWEYLFHCGDMRLRAFGHVPRAAGKHWIEFPTNDCWAFAKAG
>NZ_CP013372.1|WP_059783668.1|1243548_1245321_-|iron-ABC-transporter-permease
MLSTSTRGTAPAVPPATGPRDMIPALPVSSLQPLAGMLRWIVVAVLTVAVALPLGFILFQSLLSAPFFDANKTLGVEGFRFVFSDPDFWSAVKNSFVIAGGMLFISIPLGGVLAFLMVRTDLPGRRWLEPLLLTPVFVSPMVLAFGYVVAAGPVGFYSVWFKEWFGVHNVPWNVYSVFAITVIVGLTHVPHVYLYSSAALRNLGSDVEEAARVTGARPFRVALDVSLPMTMPALLFAGVLVFFLGFEVFGLPLVLGDPEGHLVLATYLYKLTNKLGVPSYHLMAAVAVCIVAITFPLVLLQRRLLKTANRFVTVKGKAGRATVLPLGVWRWVALAIVALWLMLTVIVPISGIVLRAFVTNWGEGVALVEVLTLSNFIELFEQDNLVRAIVNTLGIGVIGGALAIGFYSLVAFAGHRRPDWATRLLDYLVLLPRAVPGLLAGLAFLWIFLFVPGLRELKNSMWSIWIAYTVVWLAYGMRLIQSALLQVGPELEEAGRSVGATRSRVSLDVTLPLVRFGLLAAWLLIFMIFEREYSTAVYLLSPGTEVIGALLVSLWATGAVDQVAALSVINIAMVGAGLGVALRFGVKLHG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP013372_1	1.1\|1235902\|26\|NZ_CP013372\|CRISPRCasFinder	1235902-1235927	26	NZ_CP013373.1	1986669-1986694	2	0.923
NZ_CP013372_1	1.1\|1235902\|26\|NZ_CP013372\|CRISPRCasFinder	1235902-1235927	26	NZ_CP013373.1	2703968-2703993	2	0.923
NZ_CP013372_1	1.1\|1235902\|26\|NZ_CP013372\|CRISPRCasFinder	1235902-1235927	26	NZ_CP013373.1	2704017-2704042	2	0.923

1. spacer 1.1|1235902|26|NZ_CP013372|CRISPRCasFinder matches to position: 1986669-1986694, mismatch: 2, identity: 0.923

cgcgaagcatgggaccggagtaaccg	CRISPR spacer
cgcgaagcatgggacccgagtaagcg	Protospacer
**************** ****** **

2. spacer 1.1|1235902|26|NZ_CP013372|CRISPRCasFinder matches to position: 2703968-2703993, mismatch: 2, identity: 0.923

cgcgaagcatgggaccggagtaaccg	CRISPR spacer
cgcgaagcatgggatcggagtaagcg	Protospacer
**************.******** **

3. spacer 1.1|1235902|26|NZ_CP013372|CRISPRCasFinder matches to position: 2704017-2704042, mismatch: 2, identity: 0.923

cgcgaagcatgggaccggagtaaccg	CRISPR spacer
cgcgaagcatgggatcggagtaagcg	Protospacer
**************.******** **

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1639248 : 1646887

Mycobacterium_phage(16.67%)

integrase

attL 1633602:1633616|attR 1657708:1657722

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1633602:1633616	attL	NA	NA	NA	NA
WP_108041807.1\|1639248_1640142_+	pentapeptide repeat-containing protein	A0A2D2W3H3	Mycobacterium_phage	1.1e-13	46.7
WP_059783203.1\|1640190_1640415_+	hypothetical protein	Q3HQW9	Burkholderia_phage	8.3e-06	39.1
WP_059783201.1\|1640411_1640861_+	hypothetical protein	NA	NA	NA	NA
WP_059783200.1\|1641369_1641945_+	ERF family protein	A0A2H4FU11	Methylophilaceae_phage	2.3e-39	47.7
WP_059783198.1\|1641944_1642223_+	hypothetical protein	NA	NA	NA	NA
WP_059783196.1\|1642219_1642609_+	recombination protein NinB	A0A1I9KFA6	Aeromonas_phage	7.2e-05	33.3
WP_059783192.1\|1642939_1643233_+	hypothetical protein	A4PE68	Ralstonia_virus	4.5e-28	64.0
WP_159086654.1\|1643229_1643379_+	hypothetical protein	NA	NA	NA	NA
WP_059783190.1\|1643375_1643642_+	hypothetical protein	NA	NA	NA	NA
WP_059783188.1\|1643638_1643839_+	hypothetical protein	NA	NA	NA	NA
WP_159086655.1\|1643835_1644480_+	hypothetical protein	NA	NA	NA	NA
WP_159086656.1\|1644479_1644749_+	hypothetical protein	NA	NA	NA	NA
WP_059783185.1\|1644745_1645105_+	hypothetical protein	NA	NA	NA	NA
WP_059783183.1\|1645560_1645788_+	hypothetical protein	NA	NA	NA	NA
WP_059783181.1\|1645759_1646887_+\|integrase	tyrosine-type recombinase/integrase	Q9G075	Enterobacteria_phage	1.6e-60	40.7
1657708:1657722	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP013374

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

245045 : 251419

Escherichia_phage(57.14%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059779887.1\|245045_245831_+	ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	4.0e-10	27.6
WP_059779885.1\|245827_246547_+	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	5.2e-17	28.0
WP_034209146.1\|246543_247941_+	MFS transporter	A0A0M3UL24	Mycobacterium_phage	4.4e-28	30.6
WP_034209145.1\|248050_248947_+	glucose-1-phosphate thymidylyltransferase RfbA	A0A291LA53	Escherichia_phage	8.3e-97	57.8
WP_059779881.1\|248943_249525_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	7.1e-49	53.9
WP_059779879.1\|249521_250406_+	dTDP-4-dehydrorhamnose reductase	K7QJU0	Escherichia_phage	3.1e-27	34.3
WP_059779877.1\|250402_251419_+	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	1.8e-79	45.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP013373

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP013372

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP013374

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection