CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP011357	Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence	0 crisprs	csa3	0	0	0	0
NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	3 crisprs	RT,csa3,cas14j,cas7,cas8c,cas5,cas3	2	22	6	6
NZ_CP011354	Bacillus thuringiensis strain YC-10 plasmid pYC6, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP011356	Bacillus thuringiensis strain YC-10 plasmid pYC11, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP011355	Bacillus thuringiensis strain YC-10 plasmid pYC10, complete sequence	0 crisprs	NA	0	0	1	0
NZ_CP011358	Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence	0 crisprs	csa3	0	0	1	0
NZ_CP011352	Bacillus thuringiensis strain YC-10 plasmid pYC4, complete sequence	0 crisprs	NA	0	0	1	4
NZ_CP011353	Bacillus thuringiensis strain YC-10 plasmid pYC5, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP011349	Bacillus thuringiensis strain YC-10, complete genome	1 crisprs	csa3,RT,cas3,cas14k,cas14j,DinG,WYL,c2c9_V-U4,DEDDh	1	0	13	0
NZ_CP011351	Bacillus thuringiensis strain YC-10 plasmid pYC3, complete sequence	0 crisprs	RT	0	0	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP011350_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011350_1

33772-34041

Orphan

Consensus_repeat	Method
GCCAGAGACAAAACCAGA	CRT

6 spacers

The CRISPR arrays of NZ_CP011350_1

>merge|NZ_CP011350|1|33772-34041|CRT
AAAAGAAACAAAACCAGAAAGAAAACCAGAGACAAAGCCAGAAACAAAACCAGAGACAAAGCCAGAAACAAAGCCAGAAACAAAGCCAGAAACTAAGCCAGAGACAAAACCAGAAACAAAGCCAGAGACAAAGCCAGAGACAAAACCAGAGACAAAACCAGAGACAAAGCCAGAAACTAAGCCAGAGACAAAGCCAGAGACAAAACCAGAAACTAAGCCAGAGACAAAACCAGAGACAAAACCAGAAACAAAACCAGAGGAAAAACCAGA

>NZ_CP011350|1|1|33772-34041|CRT
AAAAGAAACAAAACCAGA	AAGAAAACCAGAGACAAA
GCCAGAAACAAAACCAGA	GACAAAGCCAGAAACAAAGCCAGAAACAAAGCCAGAAACTAA
GCCAGAGACAAAACCAGA	AACAAAGCCAGAGACAAA
GCCAGAGACAAAACCAGA	GACAAAACCAGAGACAAAGCCAGAAACTAA
GCCAGAGACAAAGCCAGA	GACAAAACCAGAAACTAA
GCCAGAGACAAAACCAGA	GACAAAACCAGAAACAAA
ACCAGAGGAAAAACCAGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011350.1\|WP_000949459.1\|42950_43154_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011350.1\|WP_016090307.1\|30566_32060_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011350.1\|WP_000879960.1\|43226_43433_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011350.1\|WP_016090304.1\|19571_20783_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011350.1\|WP_001097031.1\|24796_26251_+\|cell-division-protein-FtsZ	unknown	unknown	gnl\|CDD\|276962
NZ_CP011350.1\|WP_001002554.1\|29586_30534_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011350.1\|WP_016090308.1\|32075_32525_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011350.1\|WP_000956352.1\|42679_42883_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011350.1\|WP_002006391.1\|20800_21274_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011350.1\|WP_001181729.1\|32549_32945_+\|DUF4320-family-protein	unknown	unknown	gnl\|CDD\|379505
NZ_CP011350.1\|WP_016090313.1\|39411_40845_+\|CpaF-family-protein	unknown	unknown	gnl\|CDD\|227297
NZ_CP011350.1\|WP_016090315.1\|43519_44065_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011350.1\|WP_000375878.1\|38576_39395_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|379293
NZ_CP011350.1\|WP_001006726.1\|24369_24792_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011350.1\|WP_000572539.1\|26285_27026_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197716
NZ_CP011350.1\|WP_016090314.1\|40837_41770_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011350.1\|WP_040120042.1\|34639_36988_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011350.1\|WP_016090305.1\|21381_22659_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379384
NZ_CP011350.1\|WP_042970383.1\|41771_42638_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011350.1\|WP_016090312.1\|37699_38560_+\|Flp-pilus-assembly-protein-CpaB	unknown	unknown	gnl\|CDD\|274472

Protein	Function_ID	Function_description	E-value
NZ_CP011350.1\|WP_000572539.1\|26285_27026_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|197716	smart00422, HTH_MERR, helix_turn_helix, mercury resistance.	0.00128867
NZ_CP011350.1\|WP_001097031.1\|24796_26251_+\|cell-division-protein-FtsZ	gnl\|CDD\|276962	cd02202, CetZ_tubulin-like, Cell-structure-related euryarchaeota tubulin/FtsZ homologs. CetZ proteins comprise a distinct tubulin/FtsZ family. The crystal structures of CetZ contain the FtsZ/tubulin superfamily fold and its family members have mosaic of tubulin-like and FtsZ-like amino acid residues. However, a recent study found that CetZ proteins (formerly annotated FtsZ type 2) are not required for cell division, whereas FtsZ proteins play an important role. Instead, CetZ proteins are shown to be involved in controlling archaeal cell shape dynamics. The results from inactivation studies of CetZ proteins in Haloferax volcanii suggest that CetZ1 is essential for normal swimming motility and rod-cell development.	4.88813e-16
NZ_CP011350.1\|WP_000375878.1\|38576_39395_+\|AAA-family-ATPase	gnl\|CDD\|379293	pfam13614, AAA_31, AAA domain. This family includes a wide variety of AAA domains including some that have lost essential nucleotide binding residues in the P-loop.	3.72762e-11
NZ_CP011350.1\|WP_016090305.1\|21381_22659_-\|hypothetical-protein	gnl\|CDD\|379384	pfam13814, Replic_Relax, Replication-relaxation. This family includes proteins which are essential for plasmid replication and plasmid DNA relaxation.	1.06319e-11
NZ_CP011350.1\|WP_016090313.1\|39411_40845_+\|CpaF-family-protein	gnl\|CDD\|227297	COG4962, CpaF, Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion].	1.42595e-54
NZ_CP011350.1\|WP_001181729.1\|32549_32945_+\|DUF4320-family-protein	gnl\|CDD\|379505	pfam14208, DUF4320, Domain of unknown function (DUF4320). This family of proteins is found in bacteria. Proteins in this family are typically between 120 and 131 amino acids in length. There are two completely conserved residues (G and Y) that may be functionally important.	9.13983e-22
NZ_CP011350.1\|WP_016090312.1\|37699_38560_+\|Flp-pilus-assembly-protein-CpaB	gnl\|CDD\|274472	TIGR03177, pilus_cpaB, Flp pilus assembly protein CpaB. Members of this protein family are the CpaB protein of Flp-type pilus assembly. Similar proteins include the FlgA protein of bacterial flagellum biosynthesis.	5.63414e-18

>NZ_CP011350.1|WP_001181729.1|32549_32945_+|DUF4320-family-protein
MQNTVTTALFLTFSLLLISLLPEGVLYGIQLVKAHNFAADMVENAENKGGFQYDYNGKRVDLVPGIEKRMKEEKMDGWKYEYTKGRIDHNQSLSFKVKAEHHFFIFKLIGVDGIKAPIWASKEGLGQVYFK
>NZ_CP011350.1|WP_016090308.1|32075_32525_+|hypothetical-protein
MQKFIVAASMLLLFVGCLSFVTDMVIGDTTHTDNKSSLERGGEIAVAKSVKVGTLRAEEEIAIDPEKAKQEFEKAYNGNADFKDPASKRNFTVHDVQEKPAMIAVESDAEAASYFKQFDEKKETIKSKARSIIIYDANGKEKQIGGNVK
>NZ_CP011350.1|WP_016090307.1|30566_32060_+|hypothetical-protein
MKKIVLAISDTVYTAYLREDFVGAGFEVADSDVMHIKYLDEILDTEQPDILCINDKRLNIDAGHEDKRELIILQKLRDIRFQRDIRIVVFTERENNDEFLAKLIYLGIYDIFNSRKIDIDNKVIPQLLQESDIKNVVEIVGASQAPQHTKLPEVPFDEEEAKVSSELEEGNNSESHSNLKLFKNKQKRKSIQEETSKAPIIKKQYKLAFEPVYEKQIGIAIPRRTIVVASMNRRSGATFVSHLLAAYLNELQIDVNYIENLYDDGYTYPLLKGYTEAPENYRSEFMLQRYKEMLQKESDILLIPKWKQGRINYIVKNPIVDQELKNETEQDFDHFIKVLLANQEAPISIIDAGSDWDKDLYHEICEMADYIFFVAEPDLHQLLKIAHPLTQKERKLVSYLGLEKVRIIGNKFSPVLLKHEIVEECFGDKVLTALPPYEIEDVFESQLNSSTLLSSRNYYKELEGIMKEIAELLLPNQLLNSKKSSILSGFRFRKSES
>NZ_CP011350.1|WP_001002554.1|29586_30534_+|hypothetical-protein
MNEIISESKRRFDKYCKDNQVFEERINSLINYYFLLLADRVNILQDREFNNEVEEKQFKSNLKRFETLFPAAAKNAFLKGYQLGLEFFKHPETVIPDSLFINPNFVQDIPFAIVNAAEFSIYELVRTDETQEFSVFAVRTYEGIKPIMEQVFCEIALFGAEISLEHEREERGLKVVEGKTTTFTNVPVDRLFTITPSVAANVVHADGRCEIWSLNWNTKLTLDNPFIELAQVTIVYKDKTEIQKNLRDGFIYEQSLFSAIPLEEIEDRLEVRVKYNLIDNMPCNLDGFEIESLLTELLTKIQNATKVPFENMLLL
>NZ_CP011350.1|WP_000572539.1|26285_27026_-|MerR-family-transcriptional-regulator
MIEQKNEKQDHQINDDDILDDNVFEKAWRITEFSKLVGRHHNTVYNWFNILEEKGLHETLRTQNTNEKLYNALDLEIALFIKQKRDEKWSLDAIIDLLPHQFDLRPVSPEHQTNEVSTELNLQATAEIIEKMVTKQLEEKIKHIESHYEERVESILKQLPQPEDVETLKLRQRQDRLDNFIIEHRARQELRKQAESLWNNKPEEERTRKAGWFKKEEDLSKKQLFIEQYIQDNIIEYIKSLMDSVE
>NZ_CP011350.1|WP_001097031.1|24796_26251_+|cell-division-protein-FtsZ
MAKNFLKNEVAVKMTMVGFGQAGTRMVDKFAEYTHTDGTAVYNCLALNSNDGDLAELKNVPKSNQVSLKLGGLGKNPERAVKVLDSNEEAKEKLKEFITERVRPSDELVLFFAGLGGGTGTSTIIKAIEEFSAFHNKPVIRQELQKVAQLYPMSEIKANQAKFARIAFENAIERKDFIKMGIVVTLPVRADGPDVLRQVNKFSQEIWKLANDKSKGVAFVVFADNQHFYDEFKELNENEKKGIANSRDYANQRISEIIHELNTAANGSGTSVILDSQDFKRILLEKTGCLVINKVSRNMNQIENSHAIIEMFQESLRGSSFHPPIDLMKKNDDGSVEASKVHHFGMLAILDEQKNINDSFMDDAKVEVSNNLPINGTVFNGYLVSKNDFLGTVYTFYKTDALPSRLSKGLVEEFNEFKERQSQIQYKKSQISTIESIDEDEDLGFAFGDFIDMGSDEENNNAGANEDEDLADFLDPDKMFGTTK
>NZ_CP011350.1|WP_001006726.1|24369_24792_+|hypothetical-protein
MNEVLSEKYQTIKFADEVVNMFADILEQDEILYSVFLYIGNIVNKQFQETKYMRGISINEIVENVVIDRRVKKKKGKSYSLEVERTNISRRSAEISVSTLSSMSLIYEKTMHPYKFLISTYRGQQVLIELGKRKKINKER
>NZ_CP011350.1|WP_016090305.1|21381_22659_-|hypothetical-protein
MSEKVYKYRRSGTQKHFHLKEADIFVFTVLYYKRALTTRQITQLYSAFEGRDCSEASIFTKLDRYSQYGAMLTKRIDKRADSITKRALFSLKEKTIEFLLEIGRIPKKSSKRRYSRTTSLHTMCSREVMIRTFLATTKKTQTNELLYELDIRSFYQKKNIKIEGNQLALIPDEHISYQDKNIHIEMDMCKETNSTLVEKVEKYIEYAKKTNEDVTVVFVMYDKSMFLAEDAEPPYIRMKNLLFSMRKHHELLMNIPNLNVHICSLKDAGDVISDIILGTDDNQNWEQDILFPLSQRTVGDVNWRYTFVEKIQTFKESIDGGLRRTYKRDKASIQDFFFIFGNENDYRMIARLDDVVFSRRNGDEGIPLVVIYPKRENPRDILLMDTYDNVLLLSIQNTNIATDEQIMVHAANNVNPKRRKLVELY
>NZ_CP011350.1|WP_002006391.1|20800_21274_-|hypothetical-protein
MKLRQATHAVFTVGVACLFLYGERWKWKMTMNLQFATTTGGVLSAREAFKTPELVLKHITEGGAKFCVSLQDIKIPGKPNYYWYDVIIETAANNKLEINIAVLSQEEYNQLCEGDSIDLYLKQTEDAAKFFLKKSKEQFKPELHNRFTLHHKAQLCL
>NZ_CP011350.1|WP_016090304.1|19571_20783_-|hypothetical-protein
MERSKQRLPLYTTIALISGFILSFGFGVANYIQLLYYAFEPPSYPIEITYVPLFLMFFSLLLGEFSFRFYSRIPALQFQNGKLLILIASHIAVDIQFLWFATTPIHAKVIPYLMNKAKHVNFGEYQAIGDVLTGNFHTLTMIFVFLPTVFMILFTLWYSGHIIRYREEILKWVQKYEYKNHKLQKWFNSQEEQIHPDVDIGPHIKHKEMIRIKGKDRTLNGIIIGPIGSGKTSSLIIPMINQDLHWMVRFINKFENTYKKNNYDTEEVKGTFLNGITVIEPSNDLCQKVFKLVQAHKIPESSIYYIDPTNPDTKNINILRGPVDKVAEVFAMVIQGLSESNNAFFEQAQRNHLKQHIYLLKLHNPQKDVTFDDLIDMYVRVNVKINMYIFACLSMYKINHFLC
>NZ_CP011350.1|WP_040120042.1|34639_36988_+|hypothetical-protein
MKLKRGLLFICTSTMLAIPSMASAKNNDVPFYNGQNDSFLTSLNLQLPGKYYRPGSGYAAKESLYRADVHFPAVYNGSFNWDNPRENLVQAEDTSEPYIRIANEGYLNSKVPAGDRMVTEVERVNNSVISSKYWGNPEFVLENMDKHMIQTYESFRELGQFYWIRDIAYLSGGYAGASGVGNINKYSLWYVRTSKPQVKDFQAMSGKKDIPVKFTFKGFEYVSKNKGYNDRDPNGTTVNPYQKAAGERNRVKWMLDITKDGETVYHQENYLRSTPQKDNQKPNEGDAGQFKKEDITWQPQLCGQYTAKIKVLDAVQRESNEKAVDFTIDGNCGTEVTPNPDPGDEDDFKYKIDFSADRIEGETAREGKNIKTRVDVSRDNFKLERDQYRAKVNNNINKSQQEINSTESDRDSAQSSLSYCRRNPIHEVDAEGKDHYYDRDCSWEENKLDSAASKLDNARQKLEKEKNKIKKLDVLEEKYMNPETVVVLKHNGQQVALQKVRLTEGEKKTLNLDWQHKGKGTIQAEINPAGNRIDIEETTYKNNPIKTAIYEPSKEKAMCGVTSVKGVVETVSERVSKEDITGAMYYETLTGSIGNLAPSKLHSGYGFSYEVNGKYKNDWNANYPGVFTAAKAQYPFADEGLKSTQDLEKKELKDTTAKFLPKNMYLSEATGHVFDSKRPTKSLYWDGQEKIIDGGQKWYSPLKTKNGVYTFNVETAPAGINEMSLCLTEQVEIKGVAYDDFIKRRVFPDDPFPGGSGVGWNWVGKEDVLYKLTDWYYMRNRK
>NZ_CP011350.1|WP_016090312.1|37699_38560_+|Flp-pilus-assembly-protein-CpaB
MKPSKFHKKQITAVGLAAITVAGIYGYNHFAVENAVKPTKVVVAAKDIPAHTEIKEEMLVERTLPGDGIPPNALRVSKKEVIGKWTNDGQPITENSYLFKNKVVKKEELPDSAILNLKDGEVAFPLLVDLETSSGNSIIPNTYVDLYFKQVVKDGDNEKVVFGGLFQRVRVTAAKDSNTEDAFVLEKKESKEEQEGKQKPKVTRLYTLAVSPEQLQYLNRAKTLGDVIPVAVGQKVEQTGKELEPAEGFSQISDQKNILDYVEKHSTNPISKSVKEYVAQYLNESK
>NZ_CP011350.1|WP_000375878.1|38576_39395_+|AAA-family-ATPase
MDRQVRMVAFYATNENVGKSTLSIAMANELAHLGKKVLYVEADQVRPNFAVGTGLSHESKNMLGLVRKENEYNLLQYICTKQDLLEKKVNPRLTQKLHDKMDFLVFPSGYSLTQFPEIQNKELFVTTFIESLVDTEYDYIILSVPTELSEVLSYPILYQSDLVVHVLNGNPRGALAIKRELQLIEEAKLTLPRMIHVLNMGDEDYVEDIEKLSSQNIAVTIPYDRDRTSYEWGMQFGSPQINAKVHHIMEVAGLNIPSQHSSMKKGLFGLRN
>NZ_CP011350.1|WP_016090313.1|39411_40845_+|CpaF-family-protein
MWGYLQEKQVSLKRNRVDLYHFGYRIRSKSVRKLGTTTAQQIKDITDEIRAFLVKEHRDILSESFMNKEKRTAVEQIIKGFLLSNQVVVSDVPSEQLLNMVCDEIVGFGIIEPLKEDKDVTDIYINGTKEIIYEKIGEGECTFPYRFETEEEVKALAYKMVNSTSESLNTAKPYVDCVFPYIRINIALDELGGLGTTITIRKNADHLRASKERMLSTNQASKEMLHFLAAAVKAKMNILVAGATGTGKSEFMKYLASHIPNGKKKERTLVVEDNPELYLHRIFPEHHFVPMQCRASEVEENAIDFDRLLTNALRQGPKRLIVGESRGKEALKMINFFQTGHPGFTSVHARSAKEAVRRLMLMCLQSGANIDAQYLYELISQTFDVIVFLEKKDDGNRYITEMIELLDYRDDIQFNQLSQFILSGEEYDEMNERVGKIHGDHIITAKMSAEMEKKFRSSTVNPALYAPFLSQKEVQYA
>NZ_CP011350.1|WP_016090314.1|40837_41770_+|hypothetical-protein
MHSLLAYGCIFLIFISVGLLVLLFAKSKGSALSQFVQENEKEERRLELRNIKGIRMYLPQSVIQEAQKYEWKLTKSMYWVYTILSGMSIAAVFYFSFGRDLFTLITVLSGFLVPRFLLYRRKKCYYLIVIDRLSIYMKAVANALQISNNAKRVLVQVKPMMHESIQEEIEKVSLLLEGGTTMHRAFREFNETFNFRELVFFHEMLEVCSREGGTNSVQVLLDIAEDFEKQKLYLARLRSSLSQAQRAFVQNCFIVIAMPIVIMLMSKEAYGFLAGSMMGKIALAVNMFIVFFLATRVEKIANYNPTERGE
>NZ_CP011350.1|WP_042970383.1|41771_42638_+|hypothetical-protein
MATILAVVVFVVMYWVFSTFLQSKKDSGSLLTNYVENAKRIEKKNLNQMMLAPFQSLSHKYLTEEKKEQIQKKLEEAGLDTKPEEYLKMKVAYPIIFTSVFLICTVFYDYYLFKVGVLVSPLLYFYPDYLLKRRIKQAIEARKFELPEYLIPMLQLLKTHTTLEAVKKAQIYAGRHLRPYVSTLTAELEMYAGSDQPFRNFAAALNSPEVNTFTIALQQAQKTDKVQSLRIMDAQIKMMRELKHENYNRLIQNKPMEMNKFNVAVIGCIVIYPMVIVIQSLMQGFASL
>NZ_CP011350.1|WP_000956352.1|42679_42883_+|hypothetical-protein
MLTKMKNWLKNEDSQLSSENGMLIALAVIIVLVIGPFVWKAIQGGYDTILARFTKASNNADVNSWNK
>NZ_CP011350.1|WP_000949459.1|42950_43154_+|hypothetical-protein
MLSKMKNWLKNEDSQLSSENGMLIALAVIIVLVIGPFVWKAIQGGYDTILARFTKASSNADVNSWNK
>NZ_CP011350.1|WP_000879960.1|43226_43433_+|hypothetical-protein
MLAKMKSWLKNEDSQLSSENGMLIALAVIIVLVIGPFVWKAIQGGYDTILARFTKASSNADVDSWNKK
>NZ_CP011350.1|WP_016090315.1|43519_44065_+|hypothetical-protein
MGLYIVGLLLSYMFLNVFTDLKYRKTKNMWHLLFLILGIGITYLAGTRTGKEIAIVLVMALVCGLLLETFKFSSPGDTKMLVVVGLYVSNVVEESAMLTAITLTAFHLLFFWIASVYRLIKILGFAGAIKDQLEHAASIFGAKLPKKEIQLIQSFPGACSILLGAIMYVAFTIYQNGGMLA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP011350_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011350_2

697165-697533

TypeI

Consensus_repeat	Method
ATTATATTTCAATCCACGCACCTA	CRISPRCasFinder
ATTTCAATCCACGCACCTANANNAGGTGCGACNT	CRT

5 spacers

cas7,RT,cas8c,cas5,cas3

The CRISPR arrays of NZ_CP011350_2

>merge|NZ_CP011350|2|697165-697533|CRISPRCasFinder,CRT
ATTTAATTTCAATCCATGCACCTATATAAGGTGCGACTTGTTTTTCACAAAGCATTAATACCAGCTACATATTTCAATCCACGCACCCATATAAGGTGCGACTTCTTTTGATCCGTAAGAACGTTCCATTTCCATATTTCAATCTACACACCTATATAAGGTGCGACGTCCCTTCCATCGGCGGCAGCTCATATTCAATTATATTTCAATCCACGCACCTATATAAGGTGCGACTCGATTCCACTTGTTCAGGCTCTTTGAATATCATATTTCAATCCACGCACCTACTAGAGGTGCGACATCCATTTGTTGTTACTTATGAACTACCGCCAATGATTTCAATCCACGTACCTACAAGAGGTACGACTT

>NZ_CP011350|2|1|697165-697518|CRISPRCasFinder
ATTTAATTTCAATCCATGCACCTA	TATAAGGTGCGACTTGTTTTTCACAAAGCATTAATACCAGC
TACATATTTCAATCCACGCACCCA	TATAAGGTGCGACTTCTTTTGATCCGTAAGAACGTTCCATT
TCCATATTTCAATCTACACACCTA	TATAAGGTGCGACGTCCCTTCCATCGGCGGCAGCTCATATTCA
ATTATATTTCAATCCACGCACCTA	TATAAGGTGCGACTCGATTCCACTTGTTCAGGCTCTTTGAAT
ATCATATTTCAATCCACGCACCTA	CTAGAGGTGCGACATCCATTTGTTGTTACTTATGAACTACCGC
CAATGATTTCAATCCACGTACCTA

>NZ_CP011350|2|2|697170-697533|CRT
ATTTCAATCCATGCACCTATATAAGGTGCGACTT	GTTTTTCACAAAGCATTAATACCAGCTACAT
ATTTCAATCCACGCACCCATATAAGGTGCGACTT	CTTTTGATCCGTAAGAACGTTCCATTTCCAT
ATTTCAATCTACACACCTATATAAGGTGCGACGT	CCCTTCCATCGGCGGCAGCTCATATTCAATTAT
ATTTCAATCCACGCACCTATATAAGGTGCGACTC	GATTCCACTTGTTCAGGCTCTTTGAATATCAT
ATTTCAATCCACGCACCTACTAGAGGTGCGACAT	CCATTTGTTGTTACTTATGAACTACCGCCAATG
ATTTCAATCCACGTACCTACAAGAGGTACGACTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011350.1\|WP_000817905.1\|684517_685153_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011350.1\|WP_000459233.1\|711723_712533_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011350.1\|WP_001024816.1\|685152_685782_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011350.1\|WP_000335059.1\|705514_707317_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|276809
NZ_CP011350.1\|WP_014481878.1\|702051_704421_-\|CRISPR-associated-helicase/endonuclease-Cas3	cas3	COG1203_cas3_CAS-I	gnl\|CDD\|224124
NZ_CP011350.1\|WP_003319726.1\|701126_701846_-\|type-I-C-CRISPR-associated-protein-Cas5	cas5	cd09752_cas5_CAS-I-C	gnl\|CDD\|273847
NZ_CP011350.1\|WP_000373088.1\|707726_708644_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011350.1\|WP_000610947.1\|708658_709441_-\|ImmA/IrrE-family-metallo-endopeptidase	unknown	unknown	gnl\|CDD\|368753
NZ_CP011350.1\|WP_000494364.1\|686118_686832_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011350.1\|WP_000853368.1\|698343_699204_-\|type-I-C-CRISPR-associated-protein-Cas7/Csd2	cas7	COG3649_cas7_CAS-I-C	gnl\|CDD\|226175
NZ_CP011350.1\|WP_000118651.1\|699206_701126_-\|type-I-C-CRISPR-associated-protein-Cas8c/Csd1	cas8c	pfam09709_cas8c_CAS-I-C	gnl\|CDD\|187887
NZ_CP011350.1\|WP_000114815.1\|693120_693348_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011350.1\|WP_103653709.1\|686848_689251_-\|DEAD/DEAH-box-helicase	unknown	unknown	gnl\|CDD\|223627
NZ_CP011350.1\|WP_000724860.1\|709533_709926_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011350.1\|WP_113623483.1\|696083_696239_-\|hypothetical-protein	cas7	COG3649_cas7_CAS-I-C	gnl\|CDD\|187820
NZ_CP011350.1\|WP_000710696.1\|694718_695144_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011350.1\|WP_000372481.1\|712914_714639_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011350.1\|WP_078405438.1\|683888_684467_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011350.1\|WP_001219637.1\|693363_694455_-\|methyltransferase	unknown	unknown	gnl\|CDD\|274377
NZ_CP011350.1\|WP_000654328.1\|689528_691394_-\|group-II-intron-reverse-transcriptase/maturase	RT	pfam00078_RT_CAS-I:CAS-III	gnl\|CDD\|275209

Protein	Function_ID	Function_description	E-value
NZ_CP011350.1\|WP_000118651.1\|699206_701126_-\|type-I-C-CRISPR-associated-protein-Cas8c/Csd1	gnl\|CDD\|187887	cd09757, Cas8c_I-C, CRISPR/Cas system-associated protein Cas8c. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Zn-finger domain containing protein, distant homologs of Cas8 proteins; signature gene for I-C subtype; also known as Csd1 family.	4.95792e-169
NZ_CP011350.1\|WP_103653709.1\|686848_689251_-\|DEAD/DEAH-box-helicase	gnl\|CDD\|223627	COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair].	1.89065e-07
NZ_CP011350.1\|WP_001219637.1\|693363_694455_-\|methyltransferase	gnl\|CDD\|274377	TIGR02987, m6_adenine_and_m5_cytosine_DNA_methyltransferase, type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family. Members of this family are the m6-adenine DNA methyltransferase protein, or domain of a fusion protein that also carries m5 cytosine methyltransferase activity, of type II restriction systems of the Alw26I/Eco31I/Esp3I family. A methyltransferase of this family is alway accompanied by a type II restriction endonuclease from the Alw26I/Eco31I/Esp3I family (TIGR02986) and by an adenine-specific modification methyltransferase. Members of this family are unusual in that regions of similarity to homologs outside this family are circularly permuted. [DNA metabolism, Restriction/modification].	0.00066001
NZ_CP011350.1\|WP_000335059.1\|705514_707317_-\|hypothetical-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	7.64325e-11
NZ_CP011350.1\|WP_014481878.1\|702051_704421_-\|CRISPR-associated-helicase/endonuclease-Cas3	gnl\|CDD\|224124	COG1203, COG1203, CRISPR-associated helicase Cas3 [Defense mechanisms].	2.06683e-76
NZ_CP011350.1\|WP_113623483.1\|696083_696239_-\|hypothetical-protein	gnl\|CDD\|187820	cd09689, Cas7_I-C, CRISPR/Cas system-associated RAMP superfamily protein Cas7. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas7 is a RAMP superfamily protein; Subunit of the Cascade complex; also known as Csd2 family.	2.60175e-14
NZ_CP011350.1\|WP_003319726.1\|701126_701846_-\|type-I-C-CRISPR-associated-protein-Cas5	gnl\|CDD\|273847	TIGR01876, cas_Cas5d, CRISPR-associated protein Cas5, subtype I-C/DVULG. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This small Cas family is represented by CT1134 of Chlorobium tepidum. This family belongs to a set of several Cas protein families, one each for a number of different CRISPR/Cas subtypes, that share a region of N-terminal sequence similarity modeled by TIGR02593. This family represents the Dvulg subtype of CRISPR/Cas locus.	1.61876e-96
NZ_CP011350.1\|WP_000610947.1\|708658_709441_-\|ImmA/IrrE-family-metallo-endopeptidase	gnl\|CDD\|368753	pfam06114, Peptidase_M78, IrrE N-terminal-like domain. This entry includes the catalytic domain of the protein ImmA, which is a metallopeptidase containing an HEXXH zinc-binding motif from peptidase family M78. ImmA is encoded on a conjugative transposon. Conjugating bacteria are able to transfer conjugative transposons that can, for example, confer resistance to antibiotics. The transposon is integrated into the chromosome, but during conjugation excises itself and then moves to the recipient bacterium and re-integrate into its chromosome. Typically a conjugative tranposon encodes only the proteins required for this activity and the proteins that regulate it. During exponential growth, the ICEBs1 transposon of Bacillus subtilis is inactivated by the immunity repressor protein ImmR, which is encoded by the transposon and represses the genes for excision and transfer. Cleavage of ImmR relaxes repression and allows transfer of the transposon. ImmA has been shown to be essential for the cleavage of ImmR. This domain is also found in in metalloprotease IrrE, a central regulator of DNA damage repair in Deinococcaceae, HTH-type transcriptional regulators RamB and PrpC.	6.33521e-07
NZ_CP011350.1\|WP_000853368.1\|698343_699204_-\|type-I-C-CRISPR-associated-protein-Cas7/Csd2	gnl\|CDD\|226175	COG3649, COG3649, CRISPR system related protein [Defense mechanisms].	1.09266e-135
NZ_CP011350.1\|WP_000654328.1\|689528_691394_-\|group-II-intron-reverse-transcriptase/maturase	gnl\|CDD\|275209	TIGR04416, hypothetical_protein, group II intron reverse transcriptase/maturase. Members of this protein family are multifunctional proteins encoded in most examples of bacterial group II introns. These group II introns are mobile selfish genetic elements, often with multiple highly identical copies per genome. Member proteins have an N-terminal reverse transcriptase (RNA-directed DNA polymerase) domain (pfam00078) followed by an RNA-binding maturase domain (pfam08388). Some members of this family may have an additional C-terminal DNA endonuclease domain that this model does not cover. A region of the group II intron ribozyme structure should be detectable nearby on the genome by Rfam model RF00029. [Mobile and extrachromosomal element functions, Other].	4.217e-121

>NZ_CP011350.1|WP_113623483.1|696083_696239_-|hypothetical-protein
MHTATSVDPIDITCMQIKKSVNSELGKDKGSDTTGIKHRVDFGVYVFLWKY
>NZ_CP011350.1|WP_000710696.1|694718_695144_-|hypothetical-protein
MKKDCRHLRLVPTVEEHKTRIEANETYQQKSYATSTMSSETRGRLNQMRGCFEAEIILPVGKFQYFKPHAMNEKEAIQEIALFIEGIQEMNIGYVILWRFVGQQSFYSGTKIVAEPKFRKIMRKLKDYLFDYEELIYETEK
>NZ_CP011350.1|WP_001219637.1|693363_694455_-|methyltransferase
MRIGNDLAAGYYPTPLLEGKHLIQLLQMEPERVYACFDPCCGEGTILRSFADEVRQVSIQIDTYGVEVDANRYGKAKEQLDEVVCSDFESMMISHDYFPLIFLNPPYNTELRTENTKSEKMEFNFLKRAHLYLQDGGIMVYVIPYDKFARDDISYFIAKHYEEIGLMRFGDENEEFEQFKQCVFIGRKRAATKNDTYFNDRFANFCENMSDLSFVKKHVNTLAEMVNRKDWAIPELRHQNKLIFTSRVDYKSAYEGVGKSEGISSFKKRLNRGNGYSLQGEKTAAERAKMPIASGQLGLLLITGVADGLLGEGDTLHAVRGSENVYYETSFEPLQKTTKEVVLQKRRAKFIIATPTGEVKELV
>NZ_CP011350.1|WP_000114815.1|693120_693348_-|hypothetical-protein
MSVLLGIGALFIVWEFSNRMFRIAIVLTVICLCASQLGAGTYLEVLEQFSAFQGAGNMLHAAEQSLPEWKQFIDF
>NZ_CP011350.1|WP_000654328.1|689528_691394_-|group-II-intron-reverse-transcriptase/maturase
MKDNKQFPQNEKELKLALDSMYRIAKESSKPFYNLIELMKNEQTILTAIHNIKGNKGSKTAGTDGKTMDYYLQMGRDKLMSLIRRNINNYQPSPVRRKYIPKSNGKQRPLGIPNMIDRIIQEIAKIVIEPIAEAKFYHYSFGFRPMRSAEQAIAETLERIRRSKTYWVIEGDIKGYFDNINHNKLIEIMWKIGIRDKRVLMMIKKMLKAGIMEEGKVRDNVSGSPQGGIISPLLANIYLNYFDWEIARMFQEHPARYKVKDVSRNGLQRVRQRHEDTFLIRYADDWVILCKSEGNAKRILKKVEKYFNHQLKLELSKEKTLITDVRTNRVNFLGFWIFAEEHRLRKGNIQGKAIPNMDKAKLKIKEINKNIKTLYDHRGNKSKQVAIIESINSKIVGIANYYKIANVSTIFQGFDKRIHYAQWRTWLFMNNRRGRYYQLTTPADTLLNRRDRHKEQKSKVFFIEEHGAKVGITKFAFTPKRNAMKVNLLMSPYTDNGRSIYKRTTGKREALERPNFFQEEIPFYQLNNRYPIYNFEFYLNREYAFNRDRGKCNCCKVQLNEWNLNTHHKNPKLPLNKVNKVINLVSLCKTCHKLVHNENPVTNTKGGKKIEQLRKLLKEVK
>NZ_CP011350.1|WP_103653709.1|686848_689251_-|DEAD/DEAH-box-helicase
MTAAVDGYFHLKGKKGYRTCVFVPPTLTEKWAKEEIRHLLPDAEIHLIKRTEDLIRIHQAWIQAGRPKPQKPTFFVISFTTMRGDSIKMMPLSYKQTPLSKKSEEEVQRYYKNGYYCSDCGAKLRKKTSSIMVQQANGEQKEVCQYKDFTASDLDTKTNKNSVCADCNSNIWSPKVKTKYASFKEWTKYEEQLVQAIKEGNKPLQKQLELENRVKPYDAKHSGRAYRKVAAVEYIRRKMKHFFDVLIADEIHELKSESAQGTALGSLAKVCKKVVAGTGTLFGGRASDVFYTLWRLFPQKMVKSGFEYSSFMEWNETYGNIERTYYHDGEVTSNIASRGAQGTLDKTKVVPGISPYVFTQFLMDTTINVRLKDVWPNPVELVNVPTILVDMSEEQKQAYEHMKESFEKAIEAAKGTPDAGKLWLSYIRTGNAYPDNMIHYPNYYLDDAGKELVWSNDKFKFDEDCIQPKERELQSILRTEISEGRPTIVYVCDTGSTVKERDVQPRLQKVVEQISGAKVAILRTNTVTPPKRSEWLKDQVNSGVNVIICSLELVKVGLDLLATPTLIFYQLPFSLFALNQAARRHCRIGQTKQCRTFYLGYRETFQQQMAQLIAQKNKAAEAMNGEVTSDGLNAMLGDTGDLQTLLIQNIKSGNQLKGSTEEWTKAASDESKRVLANIGNVITPVFESIEIQFTNWVGKLPGTMDVAFMKEVQFVQRAVECIKKEQVPGVRVKKNVLEIAGEIEDVIRALTTLNTDKRMLVQKQDITFWDSVIVEVDSSKKKGKRKNKVIDGQFEFDLFG
>NZ_CP011350.1|WP_000494364.1|686118_686832_-|hypothetical-protein
MFTKIFIGLFCYVFLVVRNSKKKFLMEEAKKKEMENKPVERPVYWCPRENKPIGREQERVTVPTKEITLEKDVASIYDLVATSVHKNLGEEESDRLKHEDIEEVEYAEDFHHTPTPEAVYDIPFPSDEDIPVELLEYEDMYPQQEYVSIPPETEHVFSVQQGVADVEDMDFVRWTAKVIEQEQGLTRVINMSNKKRYWIHTEGEILPKNQLLYMKLEVNSPYSYTLVEWSNRQLGNI
>NZ_CP011350.1|WP_001024816.1|685152_685782_-|hypothetical-protein
MNINSISNNVVEKLEQTVRYEKKQVQVLRVSKSSSNIHAYMIFPEFSEVKISNTELDEYIENLSTSVKYVIDRKLSQQEIEKQNHSFIMTCEVEEDGVIDDETIHFNTTYVKPPTIANKVFKLVCGLGNRLDSLKELHITVLNNNINRIEIEFYNENETYVAVEKEEIANAIMGAYTKANIYYAADLYYAAEGNEIKLKSIKPKLAGDV
>NZ_CP011350.1|WP_000817905.1|684517_685153_-|hypothetical-protein
MKREKGMIGVLCTLVLMILLLVPLEAAQASVKVDFNELKGNDVSSSFKDGLNNRMKTTEKEDSFGSSIIQKIEGLYAPAFKVGVNIFSISFVLGVIVMVMALITKNGQWMKWATGSMIFSFISMMSMRLSVYFLFSSDVFSFMNIFTDFLDLFKATALIFTPFMLIAGIRLRRIHESTKQPEYYRWANRVITGSCLLCMLAVLAPWLFANM
>NZ_CP011350.1|WP_078405438.1|683888_684467_+|hypothetical-protein
MLEHTILFSLVQLVPLIVSTGIIYILLELTDTEWKTWFSYEGIFVIIFLITRFQVFQNKKSIISLNQHEKWFSKLNIFLISIFLVLFASIPTLLKIAFILQMTVILFLLEYLCLYINRLPTHNLYRVKEIICDKKQLKIERIIPNNEEHGTHTIKTNDGQYFLYTAVYLSGILSPISEEVFEEYERKNLMGR
>NZ_CP011350.1|WP_000853368.1|698343_699204_-|type-I-C-CRISPR-associated-protein-Cas7/Csd2
MKTLDHKIDFAVVLSVTKANPNGDPLNGNRPRQNYDGHGEISDVAIKRKIRNRLQDMEESIFVQSNDRKVDQFNSLRERAETNVDLVKALKSKDNPHEQFAAIACKEWIDVRSFGQVFAFKGGAGKGVSVGVRGPVSIHTATSVDPIDITSMQITKSVNSEPGKDKGSDTMGMKHRVDFGVYVFYGSINTQLAEKTGFTNEDAEKIKNALVTLFENDASAARPEGSIEVHKVCWWDHNSKLGQYSSAKVHRLLEVKRNIDEPKTIDDYTVLVHELDDLKVEIINGM
>NZ_CP011350.1|WP_000118651.1|699206_701126_-|type-I-C-CRISPR-associated-protein-Cas8c/Csd1
MSWLLNLYETYQSNLDRVGKIEKKYNGQEYTLLPISHTTQSANIEVLITEEGEFHSATVIDKSDANTLIPCTEDSASRSGTGAYKVPHPLHDKLTYVAGDFGEYGGSKKEEESFGYYIEHLRNWVESPYSTDKLKSIYKYLRKKQLVKDLVETKILWLDENQKLIGKWDKKVEVFLGNKPEIFTVLPAGQEAAFVRFTVYSPNKMLSKVWQDKEIHNSFINFYDGLLDNEDYCYVTGEIKPSTDKHAKKIRNASDQAKLISSNDLRGFTFRGRFTTSNEVANISYDVSQKAHNALKWLINKQGKIIDQRVFLVWGNDAEDVPDIVEDSYSIFSMDIRGTKKREIKSYTHEQFANEVAKAIDGYKNNLSSSENVNILLLDSATTGRLAVLYYRNMDKNLYLNRLKNWHSTCVWEHGYRKNADNEFVKFYGTPSTRDIAFAAYGPKANEKVVKSLMERMLPCIIDERKIPFDIVRSAFQRASNPLSMEKWEWEKTLSITCALINKMEGYQLVLDKENNNRDYLFGRLLAVADVLERKALNNGDQRATNARRYMNSFSQHPERTWRTIQGALQPYQARLGEKVWYYNKLIDEIGSMIKIEDFNNKPLSGKYLLGFYSQRHELYQKKEKNVSLNDVVNIGEEN
>NZ_CP011350.1|WP_003319726.1|701126_701846_-|type-I-C-CRISPR-associated-protein-Cas5
MRNSIEFEVFGDYALFTDPLMKMGGEKLTYQVPTYQAIKGIVESIYWKPTLLMIVDKIRIMNAIKMESKGIRPIEYGGGNTLANYTYLKNVRYQVQAHFIFNHHRPDLAFDRNEYKHHNILKRSLKVGGRRDIFLGTRECQGYVEPCVFGEGEGFYDNYGGDIHLGTMVHGLNYPDETGRNELEVRLWNPVMRDGIIQFIRPEECTKIRKISKMDPKIFDSSNVESVDELIKQLEEGGE
>NZ_CP011350.1|WP_014481878.1|702051_704421_-|CRISPR-associated-helicase/endonuclease-Cas3
MTYIAHIRESDSQVQTVEEHLLRVKELAETYGEKIGIKHLAGLAGMLHDMGKYTNEFKEYILEAVNNPNSPPKKGSVDHSTAGGKLLYQLFHTENMIPYKGIISEIVGNAIISHHGYLQDFLNPDLESPYLNRVRDKQLRGFDVTQQFFFKHVMKEKDFHEYVDKATVELESFLLKESPENAEKQLMFLTKFIFSTLIDADRTNTRLFEEEKSVESVINVDELFEKYYERLMTKINSFKKQQNANTPINMLRADMSDQCDQFAERPSGIYTLSIPTGGGKTLASLRYALKHANTHNKKRIIYVVPFTTIIEQNAEEVRRILEDEENILEHHSNIVEEVNEHDENEDGVVSIQQKLKLAKDNWDSPIIFTTMVQFLNVFYAKGNRNTRRLHNLSEAIIIFDEVQKVPVSCVSLFNQALNFLKIYTRSSIVLCTATQPALDFVEQKLDINTDAEMINNLDHVIEAFKRVKIIDQATNEIFNKDKLKTFIHTKIEEVQSILIVLNTKSVVRDLYTQLQSQGLNIPIYHLSTTMCAAHRHKILEEVRECLKEGRKIICISTQLIEAGVDVSFECVVRSLSGLDYIAQAAGRCNRHGEKGIQNVYVIDYEEENLSHLKEIKIGKKITKKILMDLKHNDKIHGGHILSREAMKRYFKEYYREFESDLDYFIPKLKKNMTELLSVPRIENSYRRAYIHKHDKKDIPLFIINSYQTAAKHFNVIDDITTSVIVPYEEGKDIIAELNSNNSIEDLTRLLRKAQQYTVNVFNYEKEKLIINDGLVYYLDGKILALKESA
>NZ_CP011350.1|WP_000335059.1|705514_707317_-|hypothetical-protein
MCKCRVCETNNNDFHCNIAGDNICRNCCNDFQLRNFKDSWSGLVKLVKDEMEIYNISECCLKCKGLMRNQRVELTGDGSIINYGYNGKYVFNDMVDSYSYKFFNKKKIVLLESMNSLDITGVYDLAEGYYLLEEYEKAIDLLENLEGKDTDSKVLLLLGKVYFHANNLQAAIDCLLNSIKIHGDNSETYRILGEVYQADNNLINSAYYFNQAIKYFKIDAYDRPNDYFPQYSYLGLAVVYSKLNQHNEVIKSAEKFLESQYSWDTLVEMLYEQRSGEKNYIGFGGFFACATIYELMALSYLEKENLMLAEKYIDRAQELNPENTNIATTKGIIIGRKHNDGKISEYREQISSLRQNIELRASSINKLKTLRPEEQVKLFTGNEEESVWGFLVGKIFDNLKTIENLSPIVTPSQNKAAEEDRYTDLFKSHMDSNLVDTFGWITHTQSRGGYTRKEMGDRGGIGERDIVIRSHQNKDLLMGEALILKGKDTASIKTHTKKIFGYDIGNCNFHIIINWGFSEKPDSVWKDYRKLVISRQEGIYAVIENGETENLYPGINKQGIRTFYTKHSTDVENEVATAIHVYVDVLKQMKREGAELARKK
>NZ_CP011350.1|WP_000373088.1|707726_708644_-|hypothetical-protein
MDQVTNTPETNQDSKCNGIEPYLQDGRKNDRVTHYYILDNNVLSDLAKLAREEQSSFKELMTCYKGTVFIVPEMVMEEAIRNLPGQQWVDEKYLNFYQVMSELHIPIYLESVEHNYQIFAEGYGSKEEAFLQYKEIALNSISNIAIQGELREAKSCKDIEKAYSQSLKDAGERFIFLYAHAMLQDKVNKISILSNEIKGVYNVWKANMRKGELLELVRVTSHEEYCEKLRPVSYNCILVNSLKKNPTLTSEQKKSLLQIMRDSKIIGRNVYYSQKSCNLVDTRADMNNEEFINFIEKHDDYKLAF
>NZ_CP011350.1|WP_000610947.1|708658_709441_-|ImmA/IrrE-family-metallo-endopeptidase
MINSTNIREVIEQNQKILPSILVNVESTIEKGIHFKYKTIESIRNYLMQKTEVLLFPSKSLSYGGMVLYRNGSFYININTLQPKTYENFVWAHEYYHFEFEKDRIKNADDVTFVNNPVLNENERRANLFAAELLINDDVLKTLFQEIKLNYVNDSLEKNVIRLIPAFELPYKTMVIKLAQENLISMEDAERIIDHDYRHNLPQDFDLSILEPTKAIKIDGLNKLLESESVQENMLESDFESIQNLANQHFKQLEAIRMEI
>NZ_CP011350.1|WP_000724860.1|709533_709926_-|hypothetical-protein
MKKIVGENIRIYLEATGRTHQWVMDKGGIPKATFYKLLKGEGDLTKGIEKINELFGIKDDFYFYNSEFKPPLKLEDKLKRSDIRNFAAANYVAVEGEETEFKNTLDTLDDFIRMIELLKPYNNLNRNDFI
>NZ_CP011350.1|WP_000459233.1|711723_712533_+|hypothetical-protein
MFDFELELFNFYSKKLSKWNLVYKYVLKNIIFLVATFISIAALVIISLNIFVEHDIEFDSFYIYMIFFFVYMILFLVCMHYVVVKPAILISVNKYNISFKSKQWQVFICLIVQSYLFKKELLNNDPKFNEESLQFLIQVLKEKKEETEKLNVLKLLSSYGSLFFLFTIPVWSAFNSWVYNHEIKTSAEAIQYLLMLGFLIFMSVFLIWMPFKKNFLEELFSKESSKISDLIKALENINFSLKNFCHLKSEKSGVIKQSTIDSIIKENTN
>NZ_CP011350.1|WP_000372481.1|712914_714639_-|hypothetical-protein
MDQLKQLFQSTLLVAYPLFQNIENNERIFNKWRGLCTLINSDVSYLEDPMYTSVSFKKFANWISYKESQGVGIMEIVAQIEGYRPEVFELLANDIEKEFEILLVKQKQEKKHTEEQQSFIEHSSAGFMYHLTDTIAKNNFTEDKELNAHIAELPDKSNSLVVVSSRFNDGDMKLRGAGELNRWNTLVDSTFVDRVMDDLTADCLDIVTEIWVKSASTESSPVHIGYEEILEMCSMKQVRNGKSYYRKEDRLKIMERLAALASIFIYVNEDNEIVILNDDENPNESLAYKKQRVRRLFVMDEIVFAKDIDTDEMLGIESMNVAPGTFLSKYLYGSEKLTGLLSKKALEYNSKQQRYHKRLTRYLSWRWRIQQAYQHLVHPYSIGGPKGLISVMGVSMNQNPARIRSVFEKTLDDLMRDEVIKEWQYQTPIDEGKCSGRNWLENYWLNLKVTVTPTDELVSLQQELLQKKKITPKNKLMETVVKDPVIEVQDMEIEEIQTSQLEQQQVNRDINWYQQKILQYKEENKCSLRDMAKEIEISPSNLSKLLIGKRKRLSEETHNKLDKWIERQEVVNLL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP011350_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011350_3

704505-705191

TypeI

I-C

Consensus_repeat	Method
ATTTCAATCCACGCACCTATATGAGGTGCGAC	CRISPRCasFinder
ATTTCAATCCACGCACCTATATNAGGTGCGAC	CRT
ATTTCAATCCACGCACCTATATGAGGTGCGAC	PILER-CR

10 spacers

cas3,cas5,cas8c,cas7,RT

The CRISPR arrays of NZ_CP011350_3

>merge|NZ_CP011350|3|704505-705191|CRISPRCasFinder,CRT,PILER-CR
ATTTCAATCCAAGCACCTATATGAGGTGCAATCATGACTGAATTTTGTCAAAATTGTGATATTATATTTCAATCCACACACCTATTTAAGGTGCGACTATGAGCGTTCCAGATAAATATAAACCCGAGGTAATTTCAATCCATGCACCTATATGAGGTGCGACTGAAAACGGAAAAACAATTGAGCTAGTTGCAAAATTTCAATCCACGCACCTATATAGGGTGCGACTATGGGCATTCCAGATAAATATAAACCCGAGGTAATTTCAATCCTCACACCTATATAAGGTGCGACTGGTCTAACATCTAAAGCCATTAATAACTCCTAATTTCAATCCACGCACCTATATAAAGTGCGACTGCAAAGACGATCATAACGACTGGAGCAACAAAATTTCAATTCACACACCTATTTAAGGTGCGACATACACTTTTTTTGATTTCTTCTACTATCTTCATTTCAATTCACGCACCTATATGAGGTGCGACTTTAAAACGTGCATAACCTAACACTTTCCCATTGTATTTCAATCCACGCACCTATATGAGGTGCGACTTTTTTACTCGGATACTCTAAAGGTGTAACAATAATTTCAATCCACGCACCTATATGAGGTGCGACATGTGGGTGACGTCATTAAATTCTCGTATCTTGTATTTCAATCCACGCACCTATATGAGGTGCGAC

>NZ_CP011350|3|2|704505-705191|CRISPRCasFinder
ATTTCAATCCAAGCACCTATATGAGGTGCAAT	CATGACTGAATTTTGTCAAAATTGTGATATTAT
ATTTCAATCCACACACCTATTTAAGGTGCGAC	TATGAGCGTTCCAGATAAATATAAACCCGAGGTA
ATTTCAATCCATGCACCTATATGAGGTGCGAC	TGAAAACGGAAAAACAATTGAGCTAGTTGCAAA
ATTTCAATCCACGCACCTATATAGGGTGCGAC	TATGGGCATTCCAGATAAATATAAACCCGAGGTA
ATTTCAATCCTCACACCTATATAAGGTGCGAC	TGGTCTAACATCTAAAGCCATTAATAACTCCTA
ATTTCAATCCACGCACCTATATAAAGTGCGAC	TGCAAAGACGATCATAACGACTGGAGCAACAAA
ATTTCAATTCACACACCTATTTAAGGTGCGAC	ATACACTTTTTTTGATTTCTTCTACTATCTTC
ATTTCAATTCACGCACCTATATGAGGTGCGAC	TTTAAAACGTGCATAACCTAACACTTTCCCATTGT
ATTTCAATCCACGCACCTATATGAGGTGCGAC	TTTTTTACTCGGATACTCTAAAGGTGTAACAATA
ATTTCAATCCACGCACCTATATGAGGTGCGAC	ATGTGGGTGACGTCATTAAATTCTCGTATCTTGT
ATTTCAATCCACGCACCTATATGAGGTGCGAC

>NZ_CP011350|3|3|704505-705191|CRT
ATTTCAATCCAAGCACCTATATGAGGTGCAAT	CATGACTGAATTTTGTCAAAATTGTGATATTAT
ATTTCAATCCACACACCTATTTAAGGTGCGAC	TATGAGCGTTCCAGATAAATATAAACCCGAGGTA
ATTTCAATCCATGCACCTATATGAGGTGCGAC	TGAAAACGGAAAAACAATTGAGCTAGTTGCAAA
ATTTCAATCCACGCACCTATATAGGGTGCGAC	TATGGGCATTCCAGATAAATATAAACCCGAGGTA
ATTTCAATCCTCACACCTATATAAGGTGCGAC	TGGTCTAACATCTAAAGCCATTAATAACTCCTA
ATTTCAATCCACGCACCTATATAAAGTGCGAC	TGCAAAGACGATCATAACGACTGGAGCAACAAA
ATTTCAATTCACACACCTATTTAAGGTGCGAC	ATACACTTTTTTTGATTTCTTCTACTATCTTC
ATTTCAATTCACGCACCTATATGAGGTGCGAC	TTTAAAACGTGCATAACCTAACACTTTCCCATTGT
ATTTCAATCCACGCACCTATATGAGGTGCGAC	TTTTTTACTCGGATACTCTAAAGGTGTAACAATA
ATTTCAATCCACGCACCTATATGAGGTGCGAC	ATGTGGGTGACGTCATTAAATTCTCGTATCTTGT
ATTTCAATCCACGCACCTATATGAGGTGCGAC

>NZ_CP011350|3|1|704961-705191|PILER-CR
ATTTCAATTCACGCACCTATATGAGGTGCGAC	TTTAAAACGTGCATAACCTAACACTTTCCCATTGT
ATTTCAATCCACGCACCTATATGAGGTGCGAC	TTTTTTACTCGGATACTCTAAAGGTGTAACAATA
ATTTCAATCCACGCACCTATATGAGGTGCGAC	ATGTGGGTGACGTCATTAAATTCTCGTATCTTGT
ATTTCAATCCACGCACCTATATGAGGTGCGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011350.1\|WP_000520262.1\|716830_718540_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011350.1\|WP_000459233.1\|711723_712533_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011350.1\|WP_000335059.1\|705514_707317_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|276809
NZ_CP011350.1\|WP_000118651.1\|699206_701126_-\|type-I-C-CRISPR-associated-protein-Cas8c/Csd1	cas8c	pfam09709_cas8c_CAS-I-C	gnl\|CDD\|187887
NZ_CP011350.1\|WP_000677976.1\|720823_721219_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP011350.1\|WP_003319726.1\|701126_701846_-\|type-I-C-CRISPR-associated-protein-Cas5	cas5	cd09752_cas5_CAS-I-C	gnl\|CDD\|273847
NZ_CP011350.1\|WP_000373088.1\|707726_708644_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011350.1\|WP_000610947.1\|708658_709441_-\|ImmA/IrrE-family-metallo-endopeptidase	unknown	unknown	gnl\|CDD\|368753
NZ_CP011350.1\|WP_000853368.1\|698343_699204_-\|type-I-C-CRISPR-associated-protein-Cas7/Csd2	cas7	COG3649_cas7_CAS-I-C	gnl\|CDD\|226175
NZ_CP011350.1\|WP_014481878.1\|702051_704421_-\|CRISPR-associated-helicase/endonuclease-Cas3	cas3	COG1203_cas3_CAS-I	gnl\|CDD\|224124
NZ_CP011350.1\|WP_000114815.1\|693120_693348_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011350.1\|WP_103653709.1\|686848_689251_-\|DEAD/DEAH-box-helicase	unknown	unknown	gnl\|CDD\|223627
NZ_CP011350.1\|WP_000724860.1\|709533_709926_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011350.1\|WP_000041871.1\|719766_720714_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271175
NZ_CP011350.1\|WP_113623483.1\|696083_696239_-\|hypothetical-protein	cas7	COG3649_cas7_CAS-I-C	gnl\|CDD\|187820
NZ_CP011350.1\|WP_000710696.1\|694718_695144_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011350.1\|WP_000372779.1\|714674_716144_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011350.1\|WP_000372481.1\|712914_714639_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011350.1\|WP_001219637.1\|693363_694455_-\|methyltransferase	unknown	unknown	gnl\|CDD\|274377
NZ_CP011350.1\|WP_000654328.1\|689528_691394_-\|group-II-intron-reverse-transcriptase/maturase	RT	pfam00078_RT_CAS-I:CAS-III	gnl\|CDD\|275209

Protein	Function_ID	Function_description	E-value
NZ_CP011350.1\|WP_000335059.1\|705514_707317_-\|hypothetical-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	7.64325e-11
NZ_CP011350.1\|WP_000118651.1\|699206_701126_-\|type-I-C-CRISPR-associated-protein-Cas8c/Csd1	gnl\|CDD\|187887	cd09757, Cas8c_I-C, CRISPR/Cas system-associated protein Cas8c. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Zn-finger domain containing protein, distant homologs of Cas8 proteins; signature gene for I-C subtype; also known as Csd1 family.	4.95792e-169
NZ_CP011350.1\|WP_000677976.1\|720823_721219_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.82323e-12
NZ_CP011350.1\|WP_003319726.1\|701126_701846_-\|type-I-C-CRISPR-associated-protein-Cas5	gnl\|CDD\|273847	TIGR01876, cas_Cas5d, CRISPR-associated protein Cas5, subtype I-C/DVULG. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This small Cas family is represented by CT1134 of Chlorobium tepidum. This family belongs to a set of several Cas protein families, one each for a number of different CRISPR/Cas subtypes, that share a region of N-terminal sequence similarity modeled by TIGR02593. This family represents the Dvulg subtype of CRISPR/Cas locus.	1.61876e-96
NZ_CP011350.1\|WP_000610947.1\|708658_709441_-\|ImmA/IrrE-family-metallo-endopeptidase	gnl\|CDD\|368753	pfam06114, Peptidase_M78, IrrE N-terminal-like domain. This entry includes the catalytic domain of the protein ImmA, which is a metallopeptidase containing an HEXXH zinc-binding motif from peptidase family M78. ImmA is encoded on a conjugative transposon. Conjugating bacteria are able to transfer conjugative transposons that can, for example, confer resistance to antibiotics. The transposon is integrated into the chromosome, but during conjugation excises itself and then moves to the recipient bacterium and re-integrate into its chromosome. Typically a conjugative tranposon encodes only the proteins required for this activity and the proteins that regulate it. During exponential growth, the ICEBs1 transposon of Bacillus subtilis is inactivated by the immunity repressor protein ImmR, which is encoded by the transposon and represses the genes for excision and transfer. Cleavage of ImmR relaxes repression and allows transfer of the transposon. ImmA has been shown to be essential for the cleavage of ImmR. This domain is also found in in metalloprotease IrrE, a central regulator of DNA damage repair in Deinococcaceae, HTH-type transcriptional regulators RamB and PrpC.	6.33521e-07
NZ_CP011350.1\|WP_000853368.1\|698343_699204_-\|type-I-C-CRISPR-associated-protein-Cas7/Csd2	gnl\|CDD\|226175	COG3649, COG3649, CRISPR system related protein [Defense mechanisms].	1.09266e-135
NZ_CP011350.1\|WP_014481878.1\|702051_704421_-\|CRISPR-associated-helicase/endonuclease-Cas3	gnl\|CDD\|224124	COG1203, COG1203, CRISPR-associated helicase Cas3 [Defense mechanisms].	2.06683e-76
NZ_CP011350.1\|WP_103653709.1\|686848_689251_-\|DEAD/DEAH-box-helicase	gnl\|CDD\|223627	COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair].	1.89065e-07
NZ_CP011350.1\|WP_000041871.1\|719766_720714_+\|site-specific-integrase	gnl\|CDD\|271175	cd00397, DNA_BRE_C, DNA breaking-rejoining enzymes, C-terminal catalytic domain. The DNA breaking-rejoining enzyme superfamily includes type IB topoisomerases and tyrosine based site-specific recombinases (integrases) that share the same fold in their catalytic domain containing conserved active site residues. The best-studied members of this diverse superfamily include Human topoisomerase I, the bacteriophage lambda integrase, the bacteriophage P1 Cre recombinase, the yeast Flp recombinase, and the bacterial XerD/C recombinases. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. The enzymes differ in that topoisomerases cleave and then rejoin the same 5' and 3' termini, whereas a site-specific recombinase transfers a 5' hydroxyl generated by recombinase cleavage to a new 3' phosphate partner located in a different duplex region. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	1.04048e-15
NZ_CP011350.1\|WP_113623483.1\|696083_696239_-\|hypothetical-protein	gnl\|CDD\|187820	cd09689, Cas7_I-C, CRISPR/Cas system-associated RAMP superfamily protein Cas7. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas7 is a RAMP superfamily protein; Subunit of the Cascade complex; also known as Csd2 family.	2.60175e-14
NZ_CP011350.1\|WP_001219637.1\|693363_694455_-\|methyltransferase	gnl\|CDD\|274377	TIGR02987, m6_adenine_and_m5_cytosine_DNA_methyltransferase, type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family. Members of this family are the m6-adenine DNA methyltransferase protein, or domain of a fusion protein that also carries m5 cytosine methyltransferase activity, of type II restriction systems of the Alw26I/Eco31I/Esp3I family. A methyltransferase of this family is alway accompanied by a type II restriction endonuclease from the Alw26I/Eco31I/Esp3I family (TIGR02986) and by an adenine-specific modification methyltransferase. Members of this family are unusual in that regions of similarity to homologs outside this family are circularly permuted. [DNA metabolism, Restriction/modification].	0.00066001
NZ_CP011350.1\|WP_000654328.1\|689528_691394_-\|group-II-intron-reverse-transcriptase/maturase	gnl\|CDD\|275209	TIGR04416, hypothetical_protein, group II intron reverse transcriptase/maturase. Members of this protein family are multifunctional proteins encoded in most examples of bacterial group II introns. These group II introns are mobile selfish genetic elements, often with multiple highly identical copies per genome. Member proteins have an N-terminal reverse transcriptase (RNA-directed DNA polymerase) domain (pfam00078) followed by an RNA-binding maturase domain (pfam08388). Some members of this family may have an additional C-terminal DNA endonuclease domain that this model does not cover. A region of the group II intron ribozyme structure should be detectable nearby on the genome by Rfam model RF00029. [Mobile and extrachromosomal element functions, Other].	4.217e-121

>NZ_CP011350.1|WP_014481878.1|702051_704421_-|CRISPR-associated-helicase/endonuclease-Cas3
MTYIAHIRESDSQVQTVEEHLLRVKELAETYGEKIGIKHLAGLAGMLHDMGKYTNEFKEYILEAVNNPNSPPKKGSVDHSTAGGKLLYQLFHTENMIPYKGIISEIVGNAIISHHGYLQDFLNPDLESPYLNRVRDKQLRGFDVTQQFFFKHVMKEKDFHEYVDKATVELESFLLKESPENAEKQLMFLTKFIFSTLIDADRTNTRLFEEEKSVESVINVDELFEKYYERLMTKINSFKKQQNANTPINMLRADMSDQCDQFAERPSGIYTLSIPTGGGKTLASLRYALKHANTHNKKRIIYVVPFTTIIEQNAEEVRRILEDEENILEHHSNIVEEVNEHDENEDGVVSIQQKLKLAKDNWDSPIIFTTMVQFLNVFYAKGNRNTRRLHNLSEAIIIFDEVQKVPVSCVSLFNQALNFLKIYTRSSIVLCTATQPALDFVEQKLDINTDAEMINNLDHVIEAFKRVKIIDQATNEIFNKDKLKTFIHTKIEEVQSILIVLNTKSVVRDLYTQLQSQGLNIPIYHLSTTMCAAHRHKILEEVRECLKEGRKIICISTQLIEAGVDVSFECVVRSLSGLDYIAQAAGRCNRHGEKGIQNVYVIDYEEENLSHLKEIKIGKKITKKILMDLKHNDKIHGGHILSREAMKRYFKEYYREFESDLDYFIPKLKKNMTELLSVPRIENSYRRAYIHKHDKKDIPLFIINSYQTAAKHFNVIDDITTSVIVPYEEGKDIIAELNSNNSIEDLTRLLRKAQQYTVNVFNYEKEKLIINDGLVYYLDGKILALKESA
>NZ_CP011350.1|WP_003319726.1|701126_701846_-|type-I-C-CRISPR-associated-protein-Cas5
MRNSIEFEVFGDYALFTDPLMKMGGEKLTYQVPTYQAIKGIVESIYWKPTLLMIVDKIRIMNAIKMESKGIRPIEYGGGNTLANYTYLKNVRYQVQAHFIFNHHRPDLAFDRNEYKHHNILKRSLKVGGRRDIFLGTRECQGYVEPCVFGEGEGFYDNYGGDIHLGTMVHGLNYPDETGRNELEVRLWNPVMRDGIIQFIRPEECTKIRKISKMDPKIFDSSNVESVDELIKQLEEGGE
>NZ_CP011350.1|WP_000118651.1|699206_701126_-|type-I-C-CRISPR-associated-protein-Cas8c/Csd1
MSWLLNLYETYQSNLDRVGKIEKKYNGQEYTLLPISHTTQSANIEVLITEEGEFHSATVIDKSDANTLIPCTEDSASRSGTGAYKVPHPLHDKLTYVAGDFGEYGGSKKEEESFGYYIEHLRNWVESPYSTDKLKSIYKYLRKKQLVKDLVETKILWLDENQKLIGKWDKKVEVFLGNKPEIFTVLPAGQEAAFVRFTVYSPNKMLSKVWQDKEIHNSFINFYDGLLDNEDYCYVTGEIKPSTDKHAKKIRNASDQAKLISSNDLRGFTFRGRFTTSNEVANISYDVSQKAHNALKWLINKQGKIIDQRVFLVWGNDAEDVPDIVEDSYSIFSMDIRGTKKREIKSYTHEQFANEVAKAIDGYKNNLSSSENVNILLLDSATTGRLAVLYYRNMDKNLYLNRLKNWHSTCVWEHGYRKNADNEFVKFYGTPSTRDIAFAAYGPKANEKVVKSLMERMLPCIIDERKIPFDIVRSAFQRASNPLSMEKWEWEKTLSITCALINKMEGYQLVLDKENNNRDYLFGRLLAVADVLERKALNNGDQRATNARRYMNSFSQHPERTWRTIQGALQPYQARLGEKVWYYNKLIDEIGSMIKIEDFNNKPLSGKYLLGFYSQRHELYQKKEKNVSLNDVVNIGEEN
>NZ_CP011350.1|WP_000853368.1|698343_699204_-|type-I-C-CRISPR-associated-protein-Cas7/Csd2
MKTLDHKIDFAVVLSVTKANPNGDPLNGNRPRQNYDGHGEISDVAIKRKIRNRLQDMEESIFVQSNDRKVDQFNSLRERAETNVDLVKALKSKDNPHEQFAAIACKEWIDVRSFGQVFAFKGGAGKGVSVGVRGPVSIHTATSVDPIDITSMQITKSVNSEPGKDKGSDTMGMKHRVDFGVYVFYGSINTQLAEKTGFTNEDAEKIKNALVTLFENDASAARPEGSIEVHKVCWWDHNSKLGQYSSAKVHRLLEVKRNIDEPKTIDDYTVLVHELDDLKVEIINGM
>NZ_CP011350.1|WP_113623483.1|696083_696239_-|hypothetical-protein
MHTATSVDPIDITCMQIKKSVNSELGKDKGSDTTGIKHRVDFGVYVFLWKY
>NZ_CP011350.1|WP_000710696.1|694718_695144_-|hypothetical-protein
MKKDCRHLRLVPTVEEHKTRIEANETYQQKSYATSTMSSETRGRLNQMRGCFEAEIILPVGKFQYFKPHAMNEKEAIQEIALFIEGIQEMNIGYVILWRFVGQQSFYSGTKIVAEPKFRKIMRKLKDYLFDYEELIYETEK
>NZ_CP011350.1|WP_001219637.1|693363_694455_-|methyltransferase
MRIGNDLAAGYYPTPLLEGKHLIQLLQMEPERVYACFDPCCGEGTILRSFADEVRQVSIQIDTYGVEVDANRYGKAKEQLDEVVCSDFESMMISHDYFPLIFLNPPYNTELRTENTKSEKMEFNFLKRAHLYLQDGGIMVYVIPYDKFARDDISYFIAKHYEEIGLMRFGDENEEFEQFKQCVFIGRKRAATKNDTYFNDRFANFCENMSDLSFVKKHVNTLAEMVNRKDWAIPELRHQNKLIFTSRVDYKSAYEGVGKSEGISSFKKRLNRGNGYSLQGEKTAAERAKMPIASGQLGLLLITGVADGLLGEGDTLHAVRGSENVYYETSFEPLQKTTKEVVLQKRRAKFIIATPTGEVKELV
>NZ_CP011350.1|WP_000114815.1|693120_693348_-|hypothetical-protein
MSVLLGIGALFIVWEFSNRMFRIAIVLTVICLCASQLGAGTYLEVLEQFSAFQGAGNMLHAAEQSLPEWKQFIDF
>NZ_CP011350.1|WP_000654328.1|689528_691394_-|group-II-intron-reverse-transcriptase/maturase
MKDNKQFPQNEKELKLALDSMYRIAKESSKPFYNLIELMKNEQTILTAIHNIKGNKGSKTAGTDGKTMDYYLQMGRDKLMSLIRRNINNYQPSPVRRKYIPKSNGKQRPLGIPNMIDRIIQEIAKIVIEPIAEAKFYHYSFGFRPMRSAEQAIAETLERIRRSKTYWVIEGDIKGYFDNINHNKLIEIMWKIGIRDKRVLMMIKKMLKAGIMEEGKVRDNVSGSPQGGIISPLLANIYLNYFDWEIARMFQEHPARYKVKDVSRNGLQRVRQRHEDTFLIRYADDWVILCKSEGNAKRILKKVEKYFNHQLKLELSKEKTLITDVRTNRVNFLGFWIFAEEHRLRKGNIQGKAIPNMDKAKLKIKEINKNIKTLYDHRGNKSKQVAIIESINSKIVGIANYYKIANVSTIFQGFDKRIHYAQWRTWLFMNNRRGRYYQLTTPADTLLNRRDRHKEQKSKVFFIEEHGAKVGITKFAFTPKRNAMKVNLLMSPYTDNGRSIYKRTTGKREALERPNFFQEEIPFYQLNNRYPIYNFEFYLNREYAFNRDRGKCNCCKVQLNEWNLNTHHKNPKLPLNKVNKVINLVSLCKTCHKLVHNENPVTNTKGGKKIEQLRKLLKEVK
>NZ_CP011350.1|WP_103653709.1|686848_689251_-|DEAD/DEAH-box-helicase
MTAAVDGYFHLKGKKGYRTCVFVPPTLTEKWAKEEIRHLLPDAEIHLIKRTEDLIRIHQAWIQAGRPKPQKPTFFVISFTTMRGDSIKMMPLSYKQTPLSKKSEEEVQRYYKNGYYCSDCGAKLRKKTSSIMVQQANGEQKEVCQYKDFTASDLDTKTNKNSVCADCNSNIWSPKVKTKYASFKEWTKYEEQLVQAIKEGNKPLQKQLELENRVKPYDAKHSGRAYRKVAAVEYIRRKMKHFFDVLIADEIHELKSESAQGTALGSLAKVCKKVVAGTGTLFGGRASDVFYTLWRLFPQKMVKSGFEYSSFMEWNETYGNIERTYYHDGEVTSNIASRGAQGTLDKTKVVPGISPYVFTQFLMDTTINVRLKDVWPNPVELVNVPTILVDMSEEQKQAYEHMKESFEKAIEAAKGTPDAGKLWLSYIRTGNAYPDNMIHYPNYYLDDAGKELVWSNDKFKFDEDCIQPKERELQSILRTEISEGRPTIVYVCDTGSTVKERDVQPRLQKVVEQISGAKVAILRTNTVTPPKRSEWLKDQVNSGVNVIICSLELVKVGLDLLATPTLIFYQLPFSLFALNQAARRHCRIGQTKQCRTFYLGYRETFQQQMAQLIAQKNKAAEAMNGEVTSDGLNAMLGDTGDLQTLLIQNIKSGNQLKGSTEEWTKAASDESKRVLANIGNVITPVFESIEIQFTNWVGKLPGTMDVAFMKEVQFVQRAVECIKKEQVPGVRVKKNVLEIAGEIEDVIRALTTLNTDKRMLVQKQDITFWDSVIVEVDSSKKKGKRKNKVIDGQFEFDLFG
>NZ_CP011350.1|WP_000335059.1|705514_707317_-|hypothetical-protein
MCKCRVCETNNNDFHCNIAGDNICRNCCNDFQLRNFKDSWSGLVKLVKDEMEIYNISECCLKCKGLMRNQRVELTGDGSIINYGYNGKYVFNDMVDSYSYKFFNKKKIVLLESMNSLDITGVYDLAEGYYLLEEYEKAIDLLENLEGKDTDSKVLLLLGKVYFHANNLQAAIDCLLNSIKIHGDNSETYRILGEVYQADNNLINSAYYFNQAIKYFKIDAYDRPNDYFPQYSYLGLAVVYSKLNQHNEVIKSAEKFLESQYSWDTLVEMLYEQRSGEKNYIGFGGFFACATIYELMALSYLEKENLMLAEKYIDRAQELNPENTNIATTKGIIIGRKHNDGKISEYREQISSLRQNIELRASSINKLKTLRPEEQVKLFTGNEEESVWGFLVGKIFDNLKTIENLSPIVTPSQNKAAEEDRYTDLFKSHMDSNLVDTFGWITHTQSRGGYTRKEMGDRGGIGERDIVIRSHQNKDLLMGEALILKGKDTASIKTHTKKIFGYDIGNCNFHIIINWGFSEKPDSVWKDYRKLVISRQEGIYAVIENGETENLYPGINKQGIRTFYTKHSTDVENEVATAIHVYVDVLKQMKREGAELARKK
>NZ_CP011350.1|WP_000373088.1|707726_708644_-|hypothetical-protein
MDQVTNTPETNQDSKCNGIEPYLQDGRKNDRVTHYYILDNNVLSDLAKLAREEQSSFKELMTCYKGTVFIVPEMVMEEAIRNLPGQQWVDEKYLNFYQVMSELHIPIYLESVEHNYQIFAEGYGSKEEAFLQYKEIALNSISNIAIQGELREAKSCKDIEKAYSQSLKDAGERFIFLYAHAMLQDKVNKISILSNEIKGVYNVWKANMRKGELLELVRVTSHEEYCEKLRPVSYNCILVNSLKKNPTLTSEQKKSLLQIMRDSKIIGRNVYYSQKSCNLVDTRADMNNEEFINFIEKHDDYKLAF
>NZ_CP011350.1|WP_000610947.1|708658_709441_-|ImmA/IrrE-family-metallo-endopeptidase
MINSTNIREVIEQNQKILPSILVNVESTIEKGIHFKYKTIESIRNYLMQKTEVLLFPSKSLSYGGMVLYRNGSFYININTLQPKTYENFVWAHEYYHFEFEKDRIKNADDVTFVNNPVLNENERRANLFAAELLINDDVLKTLFQEIKLNYVNDSLEKNVIRLIPAFELPYKTMVIKLAQENLISMEDAERIIDHDYRHNLPQDFDLSILEPTKAIKIDGLNKLLESESVQENMLESDFESIQNLANQHFKQLEAIRMEI
>NZ_CP011350.1|WP_000724860.1|709533_709926_-|hypothetical-protein
MKKIVGENIRIYLEATGRTHQWVMDKGGIPKATFYKLLKGEGDLTKGIEKINELFGIKDDFYFYNSEFKPPLKLEDKLKRSDIRNFAAANYVAVEGEETEFKNTLDTLDDFIRMIELLKPYNNLNRNDFI
>NZ_CP011350.1|WP_000459233.1|711723_712533_+|hypothetical-protein
MFDFELELFNFYSKKLSKWNLVYKYVLKNIIFLVATFISIAALVIISLNIFVEHDIEFDSFYIYMIFFFVYMILFLVCMHYVVVKPAILISVNKYNISFKSKQWQVFICLIVQSYLFKKELLNNDPKFNEESLQFLIQVLKEKKEETEKLNVLKLLSSYGSLFFLFTIPVWSAFNSWVYNHEIKTSAEAIQYLLMLGFLIFMSVFLIWMPFKKNFLEELFSKESSKISDLIKALENINFSLKNFCHLKSEKSGVIKQSTIDSIIKENTN
>NZ_CP011350.1|WP_000372481.1|712914_714639_-|hypothetical-protein
MDQLKQLFQSTLLVAYPLFQNIENNERIFNKWRGLCTLINSDVSYLEDPMYTSVSFKKFANWISYKESQGVGIMEIVAQIEGYRPEVFELLANDIEKEFEILLVKQKQEKKHTEEQQSFIEHSSAGFMYHLTDTIAKNNFTEDKELNAHIAELPDKSNSLVVVSSRFNDGDMKLRGAGELNRWNTLVDSTFVDRVMDDLTADCLDIVTEIWVKSASTESSPVHIGYEEILEMCSMKQVRNGKSYYRKEDRLKIMERLAALASIFIYVNEDNEIVILNDDENPNESLAYKKQRVRRLFVMDEIVFAKDIDTDEMLGIESMNVAPGTFLSKYLYGSEKLTGLLSKKALEYNSKQQRYHKRLTRYLSWRWRIQQAYQHLVHPYSIGGPKGLISVMGVSMNQNPARIRSVFEKTLDDLMRDEVIKEWQYQTPIDEGKCSGRNWLENYWLNLKVTVTPTDELVSLQQELLQKKKITPKNKLMETVVKDPVIEVQDMEIEEIQTSQLEQQQVNRDINWYQQKILQYKEENKCSLRDMAKEIEISPSNLSKLLIGKRKRLSEETHNKLDKWIERQEVVNLL
>NZ_CP011350.1|WP_000372779.1|714674_716144_-|hypothetical-protein
MDQRIEEVNYKLIDNGIFFSVNKTQLARHFLNNVLEIDVCNLNKEEVTKIICEKYGYKLKQLPDEEEIYLFVAHNIMGIKEDKEPYECFNHEVFLVMKDLRKINFMIQEYESKQQVKDIDRYEKKKYQYLAEKLYKAKDVICEYMTGEINSCIYKEVKDWSKPNGFPSSGSFNQMLPSRYAFRGREEEYEMSVFDGLNYKFEFITLQERNELKLLHSNNKDEFNERVDRYIITHEIDNKILSLIEENHVLNKRGMLKQAIEIYKEDMMELFCQIIPLQIEGIIYDYCIELGVSSANIERTSLDRKIEEIVKKDRRFKCHEYFKYDFIELRNTAAHGRLHENVNFKDTANMLILDLMYLCDALNNSNALVVNRMRSLIKRFEENFNNDYVPIDGIVYSFIAKYRDKSLPSIYEKENVIQEIKKYAMSDNFLRYIHIHIMHPSLVSELSPEQKQEIKKIIVYLMRSKEIKERCVNLLKLLADNSKEELVHK
>NZ_CP011350.1|WP_000520262.1|716830_718540_+|hypothetical-protein
MGKSFVIRNQRSLNGETTNAVLVTLKSWQKFVETFEEKYYSYKDTYLEDILQHMTYEERIADVEGFVEKAKPSFSRRAMSAIAEKTGRKHKLYGITNADLEVFLYLHKKCYTNGVIPNVTIHMMWEDYKQYKEELAYIQHSQFYIALKKLSLHNIISIENGLDGRYTIKLTHFINEETEKANPYVYISPVVFTKAFFKLSVAAKKLFLDIAMQQHTETTLKRSLDKQDERGNKTHFGGMYCFLHKKYPHQIRAVIEELTTALPCTGNPLFKICKMQKGVKHTKRYTTLYLSIHSDFLCSKEAGEEQHRDPFTPKATYARKAKFIEAVLQEMNIGELSADMNKFIHVLKHTCHRQIRSVIRGLRDMVDRKEGYPTKIVYTLKKLLHQTSQYQILDTAAKEGIYPLIAQHIPKERNSDREQAVFNFGLHYSMYSLHNIKKMFKNVHALLKQKFAVPVTEESYHRNYLKYQEETLFRKYAYDQGVNLHAYIALEIEMREKLKVRGHKERTIPSDVREWFIEAIDKLPQEKLRVIELPKQFNLLEFMRTFERLVRADVTITAPDQVLHAMETK
>NZ_CP011350.1|WP_000041871.1|719766_720714_+|site-specific-integrase
MSKNINLEETLAAFSAYLTEKGRKQSTIKRYAYDIKDFYKWLRENEKLLHIKSWRELSEADYQTYFSELEDKRKYSQKTRHRIWVVLKKVHMFLGIVSPLDGINFSLIPDQSLNDNDFITEMEEKLLKQTVLSTKGLTERQAKYRPLIMDRNVCIINLVVNYGLSLHELVSLNMSHIKFARNILMVPGENGATRSVFLTMEDTQQLYKYYKTIPEPVRPRQHTDNPLFVAFDFNRGTYRWVYEKDMPKALSEVAIQKMIRLEVKRAGLKRRISAQQMRNTFILRLIKQGVTEKDLVSRMGFKTKISLKRYYQYLQ
>NZ_CP011350.1|WP_000677976.1|720823_721219_+|helix-turn-helix-transcriptional-regulator
MKGNIFGQNLRNLRTLKGISLHKLGIELGVTGSAISSWELGNKEPNFDMVKKIAIYFLVSTDYLFNHQVLDNVEHEKAVVTQLAHKLYGKCEDILLFEEELLSYISYLDFKNKSKHVALKNIENENQEKDS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP011350_1	1.1\|33790\|18\|NZ_CP011350\|CRT	33790-33807	18	NZ_CP011350.1	372960-372977	2	0.889
NZ_CP011350_1	1.1\|33790\|18\|NZ_CP011350\|CRT	33790-33807	18	NZ_CP011350.1	677769-677786	2	0.889
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NZ_CP011352.1	37048-37079	0	1.0

1. spacer 1.1|33790|18|NZ_CP011350|CRT matches to position: 372960-372977, mismatch: 2, identity: 0.889

aagaaaaccagagacaaa	CRISPR spacer
aacaaaaccagagccaaa	Protospacer
** ********** ****

2. spacer 1.1|33790|18|NZ_CP011350|CRT matches to position: 677769-677786, mismatch: 2, identity: 0.889

aagaaaaccagagacaaa	CRISPR spacer
aagaaaaccggagaaaaa	Protospacer
*********.**** ***

3. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to position: 37048-37079, mismatch: 0, identity: 1.0

atacactttttttgatttcttctactatcttc	CRISPR spacer
atacactttttttgatttcttctactatcttc	Protospacer
********************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	409370-409411	0	1.0
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	33826-33867	0	1.0
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	385253-385294	0	1.0
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP010090	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence	387524-387565	0	1.0
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	409286-409315	0	1.0
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	33922-33951	0	1.0
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	385349-385378	0	1.0
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP010090	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence	387620-387649	0	1.0
NZ_CP011350_2	2.1\|697189\|41\|NZ_CP011350\|CRISPRCasFinder	697189-697229	41	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	151839-151879	0	1.0
NZ_CP011350_2	2.1\|697189\|41\|NZ_CP011350\|CRISPRCasFinder	697189-697229	41	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	183365-183405	0	1.0
NZ_CP011350_2	2.1\|697189\|41\|NZ_CP011350\|CRISPRCasFinder	697189-697229	41	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	187590-187630	0	1.0
NZ_CP011350_2	2.1\|697189\|41\|NZ_CP011350\|CRISPRCasFinder	697189-697229	41	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	697189-697229	0	1.0
NZ_CP011350_2	2.1\|697189\|41\|NZ_CP011350\|CRISPRCasFinder	697189-697229	41	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	14656-14696	0	1.0
NZ_CP011350_2	2.1\|697189\|41\|NZ_CP011350\|CRISPRCasFinder	697189-697229	41	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	16727-16767	0	1.0
NZ_CP011350_2	2.1\|697189\|41\|NZ_CP011350\|CRISPRCasFinder	697189-697229	41	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	148530-148570	0	1.0
NZ_CP011350_2	2.1\|697189\|41\|NZ_CP011350\|CRISPRCasFinder	697189-697229	41	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	292337-292377	0	1.0
NZ_CP011350_2	2.1\|697189\|41\|NZ_CP011350\|CRISPRCasFinder	697189-697229	41	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	143291-143331	0	1.0
NZ_CP011350_2	2.2\|697254\|41\|NZ_CP011350\|CRISPRCasFinder	697254-697294	41	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	151774-151814	0	1.0
NZ_CP011350_2	2.2\|697254\|41\|NZ_CP011350\|CRISPRCasFinder	697254-697294	41	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	183300-183340	0	1.0
NZ_CP011350_2	2.2\|697254\|41\|NZ_CP011350\|CRISPRCasFinder	697254-697294	41	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	187525-187565	0	1.0
NZ_CP011350_2	2.2\|697254\|41\|NZ_CP011350\|CRISPRCasFinder	697254-697294	41	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	14591-14631	0	1.0
NZ_CP011350_2	2.2\|697254\|41\|NZ_CP011350\|CRISPRCasFinder	697254-697294	41	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	148465-148505	0	1.0
NZ_CP011350_2	2.2\|697254\|41\|NZ_CP011350\|CRISPRCasFinder	697254-697294	41	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	57727-57767	0	1.0
NZ_CP011350_2	2.2\|697254\|41\|NZ_CP011350\|CRISPRCasFinder	697254-697294	41	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	143226-143266	0	1.0
NZ_CP011350_2	2.2\|697254\|41\|NZ_CP011350\|CRISPRCasFinder	697254-697294	41	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	697254-697294	0	1.0
NZ_CP011350_2	2.2\|697254\|41\|NZ_CP011350\|CRISPRCasFinder	697254-697294	41	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	16792-16832	0	1.0
NZ_CP011350_2	2.2\|697254\|41\|NZ_CP011350\|CRISPRCasFinder	697254-697294	41	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	292402-292442	0	1.0
NZ_CP011350_2	2.3\|697319\|43\|NZ_CP011350\|CRISPRCasFinder	697319-697361	43	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	151707-151749	0	1.0
NZ_CP011350_2	2.3\|697319\|43\|NZ_CP011350\|CRISPRCasFinder	697319-697361	43	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	183233-183275	0	1.0
NZ_CP011350_2	2.3\|697319\|43\|NZ_CP011350\|CRISPRCasFinder	697319-697361	43	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	187458-187500	0	1.0
NZ_CP011350_2	2.3\|697319\|43\|NZ_CP011350\|CRISPRCasFinder	697319-697361	43	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	697319-697361	0	1.0
NZ_CP011350_2	2.3\|697319\|43\|NZ_CP011350\|CRISPRCasFinder	697319-697361	43	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	14524-14566	0	1.0
NZ_CP011350_2	2.3\|697319\|43\|NZ_CP011350\|CRISPRCasFinder	697319-697361	43	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	16857-16899	0	1.0
NZ_CP011350_2	2.3\|697319\|43\|NZ_CP011350\|CRISPRCasFinder	697319-697361	43	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	148398-148440	0	1.0
NZ_CP011350_2	2.3\|697319\|43\|NZ_CP011350\|CRISPRCasFinder	697319-697361	43	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	292467-292509	0	1.0
NZ_CP011350_2	2.3\|697319\|43\|NZ_CP011350\|CRISPRCasFinder	697319-697361	43	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	143159-143201	0	1.0
NZ_CP011350_2	2.4\|697386\|42\|NZ_CP011350\|CRISPRCasFinder	697386-697427	42	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	151641-151682	0	1.0
NZ_CP011350_2	2.4\|697386\|42\|NZ_CP011350\|CRISPRCasFinder	697386-697427	42	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	183167-183208	0	1.0
NZ_CP011350_2	2.4\|697386\|42\|NZ_CP011350\|CRISPRCasFinder	697386-697427	42	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	187392-187433	0	1.0
NZ_CP011350_2	2.4\|697386\|42\|NZ_CP011350\|CRISPRCasFinder	697386-697427	42	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	14458-14499	0	1.0
NZ_CP011350_2	2.4\|697386\|42\|NZ_CP011350\|CRISPRCasFinder	697386-697427	42	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	148332-148373	0	1.0
NZ_CP011350_2	2.4\|697386\|42\|NZ_CP011350\|CRISPRCasFinder	697386-697427	42	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	143093-143134	0	1.0
NZ_CP011350_2	2.4\|697386\|42\|NZ_CP011350\|CRISPRCasFinder	697386-697427	42	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	697386-697427	0	1.0
NZ_CP011350_2	2.4\|697386\|42\|NZ_CP011350\|CRISPRCasFinder	697386-697427	42	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	16924-16965	0	1.0
NZ_CP011350_2	2.4\|697386\|42\|NZ_CP011350\|CRISPRCasFinder	697386-697427	42	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	292534-292575	0	1.0
NZ_CP011350_2	2.5\|697452\|43\|NZ_CP011350\|CRISPRCasFinder	697452-697494	43	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	697452-697494	0	1.0
NZ_CP011350_2	2.5\|697452\|43\|NZ_CP011350\|CRISPRCasFinder	697452-697494	43	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	16990-17032	0	1.0
NZ_CP011350_2	2.5\|697452\|43\|NZ_CP011350\|CRISPRCasFinder	697452-697494	43	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	151574-151616	0	1.0
NZ_CP011350_2	2.5\|697452\|43\|NZ_CP011350\|CRISPRCasFinder	697452-697494	43	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	183100-183142	0	1.0
NZ_CP011350_2	2.5\|697452\|43\|NZ_CP011350\|CRISPRCasFinder	697452-697494	43	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	187325-187367	0	1.0
NZ_CP011350_2	2.5\|697452\|43\|NZ_CP011350\|CRISPRCasFinder	697452-697494	43	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	14391-14433	0	1.0
NZ_CP011350_2	2.5\|697452\|43\|NZ_CP011350\|CRISPRCasFinder	697452-697494	43	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	148265-148307	0	1.0
NZ_CP011350_2	2.5\|697452\|43\|NZ_CP011350\|CRISPRCasFinder	697452-697494	43	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	143026-143068	0	1.0
NZ_CP011350_2	2.6\|697204\|31\|NZ_CP011350\|CRT	697204-697234	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	697204-697234	0	1.0
NZ_CP011350_2	2.6\|697204\|31\|NZ_CP011350\|CRT	697204-697234	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	16742-16772	0	1.0
NZ_CP011350_2	2.6\|697204\|31\|NZ_CP011350\|CRT	697204-697234	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	292352-292382	0	1.0
NZ_CP011350_2	2.6\|697204\|31\|NZ_CP011350\|CRT	697204-697234	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	151834-151864	0	1.0
NZ_CP011350_2	2.6\|697204\|31\|NZ_CP011350\|CRT	697204-697234	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	183360-183390	0	1.0
NZ_CP011350_2	2.6\|697204\|31\|NZ_CP011350\|CRT	697204-697234	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	187585-187615	0	1.0
NZ_CP011350_2	2.6\|697204\|31\|NZ_CP011350\|CRT	697204-697234	31	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	14651-14681	0	1.0
NZ_CP011350_2	2.6\|697204\|31\|NZ_CP011350\|CRT	697204-697234	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	148525-148555	0	1.0
NZ_CP011350_2	2.6\|697204\|31\|NZ_CP011350\|CRT	697204-697234	31	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	143286-143316	0	1.0
NZ_CP011350_2	2.7\|697269\|31\|NZ_CP011350\|CRT	697269-697299	31	NZ_CP047087	Bacillus paranthracis strain BC307 plasmid pCE2, complete sequence	65792-65822	0	1.0
NZ_CP011350_2	2.7\|697269\|31\|NZ_CP011350\|CRT	697269-697299	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	697269-697299	0	1.0
NZ_CP011350_2	2.7\|697269\|31\|NZ_CP011350\|CRT	697269-697299	31	NC_018510	Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence	186510-186540	0	1.0
NZ_CP011350_2	2.7\|697269\|31\|NZ_CP011350\|CRT	697269-697299	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	16807-16837	0	1.0
NZ_CP011350_2	2.7\|697269\|31\|NZ_CP011350\|CRT	697269-697299	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	292417-292447	0	1.0
NZ_CP011350_2	2.7\|697269\|31\|NZ_CP011350\|CRT	697269-697299	31	CP041751	Bacillus paranthracis strain NCCP 14796 plasmid unnamed1, complete sequence	5829-5859	0	1.0
NZ_CP011350_2	2.7\|697269\|31\|NZ_CP011350\|CRT	697269-697299	31	NZ_CP017573	Bacillus thuringiensis strain SCG04-02 plasmid PSCG61, complete sequence	10722-10752	0	1.0
NZ_CP011350_2	2.7\|697269\|31\|NZ_CP011350\|CRT	697269-697299	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	151769-151799	0	1.0
NZ_CP011350_2	2.7\|697269\|31\|NZ_CP011350\|CRT	697269-697299	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	183295-183325	0	1.0
NZ_CP011350_2	2.7\|697269\|31\|NZ_CP011350\|CRT	697269-697299	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	187520-187550	0	1.0
NZ_CP011350_2	2.7\|697269\|31\|NZ_CP011350\|CRT	697269-697299	31	NZ_CP029456	Bacillus cereus strain FORC087 plasmid pFORC087.2, complete sequence	42954-42984	0	1.0
NZ_CP011350_2	2.7\|697269\|31\|NZ_CP011350\|CRT	697269-697299	31	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	14586-14616	0	1.0
NZ_CP011350_2	2.7\|697269\|31\|NZ_CP011350\|CRT	697269-697299	31	NZ_CP013280	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence	80319-80349	0	1.0
NZ_CP011350_2	2.7\|697269\|31\|NZ_CP011350\|CRT	697269-697299	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	148460-148490	0	1.0
NZ_CP011350_2	2.7\|697269\|31\|NZ_CP011350\|CRT	697269-697299	31	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	57722-57752	0	1.0
NZ_CP011350_2	2.7\|697269\|31\|NZ_CP011350\|CRT	697269-697299	31	NC_011656	Bacillus cereus AH187 plasmid pAH187_45, complete sequence	9678-9708	0	1.0
NZ_CP011350_2	2.7\|697269\|31\|NZ_CP011350\|CRT	697269-697299	31	NZ_CP039726	Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence	89365-89395	0	1.0
NZ_CP011350_2	2.7\|697269\|31\|NZ_CP011350\|CRT	697269-697299	31	NC_018685	Bacillus thuringiensis MC28 plasmid pMC95, complete sequence	28739-28769	0	1.0
NZ_CP011350_2	2.7\|697269\|31\|NZ_CP011350\|CRT	697269-697299	31	NZ_CP009350	Bacillus thuringiensis HD1002 plasmid 4, complete sequence	1706-1736	0	1.0
NZ_CP011350_2	2.7\|697269\|31\|NZ_CP011350\|CRT	697269-697299	31	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	143221-143251	0	1.0
NZ_CP011350_2	2.7\|697269\|31\|NZ_CP011350\|CRT	697269-697299	31	NZ_CP033793	Bacillus sp. FDAARGOS_527 plasmid unnamed6, complete sequence	7582-7612	0	1.0
NZ_CP011350_2	2.8\|697334\|33\|NZ_CP011350\|CRT	697334-697366	33	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	697334-697366	0	1.0
NZ_CP011350_2	2.8\|697334\|33\|NZ_CP011350\|CRT	697334-697366	33	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	16872-16904	0	1.0
NZ_CP011350_2	2.8\|697334\|33\|NZ_CP011350\|CRT	697334-697366	33	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	292482-292514	0	1.0
NZ_CP011350_2	2.8\|697334\|33\|NZ_CP011350\|CRT	697334-697366	33	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	151702-151734	0	1.0
NZ_CP011350_2	2.8\|697334\|33\|NZ_CP011350\|CRT	697334-697366	33	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	183228-183260	0	1.0
NZ_CP011350_2	2.8\|697334\|33\|NZ_CP011350\|CRT	697334-697366	33	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	187453-187485	0	1.0
NZ_CP011350_2	2.8\|697334\|33\|NZ_CP011350\|CRT	697334-697366	33	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	14519-14551	0	1.0
NZ_CP011350_2	2.8\|697334\|33\|NZ_CP011350\|CRT	697334-697366	33	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	148393-148425	0	1.0
NZ_CP011350_2	2.8\|697334\|33\|NZ_CP011350\|CRT	697334-697366	33	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	143154-143186	0	1.0
NZ_CP011350_2	2.9\|697401\|32\|NZ_CP011350\|CRT	697401-697432	32	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	151636-151667	0	1.0
NZ_CP011350_2	2.9\|697401\|32\|NZ_CP011350\|CRT	697401-697432	32	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	183162-183193	0	1.0
NZ_CP011350_2	2.9\|697401\|32\|NZ_CP011350\|CRT	697401-697432	32	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	187387-187418	0	1.0
NZ_CP011350_2	2.9\|697401\|32\|NZ_CP011350\|CRT	697401-697432	32	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	697401-697432	0	1.0
NZ_CP011350_2	2.9\|697401\|32\|NZ_CP011350\|CRT	697401-697432	32	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	14453-14484	0	1.0
NZ_CP011350_2	2.9\|697401\|32\|NZ_CP011350\|CRT	697401-697432	32	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	16939-16970	0	1.0
NZ_CP011350_2	2.9\|697401\|32\|NZ_CP011350\|CRT	697401-697432	32	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	148327-148358	0	1.0
NZ_CP011350_2	2.9\|697401\|32\|NZ_CP011350\|CRT	697401-697432	32	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	292549-292580	0	1.0
NZ_CP011350_2	2.9\|697401\|32\|NZ_CP011350\|CRT	697401-697432	32	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	143088-143119	0	1.0
NZ_CP011350_2	2.10\|697467\|33\|NZ_CP011350\|CRT	697467-697499	33	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	697467-697499	0	1.0
NZ_CP011350_2	2.10\|697467\|33\|NZ_CP011350\|CRT	697467-697499	33	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	17005-17037	0	1.0
NZ_CP011350_2	2.10\|697467\|33\|NZ_CP011350\|CRT	697467-697499	33	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	151569-151601	0	1.0
NZ_CP011350_2	2.10\|697467\|33\|NZ_CP011350\|CRT	697467-697499	33	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	183095-183127	0	1.0
NZ_CP011350_2	2.10\|697467\|33\|NZ_CP011350\|CRT	697467-697499	33	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	187320-187352	0	1.0
NZ_CP011350_2	2.10\|697467\|33\|NZ_CP011350\|CRT	697467-697499	33	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	14386-14418	0	1.0
NZ_CP011350_2	2.10\|697467\|33\|NZ_CP011350\|CRT	697467-697499	33	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	148260-148292	0	1.0
NZ_CP011350_2	2.10\|697467\|33\|NZ_CP011350\|CRT	697467-697499	33	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	143021-143053	0	1.0
NZ_CP011350_3	3.1\|704537\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704537-704569	33	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143859-143891	0	1.0
NZ_CP011350_3	3.1\|704537\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704537-704569	33	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	176025-176057	0	1.0
NZ_CP011350_3	3.1\|704537\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704537-704569	33	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	180250-180282	0	1.0
NZ_CP011350_3	3.1\|704537\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704537-704569	33	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	7325-7357	0	1.0
NZ_CP011350_3	3.1\|704537\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704537-704569	33	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	141190-141222	0	1.0
NZ_CP011350_3	3.1\|704537\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704537-704569	33	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135922-135954	0	1.0
NZ_CP011350_3	3.1\|704537\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704537-704569	33	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704537-704569	0	1.0
NZ_CP011350_3	3.1\|704537\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704537-704569	33	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24075-24107	0	1.0
NZ_CP011350_3	3.1\|704537\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704537-704569	33	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6430-6462	0	1.0
NZ_CP011350_3	3.2\|704602\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704602-704635	34	NZ_KX258624	Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence	50231-50264	0	1.0
NZ_CP011350_3	3.2\|704602\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704602-704635	34	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704602-704635	0	1.0
NZ_CP011350_3	3.2\|704602\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704602-704635	34	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24140-24173	0	1.0
NZ_CP011350_3	3.2\|704602\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704602-704635	34	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6495-6528	0	1.0
NZ_CP011350_3	3.2\|704602\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704602-704635	34	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143793-143826	0	1.0
NZ_CP011350_3	3.2\|704602\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704602-704635	34	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175959-175992	0	1.0
NZ_CP011350_3	3.2\|704602\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704602-704635	34	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	180184-180217	0	1.0
NZ_CP011350_3	3.2\|704602\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704602-704635	34	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	7258-7291	0	1.0
NZ_CP011350_3	3.2\|704602\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704602-704635	34	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	141124-141157	0	1.0
NZ_CP011350_3	3.2\|704602\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704602-704635	34	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135856-135889	0	1.0
NZ_CP011350_3	3.3\|704668\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704668-704700	33	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143728-143760	0	1.0
NZ_CP011350_3	3.3\|704668\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704668-704700	33	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175894-175926	0	1.0
NZ_CP011350_3	3.3\|704668\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704668-704700	33	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	180119-180151	0	1.0
NZ_CP011350_3	3.3\|704668\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704668-704700	33	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	141059-141091	0	1.0
NZ_CP011350_3	3.3\|704668\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704668-704700	33	CP041751	Bacillus paranthracis strain NCCP 14796 plasmid unnamed1, complete sequence	10913-10945	0	1.0
NZ_CP011350_3	3.3\|704668\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704668-704700	33	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135791-135823	0	1.0
NZ_CP011350_3	3.3\|704668\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704668-704700	33	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704668-704700	0	1.0
NZ_CP011350_3	3.3\|704668\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704668-704700	33	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24206-24238	0	1.0
NZ_CP011350_3	3.3\|704668\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704668-704700	33	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6561-6593	0	1.0
NZ_CP011350_3	3.3\|704668\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704668-704700	33	CP024689	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-5-125K, complete sequence	6571-6603	0	1.0
NZ_CP011350_3	3.3\|704668\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704668-704700	33	NC_018685	Bacillus thuringiensis MC28 plasmid pMC95, complete sequence	23122-23154	0	1.0
NZ_CP011350_3	3.3\|704668\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704668-704700	33	NZ_CP033793	Bacillus sp. FDAARGOS_527 plasmid unnamed6, complete sequence	2200-2232	0	1.0
NZ_CP011350_3	3.4\|704733\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704733-704766	34	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704733-704766	0	1.0
NZ_CP011350_3	3.4\|704733\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704733-704766	34	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24271-24304	0	1.0
NZ_CP011350_3	3.4\|704733\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704733-704766	34	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6626-6659	0	1.0
NZ_CP011350_3	3.4\|704733\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704733-704766	34	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143662-143695	0	1.0
NZ_CP011350_3	3.4\|704733\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704733-704766	34	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175828-175861	0	1.0
NZ_CP011350_3	3.4\|704733\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704733-704766	34	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	180053-180086	0	1.0
NZ_CP011350_3	3.4\|704733\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704733-704766	34	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	7126-7159	0	1.0
NZ_CP011350_3	3.4\|704733\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704733-704766	34	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140993-141026	0	1.0
NZ_CP011350_3	3.4\|704733\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704733-704766	34	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135725-135758	0	1.0
NZ_CP011350_3	3.5\|704799\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704799-704831	33	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	151946-151978	0	1.0
NZ_CP011350_3	3.5\|704799\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704799-704831	33	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704799-704831	0	1.0
NZ_CP011350_3	3.5\|704799\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704799-704831	33	NZ_CP053974	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed5, complete sequence	2157-2189	0	1.0
NZ_CP011350_3	3.5\|704799\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704799-704831	33	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24337-24369	0	1.0
NZ_CP011350_3	3.5\|704799\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704799-704831	33	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	243847-243879	0	1.0
NZ_CP011350_3	3.5\|704799\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704799-704831	33	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6692-6724	0	1.0
NZ_CP011350_3	3.5\|704799\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704799-704831	33	NZ_CP009346	Bacillus thuringiensis HD1002 plasmid 5, complete sequence	3933-3965	0	1.0
NZ_CP011350_3	3.5\|704799\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704799-704831	33	NZ_CP045027	Bacillus thuringiensis strain JW-1 plasmid p5, complete sequence	3931-3963	0	1.0
NZ_CP011350_3	3.5\|704799\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704799-704831	33	CP013282	Bacillus phage pGIL02, complete sequence	3933-3965	0	1.0
NZ_CP011350_3	3.5\|704799\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704799-704831	33	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143597-143629	0	1.0
NZ_CP011350_3	3.5\|704799\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704799-704831	33	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175763-175795	0	1.0
NZ_CP011350_3	3.5\|704799\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704799-704831	33	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	179988-180020	0	1.0
NZ_CP011350_3	3.5\|704799\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704799-704831	33	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	7062-7094	0	1.0
NZ_CP011350_3	3.5\|704799\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704799-704831	33	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140928-140960	0	1.0
NZ_CP011350_3	3.5\|704799\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704799-704831	33	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135660-135692	0	1.0
NZ_CP011350_3	3.5\|704799\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704799-704831	33	NC_005258	Bacillus phage Bam35c, complete genome	10971-11003	0	1.0
NZ_CP011350_3	3.5\|704799\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704799-704831	33	AY257527	Bacillus thuringiensis bacteriophage Bam35c, complete genome	10971-11003	0	1.0
NZ_CP011350_3	3.5\|704799\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704799-704831	33	AJ536073	Bacillus phage pGIL01, complete genome	10969-11001	0	1.0
NZ_CP011350_3	3.6\|704864\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704864-704896	33	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143532-143564	0	1.0
NZ_CP011350_3	3.6\|704864\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704864-704896	33	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175698-175730	0	1.0
NZ_CP011350_3	3.6\|704864\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704864-704896	33	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	179923-179955	0	1.0
NZ_CP011350_3	3.6\|704864\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704864-704896	33	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	6997-7029	0	1.0
NZ_CP011350_3	3.6\|704864\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704864-704896	33	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140863-140895	0	1.0
NZ_CP011350_3	3.6\|704864\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704864-704896	33	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135595-135627	0	1.0
NZ_CP011350_3	3.6\|704864\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704864-704896	33	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704864-704896	0	1.0
NZ_CP011350_3	3.6\|704864\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704864-704896	33	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24402-24434	0	1.0
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NZ_CP004871	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB46, complete sequence	26388-26419	0	1.0
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143468-143499	0	1.0
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175634-175665	0	1.0
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	179859-179890	0	1.0
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NC_023074	Bacillus thuringiensis serovar tenebrionis str. YBT-1765 plasmid pBMB165, complete sequence	37573-37604	0	1.0
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704929-704960	0	1.0
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NZ_CP011352	Bacillus thuringiensis strain YC-10 plasmid pYC4, complete sequence	37048-37079	0	1.0
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	6933-6964	0	1.0
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24467-24498	0	1.0
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NZ_CP013060	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-5, complete sequence	9632-9663	0	1.0
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140799-140830	0	1.0
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135531-135562	0	1.0
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NZ_CP010095	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB47, complete sequence	26388-26419	0	1.0
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	MK843319	Bacillus phage vB_BthS-TP21T, complete genome	34443-34474	0	1.0
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	KT970646	Bacillus phage phiS58, complete genome	34443-34474	0	1.0
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	KJ024807	Bacillus phage vB_BtS_BMBtp3, complete genome	34642-34673	0	1.0
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NC_025424	Bacillus phage Waukesha92, complete genome	11483-11514	0	1.0
NZ_CP011350_3	3.8\|704993\|35\|NZ_CP011350\|CRISPRCasFinder,CRT,PILER-CR	704993-705027	35	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704993-705027	0	1.0
NZ_CP011350_3	3.8\|704993\|35\|NZ_CP011350\|CRISPRCasFinder,CRT,PILER-CR	704993-705027	35	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24531-24565	0	1.0
NZ_CP011350_3	3.8\|704993\|35\|NZ_CP011350\|CRISPRCasFinder,CRT,PILER-CR	704993-705027	35	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6757-6791	0	1.0
NZ_CP011350_3	3.8\|704993\|35\|NZ_CP011350\|CRISPRCasFinder,CRT,PILER-CR	704993-705027	35	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143401-143435	0	1.0
NZ_CP011350_3	3.8\|704993\|35\|NZ_CP011350\|CRISPRCasFinder,CRT,PILER-CR	704993-705027	35	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175567-175601	0	1.0
NZ_CP011350_3	3.8\|704993\|35\|NZ_CP011350\|CRISPRCasFinder,CRT,PILER-CR	704993-705027	35	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	179792-179826	0	1.0
NZ_CP011350_3	3.8\|704993\|35\|NZ_CP011350\|CRISPRCasFinder,CRT,PILER-CR	704993-705027	35	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140732-140766	0	1.0
NZ_CP011350_3	3.8\|704993\|35\|NZ_CP011350\|CRISPRCasFinder,CRT,PILER-CR	704993-705027	35	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135464-135498	0	1.0
NZ_CP011350_3	3.9\|705060\|34\|NZ_CP011350\|CRISPRCasFinder,CRT,PILER-CR	705060-705093	34	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143335-143368	0	1.0
NZ_CP011350_3	3.9\|705060\|34\|NZ_CP011350\|CRISPRCasFinder,CRT,PILER-CR	705060-705093	34	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175501-175534	0	1.0
NZ_CP011350_3	3.9\|705060\|34\|NZ_CP011350\|CRISPRCasFinder,CRT,PILER-CR	705060-705093	34	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	179726-179759	0	1.0
NZ_CP011350_3	3.9\|705060\|34\|NZ_CP011350\|CRISPRCasFinder,CRT,PILER-CR	705060-705093	34	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140666-140699	0	1.0
NZ_CP011350_3	3.9\|705060\|34\|NZ_CP011350\|CRISPRCasFinder,CRT,PILER-CR	705060-705093	34	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135332-135365	0	1.0
NZ_CP011350_3	3.9\|705060\|34\|NZ_CP011350\|CRISPRCasFinder,CRT,PILER-CR	705060-705093	34	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	705060-705093	0	1.0
NZ_CP011350_3	3.9\|705060\|34\|NZ_CP011350\|CRISPRCasFinder,CRT,PILER-CR	705060-705093	34	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24598-24631	0	1.0
NZ_CP011350_3	3.9\|705060\|34\|NZ_CP011350\|CRISPRCasFinder,CRT,PILER-CR	705060-705093	34	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6890-6923	0	1.0
NZ_CP011350_3	3.10\|705126\|34\|NZ_CP011350\|CRISPRCasFinder,CRT,PILER-CR	705126-705159	34	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143269-143302	0	1.0
NZ_CP011350_3	3.10\|705126\|34\|NZ_CP011350\|CRISPRCasFinder,CRT,PILER-CR	705126-705159	34	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175435-175468	0	1.0
NZ_CP011350_3	3.10\|705126\|34\|NZ_CP011350\|CRISPRCasFinder,CRT,PILER-CR	705126-705159	34	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	179660-179693	0	1.0
NZ_CP011350_3	3.10\|705126\|34\|NZ_CP011350\|CRISPRCasFinder,CRT,PILER-CR	705126-705159	34	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	705126-705159	0	1.0
NZ_CP011350_3	3.10\|705126\|34\|NZ_CP011350\|CRISPRCasFinder,CRT,PILER-CR	705126-705159	34	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	6735-6768	0	1.0
NZ_CP011350_3	3.10\|705126\|34\|NZ_CP011350\|CRISPRCasFinder,CRT,PILER-CR	705126-705159	34	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24664-24697	0	1.0
NZ_CP011350_3	3.10\|705126\|34\|NZ_CP011350\|CRISPRCasFinder,CRT,PILER-CR	705126-705159	34	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140600-140633	0	1.0
NZ_CP011350_3	3.10\|705126\|34\|NZ_CP011350\|CRISPRCasFinder,CRT,PILER-CR	705126-705159	34	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6956-6989	0	1.0
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31103-31144	1	0.976
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31343-31384	1	0.976
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	257369-257398	1	0.967
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	257573-257602	1	0.967
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	257525-257554	1	0.967
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	151616-151645	1	0.967
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	151820-151849	1	0.967
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	151772-151801	1	0.967
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83562-83591	1	0.967
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP015592	Bacillus cereus strain AR156 plasmid pAR460, complete sequence	393617-393646	1	0.967
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	373688-373717	1	0.967
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	30983-31012	1	0.967
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31151-31180	1	0.967
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31283-31312	1	0.967
NZ_CP011350_2	2.7\|697269\|31\|NZ_CP011350\|CRT	697269-697299	31	NC_017206	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence	76595-76625	1	0.968
NZ_CP011350_2	2.7\|697269\|31\|NZ_CP011350\|CRT	697269-697299	31	NC_020383	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence	57458-57488	1	0.968
NZ_CP011350_2	2.7\|697269\|31\|NZ_CP011350\|CRT	697269-697299	31	CP024689	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-5-125K, complete sequence	14979-15009	1	0.968
NZ_CP011350_2	2.10\|697467\|33\|NZ_CP011350\|CRT	697467-697499	33	NZ_CP032610	Bacillus thuringiensis strain QZL38 plasmid p.3, complete sequence	20763-20795	1	0.97
NZ_CP011350_2	2.10\|697467\|33\|NZ_CP011350\|CRT	697467-697499	33	NZ_CP014286	Bacillus thuringiensis strain Bt185 plasmid pBT1850054, complete sequence	47292-47324	1	0.97
NZ_CP011350_3	3.2\|704602\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704602-704635	34	NZ_CP020748	Bacillus mycoides strain Gnyt1 plasmid unnamed5, complete sequence	17567-17600	1	0.971
NZ_CP011350_3	3.2\|704602\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704602-704635	34	NZ_CP011157	Bacillus cereus strain HN001 plasmid pRML02, complete sequence	11311-11344	1	0.971
NZ_CP011350_3	3.3\|704668\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704668-704700	33	NC_017206	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence	81662-81694	1	0.97
NZ_CP011350_3	3.3\|704668\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704668-704700	33	NZ_CP047087	Bacillus paranthracis strain BC307 plasmid pCE2, complete sequence	70876-70908	1	0.97
NZ_CP011350_3	3.3\|704668\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704668-704700	33	NC_018510	Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence	191924-191956	1	0.97
NZ_CP011350_3	3.3\|704668\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704668-704700	33	NC_022882	Bacillus thuringiensis YBT-1518 plasmid pBMB0233, complete sequence	142461-142493	1	0.97
NZ_CP011350_3	3.3\|704668\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704668-704700	33	NC_020383	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence	62525-62557	1	0.97
NZ_CP011350_3	3.3\|704668\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704668-704700	33	NZ_CP013280	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence	74903-74935	1	0.97
NZ_CP011350_3	3.3\|704668\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704668-704700	33	NZ_CP039726	Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence	83949-83981	1	0.97
NZ_CP011350_3	3.3\|704668\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704668-704700	33	NZ_CP009350	Bacillus thuringiensis HD1002 plasmid 4, complete sequence	103733-103765	1	0.97
NZ_CP011350_3	3.3\|704668\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704668-704700	33	NC_022877	Bacillus thuringiensis YBT-1518 plasmid pBMB0232, complete sequence	89648-89680	1	0.97
NZ_CP011350_3	3.3\|704668\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704668-704700	33	CP016198	Bacillus thuringiensis serovar coreanensis strain ST7 plasmid pST7-4, complete sequence	32033-32065	1	0.97
NZ_CP011350_3	3.5\|704799\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704799-704831	33	NZ_CP010096	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMBLin15, complete sequence	10984-11016	1	0.97
NZ_CP011350_3	3.8\|704993\|35\|NZ_CP011350\|CRISPRCasFinder,CRT,PILER-CR	704993-705027	35	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	6865-6899	1	0.971
NZ_CP011350_3	3.10\|705126\|34\|NZ_CP011350\|CRISPRCasFinder,CRT,PILER-CR	705126-705159	34	NZ_CP010096	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMBLin15, complete sequence	12891-12924	1	0.971
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31091-31132	2	0.952
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31331-31372	2	0.952
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NC_011973	Bacillus cereus Q1 plasmid pBc239, complete sequence	212046-212087	2	0.952
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	257513-257554	2	0.952
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	151760-151801	2	0.952
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	409394-409423	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	409214-409243	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	409250-409279	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	33814-33843	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	33958-33987	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	33994-34023	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	385241-385270	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	385385-385414	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	385421-385450	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP010090	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence	387512-387541	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP010090	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence	387656-387685	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP010090	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence	387692-387721	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	257477-257506	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	257501-257530	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	151724-151753	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	151748-151777	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83598-83627	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83634-83663	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83718-83747	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83154-83183	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83166-83195	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83226-83255	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83274-83303	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83322-83351	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83406-83435	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83418-83447	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83478-83507	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31199-31228	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31031-31060	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31043-31072	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31079-31108	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31091-31120	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31319-31348	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31331-31360	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP023002	Bacillus anthracis strain 14RA5914 plasmid pX01, complete sequence	137650-137679	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_AP019732	Bacillus anthracis strain PCr plasmid PCr-pXO1	132257-132286	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP029324	Bacillus anthracis strain 17OD930 plasmid pXO1, complete sequence	155712-155741	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP007665	Bacillus anthracis str. Vollum plasmid unnamed, complete sequence	133581-133610	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP009340	Bacillus anthracis strain Ohio ACB plasmid 1, complete sequence	8584-8613	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP009696	Bacillus anthracis strain RA3 plasmid pXO1, complete sequence	128796-128825	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP009463	Bacillus anthracis strain SK-102 plasmid pXO1, complete sequence	174652-174681	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP009699	Bacillus anthracis strain BA1035 plasmid pXO1, complete sequence	137702-137731	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP009540	Bacillus anthracis str. Sterne plasmid pXO1, complete sequence	107079-107108	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP009324	Bacillus anthracis strain PAK-1 plasmid 1, complete sequence	131724-131753	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP009980	Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed1, complete sequence	39394-39423	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP047132	Bacillus anthracis str. BF1 plasmid pXO1, complete sequence	154832-154861	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	297014-297043	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_KT186230	Bacillus anthracis strain P.NO2 plasmid pXO1, complete sequence	68409-68438	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP022045	Bacillus anthracis strain FDAARGOS_341 plasmid unnamed1, complete sequence	5253-5282	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_007322	Bacillus anthracis str. 'Ames Ancestor' plasmid pXO1, complete sequence	68344-68373	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	53247-53276	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	53391-53420	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	53427-53456	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_012579	Bacillus anthracis str. CDC 684 plasmid pX01, complete sequence	68650-68679	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP015777	Bacillus anthracis strain Tangail-1 plasmid pXO1, complete sequence	68344-68373	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP018904	Bacillus anthracis strain Tyrol 4675 plasmid pXO1, complete sequence	68448-68477	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_AP018444	Bacillus anthracis strain CZC5 plasmid pXO1, complete sequence	68428-68457	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_012656	Bacillus anthracis str. A0248 plasmid pXO1, complete sequence	68608-68637	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_010934	Bacillus cereus strain G9241 plasmid pBCXO1, complete sequence	126452-126481	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP019589	Bacillus anthracis strain SPV842_15 plasmid pX01, complete sequence	68344-68373	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP010853	Bacillus anthracis strain A1144 plasmid pXO1, complete sequence	68313-68342	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP008847	Bacillus anthracis strain HYU01 plasmid pX01, complete sequence	68430-68459	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP006743	Bacillus anthracis str. SVA11 plasmid pXO1, complete sequence	68333-68362	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_AP014834	Bacillus anthracis strain Shikan-NIID plasmid pXO1	68428-68457	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP029806	Bacillus anthracis strain London_499 plasmid pX01, complete sequence	67330-67359	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_001496	Bacillus anthracis virulence plasmid PX01, complete sequence	68293-68322	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_017726	Bacillus anthracis str. H9401 plasmid BAP1, complete sequence	68415-68444	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP014177	Bacillus anthracis strain Stendal plasmid pXO1, complete sequence	68344-68373	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	46283-46312	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	46379-46408	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	46439-46468	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP009597	Bacillus anthracis str. V770-NP-1R plasmid pXO1, complete sequence	42015-42044	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP009901	Bacillus anthracis strain 2002013094 plasmid pXO1, complete sequence	39254-39283	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP009592	Bacillus cereus G9241 plasmid pBCX01, complete sequence	7822-7851	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP009543	Bacillus anthracis strain BA1015 plasmid pXO1, complete sequence	154934-154963	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP010321	Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 1, complete sequence	136519-136548	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP009330	Bacillus anthracis strain K3 plasmid 1, complete sequence	106220-106249	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP009327	Bacillus anthracis strain Vollum 1B plasmid 1, complete sequence	112145-112174	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP001975	Bacillus anthracis str. A16R plasmid pXO1, complete sequence	68429-68458	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP001971	Bacillus anthracis str. A16 plasmid pXO1, complete sequence	68429-68458	2	0.933
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_018503	Bacillus thuringiensis HD-771 plasmid p07, complete sequence	5543-5572	2	0.933
NZ_CP011350_2	2.7\|697269\|31\|NZ_CP011350\|CRT	697269-697299	31	NC_022882	Bacillus thuringiensis YBT-1518 plasmid pBMB0233, complete sequence	134344-134374	2	0.935
NZ_CP011350_2	2.7\|697269\|31\|NZ_CP011350\|CRT	697269-697299	31	NC_022782	Bacillus toyonensis BCT-7112 plasmid pBCT77, complete sequence	43137-43167	2	0.935
NZ_CP011350_2	2.7\|697269\|31\|NZ_CP011350\|CRT	697269-697299	31	NC_022877	Bacillus thuringiensis YBT-1518 plasmid pBMB0232, complete sequence	97767-97797	2	0.935
NZ_CP011350_2	2.10\|697467\|33\|NZ_CP011350\|CRT	697467-697499	33	NC_017204	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT51, complete sequence	43939-43971	2	0.939
NZ_CP011350_2	2.10\|697467\|33\|NZ_CP011350\|CRT	697467-697499	33	CP020757	Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-18, complete sequence	14280-14312	2	0.939
NZ_CP011350_2	2.10\|697467\|33\|NZ_CP011350\|CRT	697467-697499	33	CP020757	Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-18, complete sequence	73882-73914	2	0.939
NZ_CP011350_2	2.10\|697467\|33\|NZ_CP011350\|CRT	697467-697499	33	NZ_CP021064	Bacillus thuringiensis strain ATCC 10792 plasmid poh3, complete sequence	21545-21577	2	0.939
NZ_CP011350_2	2.10\|697467\|33\|NZ_CP011350\|CRT	697467-697499	33	NZ_CP021064	Bacillus thuringiensis strain ATCC 10792 plasmid poh3, complete sequence	81225-81257	2	0.939
NZ_CP011350_3	3.2\|704602\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704602-704635	34	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704733-704766	2	0.941
NZ_CP011350_3	3.2\|704602\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704602-704635	34	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24271-24304	2	0.941
NZ_CP011350_3	3.2\|704602\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704602-704635	34	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6626-6659	2	0.941
NZ_CP011350_3	3.2\|704602\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704602-704635	34	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143662-143695	2	0.941
NZ_CP011350_3	3.2\|704602\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704602-704635	34	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175828-175861	2	0.941
NZ_CP011350_3	3.2\|704602\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704602-704635	34	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	180053-180086	2	0.941
NZ_CP011350_3	3.2\|704602\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704602-704635	34	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	7126-7159	2	0.941
NZ_CP011350_3	3.2\|704602\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704602-704635	34	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140993-141026	2	0.941
NZ_CP011350_3	3.2\|704602\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704602-704635	34	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135725-135758	2	0.941
NZ_CP011350_3	3.3\|704668\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704668-704700	33	NC_022782	Bacillus toyonensis BCT-7112 plasmid pBCT77, complete sequence	48450-48482	2	0.939
NZ_CP011350_3	3.3\|704668\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704668-704700	33	NZ_CP017573	Bacillus thuringiensis strain SCG04-02 plasmid PSCG61, complete sequence	5936-5968	2	0.939
NZ_CP011350_3	3.3\|704668\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704668-704700	33	NZ_CP029456	Bacillus cereus strain FORC087 plasmid pFORC087.2, complete sequence	37904-37936	2	0.939
NZ_CP011350_3	3.3\|704668\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704668-704700	33	NC_011656	Bacillus cereus AH187 plasmid pAH187_45, complete sequence	4616-4648	2	0.939
NZ_CP011350_3	3.4\|704733\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704733-704766	34	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704602-704635	2	0.941
NZ_CP011350_3	3.4\|704733\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704733-704766	34	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24140-24173	2	0.941
NZ_CP011350_3	3.4\|704733\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704733-704766	34	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6495-6528	2	0.941
NZ_CP011350_3	3.4\|704733\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704733-704766	34	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143793-143826	2	0.941
NZ_CP011350_3	3.4\|704733\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704733-704766	34	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175959-175992	2	0.941
NZ_CP011350_3	3.4\|704733\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704733-704766	34	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	180184-180217	2	0.941
NZ_CP011350_3	3.4\|704733\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704733-704766	34	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	7258-7291	2	0.941
NZ_CP011350_3	3.4\|704733\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704733-704766	34	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	141124-141157	2	0.941
NZ_CP011350_3	3.4\|704733\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704733-704766	34	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135856-135889	2	0.941
NZ_CP011350_3	3.4\|704733\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704733-704766	34	NZ_KX258624	Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence	50231-50264	2	0.941
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	409370-409399	3	0.9
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	409418-409447	3	0.9
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	33790-33819	3	0.9
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	33838-33867	3	0.9
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	385217-385246	3	0.9
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	385265-385294	3	0.9
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP010090	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence	387488-387517	3	0.9
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP010090	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence	387536-387565	3	0.9
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83202-83231	3	0.9
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83358-83387	3	0.9
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83382-83411	3	0.9
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83454-83483	3	0.9
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	373712-373741	3	0.9
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	297074-297103	3	0.9
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	297230-297259	3	0.9
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	53271-53300	3	0.9
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	46175-46204	3	0.9
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_011973	Bacillus cereus Q1 plasmid pBc239, complete sequence	212070-212099	3	0.9
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_011973	Bacillus cereus Q1 plasmid pBc239, complete sequence	212106-212135	3	0.9
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_011973	Bacillus cereus Q1 plasmid pBc239, complete sequence	212142-212171	3	0.9
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_014331	Bacillus cereus biovar anthracis str. CI plasmid pCI-XO1, complete sequence	68381-68410	3	0.9
NZ_CP011350_2	2.6\|697204\|31\|NZ_CP011350\|CRT	697204-697234	31	NZ_CP011157	Bacillus cereus strain HN001 plasmid pRML02, complete sequence	123667-123697	3	0.903
NZ_CP011350_2	2.6\|697204\|31\|NZ_CP011350\|CRT	697204-697234	31	NZ_CP014851	Bacillus thuringiensis strain HD12 plasmid pHD120112, complete sequence	21452-21482	3	0.903
NZ_CP011350_2	2.9\|697401\|32\|NZ_CP011350\|CRT	697401-697432	32	MH598512	Bacillus phage Wes44, complete genome	12678-12709	3	0.906
NZ_CP011350_3	3.5\|704799\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704799-704831	33	NZ_AP014870	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK6	7217-7249	3	0.909
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31355-31396	4	0.905
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	373640-373681	4	0.905
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	257417-257446	4	0.867
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	151664-151693	4	0.867
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83130-83159	4	0.867
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	297218-297247	4	0.867
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	46187-46216	4	0.867
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP032411	Brevibacillus laterosporus strain E7593-50 plasmid pAZOBL1, complete sequence	82289-82318	4	0.867
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP032411	Brevibacillus laterosporus strain E7593-50 plasmid pAZOBL1, complete sequence	82601-82630	4	0.867
NZ_CP011350_3	3.10\|705126\|34\|NZ_CP011350\|CRISPRCasFinder,CRT,PILER-CR	705126-705159	34	NZ_CP004882	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMBLin15, complete sequence	12814-12847	4	0.882
NZ_CP011350_3	3.10\|705126\|34\|NZ_CP011350\|CRISPRCasFinder,CRT,PILER-CR	705126-705159	34	NZ_CP011355	Bacillus thuringiensis strain YC-10 plasmid pYC10, complete sequence	9710-9743	4	0.882
NZ_CP011350_3	3.10\|705126\|34\|NZ_CP011350\|CRISPRCasFinder,CRT,PILER-CR	705126-705159	34	NC_006945	Bacillus phage GIL16c, complete genome	12805-12838	4	0.882
NZ_CP011350_3	3.10\|705126\|34\|NZ_CP011350\|CRISPRCasFinder,CRT,PILER-CR	705126-705159	34	AY701338	Bacillus thuringiensis phage GIL16c, complete genome	12805-12838	4	0.882
NZ_CP011350_3	3.2\|704602\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704602-704635	34	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	151419-151452	5	0.853
NZ_CP011350_3	3.2\|704602\|34\|NZ_CP011350\|CRISPRCasFinder,CRT	704602-704635	34	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	243320-243353	5	0.853
NZ_CP011350_3	3.5\|704799\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704799-704831	33	NZ_CP004882	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMBLin15, complete sequence	10906-10938	5	0.848
NZ_CP011350_3	3.5\|704799\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704799-704831	33	NZ_CP011355	Bacillus thuringiensis strain YC-10 plasmid pYC10, complete sequence	7802-7834	5	0.848
NZ_CP011350_3	3.5\|704799\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704799-704831	33	NC_006945	Bacillus phage GIL16c, complete genome	10897-10929	5	0.848
NZ_CP011350_3	3.5\|704799\|33\|NZ_CP011350\|CRISPRCasFinder,CRT	704799-704831	33	AY701338	Bacillus thuringiensis phage GIL16c, complete genome	10897-10929	5	0.848
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP023002	Bacillus anthracis strain 14RA5914 plasmid pX01, complete sequence	137614-137655	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_AP019732	Bacillus anthracis strain PCr plasmid PCr-pXO1	132221-132262	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP029324	Bacillus anthracis strain 17OD930 plasmid pXO1, complete sequence	155676-155717	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP007665	Bacillus anthracis str. Vollum plasmid unnamed, complete sequence	133545-133586	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP009340	Bacillus anthracis strain Ohio ACB plasmid 1, complete sequence	8548-8589	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP009696	Bacillus anthracis strain RA3 plasmid pXO1, complete sequence	128760-128801	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP009463	Bacillus anthracis strain SK-102 plasmid pXO1, complete sequence	174616-174657	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP009699	Bacillus anthracis strain BA1035 plasmid pXO1, complete sequence	137654-137695	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP009540	Bacillus anthracis str. Sterne plasmid pXO1, complete sequence	107043-107084	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP009324	Bacillus anthracis strain PAK-1 plasmid 1, complete sequence	131688-131729	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP009980	Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed1, complete sequence	39358-39399	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP047132	Bacillus anthracis str. BF1 plasmid pXO1, complete sequence	154796-154837	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_KT186230	Bacillus anthracis strain P.NO2 plasmid pXO1, complete sequence	68433-68474	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NC_014331	Bacillus cereus biovar anthracis str. CI plasmid pCI-XO1, complete sequence	68393-68434	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP022045	Bacillus anthracis strain FDAARGOS_341 plasmid unnamed1, complete sequence	5277-5318	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NC_007322	Bacillus anthracis str. 'Ames Ancestor' plasmid pXO1, complete sequence	68368-68409	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NC_012579	Bacillus anthracis str. CDC 684 plasmid pX01, complete sequence	68674-68715	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP015777	Bacillus anthracis strain Tangail-1 plasmid pXO1, complete sequence	68368-68409	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP018904	Bacillus anthracis strain Tyrol 4675 plasmid pXO1, complete sequence	68472-68513	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_AP018444	Bacillus anthracis strain CZC5 plasmid pXO1, complete sequence	68452-68493	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NC_012656	Bacillus anthracis str. A0248 plasmid pXO1, complete sequence	68632-68673	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP019589	Bacillus anthracis strain SPV842_15 plasmid pX01, complete sequence	68368-68409	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP010853	Bacillus anthracis strain A1144 plasmid pXO1, complete sequence	68337-68378	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP006743	Bacillus anthracis str. SVA11 plasmid pXO1, complete sequence	68357-68398	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_AP014834	Bacillus anthracis strain Shikan-NIID plasmid pXO1	68452-68493	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NC_001496	Bacillus anthracis virulence plasmid PX01, complete sequence	68317-68358	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NC_017726	Bacillus anthracis str. H9401 plasmid BAP1, complete sequence	68427-68468	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP014177	Bacillus anthracis strain Stendal plasmid pXO1, complete sequence	68368-68409	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP009597	Bacillus anthracis str. V770-NP-1R plasmid pXO1, complete sequence	42039-42080	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP009901	Bacillus anthracis strain 2002013094 plasmid pXO1, complete sequence	39278-39319	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP009543	Bacillus anthracis strain BA1015 plasmid pXO1, complete sequence	154958-154999	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP010321	Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 1, complete sequence	136543-136584	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP009330	Bacillus anthracis strain K3 plasmid 1, complete sequence	106244-106285	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP009327	Bacillus anthracis strain Vollum 1B plasmid 1, complete sequence	112169-112210	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP001975	Bacillus anthracis str. A16R plasmid pXO1, complete sequence	68453-68494	6	0.857
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP001971	Bacillus anthracis str. A16 plasmid pXO1, complete sequence	68453-68494	6	0.857
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	409202-409231	6	0.8
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	34006-34035	6	0.8
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	385433-385462	6	0.8
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP010090	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence	387704-387733	6	0.8
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83670-83699	6	0.8
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83778-83807	6	0.8
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	373628-373657	6	0.8
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	373772-373801	6	0.8
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	46211-46240	6	0.8
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP023246	Bacillus cereus strain HBL-AI plasmid unnamed1, complete sequence	475063-475092	6	0.8
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_019775	Anabaena cylindrica PCC 7122 plasmid pANACY.06, complete sequence	18529-18558	6	0.8
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP011358	Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence	78140-78169	6	0.8
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_018879	Bacillus thuringiensis Bt407 plasmid BTB_78p, complete sequence	37265-37294	6	0.8
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP013057	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence	77317-77346	6	0.8
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_020382	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-68, complete sequence	43001-43030	6	0.8
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP004872	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB64, complete sequence	17182-17211	6	0.8
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_017205	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT72, complete sequence	24544-24573	6	0.8
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP015156	Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence	23798-23827	6	0.8
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP004869	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB67, complete sequence	54796-54825	6	0.8
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	CP020758	Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-19, complete sequence	54972-55001	6	0.8
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP010093	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB71, complete sequence	16477-16506	6	0.8
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP021065	Bacillus thuringiensis strain ATCC 10792 plasmid poh4, complete sequence	80447-80476	6	0.8
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NC_010934	Bacillus cereus strain G9241 plasmid pBCXO1, complete sequence	126476-126517	7	0.833
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP009592	Bacillus cereus G9241 plasmid pBCX01, complete sequence	7846-7887	7	0.833
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	CP024688	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-4-144K, complete sequence	100147-100176	7	0.767
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	CP024688	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-4-144K, complete sequence	100195-100224	7	0.767
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP022446	Bacillus cereus C1L plasmid pC1L1, complete sequence	382129-382158	7	0.767
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP036355	Bacillus sp. SYJ plasmid unnamed1, complete sequence	80158-80187	7	0.767
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP036355	Bacillus sp. SYJ plasmid unnamed1, complete sequence	80206-80235	7	0.767
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP036355	Bacillus sp. SYJ plasmid unnamed1, complete sequence	80254-80283	7	0.767
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP009636	Bacillus cereus 03BB108 plasmid pBFI_2, complete sequence	133233-133262	7	0.767
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP009636	Bacillus cereus 03BB108 plasmid pBFI_2, complete sequence	133281-133310	7	0.767
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP009636	Bacillus cereus 03BB108 plasmid pBFI_2, complete sequence	133377-133406	7	0.767
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP053962	Bacillus cereus strain FDAARGOS_802 plasmid unnamed2, complete sequence	197609-197638	7	0.767
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP053962	Bacillus cereus strain FDAARGOS_802 plasmid unnamed2, complete sequence	197657-197686	7	0.767
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP053962	Bacillus cereus strain FDAARGOS_802 plasmid unnamed2, complete sequence	197753-197782	7	0.767
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP016317	Bacillus cereus strain M3 plasmid pBCM301, complete sequence	143793-143822	7	0.767
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	68913-68942	7	0.767
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	123575-123604	7	0.767
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP020748	Bacillus mycoides strain Gnyt1 plasmid unnamed5, complete sequence	15259-15288	7	0.767
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_011655	Bacillus cereus AH187 plasmid pAH187_270, complete sequence	50647-50676	7	0.767
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_010924	Bacillus cereus strain AH187 plasmid pCER270, complete sequence	107056-107085	7	0.767
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	CP045776	Bacillus paranthracis strain CFSAN068816 plasmid p1CFSAN068816, complete sequence	96371-96400	7	0.767
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_016792	Bacillus cereus NC7401 plasmid pNCcld, complete sequence	105925-105954	7	0.767
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	MN692959	Marine virus AFVG_117M52, complete genome	47041-47072	7	0.781
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	MN855765	Myoviridae sp. isolate 14, complete genome	5886-5917	7	0.781
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP023002	Bacillus anthracis strain 14RA5914 plasmid pX01, complete sequence	137614-137643	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_AP019732	Bacillus anthracis strain PCr plasmid PCr-pXO1	132221-132250	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP029324	Bacillus anthracis strain 17OD930 plasmid pXO1, complete sequence	155676-155705	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP007665	Bacillus anthracis str. Vollum plasmid unnamed, complete sequence	133545-133574	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP009340	Bacillus anthracis strain Ohio ACB plasmid 1, complete sequence	8548-8577	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP009696	Bacillus anthracis strain RA3 plasmid pXO1, complete sequence	128760-128789	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP009463	Bacillus anthracis strain SK-102 plasmid pXO1, complete sequence	174616-174645	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP009699	Bacillus anthracis strain BA1035 plasmid pXO1, complete sequence	137654-137683	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP009540	Bacillus anthracis str. Sterne plasmid pXO1, complete sequence	107043-107072	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP009324	Bacillus anthracis strain PAK-1 plasmid 1, complete sequence	131688-131717	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP009980	Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed1, complete sequence	39358-39387	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP047132	Bacillus anthracis str. BF1 plasmid pXO1, complete sequence	154796-154825	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_KT186230	Bacillus anthracis strain P.NO2 plasmid pXO1, complete sequence	68445-68474	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP022045	Bacillus anthracis strain FDAARGOS_341 plasmid unnamed1, complete sequence	5289-5318	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_007322	Bacillus anthracis str. 'Ames Ancestor' plasmid pXO1, complete sequence	68380-68409	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_012579	Bacillus anthracis str. CDC 684 plasmid pX01, complete sequence	68686-68715	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP015777	Bacillus anthracis strain Tangail-1 plasmid pXO1, complete sequence	68380-68409	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP018904	Bacillus anthracis strain Tyrol 4675 plasmid pXO1, complete sequence	68484-68513	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_AP018444	Bacillus anthracis strain CZC5 plasmid pXO1, complete sequence	68464-68493	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_012656	Bacillus anthracis str. A0248 plasmid pXO1, complete sequence	68644-68673	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_010934	Bacillus cereus strain G9241 plasmid pBCXO1, complete sequence	126488-126517	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP019589	Bacillus anthracis strain SPV842_15 plasmid pX01, complete sequence	68380-68409	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP010853	Bacillus anthracis strain A1144 plasmid pXO1, complete sequence	68349-68378	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP006743	Bacillus anthracis str. SVA11 plasmid pXO1, complete sequence	68369-68398	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_AP014834	Bacillus anthracis strain Shikan-NIID plasmid pXO1	68464-68493	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_001496	Bacillus anthracis virulence plasmid PX01, complete sequence	68329-68358	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_017726	Bacillus anthracis str. H9401 plasmid BAP1, complete sequence	68439-68468	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP014177	Bacillus anthracis strain Stendal plasmid pXO1, complete sequence	68380-68409	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP009597	Bacillus anthracis str. V770-NP-1R plasmid pXO1, complete sequence	42051-42080	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP009901	Bacillus anthracis strain 2002013094 plasmid pXO1, complete sequence	39290-39319	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP009592	Bacillus cereus G9241 plasmid pBCX01, complete sequence	7858-7887	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP009543	Bacillus anthracis strain BA1015 plasmid pXO1, complete sequence	154970-154999	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP010321	Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 1, complete sequence	136555-136584	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP009330	Bacillus anthracis strain K3 plasmid 1, complete sequence	106256-106285	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP009327	Bacillus anthracis strain Vollum 1B plasmid 1, complete sequence	112181-112210	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP001975	Bacillus anthracis str. A16R plasmid pXO1, complete sequence	68465-68494	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP001971	Bacillus anthracis str. A16 plasmid pXO1, complete sequence	68465-68494	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_014331	Bacillus cereus biovar anthracis str. CI plasmid pCI-XO1, complete sequence	68405-68434	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP022446	Bacillus cereus C1L plasmid pC1L1, complete sequence	471851-471880	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP040343	Bacillus cereus strain DLOU-Weihai plasmid unnamed1, complete sequence	180831-180860	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP040341	Bacillus cereus strain DLOU-Tangshan plasmid unnamed1, complete sequence	233763-233792	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	123299-123328	8	0.733
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP042928	Bacillus cereus strain G1-1 plasmid unnamed, complete sequence	69484-69513	8	0.733
NZ_CP011350_2	2.2\|697254\|41\|NZ_CP011350\|CRISPRCasFinder	697254-697294	41	NZ_CP017573	Bacillus thuringiensis strain SCG04-02 plasmid PSCG61, complete sequence	10727-10767	8	0.805
NZ_CP011350_2	2.2\|697254\|41\|NZ_CP011350\|CRISPRCasFinder	697254-697294	41	NZ_CP029456	Bacillus cereus strain FORC087 plasmid pFORC087.2, complete sequence	42959-42999	8	0.805
NZ_CP011350_2	2.2\|697254\|41\|NZ_CP011350\|CRISPRCasFinder	697254-697294	41	NZ_CP013280	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence	80324-80364	8	0.805
NZ_CP011350_2	2.2\|697254\|41\|NZ_CP011350\|CRISPRCasFinder	697254-697294	41	NC_011656	Bacillus cereus AH187 plasmid pAH187_45, complete sequence	9683-9723	8	0.805
NZ_CP011350_2	2.2\|697254\|41\|NZ_CP011350\|CRISPRCasFinder	697254-697294	41	NZ_CP039726	Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence	89370-89410	8	0.805
NZ_CP011350_2	2.2\|697254\|41\|NZ_CP011350\|CRISPRCasFinder	697254-697294	41	NC_018685	Bacillus thuringiensis MC28 plasmid pMC95, complete sequence	28744-28784	8	0.805
NZ_CP011350_2	2.2\|697254\|41\|NZ_CP011350\|CRISPRCasFinder	697254-697294	41	NZ_CP009350	Bacillus thuringiensis HD1002 plasmid 4, complete sequence	1711-1751	8	0.805
NZ_CP011350_2	2.2\|697254\|41\|NZ_CP011350\|CRISPRCasFinder	697254-697294	41	NZ_CP033793	Bacillus sp. FDAARGOS_527 plasmid unnamed6, complete sequence	7587-7627	8	0.805
NZ_CP011350_2	2.2\|697254\|41\|NZ_CP011350\|CRISPRCasFinder	697254-697294	41	NZ_CP047087	Bacillus paranthracis strain BC307 plasmid pCE2, complete sequence	65777-65817	8	0.805
NZ_CP011350_2	2.2\|697254\|41\|NZ_CP011350\|CRISPRCasFinder	697254-697294	41	NC_018510	Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence	186495-186535	8	0.805
NZ_CP011350_2	2.2\|697254\|41\|NZ_CP011350\|CRISPRCasFinder	697254-697294	41	CP041751	Bacillus paranthracis strain NCCP 14796 plasmid unnamed1, complete sequence	5814-5854	8	0.805
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	KF114879	Leptospira phage LbrZ_5399, complete genome	54875-54906	8	0.75
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	KF114880	Leptospira phage LinZ_10, complete genome	63450-63481	8	0.75
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	KX656785	UNVERIFIED: Leptospira phage Lin_34, complete genome	44219-44250	8	0.75
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	MN693414	Marine virus AFVG_25M246, complete genome	29744-29775	8	0.75
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	MN693468	Marine virus AFVG_25M247, complete genome	26957-26988	8	0.75
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	MN693065	Marine virus AFVG_25M245, complete genome	32108-32139	8	0.75
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	MN693042	Marine virus AFVG_25M244, complete genome	2781-2812	8	0.75
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	410251-410282	8	0.75
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	1331287-1331318	8	0.75
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	245907-245938	8	0.75
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	396540-396571	8	0.75
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	1397510-1397541	8	0.75
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	1648116-1648147	8	0.75
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NZ_CP053834	Arcobacter cloacae strain LMG 26153 plasmid pACLO, complete sequence	67012-67043	8	0.75
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NZ_CP013276	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-1-360K, complete sequence	321345-321376	8	0.75
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	391492-391523	8	0.75
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NZ_CP039722	Bacillus thuringiensis strain BT-59 plasmid p1, complete sequence	99134-99165	8	0.75
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	751194-751225	8	0.75
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	657098-657129	8	0.75
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	1017333-1017364	8	0.75
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	286611-286642	8	0.75
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	557921-557952	8	0.75
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	1180286-1180317	8	0.75
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	608940-608971	8	0.75
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NZ_CP009349	Bacillus thuringiensis HD1002 plasmid 1, complete sequence	37875-37906	8	0.75
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	545410-545441	8	0.75
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	408365-408396	8	0.75
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	1449741-1449772	8	0.75
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NZ_CP045023	Bacillus thuringiensis strain JW-1 plasmid p1, complete sequence	321346-321377	8	0.75
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	1226034-1226065	8	0.75
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	1331293-1331324	8	0.75
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	AJ748296	Sulfolobus islandicus rudivirus 1 variant XX, complete genome	8874-8905	8	0.75
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	L35061	Bacteriophage phi-41 orfs L1-12, complete cds's, orf 13, 5' end	1064-1095	8	0.75
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NZ_CP009317	Bacillus cereus 03BB102 plasmid unnamed, complete sequence	83883-83912	9	0.7
NZ_CP011350_1	1.4\|33922\|30\|NZ_CP011350\|CRT	33922-33951	30	NC_012473	Bacillus cereus 03BB102 plasmid p03BB102_179, complete sequence	53011-53040	9	0.7
NZ_CP011350_2	2.2\|697254\|41\|NZ_CP011350\|CRISPRCasFinder	697254-697294	41	CP024689	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-5-125K, complete sequence	14984-15024	9	0.78
NZ_CP011350_2	2.2\|697254\|41\|NZ_CP011350\|CRISPRCasFinder	697254-697294	41	NC_017206	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence	76580-76620	9	0.78
NZ_CP011350_2	2.2\|697254\|41\|NZ_CP011350\|CRISPRCasFinder	697254-697294	41	NC_020383	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence	57443-57483	9	0.78
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	AP013489	Uncultured Mediterranean phage uvMED DNA, complete genome, group G19, isolate: uvMED-CGR-C30A-MedDCM-OCT-S45-C81	28802-28833	9	0.719
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	MN698245	Pelagibacter phage HTVC111P, complete genome	31276-31307	9	0.719
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	AP013487	Uncultured Mediterranean phage uvMED DNA, complete genome, group G19, isolate: uvMED-CGR-C30A-MedDCM-OCT-S33-C83	14788-14819	9	0.719
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NC_021794	Cellulophaga phage phi18:3, complete genome	54281-54312	9	0.719
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	1024589-1024620	9	0.719
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	MN693376	Marine virus AFVG_25M306, complete genome	10198-10229	9	0.719
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	KY065482	Streptococcus phage IPP42, complete genome	11351-11382	9	0.719
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	KY065483	Streptococcus phage IPP43, complete genome	11953-11984	9	0.719
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	MH853357	Streptococcus phage LF3, partial genome	31519-31550	9	0.719
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	KY363359	Streptococcus phage Str03, complete genome	32004-32035	9	0.719
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	MK448731	Streptococcus phage Javan33, complete genome	16103-16134	9	0.719
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	KY065489	Streptococcus phage IPP51, complete genome	11789-11820	9	0.719
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	KY065484	Streptococcus phage IPP44, complete genome	11670-11701	9	0.719
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	MK448992	Streptococcus phage Javan6, complete genome	14110-14141	9	0.719
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	MT774388	CrAssphage cr112_1, complete genome	69862-69893	9	0.719
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NC_030946	Streptococcus phage phiARI0923, complete genome	21680-21711	9	0.719
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	MK448734	Streptococcus phage Javan347, complete genome	11840-11871	9	0.719
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	MN693062	Marine virus AFVG_25M389, complete genome	27193-27224	9	0.719
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	KY065481	Streptococcus phage IPP41, complete genome	11172-11203	9	0.719
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	MK448888	Streptococcus phage Javan26, complete genome	14075-14106	9	0.719
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	MK448863	Streptococcus phage Javan18, complete genome	12322-12353	9	0.719
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	NC_027396	Streptococcus phage SpSL1, complete genome	32940-32971	9	0.719
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	KY065449	Streptococcus phage IPP5, complete genome	12549-12580	9	0.719
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	257357-257398	10	0.762
NZ_CP011350_1	1.2\|33826\|42\|NZ_CP011350\|CRT	33826-33867	42	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	151604-151645	10	0.762
NZ_CP011350_2	2.2\|697254\|41\|NZ_CP011350\|CRISPRCasFinder	697254-697294	41	NC_022877	Bacillus thuringiensis YBT-1518 plasmid pBMB0232, complete sequence	97772-97812	10	0.756
NZ_CP011350_2	2.2\|697254\|41\|NZ_CP011350\|CRISPRCasFinder	697254-697294	41	NC_022882	Bacillus thuringiensis YBT-1518 plasmid pBMB0233, complete sequence	134329-134369	10	0.756
NZ_CP011350_2	2.2\|697254\|41\|NZ_CP011350\|CRISPRCasFinder	697254-697294	41	NC_022782	Bacillus toyonensis BCT-7112 plasmid pBCT77, complete sequence	43122-43162	10	0.756
NZ_CP011350_3	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	AP014291	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S25-C40, * SEQUENCING IN PROGRESS *	18771-18802	10	0.688

1. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 0, identity: 1.0

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gacaaagccagaaacaaagccagaaacaaagccagaaactaa	Protospacer
******************************************

2. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gacaaagccagaaacaaagccagaaacaaagccagaaactaa	Protospacer
******************************************

3. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 0, identity: 1.0

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gacaaagccagaaacaaagccagaaacaaagccagaaactaa	Protospacer
******************************************

4. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP010090 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence) position: , mismatch: 0, identity: 1.0

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gacaaagccagaaacaaagccagaaacaaagccagaaactaa	Protospacer
******************************************

5. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 0, identity: 1.0

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagacaaagccagaaactaa	Protospacer
******************************

6. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagacaaagccagaaactaa	Protospacer
******************************

7. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 0, identity: 1.0

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagacaaagccagaaactaa	Protospacer
******************************

8. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP010090 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence) position: , mismatch: 0, identity: 1.0

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagacaaagccagaaactaa	Protospacer
******************************

9. spacer 2.1|697189|41|NZ_CP011350|CRISPRCasFinder matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgacttgtttttcacaaagcattaataccagc	CRISPR spacer
tataaggtgcgacttgtttttcacaaagcattaataccagc	Protospacer
*****************************************

10. spacer 2.1|697189|41|NZ_CP011350|CRISPRCasFinder matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgacttgtttttcacaaagcattaataccagc	CRISPR spacer
tataaggtgcgacttgtttttcacaaagcattaataccagc	Protospacer
*****************************************

11. spacer 2.1|697189|41|NZ_CP011350|CRISPRCasFinder matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgacttgtttttcacaaagcattaataccagc	CRISPR spacer
tataaggtgcgacttgtttttcacaaagcattaataccagc	Protospacer
*****************************************

12. spacer 2.1|697189|41|NZ_CP011350|CRISPRCasFinder matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgacttgtttttcacaaagcattaataccagc	CRISPR spacer
tataaggtgcgacttgtttttcacaaagcattaataccagc	Protospacer
*****************************************

13. spacer 2.1|697189|41|NZ_CP011350|CRISPRCasFinder matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgacttgtttttcacaaagcattaataccagc	CRISPR spacer
tataaggtgcgacttgtttttcacaaagcattaataccagc	Protospacer
*****************************************

14. spacer 2.1|697189|41|NZ_CP011350|CRISPRCasFinder matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgacttgtttttcacaaagcattaataccagc	CRISPR spacer
tataaggtgcgacttgtttttcacaaagcattaataccagc	Protospacer
*****************************************

15. spacer 2.1|697189|41|NZ_CP011350|CRISPRCasFinder matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgacttgtttttcacaaagcattaataccagc	CRISPR spacer
tataaggtgcgacttgtttttcacaaagcattaataccagc	Protospacer
*****************************************

16. spacer 2.1|697189|41|NZ_CP011350|CRISPRCasFinder matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgacttgtttttcacaaagcattaataccagc	CRISPR spacer
tataaggtgcgacttgtttttcacaaagcattaataccagc	Protospacer
*****************************************

17. spacer 2.1|697189|41|NZ_CP011350|CRISPRCasFinder matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgacttgtttttcacaaagcattaataccagc	CRISPR spacer
tataaggtgcgacttgtttttcacaaagcattaataccagc	Protospacer
*****************************************

18. spacer 2.2|697254|41|NZ_CP011350|CRISPRCasFinder matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgacttcttttgatccgtaagaacgttccatt	CRISPR spacer
tataaggtgcgacttcttttgatccgtaagaacgttccatt	Protospacer
*****************************************

19. spacer 2.2|697254|41|NZ_CP011350|CRISPRCasFinder matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgacttcttttgatccgtaagaacgttccatt	CRISPR spacer
tataaggtgcgacttcttttgatccgtaagaacgttccatt	Protospacer
*****************************************

20. spacer 2.2|697254|41|NZ_CP011350|CRISPRCasFinder matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgacttcttttgatccgtaagaacgttccatt	CRISPR spacer
tataaggtgcgacttcttttgatccgtaagaacgttccatt	Protospacer
*****************************************

21. spacer 2.2|697254|41|NZ_CP011350|CRISPRCasFinder matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgacttcttttgatccgtaagaacgttccatt	CRISPR spacer
tataaggtgcgacttcttttgatccgtaagaacgttccatt	Protospacer
*****************************************

22. spacer 2.2|697254|41|NZ_CP011350|CRISPRCasFinder matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgacttcttttgatccgtaagaacgttccatt	CRISPR spacer
tataaggtgcgacttcttttgatccgtaagaacgttccatt	Protospacer
*****************************************

23. spacer 2.2|697254|41|NZ_CP011350|CRISPRCasFinder matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgacttcttttgatccgtaagaacgttccatt	CRISPR spacer
tataaggtgcgacttcttttgatccgtaagaacgttccatt	Protospacer
*****************************************

24. spacer 2.2|697254|41|NZ_CP011350|CRISPRCasFinder matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgacttcttttgatccgtaagaacgttccatt	CRISPR spacer
tataaggtgcgacttcttttgatccgtaagaacgttccatt	Protospacer
*****************************************

25. spacer 2.2|697254|41|NZ_CP011350|CRISPRCasFinder matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgacttcttttgatccgtaagaacgttccatt	CRISPR spacer
tataaggtgcgacttcttttgatccgtaagaacgttccatt	Protospacer
*****************************************

26. spacer 2.2|697254|41|NZ_CP011350|CRISPRCasFinder matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgacttcttttgatccgtaagaacgttccatt	CRISPR spacer
tataaggtgcgacttcttttgatccgtaagaacgttccatt	Protospacer
*****************************************

27. spacer 2.2|697254|41|NZ_CP011350|CRISPRCasFinder matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgacttcttttgatccgtaagaacgttccatt	CRISPR spacer
tataaggtgcgacttcttttgatccgtaagaacgttccatt	Protospacer
*****************************************

28. spacer 2.3|697319|43|NZ_CP011350|CRISPRCasFinder matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgacgtcccttccatcggcggcagctcatattca	CRISPR spacer
tataaggtgcgacgtcccttccatcggcggcagctcatattca	Protospacer
*******************************************

29. spacer 2.3|697319|43|NZ_CP011350|CRISPRCasFinder matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgacgtcccttccatcggcggcagctcatattca	CRISPR spacer
tataaggtgcgacgtcccttccatcggcggcagctcatattca	Protospacer
*******************************************

30. spacer 2.3|697319|43|NZ_CP011350|CRISPRCasFinder matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgacgtcccttccatcggcggcagctcatattca	CRISPR spacer
tataaggtgcgacgtcccttccatcggcggcagctcatattca	Protospacer
*******************************************

31. spacer 2.3|697319|43|NZ_CP011350|CRISPRCasFinder matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgacgtcccttccatcggcggcagctcatattca	CRISPR spacer
tataaggtgcgacgtcccttccatcggcggcagctcatattca	Protospacer
*******************************************

32. spacer 2.3|697319|43|NZ_CP011350|CRISPRCasFinder matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgacgtcccttccatcggcggcagctcatattca	CRISPR spacer
tataaggtgcgacgtcccttccatcggcggcagctcatattca	Protospacer
*******************************************

33. spacer 2.3|697319|43|NZ_CP011350|CRISPRCasFinder matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgacgtcccttccatcggcggcagctcatattca	CRISPR spacer
tataaggtgcgacgtcccttccatcggcggcagctcatattca	Protospacer
*******************************************

34. spacer 2.3|697319|43|NZ_CP011350|CRISPRCasFinder matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgacgtcccttccatcggcggcagctcatattca	CRISPR spacer
tataaggtgcgacgtcccttccatcggcggcagctcatattca	Protospacer
*******************************************

35. spacer 2.3|697319|43|NZ_CP011350|CRISPRCasFinder matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgacgtcccttccatcggcggcagctcatattca	CRISPR spacer
tataaggtgcgacgtcccttccatcggcggcagctcatattca	Protospacer
*******************************************

36. spacer 2.3|697319|43|NZ_CP011350|CRISPRCasFinder matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgacgtcccttccatcggcggcagctcatattca	CRISPR spacer
tataaggtgcgacgtcccttccatcggcggcagctcatattca	Protospacer
*******************************************

37. spacer 2.4|697386|42|NZ_CP011350|CRISPRCasFinder matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgactcgattccacttgttcaggctctttgaat	CRISPR spacer
tataaggtgcgactcgattccacttgttcaggctctttgaat	Protospacer
******************************************

38. spacer 2.4|697386|42|NZ_CP011350|CRISPRCasFinder matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgactcgattccacttgttcaggctctttgaat	CRISPR spacer
tataaggtgcgactcgattccacttgttcaggctctttgaat	Protospacer
******************************************

39. spacer 2.4|697386|42|NZ_CP011350|CRISPRCasFinder matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgactcgattccacttgttcaggctctttgaat	CRISPR spacer
tataaggtgcgactcgattccacttgttcaggctctttgaat	Protospacer
******************************************

40. spacer 2.4|697386|42|NZ_CP011350|CRISPRCasFinder matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgactcgattccacttgttcaggctctttgaat	CRISPR spacer
tataaggtgcgactcgattccacttgttcaggctctttgaat	Protospacer
******************************************

41. spacer 2.4|697386|42|NZ_CP011350|CRISPRCasFinder matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgactcgattccacttgttcaggctctttgaat	CRISPR spacer
tataaggtgcgactcgattccacttgttcaggctctttgaat	Protospacer
******************************************

42. spacer 2.4|697386|42|NZ_CP011350|CRISPRCasFinder matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgactcgattccacttgttcaggctctttgaat	CRISPR spacer
tataaggtgcgactcgattccacttgttcaggctctttgaat	Protospacer
******************************************

43. spacer 2.4|697386|42|NZ_CP011350|CRISPRCasFinder matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgactcgattccacttgttcaggctctttgaat	CRISPR spacer
tataaggtgcgactcgattccacttgttcaggctctttgaat	Protospacer
******************************************

44. spacer 2.4|697386|42|NZ_CP011350|CRISPRCasFinder matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgactcgattccacttgttcaggctctttgaat	CRISPR spacer
tataaggtgcgactcgattccacttgttcaggctctttgaat	Protospacer
******************************************

45. spacer 2.4|697386|42|NZ_CP011350|CRISPRCasFinder matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

tataaggtgcgactcgattccacttgttcaggctctttgaat	CRISPR spacer
tataaggtgcgactcgattccacttgttcaggctctttgaat	Protospacer
******************************************

46. spacer 2.5|697452|43|NZ_CP011350|CRISPRCasFinder matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

ctagaggtgcgacatccatttgttgttacttatgaactaccgc	CRISPR spacer
ctagaggtgcgacatccatttgttgttacttatgaactaccgc	Protospacer
*******************************************

47. spacer 2.5|697452|43|NZ_CP011350|CRISPRCasFinder matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

ctagaggtgcgacatccatttgttgttacttatgaactaccgc	CRISPR spacer
ctagaggtgcgacatccatttgttgttacttatgaactaccgc	Protospacer
*******************************************

48. spacer 2.5|697452|43|NZ_CP011350|CRISPRCasFinder matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

ctagaggtgcgacatccatttgttgttacttatgaactaccgc	CRISPR spacer
ctagaggtgcgacatccatttgttgttacttatgaactaccgc	Protospacer
*******************************************

49. spacer 2.5|697452|43|NZ_CP011350|CRISPRCasFinder matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

ctagaggtgcgacatccatttgttgttacttatgaactaccgc	CRISPR spacer
ctagaggtgcgacatccatttgttgttacttatgaactaccgc	Protospacer
*******************************************

50. spacer 2.5|697452|43|NZ_CP011350|CRISPRCasFinder matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

ctagaggtgcgacatccatttgttgttacttatgaactaccgc	CRISPR spacer
ctagaggtgcgacatccatttgttgttacttatgaactaccgc	Protospacer
*******************************************

51. spacer 2.5|697452|43|NZ_CP011350|CRISPRCasFinder matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

ctagaggtgcgacatccatttgttgttacttatgaactaccgc	CRISPR spacer
ctagaggtgcgacatccatttgttgttacttatgaactaccgc	Protospacer
*******************************************

52. spacer 2.5|697452|43|NZ_CP011350|CRISPRCasFinder matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

ctagaggtgcgacatccatttgttgttacttatgaactaccgc	CRISPR spacer
ctagaggtgcgacatccatttgttgttacttatgaactaccgc	Protospacer
*******************************************

53. spacer 2.5|697452|43|NZ_CP011350|CRISPRCasFinder matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

ctagaggtgcgacatccatttgttgttacttatgaactaccgc	CRISPR spacer
ctagaggtgcgacatccatttgttgttacttatgaactaccgc	Protospacer
*******************************************

54. spacer 2.6|697204|31|NZ_CP011350|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

gtttttcacaaagcattaataccagctacat	CRISPR spacer
gtttttcacaaagcattaataccagctacat	Protospacer
*******************************

55. spacer 2.6|697204|31|NZ_CP011350|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtttttcacaaagcattaataccagctacat	CRISPR spacer
gtttttcacaaagcattaataccagctacat	Protospacer
*******************************

56. spacer 2.6|697204|31|NZ_CP011350|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

gtttttcacaaagcattaataccagctacat	CRISPR spacer
gtttttcacaaagcattaataccagctacat	Protospacer
*******************************

57. spacer 2.6|697204|31|NZ_CP011350|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

gtttttcacaaagcattaataccagctacat	CRISPR spacer
gtttttcacaaagcattaataccagctacat	Protospacer
*******************************

58. spacer 2.6|697204|31|NZ_CP011350|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

gtttttcacaaagcattaataccagctacat	CRISPR spacer
gtttttcacaaagcattaataccagctacat	Protospacer
*******************************

59. spacer 2.6|697204|31|NZ_CP011350|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

gtttttcacaaagcattaataccagctacat	CRISPR spacer
gtttttcacaaagcattaataccagctacat	Protospacer
*******************************

60. spacer 2.6|697204|31|NZ_CP011350|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

gtttttcacaaagcattaataccagctacat	CRISPR spacer
gtttttcacaaagcattaataccagctacat	Protospacer
*******************************

61. spacer 2.6|697204|31|NZ_CP011350|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

gtttttcacaaagcattaataccagctacat	CRISPR spacer
gtttttcacaaagcattaataccagctacat	Protospacer
*******************************

62. spacer 2.6|697204|31|NZ_CP011350|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

gtttttcacaaagcattaataccagctacat	CRISPR spacer
gtttttcacaaagcattaataccagctacat	Protospacer
*******************************

63. spacer 2.7|697269|31|NZ_CP011350|CRT matches to NZ_CP047087 (Bacillus paranthracis strain BC307 plasmid pCE2, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttccat	CRISPR spacer
cttttgatccgtaagaacgttccatttccat	Protospacer
*******************************

64. spacer 2.7|697269|31|NZ_CP011350|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttccat	CRISPR spacer
cttttgatccgtaagaacgttccatttccat	Protospacer
*******************************

65. spacer 2.7|697269|31|NZ_CP011350|CRT matches to NC_018510 (Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttccat	CRISPR spacer
cttttgatccgtaagaacgttccatttccat	Protospacer
*******************************

66. spacer 2.7|697269|31|NZ_CP011350|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttccat	CRISPR spacer
cttttgatccgtaagaacgttccatttccat	Protospacer
*******************************

67. spacer 2.7|697269|31|NZ_CP011350|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttccat	CRISPR spacer
cttttgatccgtaagaacgttccatttccat	Protospacer
*******************************

68. spacer 2.7|697269|31|NZ_CP011350|CRT matches to CP041751 (Bacillus paranthracis strain NCCP 14796 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttccat	CRISPR spacer
cttttgatccgtaagaacgttccatttccat	Protospacer
*******************************

69. spacer 2.7|697269|31|NZ_CP011350|CRT matches to NZ_CP017573 (Bacillus thuringiensis strain SCG04-02 plasmid PSCG61, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttccat	CRISPR spacer
cttttgatccgtaagaacgttccatttccat	Protospacer
*******************************

70. spacer 2.7|697269|31|NZ_CP011350|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttccat	CRISPR spacer
cttttgatccgtaagaacgttccatttccat	Protospacer
*******************************

71. spacer 2.7|697269|31|NZ_CP011350|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttccat	CRISPR spacer
cttttgatccgtaagaacgttccatttccat	Protospacer
*******************************

72. spacer 2.7|697269|31|NZ_CP011350|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttccat	CRISPR spacer
cttttgatccgtaagaacgttccatttccat	Protospacer
*******************************

73. spacer 2.7|697269|31|NZ_CP011350|CRT matches to NZ_CP029456 (Bacillus cereus strain FORC087 plasmid pFORC087.2, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttccat	CRISPR spacer
cttttgatccgtaagaacgttccatttccat	Protospacer
*******************************

74. spacer 2.7|697269|31|NZ_CP011350|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttccat	CRISPR spacer
cttttgatccgtaagaacgttccatttccat	Protospacer
*******************************

75. spacer 2.7|697269|31|NZ_CP011350|CRT matches to NZ_CP013280 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttccat	CRISPR spacer
cttttgatccgtaagaacgttccatttccat	Protospacer
*******************************

76. spacer 2.7|697269|31|NZ_CP011350|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttccat	CRISPR spacer
cttttgatccgtaagaacgttccatttccat	Protospacer
*******************************

77. spacer 2.7|697269|31|NZ_CP011350|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttccat	CRISPR spacer
cttttgatccgtaagaacgttccatttccat	Protospacer
*******************************

78. spacer 2.7|697269|31|NZ_CP011350|CRT matches to NC_011656 (Bacillus cereus AH187 plasmid pAH187_45, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttccat	CRISPR spacer
cttttgatccgtaagaacgttccatttccat	Protospacer
*******************************

79. spacer 2.7|697269|31|NZ_CP011350|CRT matches to NZ_CP039726 (Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttccat	CRISPR spacer
cttttgatccgtaagaacgttccatttccat	Protospacer
*******************************

80. spacer 2.7|697269|31|NZ_CP011350|CRT matches to NC_018685 (Bacillus thuringiensis MC28 plasmid pMC95, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttccat	CRISPR spacer
cttttgatccgtaagaacgttccatttccat	Protospacer
*******************************

81. spacer 2.7|697269|31|NZ_CP011350|CRT matches to NZ_CP009350 (Bacillus thuringiensis HD1002 plasmid 4, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttccat	CRISPR spacer
cttttgatccgtaagaacgttccatttccat	Protospacer
*******************************

82. spacer 2.7|697269|31|NZ_CP011350|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttccat	CRISPR spacer
cttttgatccgtaagaacgttccatttccat	Protospacer
*******************************

83. spacer 2.7|697269|31|NZ_CP011350|CRT matches to NZ_CP033793 (Bacillus sp. FDAARGOS_527 plasmid unnamed6, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttccat	CRISPR spacer
cttttgatccgtaagaacgttccatttccat	Protospacer
*******************************

84. spacer 2.8|697334|33|NZ_CP011350|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

cccttccatcggcggcagctcatattcaattat	CRISPR spacer
cccttccatcggcggcagctcatattcaattat	Protospacer
*********************************

85. spacer 2.8|697334|33|NZ_CP011350|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

cccttccatcggcggcagctcatattcaattat	CRISPR spacer
cccttccatcggcggcagctcatattcaattat	Protospacer
*********************************

86. spacer 2.8|697334|33|NZ_CP011350|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

cccttccatcggcggcagctcatattcaattat	CRISPR spacer
cccttccatcggcggcagctcatattcaattat	Protospacer
*********************************

87. spacer 2.8|697334|33|NZ_CP011350|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

cccttccatcggcggcagctcatattcaattat	CRISPR spacer
cccttccatcggcggcagctcatattcaattat	Protospacer
*********************************

88. spacer 2.8|697334|33|NZ_CP011350|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

cccttccatcggcggcagctcatattcaattat	CRISPR spacer
cccttccatcggcggcagctcatattcaattat	Protospacer
*********************************

89. spacer 2.8|697334|33|NZ_CP011350|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

cccttccatcggcggcagctcatattcaattat	CRISPR spacer
cccttccatcggcggcagctcatattcaattat	Protospacer
*********************************

90. spacer 2.8|697334|33|NZ_CP011350|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

cccttccatcggcggcagctcatattcaattat	CRISPR spacer
cccttccatcggcggcagctcatattcaattat	Protospacer
*********************************

91. spacer 2.8|697334|33|NZ_CP011350|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

cccttccatcggcggcagctcatattcaattat	CRISPR spacer
cccttccatcggcggcagctcatattcaattat	Protospacer
*********************************

92. spacer 2.8|697334|33|NZ_CP011350|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

cccttccatcggcggcagctcatattcaattat	CRISPR spacer
cccttccatcggcggcagctcatattcaattat	Protospacer
*********************************

93. spacer 2.9|697401|32|NZ_CP011350|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

gattccacttgttcaggctctttgaatatcat	CRISPR spacer
gattccacttgttcaggctctttgaatatcat	Protospacer
********************************

94. spacer 2.9|697401|32|NZ_CP011350|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

gattccacttgttcaggctctttgaatatcat	CRISPR spacer
gattccacttgttcaggctctttgaatatcat	Protospacer
********************************

95. spacer 2.9|697401|32|NZ_CP011350|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

gattccacttgttcaggctctttgaatatcat	CRISPR spacer
gattccacttgttcaggctctttgaatatcat	Protospacer
********************************

96. spacer 2.9|697401|32|NZ_CP011350|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

gattccacttgttcaggctctttgaatatcat	CRISPR spacer
gattccacttgttcaggctctttgaatatcat	Protospacer
********************************

97. spacer 2.9|697401|32|NZ_CP011350|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

gattccacttgttcaggctctttgaatatcat	CRISPR spacer
gattccacttgttcaggctctttgaatatcat	Protospacer
********************************

98. spacer 2.9|697401|32|NZ_CP011350|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

gattccacttgttcaggctctttgaatatcat	CRISPR spacer
gattccacttgttcaggctctttgaatatcat	Protospacer
********************************

99. spacer 2.9|697401|32|NZ_CP011350|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

gattccacttgttcaggctctttgaatatcat	CRISPR spacer
gattccacttgttcaggctctttgaatatcat	Protospacer
********************************

100. spacer 2.9|697401|32|NZ_CP011350|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

gattccacttgttcaggctctttgaatatcat	CRISPR spacer
gattccacttgttcaggctctttgaatatcat	Protospacer
********************************

101. spacer 2.9|697401|32|NZ_CP011350|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

gattccacttgttcaggctctttgaatatcat	CRISPR spacer
gattccacttgttcaggctctttgaatatcat	Protospacer
********************************

102. spacer 2.10|697467|33|NZ_CP011350|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

ccatttgttgttacttatgaactaccgccaatg	CRISPR spacer
ccatttgttgttacttatgaactaccgccaatg	Protospacer
*********************************

103. spacer 2.10|697467|33|NZ_CP011350|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

ccatttgttgttacttatgaactaccgccaatg	CRISPR spacer
ccatttgttgttacttatgaactaccgccaatg	Protospacer
*********************************

104. spacer 2.10|697467|33|NZ_CP011350|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

ccatttgttgttacttatgaactaccgccaatg	CRISPR spacer
ccatttgttgttacttatgaactaccgccaatg	Protospacer
*********************************

105. spacer 2.10|697467|33|NZ_CP011350|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

ccatttgttgttacttatgaactaccgccaatg	CRISPR spacer
ccatttgttgttacttatgaactaccgccaatg	Protospacer
*********************************

106. spacer 2.10|697467|33|NZ_CP011350|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

ccatttgttgttacttatgaactaccgccaatg	CRISPR spacer
ccatttgttgttacttatgaactaccgccaatg	Protospacer
*********************************

107. spacer 2.10|697467|33|NZ_CP011350|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

ccatttgttgttacttatgaactaccgccaatg	CRISPR spacer
ccatttgttgttacttatgaactaccgccaatg	Protospacer
*********************************

108. spacer 2.10|697467|33|NZ_CP011350|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

ccatttgttgttacttatgaactaccgccaatg	CRISPR spacer
ccatttgttgttacttatgaactaccgccaatg	Protospacer
*********************************

109. spacer 2.10|697467|33|NZ_CP011350|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

ccatttgttgttacttatgaactaccgccaatg	CRISPR spacer
ccatttgttgttacttatgaactaccgccaatg	Protospacer
*********************************

110. spacer 3.1|704537|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

catgactgaattttgtcaaaattgtgatattat	CRISPR spacer
catgactgaattttgtcaaaattgtgatattat	Protospacer
*********************************

111. spacer 3.1|704537|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

catgactgaattttgtcaaaattgtgatattat	CRISPR spacer
catgactgaattttgtcaaaattgtgatattat	Protospacer
*********************************

112. spacer 3.1|704537|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

catgactgaattttgtcaaaattgtgatattat	CRISPR spacer
catgactgaattttgtcaaaattgtgatattat	Protospacer
*********************************

113. spacer 3.1|704537|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

catgactgaattttgtcaaaattgtgatattat	CRISPR spacer
catgactgaattttgtcaaaattgtgatattat	Protospacer
*********************************

114. spacer 3.1|704537|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

catgactgaattttgtcaaaattgtgatattat	CRISPR spacer
catgactgaattttgtcaaaattgtgatattat	Protospacer
*********************************

115. spacer 3.1|704537|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

catgactgaattttgtcaaaattgtgatattat	CRISPR spacer
catgactgaattttgtcaaaattgtgatattat	Protospacer
*********************************

116. spacer 3.1|704537|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

catgactgaattttgtcaaaattgtgatattat	CRISPR spacer
catgactgaattttgtcaaaattgtgatattat	Protospacer
*********************************

117. spacer 3.1|704537|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

catgactgaattttgtcaaaattgtgatattat	CRISPR spacer
catgactgaattttgtcaaaattgtgatattat	Protospacer
*********************************

118. spacer 3.1|704537|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

catgactgaattttgtcaaaattgtgatattat	CRISPR spacer
catgactgaattttgtcaaaattgtgatattat	Protospacer
*********************************

119. spacer 3.2|704602|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_KX258624 (Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence) position: , mismatch: 0, identity: 1.0

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
**********************************

120. spacer 3.2|704602|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
**********************************

121. spacer 3.2|704602|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
**********************************

122. spacer 3.2|704602|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
**********************************

123. spacer 3.2|704602|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
**********************************

124. spacer 3.2|704602|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
**********************************

125. spacer 3.2|704602|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
**********************************

126. spacer 3.2|704602|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
**********************************

127. spacer 3.2|704602|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
**********************************

128. spacer 3.2|704602|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
**********************************

129. spacer 3.3|704668|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
*********************************

130. spacer 3.3|704668|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
*********************************

131. spacer 3.3|704668|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
*********************************

132. spacer 3.3|704668|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
*********************************

133. spacer 3.3|704668|33|NZ_CP011350|CRISPRCasFinder,CRT matches to CP041751 (Bacillus paranthracis strain NCCP 14796 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
*********************************

134. spacer 3.3|704668|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
*********************************

135. spacer 3.3|704668|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
*********************************

136. spacer 3.3|704668|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
*********************************

137. spacer 3.3|704668|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
*********************************

138. spacer 3.3|704668|33|NZ_CP011350|CRISPRCasFinder,CRT matches to CP024689 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-5-125K, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
*********************************

139. spacer 3.3|704668|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_018685 (Bacillus thuringiensis MC28 plasmid pMC95, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
*********************************

140. spacer 3.3|704668|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP033793 (Bacillus sp. FDAARGOS_527 plasmid unnamed6, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
*********************************

141. spacer 3.4|704733|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
**********************************

142. spacer 3.4|704733|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
**********************************

143. spacer 3.4|704733|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
**********************************

144. spacer 3.4|704733|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
**********************************

145. spacer 3.4|704733|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
**********************************

146. spacer 3.4|704733|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
**********************************

147. spacer 3.4|704733|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
**********************************

148. spacer 3.4|704733|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
**********************************

149. spacer 3.4|704733|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
**********************************

150. spacer 3.5|704799|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

151. spacer 3.5|704799|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

152. spacer 3.5|704799|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP053974 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

153. spacer 3.5|704799|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

154. spacer 3.5|704799|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

155. spacer 3.5|704799|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

156. spacer 3.5|704799|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP009346 (Bacillus thuringiensis HD1002 plasmid 5, complete sequence) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

157. spacer 3.5|704799|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP045027 (Bacillus thuringiensis strain JW-1 plasmid p5, complete sequence) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

158. spacer 3.5|704799|33|NZ_CP011350|CRISPRCasFinder,CRT matches to CP013282 (Bacillus phage pGIL02, complete sequence) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

159. spacer 3.5|704799|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

160. spacer 3.5|704799|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

161. spacer 3.5|704799|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

162. spacer 3.5|704799|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

163. spacer 3.5|704799|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

164. spacer 3.5|704799|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

165. spacer 3.5|704799|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_005258 (Bacillus phage Bam35c, complete genome) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

166. spacer 3.5|704799|33|NZ_CP011350|CRISPRCasFinder,CRT matches to AY257527 (Bacillus thuringiensis bacteriophage Bam35c, complete genome) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

167. spacer 3.5|704799|33|NZ_CP011350|CRISPRCasFinder,CRT matches to AJ536073 (Bacillus phage pGIL01, complete genome) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

168. spacer 3.6|704864|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

tgcaaagacgatcataacgactggagcaacaaa	CRISPR spacer
tgcaaagacgatcataacgactggagcaacaaa	Protospacer
*********************************

169. spacer 3.6|704864|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

tgcaaagacgatcataacgactggagcaacaaa	CRISPR spacer
tgcaaagacgatcataacgactggagcaacaaa	Protospacer
*********************************

170. spacer 3.6|704864|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

tgcaaagacgatcataacgactggagcaacaaa	CRISPR spacer
tgcaaagacgatcataacgactggagcaacaaa	Protospacer
*********************************

171. spacer 3.6|704864|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

tgcaaagacgatcataacgactggagcaacaaa	CRISPR spacer
tgcaaagacgatcataacgactggagcaacaaa	Protospacer
*********************************

172. spacer 3.6|704864|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

tgcaaagacgatcataacgactggagcaacaaa	CRISPR spacer
tgcaaagacgatcataacgactggagcaacaaa	Protospacer
*********************************

173. spacer 3.6|704864|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

tgcaaagacgatcataacgactggagcaacaaa	CRISPR spacer
tgcaaagacgatcataacgactggagcaacaaa	Protospacer
*********************************

174. spacer 3.6|704864|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

tgcaaagacgatcataacgactggagcaacaaa	CRISPR spacer
tgcaaagacgatcataacgactggagcaacaaa	Protospacer
*********************************

175. spacer 3.6|704864|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

tgcaaagacgatcataacgactggagcaacaaa	CRISPR spacer
tgcaaagacgatcataacgactggagcaacaaa	Protospacer
*********************************

176. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP004871 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB46, complete sequence) position: , mismatch: 0, identity: 1.0

atacactttttttgatttcttctactatcttc	CRISPR spacer
atacactttttttgatttcttctactatcttc	Protospacer
********************************

177. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

atacactttttttgatttcttctactatcttc	CRISPR spacer
atacactttttttgatttcttctactatcttc	Protospacer
********************************

178. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

atacactttttttgatttcttctactatcttc	CRISPR spacer
atacactttttttgatttcttctactatcttc	Protospacer
********************************

179. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

atacactttttttgatttcttctactatcttc	CRISPR spacer
atacactttttttgatttcttctactatcttc	Protospacer
********************************

180. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_023074 (Bacillus thuringiensis serovar tenebrionis str. YBT-1765 plasmid pBMB165, complete sequence) position: , mismatch: 0, identity: 1.0

atacactttttttgatttcttctactatcttc	CRISPR spacer
atacactttttttgatttcttctactatcttc	Protospacer
********************************

181. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

atacactttttttgatttcttctactatcttc	CRISPR spacer
atacactttttttgatttcttctactatcttc	Protospacer
********************************

182. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP011352 (Bacillus thuringiensis strain YC-10 plasmid pYC4, complete sequence) position: , mismatch: 0, identity: 1.0

atacactttttttgatttcttctactatcttc	CRISPR spacer
atacactttttttgatttcttctactatcttc	Protospacer
********************************

183. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

atacactttttttgatttcttctactatcttc	CRISPR spacer
atacactttttttgatttcttctactatcttc	Protospacer
********************************

184. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

atacactttttttgatttcttctactatcttc	CRISPR spacer
atacactttttttgatttcttctactatcttc	Protospacer
********************************

185. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP013060 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-5, complete sequence) position: , mismatch: 0, identity: 1.0

atacactttttttgatttcttctactatcttc	CRISPR spacer
atacactttttttgatttcttctactatcttc	Protospacer
********************************

186. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

atacactttttttgatttcttctactatcttc	CRISPR spacer
atacactttttttgatttcttctactatcttc	Protospacer
********************************

187. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

atacactttttttgatttcttctactatcttc	CRISPR spacer
atacactttttttgatttcttctactatcttc	Protospacer
********************************

188. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP010095 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB47, complete sequence) position: , mismatch: 0, identity: 1.0

atacactttttttgatttcttctactatcttc	CRISPR spacer
atacactttttttgatttcttctactatcttc	Protospacer
********************************

189. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to MK843319 (Bacillus phage vB_BthS-TP21T, complete genome) position: , mismatch: 0, identity: 1.0

atacactttttttgatttcttctactatcttc	CRISPR spacer
atacactttttttgatttcttctactatcttc	Protospacer
********************************

190. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to KT970646 (Bacillus phage phiS58, complete genome) position: , mismatch: 0, identity: 1.0

atacactttttttgatttcttctactatcttc	CRISPR spacer
atacactttttttgatttcttctactatcttc	Protospacer
********************************

191. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to KJ024807 (Bacillus phage vB_BtS_BMBtp3, complete genome) position: , mismatch: 0, identity: 1.0

atacactttttttgatttcttctactatcttc	CRISPR spacer
atacactttttttgatttcttctactatcttc	Protospacer
********************************

192. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_025424 (Bacillus phage Waukesha92, complete genome) position: , mismatch: 0, identity: 1.0

atacactttttttgatttcttctactatcttc	CRISPR spacer
atacactttttttgatttcttctactatcttc	Protospacer
********************************

193. spacer 3.8|704993|35|NZ_CP011350|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

tttaaaacgtgcataacctaacactttcccattgt	CRISPR spacer
tttaaaacgtgcataacctaacactttcccattgt	Protospacer
***********************************

194. spacer 3.8|704993|35|NZ_CP011350|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

tttaaaacgtgcataacctaacactttcccattgt	CRISPR spacer
tttaaaacgtgcataacctaacactttcccattgt	Protospacer
***********************************

195. spacer 3.8|704993|35|NZ_CP011350|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

tttaaaacgtgcataacctaacactttcccattgt	CRISPR spacer
tttaaaacgtgcataacctaacactttcccattgt	Protospacer
***********************************

196. spacer 3.8|704993|35|NZ_CP011350|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

tttaaaacgtgcataacctaacactttcccattgt	CRISPR spacer
tttaaaacgtgcataacctaacactttcccattgt	Protospacer
***********************************

197. spacer 3.8|704993|35|NZ_CP011350|CRISPRCasFinder,CRT,PILER-CR matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

tttaaaacgtgcataacctaacactttcccattgt	CRISPR spacer
tttaaaacgtgcataacctaacactttcccattgt	Protospacer
***********************************

198. spacer 3.8|704993|35|NZ_CP011350|CRISPRCasFinder,CRT,PILER-CR matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

tttaaaacgtgcataacctaacactttcccattgt	CRISPR spacer
tttaaaacgtgcataacctaacactttcccattgt	Protospacer
***********************************

199. spacer 3.8|704993|35|NZ_CP011350|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

tttaaaacgtgcataacctaacactttcccattgt	CRISPR spacer
tttaaaacgtgcataacctaacactttcccattgt	Protospacer
***********************************

200. spacer 3.8|704993|35|NZ_CP011350|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

tttaaaacgtgcataacctaacactttcccattgt	CRISPR spacer
tttaaaacgtgcataacctaacactttcccattgt	Protospacer
***********************************

201. spacer 3.9|705060|34|NZ_CP011350|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

ttttttactcggatactctaaaggtgtaacaata	CRISPR spacer
ttttttactcggatactctaaaggtgtaacaata	Protospacer
**********************************

202. spacer 3.9|705060|34|NZ_CP011350|CRISPRCasFinder,CRT,PILER-CR matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

ttttttactcggatactctaaaggtgtaacaata	CRISPR spacer
ttttttactcggatactctaaaggtgtaacaata	Protospacer
**********************************

203. spacer 3.9|705060|34|NZ_CP011350|CRISPRCasFinder,CRT,PILER-CR matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

ttttttactcggatactctaaaggtgtaacaata	CRISPR spacer
ttttttactcggatactctaaaggtgtaacaata	Protospacer
**********************************

204. spacer 3.9|705060|34|NZ_CP011350|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

ttttttactcggatactctaaaggtgtaacaata	CRISPR spacer
ttttttactcggatactctaaaggtgtaacaata	Protospacer
**********************************

205. spacer 3.9|705060|34|NZ_CP011350|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

ttttttactcggatactctaaaggtgtaacaata	CRISPR spacer
ttttttactcggatactctaaaggtgtaacaata	Protospacer
**********************************

206. spacer 3.9|705060|34|NZ_CP011350|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

ttttttactcggatactctaaaggtgtaacaata	CRISPR spacer
ttttttactcggatactctaaaggtgtaacaata	Protospacer
**********************************

207. spacer 3.9|705060|34|NZ_CP011350|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

ttttttactcggatactctaaaggtgtaacaata	CRISPR spacer
ttttttactcggatactctaaaggtgtaacaata	Protospacer
**********************************

208. spacer 3.9|705060|34|NZ_CP011350|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

ttttttactcggatactctaaaggtgtaacaata	CRISPR spacer
ttttttactcggatactctaaaggtgtaacaata	Protospacer
**********************************

209. spacer 3.10|705126|34|NZ_CP011350|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

atgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
atgtgggtgacgtcattaaattctcgtatcttgt	Protospacer
**********************************

210. spacer 3.10|705126|34|NZ_CP011350|CRISPRCasFinder,CRT,PILER-CR matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

atgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
atgtgggtgacgtcattaaattctcgtatcttgt	Protospacer
**********************************

211. spacer 3.10|705126|34|NZ_CP011350|CRISPRCasFinder,CRT,PILER-CR matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

atgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
atgtgggtgacgtcattaaattctcgtatcttgt	Protospacer
**********************************

212. spacer 3.10|705126|34|NZ_CP011350|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

atgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
atgtgggtgacgtcattaaattctcgtatcttgt	Protospacer
**********************************

213. spacer 3.10|705126|34|NZ_CP011350|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

atgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
atgtgggtgacgtcattaaattctcgtatcttgt	Protospacer
**********************************

214. spacer 3.10|705126|34|NZ_CP011350|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

atgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
atgtgggtgacgtcattaaattctcgtatcttgt	Protospacer
**********************************

215. spacer 3.10|705126|34|NZ_CP011350|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

atgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
atgtgggtgacgtcattaaattctcgtatcttgt	Protospacer
**********************************

216. spacer 3.10|705126|34|NZ_CP011350|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

atgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
atgtgggtgacgtcattaaattctcgtatcttgt	Protospacer
**********************************

217. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 1, identity: 0.976

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gacaaagccagaaacaaagccagaaacaaagccagaaacaaa	Protospacer
*************************************** **

218. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 1, identity: 0.976

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gacaaagccagaaacaaagccagaaacaaagccagaaacaaa	Protospacer
*************************************** **

219. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaaaccagagacaaagccagaaactaa	Protospacer
.*****************************

220. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaaaccagagacaaagccagaaactaa	Protospacer
.*****************************

221. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaagccagagacaaagccagaaactaa	Protospacer
******.***********************

222. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaaaccagagacaaagccagaaactaa	Protospacer
.*****************************

223. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaaaccagagacaaagccagaaactaa	Protospacer
.*****************************

224. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaagccagagacaaagccagaaactaa	Protospacer
******.***********************

225. spacer 1.4|33922|30|NZ_CP011350|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 1, identity: 0.967

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagacaaagccagaaacaaa	Protospacer
*************************** **

226. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP015592 (Bacillus cereus strain AR156 plasmid pAR460, complete sequence) position: , mismatch: 1, identity: 0.967

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagacaaagccagaaacaaa	Protospacer
*************************** **

227. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 1, identity: 0.967

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaacccagagacaaagccagaaactaa	Protospacer
****** ***********************

228. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 1, identity: 0.967

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagacaaagccagaaacaaa	Protospacer
*************************** **

229. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 1, identity: 0.967

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagacaaagccagaaacaaa	Protospacer
*************************** **

230. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 1, identity: 0.967

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagacaaagccagaaacaaa	Protospacer
*************************** **

231. spacer 2.7|697269|31|NZ_CP011350|CRT matches to NC_017206 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence) position: , mismatch: 1, identity: 0.968

cttttgatccgtaagaacgttccatttccat	CRISPR spacer
cttttgatccgtaaaaacgttccatttccat	Protospacer
**************.****************

232. spacer 2.7|697269|31|NZ_CP011350|CRT matches to NC_020383 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence) position: , mismatch: 1, identity: 0.968

cttttgatccgtaagaacgttccatttccat	CRISPR spacer
cttttgatccgtaaaaacgttccatttccat	Protospacer
**************.****************

233. spacer 2.7|697269|31|NZ_CP011350|CRT matches to CP024689 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-5-125K, complete sequence) position: , mismatch: 1, identity: 0.968

cttttgatccgtaagaacgttccatttccat	CRISPR spacer
cttttgatccataagaacgttccatttccat	Protospacer
**********.********************

234. spacer 2.10|697467|33|NZ_CP011350|CRT matches to NZ_CP032610 (Bacillus thuringiensis strain QZL38 plasmid p.3, complete sequence) position: , mismatch: 1, identity: 0.97

ccatttgttgttacttatgaactaccgccaatg	CRISPR spacer
acatttgttgttacttatgaactaccgccaatg	Protospacer
 ********************************

235. spacer 2.10|697467|33|NZ_CP011350|CRT matches to NZ_CP014286 (Bacillus thuringiensis strain Bt185 plasmid pBT1850054, complete sequence) position: , mismatch: 1, identity: 0.97

ccatttgttgttacttatgaactaccgccaatg	CRISPR spacer
acatttgttgttacttatgaactaccgccaatg	Protospacer
 ********************************

236. spacer 3.2|704602|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP020748 (Bacillus mycoides strain Gnyt1 plasmid unnamed5, complete sequence) position: , mismatch: 1, identity: 0.971

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgagcgtcccagataaatataaacccgaggta	Protospacer
*********.************************

237. spacer 3.2|704602|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP011157 (Bacillus cereus strain HN001 plasmid pRML02, complete sequence) position: , mismatch: 1, identity: 0.971

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgagcgtcccagataaatataaacccgaggta	Protospacer
*********.************************

238. spacer 3.3|704668|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_017206 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence) position: , mismatch: 1, identity: 0.97

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacgggaaaacaattgagctagttgcaaa	Protospacer
*********.***********************

239. spacer 3.3|704668|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP047087 (Bacillus paranthracis strain BC307 plasmid pCE2, complete sequence) position: , mismatch: 1, identity: 0.97

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacgggaaaacaattgagctagttgcaaa	Protospacer
*********.***********************

240. spacer 3.3|704668|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_018510 (Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence) position: , mismatch: 1, identity: 0.97

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacgggaaaacaattgagctagttgcaaa	Protospacer
*********.***********************

241. spacer 3.3|704668|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_022882 (Bacillus thuringiensis YBT-1518 plasmid pBMB0233, complete sequence) position: , mismatch: 1, identity: 0.97

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaatggaaaaacaattgagctagttgcaaa	Protospacer
******.**************************

242. spacer 3.3|704668|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_020383 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence) position: , mismatch: 1, identity: 0.97

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacgggaaaacaattgagctagttgcaaa	Protospacer
*********.***********************

243. spacer 3.3|704668|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP013280 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence) position: , mismatch: 1, identity: 0.97

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacgggaaaacaattgagctagttgcaaa	Protospacer
*********.***********************

244. spacer 3.3|704668|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP039726 (Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence) position: , mismatch: 1, identity: 0.97

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacgggaaaacaattgagctagttgcaaa	Protospacer
*********.***********************

245. spacer 3.3|704668|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP009350 (Bacillus thuringiensis HD1002 plasmid 4, complete sequence) position: , mismatch: 1, identity: 0.97

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacgggaaaacaattgagctagttgcaaa	Protospacer
*********.***********************

246. spacer 3.3|704668|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_022877 (Bacillus thuringiensis YBT-1518 plasmid pBMB0232, complete sequence) position: , mismatch: 1, identity: 0.97

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaatggaaaaacaattgagctagttgcaaa	Protospacer
******.**************************

247. spacer 3.3|704668|33|NZ_CP011350|CRISPRCasFinder,CRT matches to CP016198 (Bacillus thuringiensis serovar coreanensis strain ST7 plasmid pST7-4, complete sequence) position: , mismatch: 1, identity: 0.97

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacgggaaaacaattgagctagttgcaaa	Protospacer
*********.***********************

248. spacer 3.5|704799|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP010096 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMBLin15, complete sequence) position: , mismatch: 1, identity: 0.97

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactcctt	Protospacer
********************************

249. spacer 3.8|704993|35|NZ_CP011350|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 1, identity: 0.971

tttaaaacgtgcataacctaacactttcccattgt-	CRISPR spacer
tttaaaacgtgcataacctaacac-ttcccattgta	Protospacer
************************ **********

250. spacer 3.10|705126|34|NZ_CP011350|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP010096 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMBLin15, complete sequence) position: , mismatch: 1, identity: 0.971

atgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
atgtgggtgacgtcattaaattctcgtatctagt	Protospacer
******************************* **

251. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 2, identity: 0.952

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gacaaagccagagacaaagccagaaacaaagccagaaacaaa	Protospacer
************.************************** **

252. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 2, identity: 0.952

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gacaaagccagagacaaagccagaaacaaagccagaaacaaa	Protospacer
************.************************** **

253. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NC_011973 (Bacillus cereus Q1 plasmid pBc239, complete sequence) position: , mismatch: 2, identity: 0.952

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaaaccagaaactaa	Protospacer
*** **************************.***********

254. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.952

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gacaaagccagagacaaagccagagacaaagccagaaactaa	Protospacer
************.***********.*****************

255. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.952

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gacaaagccagagacaaagccagagacaaagccagaaactaa	Protospacer
************.***********.*****************

256. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaaaccagagacaaagccagaaacaaa	Protospacer
.************************** **

257. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagacaaaaccagaaacaaa	Protospacer
******************.******** **

258. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaagccagagacaaaaccagaaactaa	Protospacer
******.***********.***********

259. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaaaccagagacaaagccagaaacaaa	Protospacer
.************************** **

260. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaagccagagacaaaaccagaaactaa	Protospacer
******.***********.***********

261. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagacaaaaccagaaacaaa	Protospacer
******************.******** **

262. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaaaccagagacaaagccagaaacaaa	Protospacer
.************************** **

263. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaagccagagacaaaaccagaaactaa	Protospacer
******.***********.***********

264. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagacaaaaccagaaacaaa	Protospacer
******************.******** **

265. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP010090 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaaaccagagacaaagccagaaacaaa	Protospacer
.************************** **

266. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP010090 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaagccagagacaaaaccagaaactaa	Protospacer
******.***********.***********

267. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP010090 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagacaaaaccagaaacaaa	Protospacer
******************.******** **

268. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagacaaagccagagacaaa	Protospacer
************************.** **

269. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagacaaagccagagacaaa	Protospacer
************************.** **

270. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagacaaagccagagacaaa	Protospacer
************************.** **

271. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagacaaagccagagacaaa	Protospacer
************************.** **

272. spacer 1.4|33922|30|NZ_CP011350|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaaaccagagacaaagccagaaacaaa	Protospacer
.************************** **

273. spacer 1.4|33922|30|NZ_CP011350|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaaaccagagacaaagccagaaacaaa	Protospacer
.************************** **

274. spacer 1.4|33922|30|NZ_CP011350|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaaaccagagacaaagccagaaacaaa	Protospacer
.************************** **

275. spacer 1.4|33922|30|NZ_CP011350|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagaaacaaagccagaaacaaa	Protospacer
************.************** **

276. spacer 1.4|33922|30|NZ_CP011350|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagacaaaaccagaaacaaa	Protospacer
******************.******** **

277. spacer 1.4|33922|30|NZ_CP011350|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagaaacaaagccagaaacaaa	Protospacer
************.************** **

278. spacer 1.4|33922|30|NZ_CP011350|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagacaaaaccagaaacgaa	Protospacer
******************.******** **

279. spacer 1.4|33922|30|NZ_CP011350|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagacaaaaccagaaacgaa	Protospacer
******************.******** **

280. spacer 1.4|33922|30|NZ_CP011350|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagaaacaaagccagaaacaaa	Protospacer
************.************** **

281. spacer 1.4|33922|30|NZ_CP011350|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagacaaaaccagaaacaaa	Protospacer
******************.******** **

282. spacer 1.4|33922|30|NZ_CP011350|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagaaacaaagccagaaacaaa	Protospacer
************.************** **

283. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaaaccagagacaaagccagaaacaaa	Protospacer
.************************** **

284. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagacaaagccagagacaaa	Protospacer
************************.** **

285. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaagccagagacaaagccagaaacaaa	Protospacer
******.******************** **

286. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagacaaagccagagacaaa	Protospacer
************************.** **

287. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaagccagagacaaagccagaaacaaa	Protospacer
******.******************** **

288. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagacaaagccagagacaaa	Protospacer
************************.** **

289. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaagccagagacaaagccagaaacaaa	Protospacer
******.******************** **

290. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP023002 (Bacillus anthracis strain 14RA5914 plasmid pX01, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

291. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_AP019732 (Bacillus anthracis strain PCr plasmid PCr-pXO1) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

292. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP029324 (Bacillus anthracis strain 17OD930 plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

293. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP007665 (Bacillus anthracis str. Vollum plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

294. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP009340 (Bacillus anthracis strain Ohio ACB plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

295. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP009696 (Bacillus anthracis strain RA3 plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

296. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP009463 (Bacillus anthracis strain SK-102 plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

297. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP009699 (Bacillus anthracis strain BA1035 plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

298. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP009540 (Bacillus anthracis str. Sterne plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

299. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP009324 (Bacillus anthracis strain PAK-1 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

300. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP009980 (Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

301. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP047132 (Bacillus anthracis str. BF1 plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

302. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagaaacaaagccagaaacgaa	Protospacer
************.************** **

303. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_KT186230 (Bacillus anthracis strain P.NO2 plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

304. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP022045 (Bacillus anthracis strain FDAARGOS_341 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

305. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_007322 (Bacillus anthracis str. 'Ames Ancestor' plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

306. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagacaaaaccagaaacaaa	Protospacer
******************.******** **

307. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagacaaagccagagacaaa	Protospacer
************************.** **

308. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagacaaagccagagacaaa	Protospacer
************************.** **

309. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_012579 (Bacillus anthracis str. CDC 684 plasmid pX01, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

310. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP015777 (Bacillus anthracis strain Tangail-1 plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

311. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP018904 (Bacillus anthracis strain Tyrol 4675 plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

312. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_AP018444 (Bacillus anthracis strain CZC5 plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

313. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_012656 (Bacillus anthracis str. A0248 plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

314. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_010934 (Bacillus cereus strain G9241 plasmid pBCXO1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

315. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP019589 (Bacillus anthracis strain SPV842_15 plasmid pX01, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

316. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP010853 (Bacillus anthracis strain A1144 plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

317. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP008847 (Bacillus anthracis strain HYU01 plasmid pX01, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

318. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP006743 (Bacillus anthracis str. SVA11 plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

319. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_AP014834 (Bacillus anthracis strain Shikan-NIID plasmid pXO1) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

320. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP029806 (Bacillus anthracis strain London_499 plasmid pX01, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

321. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_001496 (Bacillus anthracis virulence plasmid PX01, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

322. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_017726 (Bacillus anthracis str. H9401 plasmid BAP1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagaaacaaa	Protospacer
*************** *********** **

323. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP014177 (Bacillus anthracis strain Stendal plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

324. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagacaaaaccagaaacaaa	Protospacer
******************.******** **

325. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagacaaagccagagacaaa	Protospacer
************************.** **

326. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagaaacaaagccagaaacgaa	Protospacer
************.************** **

327. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP009597 (Bacillus anthracis str. V770-NP-1R plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

328. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP009901 (Bacillus anthracis strain 2002013094 plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

329. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP009592 (Bacillus cereus G9241 plasmid pBCX01, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

330. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP009543 (Bacillus anthracis strain BA1015 plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

331. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP010321 (Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

332. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP009330 (Bacillus anthracis strain K3 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

333. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP009327 (Bacillus anthracis strain Vollum 1B plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

334. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP001975 (Bacillus anthracis str. A16R plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

335. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP001971 (Bacillus anthracis str. A16 plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagactaagccagagactaa	Protospacer
*************** ********.*****

336. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_018503 (Bacillus thuringiensis HD-771 plasmid p07, complete sequence) position: , mismatch: 2, identity: 0.933

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gactaaaccagagactaagccagaaactaa	Protospacer
*** *********** **************

337. spacer 2.7|697269|31|NZ_CP011350|CRT matches to NC_022882 (Bacillus thuringiensis YBT-1518 plasmid pBMB0233, complete sequence) position: , mismatch: 2, identity: 0.935

cttttgatccgtaagaacgttccatttccat	CRISPR spacer
cttttgatccataagatcgttccatttccat	Protospacer
**********.***** **************

338. spacer 2.7|697269|31|NZ_CP011350|CRT matches to NC_022782 (Bacillus toyonensis BCT-7112 plasmid pBCT77, complete sequence) position: , mismatch: 2, identity: 0.935

cttttgatccgtaagaacgttccatttccat	CRISPR spacer
cttttgatccataagatcgttccatttccat	Protospacer
**********.***** **************

339. spacer 2.7|697269|31|NZ_CP011350|CRT matches to NC_022877 (Bacillus thuringiensis YBT-1518 plasmid pBMB0232, complete sequence) position: , mismatch: 2, identity: 0.935

cttttgatccgtaagaacgttccatttccat	CRISPR spacer
cttttgatccataagatcgttccatttccat	Protospacer
**********.***** **************

340. spacer 2.10|697467|33|NZ_CP011350|CRT matches to NC_017204 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT51, complete sequence) position: , mismatch: 2, identity: 0.939

ccatttgttgttacttatgaactaccgccaatg	CRISPR spacer
acatttgttgttacttatgaattaccgccaatg	Protospacer
 ********************.***********

341. spacer 2.10|697467|33|NZ_CP011350|CRT matches to CP020757 (Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-18, complete sequence) position: , mismatch: 2, identity: 0.939

ccatttgttgttacttatgaactaccgccaatg	CRISPR spacer
acatttgttgttacttatgaattaccgccaatg	Protospacer
 ********************.***********

342. spacer 2.10|697467|33|NZ_CP011350|CRT matches to CP020757 (Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-18, complete sequence) position: , mismatch: 2, identity: 0.939

ccatttgttgttacttatgaactaccgccaatg	CRISPR spacer
acatttgttgttacttatgaattaccgccaatg	Protospacer
 ********************.***********

343. spacer 2.10|697467|33|NZ_CP011350|CRT matches to NZ_CP021064 (Bacillus thuringiensis strain ATCC 10792 plasmid poh3, complete sequence) position: , mismatch: 2, identity: 0.939

ccatttgttgttacttatgaactaccgccaatg	CRISPR spacer
acatttgttgttacttatgaattaccgccaatg	Protospacer
 ********************.***********

344. spacer 2.10|697467|33|NZ_CP011350|CRT matches to NZ_CP021064 (Bacillus thuringiensis strain ATCC 10792 plasmid poh3, complete sequence) position: , mismatch: 2, identity: 0.939

ccatttgttgttacttatgaactaccgccaatg	CRISPR spacer
acatttgttgttacttatgaattaccgccaatg	Protospacer
 ********************.***********

345. spacer 3.2|704602|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 2, identity: 0.941

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
****.**.**************************

346. spacer 3.2|704602|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 2, identity: 0.941

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
****.**.**************************

347. spacer 3.2|704602|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 2, identity: 0.941

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
****.**.**************************

348. spacer 3.2|704602|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 2, identity: 0.941

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
****.**.**************************

349. spacer 3.2|704602|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 2, identity: 0.941

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
****.**.**************************

350. spacer 3.2|704602|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 2, identity: 0.941

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
****.**.**************************

351. spacer 3.2|704602|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 2, identity: 0.941

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
****.**.**************************

352. spacer 3.2|704602|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 2, identity: 0.941

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
****.**.**************************

353. spacer 3.2|704602|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 2, identity: 0.941

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
****.**.**************************

354. spacer 3.3|704668|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_022782 (Bacillus toyonensis BCT-7112 plasmid pBCT77, complete sequence) position: , mismatch: 2, identity: 0.939

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaatgggaaaacaattgagctagttgcaaa	Protospacer
******.**.***********************

355. spacer 3.3|704668|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP017573 (Bacillus thuringiensis strain SCG04-02 plasmid PSCG61, complete sequence) position: , mismatch: 2, identity: 0.939

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacgggaaaataattgagctagttgcaaa	Protospacer
*********.****.******************

356. spacer 3.3|704668|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP029456 (Bacillus cereus strain FORC087 plasmid pFORC087.2, complete sequence) position: , mismatch: 2, identity: 0.939

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacgggaaaataattgagctagttgcaaa	Protospacer
*********.****.******************

357. spacer 3.3|704668|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_011656 (Bacillus cereus AH187 plasmid pAH187_45, complete sequence) position: , mismatch: 2, identity: 0.939

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacgggaaaacaattgagctggttgcaaa	Protospacer
*********.**************.********

358. spacer 3.4|704733|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 2, identity: 0.941

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
****.**.**************************

359. spacer 3.4|704733|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 2, identity: 0.941

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
****.**.**************************

360. spacer 3.4|704733|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 2, identity: 0.941

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
****.**.**************************

361. spacer 3.4|704733|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 2, identity: 0.941

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
****.**.**************************

362. spacer 3.4|704733|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 2, identity: 0.941

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
****.**.**************************

363. spacer 3.4|704733|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 2, identity: 0.941

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
****.**.**************************

364. spacer 3.4|704733|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 2, identity: 0.941

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
****.**.**************************

365. spacer 3.4|704733|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 2, identity: 0.941

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
****.**.**************************

366. spacer 3.4|704733|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 2, identity: 0.941

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
****.**.**************************

367. spacer 3.4|704733|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_KX258624 (Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence) position: , mismatch: 2, identity: 0.941

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
****.**.**************************

368. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 3, identity: 0.9

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagaaactaa	Protospacer
.*****.*****.*****************

369. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 3, identity: 0.9

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aagaaaaccagagacaaagccagaaacaaa	Protospacer
.* ************************ **

370. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 3, identity: 0.9

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aagaaaaccagagacaaagccagaaacaaa	Protospacer
.* ************************ **

371. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 3, identity: 0.9

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagaaactaa	Protospacer
.*****.*****.*****************

372. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 3, identity: 0.9

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aagaaaaccagagacaaagccagaaacaaa	Protospacer
.* ************************ **

373. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 3, identity: 0.9

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagaaactaa	Protospacer
.*****.*****.*****************

374. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP010090 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence) position: , mismatch: 3, identity: 0.9

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aagaaaaccagagacaaagccagaaacaaa	Protospacer
.* ************************ **

375. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP010090 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence) position: , mismatch: 3, identity: 0.9

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagaaactaa	Protospacer
.*****.*****.*****************

376. spacer 1.4|33922|30|NZ_CP011350|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 3, identity: 0.9

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaaaccagagacgaagccagaaacaaa	Protospacer
.**************.*********** **

377. spacer 1.4|33922|30|NZ_CP011350|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 3, identity: 0.9

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaaaccagagacgaagccagaaacaaa	Protospacer
.**************.*********** **

378. spacer 1.4|33922|30|NZ_CP011350|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 3, identity: 0.9

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaaaccagagacgaagccagaaacaaa	Protospacer
.**************.*********** **

379. spacer 1.4|33922|30|NZ_CP011350|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 3, identity: 0.9

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaaaccagagacgaagccagaaacaaa	Protospacer
.**************.*********** **

380. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 3, identity: 0.9

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aactaaaccagagacaaagccagaaaccaa	Protospacer
.** ***********************.**

381. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 3, identity: 0.9

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaaaccagagacaaagccagagacaaa	Protospacer
.***********************.** **

382. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 3, identity: 0.9

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaaaccagagacaaaaccagaaacaaa	Protospacer
.*****************.******** **

383. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 3, identity: 0.9

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaaaccagagacaaaaccagaaacaaa	Protospacer
.*****************.******** **

384. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.9

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaaaccagagacaaaaccagaaacaaa	Protospacer
.*****************.******** **

385. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_011973 (Bacillus cereus Q1 plasmid pBc239, complete sequence) position: , mismatch: 3, identity: 0.9

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaaaccagagactaagccagaaacaaa	Protospacer
.************** *********** **

386. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_011973 (Bacillus cereus Q1 plasmid pBc239, complete sequence) position: , mismatch: 3, identity: 0.9

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaaaccagagactaagccagaaacaaa	Protospacer
.************** *********** **

387. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_011973 (Bacillus cereus Q1 plasmid pBc239, complete sequence) position: , mismatch: 3, identity: 0.9

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaaaccagagactaagccagaaacaaa	Protospacer
.************** *********** **

388. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_014331 (Bacillus cereus biovar anthracis str. CI plasmid pCI-XO1, complete sequence) position: , mismatch: 3, identity: 0.9

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaaaccagagactaagccagaaacaaa	Protospacer
.************** *********** **

389. spacer 2.6|697204|31|NZ_CP011350|CRT matches to NZ_CP011157 (Bacillus cereus strain HN001 plasmid pRML02, complete sequence) position: , mismatch: 3, identity: 0.903

gtttttcacaaagcattaataccagctacat	CRISPR spacer
gctttccacaaagtattaataccagctacat	Protospacer
*.***.*******.*****************

390. spacer 2.6|697204|31|NZ_CP011350|CRT matches to NZ_CP014851 (Bacillus thuringiensis strain HD12 plasmid pHD120112, complete sequence) position: , mismatch: 3, identity: 0.903

gtttttcacaaagcattaataccagctacat	CRISPR spacer
gctttccacaaagcattaatgccagctacat	Protospacer
*.***.**************.**********

391. spacer 2.9|697401|32|NZ_CP011350|CRT matches to MH598512 (Bacillus phage Wes44, complete genome) position: , mismatch: 3, identity: 0.906

gattccacttgttcaggctctttgaatatcat	CRISPR spacer
gattccacttgttcaggctcattgaataccac	Protospacer
******************** *******.**.

392. spacer 3.5|704799|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_AP014870 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK6) position: , mismatch: 3, identity: 0.909

tggtctaacatctaaagccattaataactccta	CRISPR spacer
cggtctaacatctaaagccattaataactacga	Protospacer
.**************************** * *

393. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 4, identity: 0.905

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagaaacaaaaccagaaacaga	Protospacer
.*****************************.******** .*

394. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 4, identity: 0.905

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gacaaagccagaaaccaagccagaaacaaagccagagaaaaa	Protospacer
*************** ********************.*  **

395. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.867

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aattaagccagagacaaagccagaaactaa	Protospacer
.*. **.***********************

396. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.867

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aattaagccagagacaaagccagaaactaa	Protospacer
.*. **.***********************

397. spacer 1.4|33922|30|NZ_CP011350|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.867

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaaaccagagacaaagccagagacaga	Protospacer
.***********************.** .*

398. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 4, identity: 0.867

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagaaacaaaaccagaaataaa	Protospacer
************.*****.*******. **

399. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.867

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagaaacaaaaccagaaataaa	Protospacer
************.*****.*******. **

400. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP032411 (Brevibacillus laterosporus strain E7593-50 plasmid pAZOBL1, complete sequence) position: , mismatch: 4, identity: 0.867

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gcctaaaccagaaactaagccagaaactaa	Protospacer
* * ********.** **************

401. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP032411 (Brevibacillus laterosporus strain E7593-50 plasmid pAZOBL1, complete sequence) position: , mismatch: 4, identity: 0.867

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gcctaaaccagaaactaagccagaaactaa	Protospacer
* * ********.** **************

402. spacer 3.10|705126|34|NZ_CP011350|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP004882 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMBLin15, complete sequence) position: , mismatch: 4, identity: 0.882

atgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
atgtaggtgacgtcattaaattctcgtacttagt	Protospacer
****.***********************..* **

403. spacer 3.10|705126|34|NZ_CP011350|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011355 (Bacillus thuringiensis strain YC-10 plasmid pYC10, complete sequence) position: , mismatch: 4, identity: 0.882

atgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
atgtaggtgacgtcattaaattctcgtacttagt	Protospacer
****.***********************..* **

404. spacer 3.10|705126|34|NZ_CP011350|CRISPRCasFinder,CRT,PILER-CR matches to NC_006945 (Bacillus phage GIL16c, complete genome) position: , mismatch: 4, identity: 0.882

atgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
atgtaggtgacgtcattaaattctcgtacttagt	Protospacer
****.***********************..* **

405. spacer 3.10|705126|34|NZ_CP011350|CRISPRCasFinder,CRT,PILER-CR matches to AY701338 (Bacillus thuringiensis phage GIL16c, complete genome) position: , mismatch: 4, identity: 0.882

atgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
atgtaggtgacgtcattaaattctcgtacttagt	Protospacer
****.***********************..* **

406. spacer 3.2|704602|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 5, identity: 0.853

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
atagagcgttgcagataaatataaactcgaggta	Protospacer
   ******* ***************.*******

407. spacer 3.2|704602|34|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 5, identity: 0.853

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
atagagcgttgcagataaatataaactcgaggta	Protospacer
   ******* ***************.*******

408. spacer 3.5|704799|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP004882 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMBLin15, complete sequence) position: , mismatch: 5, identity: 0.848

tggtctaacatctaaagcc----attaataactccta	CRISPR spacer
tggtctaacatctagagccattaattaataact----	Protospacer
**************.****    **********

409. spacer 3.5|704799|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP011355 (Bacillus thuringiensis strain YC-10 plasmid pYC10, complete sequence) position: , mismatch: 5, identity: 0.848

tggtctaacatctaaagcc----attaataactccta	CRISPR spacer
tggtctaacatctagagccattaattaataact----	Protospacer
**************.****    **********

410. spacer 3.5|704799|33|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_006945 (Bacillus phage GIL16c, complete genome) position: , mismatch: 5, identity: 0.848

tggtctaacatctaaagcc----attaataactccta	CRISPR spacer
tggtctaacatctagagccattaattaataact----	Protospacer
**************.****    **********

411. spacer 3.5|704799|33|NZ_CP011350|CRISPRCasFinder,CRT matches to AY701338 (Bacillus thuringiensis phage GIL16c, complete genome) position: , mismatch: 5, identity: 0.848

tggtctaacatctaaagcc----attaataactccta	CRISPR spacer
tggtctaacatctagagccattaattaataact----	Protospacer
**************.****    **********

412. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP023002 (Bacillus anthracis strain 14RA5914 plasmid pX01, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

413. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_AP019732 (Bacillus anthracis strain PCr plasmid PCr-pXO1) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

414. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP029324 (Bacillus anthracis strain 17OD930 plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

415. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP007665 (Bacillus anthracis str. Vollum plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

416. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP009340 (Bacillus anthracis strain Ohio ACB plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

417. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP009696 (Bacillus anthracis strain RA3 plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

418. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP009463 (Bacillus anthracis strain SK-102 plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

419. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP009699 (Bacillus anthracis strain BA1035 plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

420. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP009540 (Bacillus anthracis str. Sterne plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

421. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP009324 (Bacillus anthracis strain PAK-1 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

422. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP009980 (Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

423. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP047132 (Bacillus anthracis str. BF1 plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

424. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_KT186230 (Bacillus anthracis strain P.NO2 plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

425. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NC_014331 (Bacillus cereus biovar anthracis str. CI plasmid pCI-XO1, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

426. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP022045 (Bacillus anthracis strain FDAARGOS_341 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

427. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NC_007322 (Bacillus anthracis str. 'Ames Ancestor' plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

428. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NC_012579 (Bacillus anthracis str. CDC 684 plasmid pX01, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

429. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP015777 (Bacillus anthracis strain Tangail-1 plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

430. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP018904 (Bacillus anthracis strain Tyrol 4675 plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

431. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_AP018444 (Bacillus anthracis strain CZC5 plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

432. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NC_012656 (Bacillus anthracis str. A0248 plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

433. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP019589 (Bacillus anthracis strain SPV842_15 plasmid pX01, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

434. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP010853 (Bacillus anthracis strain A1144 plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

435. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP006743 (Bacillus anthracis str. SVA11 plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

436. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_AP014834 (Bacillus anthracis strain Shikan-NIID plasmid pXO1) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

437. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NC_001496 (Bacillus anthracis virulence plasmid PX01, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

438. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NC_017726 (Bacillus anthracis str. H9401 plasmid BAP1, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

439. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP014177 (Bacillus anthracis strain Stendal plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

440. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP009597 (Bacillus anthracis str. V770-NP-1R plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

441. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP009901 (Bacillus anthracis strain 2002013094 plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

442. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP009543 (Bacillus anthracis strain BA1015 plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

443. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP010321 (Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

444. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP009330 (Bacillus anthracis strain K3 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

445. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP009327 (Bacillus anthracis strain Vollum 1B plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

446. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP001975 (Bacillus anthracis str. A16R plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

447. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP001971 (Bacillus anthracis str. A16 plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.857

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagccagaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ******************************** ..*

448. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 6, identity: 0.8

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagaaacaaaaccagaggaaaa	Protospacer
************.*****.*****..  **

449. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 6, identity: 0.8

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagaaacaaaaccagaggaaaa	Protospacer
************.*****.*****..  **

450. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 6, identity: 0.8

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagaaacaaaaccagaggaaaa	Protospacer
************.*****.*****..  **

451. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP010090 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence) position: , mismatch: 6, identity: 0.8

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagaaacaaaaccagaggaaaa	Protospacer
************.*****.*****..  **

452. spacer 1.4|33922|30|NZ_CP011350|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 6, identity: 0.8

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagaaacaaaaccagtagaaaa	Protospacer
************.*****.**** *.  **

453. spacer 1.4|33922|30|NZ_CP011350|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 6, identity: 0.8

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagaaacaaaaccagtagaaaa	Protospacer
************.*****.**** *.  **

454. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 6, identity: 0.8

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aaaaccagcagagacaaagccagaaaccaa	Protospacer
.* *  * *******************.**

455. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 6, identity: 0.8

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagaaacaaaaccagaggaaaa	Protospacer
************.*****.*****..  **

456. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aataaagccagagacaaaaccagaaataaa	Protospacer
.*.***.***********.*******. **

457. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP023246 (Bacillus cereus strain HBL-AI plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaaaccagagccaaaaccagagccaaa	Protospacer
.************ ****.*****. * **

458. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_019775 (Anabaena cylindrica PCC 7122 plasmid pANACY.06, complete sequence) position: , mismatch: 6, identity: 0.8

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aaccaagccagagacaaagccagaagttat	Protospacer
.** **.******************..**

459. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP011358 (Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence) position: , mismatch: 6, identity: 0.8

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
ggaaaaaccagaaacaaagccagaacaaaa	Protospacer
*. *********.************   **

460. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_018879 (Bacillus thuringiensis Bt407 plasmid BTB_78p, complete sequence) position: , mismatch: 6, identity: 0.8

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
ggaaaaaccagaaacaaagccagaacaaaa	Protospacer
*. *********.************   **

461. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP013057 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence) position: , mismatch: 6, identity: 0.8

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
ggaaaaaccagaaacaaagccagaacaaaa	Protospacer
*. *********.************   **

462. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_020382 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-68, complete sequence) position: , mismatch: 6, identity: 0.8

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
ggaaaaaccagaaacaaagccagaacaaaa	Protospacer
*. *********.************   **

463. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP004872 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB64, complete sequence) position: , mismatch: 6, identity: 0.8

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
ggaaaaaccagaaacaaagccagaacaaaa	Protospacer
*. *********.************   **

464. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_017205 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT72, complete sequence) position: , mismatch: 6, identity: 0.8

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
ggaaaaaccagaaacaaagccagaacaaaa	Protospacer
*. *********.************   **

465. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP015156 (Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence) position: , mismatch: 6, identity: 0.8

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
ggaaaaaccagaaacaaagccagaacaaaa	Protospacer
*. *********.************   **

466. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP004869 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB67, complete sequence) position: , mismatch: 6, identity: 0.8

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
ggaaaaaccagaaacaaagccagaacaaaa	Protospacer
*. *********.************   **

467. spacer 1.4|33922|30|NZ_CP011350|CRT matches to CP020758 (Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-19, complete sequence) position: , mismatch: 6, identity: 0.8

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
ggaaaaaccagaaacaaagccagaacaaaa	Protospacer
*. *********.************   **

468. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP010093 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB71, complete sequence) position: , mismatch: 6, identity: 0.8

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
ggaaaaaccagaaacaaagccagaacaaaa	Protospacer
*. *********.************   **

469. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP021065 (Bacillus thuringiensis strain ATCC 10792 plasmid poh4, complete sequence) position: , mismatch: 6, identity: 0.8

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
ggaaaaaccagaaacaaagccagaacaaaa	Protospacer
*. *********.************   **

470. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NC_010934 (Bacillus cereus strain G9241 plasmid pBCXO1, complete sequence) position: , mismatch: 7, identity: 0.833

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagcccgaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ***** ************************** ..*

471. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP009592 (Bacillus cereus G9241 plasmid pBCX01, complete sequence) position: , mismatch: 7, identity: 0.833

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
gactaagcccgaaacaaagccagaaacaaagccagacgtttt	Protospacer
*** ***** ************************** ..*

472. spacer 1.4|33922|30|NZ_CP011350|CRT matches to CP024688 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-4-144K, complete sequence) position: , mismatch: 7, identity: 0.767

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
cccaaaacctgagacaaaaccagaagaaaa	Protospacer
  ******* ********.******.  **

473. spacer 1.4|33922|30|NZ_CP011350|CRT matches to CP024688 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-4-144K, complete sequence) position: , mismatch: 7, identity: 0.767

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
cccaaaacctgagacaaaaccagaagaaaa	Protospacer
  ******* ********.******.  **

474. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP022446 (Bacillus cereus C1L plasmid pC1L1, complete sequence) position: , mismatch: 7, identity: 0.767

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
gacaaaaccagagacaaaaccaggggtaac	Protospacer
******************.****.... *

475. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP036355 (Bacillus sp. SYJ plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
tccaaaacctgaaacaaagccagaagaaaa	Protospacer
  ******* **.************.  **

476. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP036355 (Bacillus sp. SYJ plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
tccaaaacctgaaacaaagccagaagaaaa	Protospacer
  ******* **.************.  **

477. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP036355 (Bacillus sp. SYJ plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
tccaaaacctgaaacaaagccagaagaaaa	Protospacer
  ******* **.************.  **

478. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP009636 (Bacillus cereus 03BB108 plasmid pBFI_2, complete sequence) position: , mismatch: 7, identity: 0.767

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
tccaaaacctgaaacaaagccagaagaaaa	Protospacer
  ******* **.************.  **

479. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP009636 (Bacillus cereus 03BB108 plasmid pBFI_2, complete sequence) position: , mismatch: 7, identity: 0.767

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
tccaaaacctgaaacaaagccagaagaaaa	Protospacer
  ******* **.************.  **

480. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP009636 (Bacillus cereus 03BB108 plasmid pBFI_2, complete sequence) position: , mismatch: 7, identity: 0.767

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
tccaaaacctgaaacaaagccagaagaaaa	Protospacer
  ******* **.************.  **

481. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP053962 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
tccaaaacctgaaacaaagccagaagaaaa	Protospacer
  ******* **.************.  **

482. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP053962 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
tccaaaacctgaaacaaagccagaagaaaa	Protospacer
  ******* **.************.  **

483. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP053962 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
tccaaaacctgaaacaaagccagaagaaaa	Protospacer
  ******* **.************.  **

484. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP016317 (Bacillus cereus strain M3 plasmid pBCM301, complete sequence) position: , mismatch: 7, identity: 0.767

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
ggaaaaaccagagacaaagccagaagtacc	Protospacer
*. **********************..

485. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 7, identity: 0.767

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
ggaaaaaccagagacaaagccagaagtacc	Protospacer
*. **********************..

486. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 7, identity: 0.767

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
tccaaaacctgaaacaaagccagaagaaaa	Protospacer
  ******* **.************.  **

487. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP020748 (Bacillus mycoides strain Gnyt1 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.767

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
accaaaaccagagcctaagccagaaccaag	Protospacer
. *********** * ********* * *.

488. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_011655 (Bacillus cereus AH187 plasmid pAH187_270, complete sequence) position: , mismatch: 7, identity: 0.767

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
tccaaaacctgaaacaaagccagaagaaaa	Protospacer
  ******* **.************.  **

489. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_010924 (Bacillus cereus strain AH187 plasmid pCER270, complete sequence) position: , mismatch: 7, identity: 0.767

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
tccaaaacctgaaacaaagccagaagaaaa	Protospacer
  ******* **.************.  **

490. spacer 1.4|33922|30|NZ_CP011350|CRT matches to CP045776 (Bacillus paranthracis strain CFSAN068816 plasmid p1CFSAN068816, complete sequence) position: , mismatch: 7, identity: 0.767

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
tccaaaacctgaaacaaagccagaagaaaa	Protospacer
  ******* **.************.  **

491. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_016792 (Bacillus cereus NC7401 plasmid pNCcld, complete sequence) position: , mismatch: 7, identity: 0.767

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
tccaaaacctgaaacaaagccagaagaaaa	Protospacer
  ******* **.************.  **

492. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to MN692959 (Marine virus AFVG_117M52, complete genome) position: , mismatch: 7, identity: 0.781

atacactttttttgatttcttctactatcttc	CRISPR spacer
aaatattttttttgatttcttataatatctct	Protospacer
* *.*.*************** ** *****..

493. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to MN855765 (Myoviridae sp. isolate 14, complete genome) position: , mismatch: 7, identity: 0.781

atacactttttttgatttcttct--actatcttc	CRISPR spacer
atacactgtttttgatttcatcttgatgattt--	Protospacer
******* *********** ***  *. **.*

494. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP023002 (Bacillus anthracis strain 14RA5914 plasmid pX01, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

495. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_AP019732 (Bacillus anthracis strain PCr plasmid PCr-pXO1) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

496. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP029324 (Bacillus anthracis strain 17OD930 plasmid pXO1, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

497. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP007665 (Bacillus anthracis str. Vollum plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

498. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP009340 (Bacillus anthracis strain Ohio ACB plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

499. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP009696 (Bacillus anthracis strain RA3 plasmid pXO1, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

500. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP009463 (Bacillus anthracis strain SK-102 plasmid pXO1, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

501. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP009699 (Bacillus anthracis strain BA1035 plasmid pXO1, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

502. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP009540 (Bacillus anthracis str. Sterne plasmid pXO1, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

503. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP009324 (Bacillus anthracis strain PAK-1 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

504. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP009980 (Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

505. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP047132 (Bacillus anthracis str. BF1 plasmid pXO1, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

506. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_KT186230 (Bacillus anthracis strain P.NO2 plasmid pXO1, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

507. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP022045 (Bacillus anthracis strain FDAARGOS_341 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

508. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_007322 (Bacillus anthracis str. 'Ames Ancestor' plasmid pXO1, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

509. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_012579 (Bacillus anthracis str. CDC 684 plasmid pX01, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

510. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP015777 (Bacillus anthracis strain Tangail-1 plasmid pXO1, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

511. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP018904 (Bacillus anthracis strain Tyrol 4675 plasmid pXO1, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

512. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_AP018444 (Bacillus anthracis strain CZC5 plasmid pXO1, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

513. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_012656 (Bacillus anthracis str. A0248 plasmid pXO1, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

514. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_010934 (Bacillus cereus strain G9241 plasmid pBCXO1, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

515. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP019589 (Bacillus anthracis strain SPV842_15 plasmid pX01, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

516. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP010853 (Bacillus anthracis strain A1144 plasmid pXO1, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

517. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP006743 (Bacillus anthracis str. SVA11 plasmid pXO1, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

518. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_AP014834 (Bacillus anthracis strain Shikan-NIID plasmid pXO1) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

519. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_001496 (Bacillus anthracis virulence plasmid PX01, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

520. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_017726 (Bacillus anthracis str. H9401 plasmid BAP1, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

521. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP014177 (Bacillus anthracis strain Stendal plasmid pXO1, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

522. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP009597 (Bacillus anthracis str. V770-NP-1R plasmid pXO1, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

523. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP009901 (Bacillus anthracis strain 2002013094 plasmid pXO1, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

524. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP009592 (Bacillus cereus G9241 plasmid pBCX01, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

525. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP009543 (Bacillus anthracis strain BA1015 plasmid pXO1, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

526. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP010321 (Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

527. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP009330 (Bacillus anthracis strain K3 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

528. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP009327 (Bacillus anthracis strain Vollum 1B plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

529. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP001975 (Bacillus anthracis str. A16R plasmid pXO1, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

530. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP001971 (Bacillus anthracis str. A16 plasmid pXO1, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

531. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_014331 (Bacillus cereus biovar anthracis str. CI plasmid pCI-XO1, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aacaaagccagaaacaaagccagacgtttt	Protospacer
.*****.*****.*********** ..*

532. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP022446 (Bacillus cereus C1L plasmid pC1L1, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aactaagccagagacaaagccagaagtacc	Protospacer
.** **.******************..

533. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP040343 (Bacillus cereus strain DLOU-Weihai plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aactaagccagagacaaagccagaagtacc	Protospacer
.** **.******************..

534. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP040341 (Bacillus cereus strain DLOU-Tangshan plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aactaagccagagacaaagccagaagtacc	Protospacer
.** **.******************..

535. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aactaagccagagacaaagccagaagtacc	Protospacer
.** **.******************..

536. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP042928 (Bacillus cereus strain G1-1 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
aactaagccagagacaaagccagaagtacc	Protospacer
.** **.******************..

537. spacer 2.2|697254|41|NZ_CP011350|CRISPRCasFinder matches to NZ_CP017573 (Bacillus thuringiensis strain SCG04-02 plasmid PSCG61, complete sequence) position: , mismatch: 8, identity: 0.805

tataaggtgcgacttcttttgatccgtaagaacgttccatt	CRISPR spacer
ttttttctaatacttcttttgatccgtaagaacgttccatt	Protospacer
* *    *.  ******************************

538. spacer 2.2|697254|41|NZ_CP011350|CRISPRCasFinder matches to NZ_CP029456 (Bacillus cereus strain FORC087 plasmid pFORC087.2, complete sequence) position: , mismatch: 8, identity: 0.805

tataaggtgcgacttcttttgatccgtaagaacgttccatt	CRISPR spacer
ttttttctaatacttcttttgatccgtaagaacgttccatt	Protospacer
* *    *.  ******************************

539. spacer 2.2|697254|41|NZ_CP011350|CRISPRCasFinder matches to NZ_CP013280 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence) position: , mismatch: 8, identity: 0.805

tataaggtgcgacttcttttgatccgtaagaacgttccatt	CRISPR spacer
ttttttctaatacttcttttgatccgtaagaacgttccatt	Protospacer
* *    *.  ******************************

540. spacer 2.2|697254|41|NZ_CP011350|CRISPRCasFinder matches to NC_011656 (Bacillus cereus AH187 plasmid pAH187_45, complete sequence) position: , mismatch: 8, identity: 0.805

tataaggtgcgacttcttttgatccgtaagaacgttccatt	CRISPR spacer
ttttttctaatacttcttttgatccgtaagaacgttccatt	Protospacer
* *    *.  ******************************

541. spacer 2.2|697254|41|NZ_CP011350|CRISPRCasFinder matches to NZ_CP039726 (Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence) position: , mismatch: 8, identity: 0.805

tataaggtgcgacttcttttgatccgtaagaacgttccatt	CRISPR spacer
ttttttctaatacttcttttgatccgtaagaacgttccatt	Protospacer
* *    *.  ******************************

542. spacer 2.2|697254|41|NZ_CP011350|CRISPRCasFinder matches to NC_018685 (Bacillus thuringiensis MC28 plasmid pMC95, complete sequence) position: , mismatch: 8, identity: 0.805

tataaggtgcgacttcttttgatccgtaagaacgttccatt	CRISPR spacer
ttttttctaatacttcttttgatccgtaagaacgttccatt	Protospacer
* *    *.  ******************************

543. spacer 2.2|697254|41|NZ_CP011350|CRISPRCasFinder matches to NZ_CP009350 (Bacillus thuringiensis HD1002 plasmid 4, complete sequence) position: , mismatch: 8, identity: 0.805

tataaggtgcgacttcttttgatccgtaagaacgttccatt	CRISPR spacer
ttttttctaatacttcttttgatccgtaagaacgttccatt	Protospacer
* *    *.  ******************************

544. spacer 2.2|697254|41|NZ_CP011350|CRISPRCasFinder matches to NZ_CP033793 (Bacillus sp. FDAARGOS_527 plasmid unnamed6, complete sequence) position: , mismatch: 8, identity: 0.805

tataaggtgcgacttcttttgatccgtaagaacgttccatt	CRISPR spacer
ttttttctaatacttcttttgatccgtaagaacgttccatt	Protospacer
* *    *.  ******************************

545. spacer 2.2|697254|41|NZ_CP011350|CRISPRCasFinder matches to NZ_CP047087 (Bacillus paranthracis strain BC307 plasmid pCE2, complete sequence) position: , mismatch: 8, identity: 0.805

tataaggtgcgacttcttttgatccgtaagaacgttccatt	CRISPR spacer
ttttttctaatacttcttttgatccgtaagaacgttccatt	Protospacer
* *    *.  ******************************

546. spacer 2.2|697254|41|NZ_CP011350|CRISPRCasFinder matches to NC_018510 (Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence) position: , mismatch: 8, identity: 0.805

tataaggtgcgacttcttttgatccgtaagaacgttccatt	CRISPR spacer
ttttttctaatacttcttttgatccgtaagaacgttccatt	Protospacer
* *    *.  ******************************

547. spacer 2.2|697254|41|NZ_CP011350|CRISPRCasFinder matches to CP041751 (Bacillus paranthracis strain NCCP 14796 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.805

tataaggtgcgacttcttttgatccgtaagaacgttccatt	CRISPR spacer
ttttttctaatacttcttttgatccgtaagaacgttccatt	Protospacer
* *    *.  ******************************

548. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to KF114879 (Leptospira phage LbrZ_5399, complete genome) position: , mismatch: 8, identity: 0.75

atacactttttttgatttcttctactatcttc	CRISPR spacer
aatgtttttttttgatttcttctacaatccac	Protospacer
*    .******************* ***. *

549. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to KF114880 (Leptospira phage LinZ_10, complete genome) position: , mismatch: 8, identity: 0.75

atacactttttttgatttcttctactatcttc	CRISPR spacer
aatgtttttttttgatttcttctacaatccac	Protospacer
*    .******************* ***. *

550. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to KX656785 (UNVERIFIED: Leptospira phage Lin_34, complete genome) position: , mismatch: 8, identity: 0.75

atacactttttttgatttcttctactatcttc	CRISPR spacer
aatgtttttttttgatttcttctacaatccac	Protospacer
*    .******************* ***. *

551. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to MN693414 (Marine virus AFVG_25M246, complete genome) position: , mismatch: 8, identity: 0.75

atacactttttttgatttcttctactatcttc	CRISPR spacer
ctaattcttttttgatttcttcttctattttt	Protospacer
 **  ..**************** ****.**.

552. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to MN693468 (Marine virus AFVG_25M247, complete genome) position: , mismatch: 8, identity: 0.75

atacactttttttgatttcttctactatcttc	CRISPR spacer
ctaattcttttttgatttcttcttctattttt	Protospacer
 **  ..**************** ****.**.

553. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to MN693065 (Marine virus AFVG_25M245, complete genome) position: , mismatch: 8, identity: 0.75

atacactttttttgatttcttctactatcttc	CRISPR spacer
ctaattcttttttgatttcttcttctattttt	Protospacer
 **  ..**************** ****.**.

554. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to MN693042 (Marine virus AFVG_25M244, complete genome) position: , mismatch: 8, identity: 0.75

atacactttttttgatttcttctactatcttc	CRISPR spacer
ctaattcttttttgatttcttcttctattttt	Protospacer
 **  ..**************** ****.**.

555. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 8, identity: 0.75

atacactttttttgatttcttctactatcttc	CRISPR spacer
actcactctttttgatatcttctacttgctct	Protospacer
*. ****.******** *********  **..

556. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

atacactttttttgatttcttctactatcttc	CRISPR spacer
actcactctttttgatatcttctacttgctct	Protospacer
*. ****.******** *********  **..

557. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 8, identity: 0.75

atacactttttttgatttcttctactatcttc	CRISPR spacer
ctgtattgtttttgatttcttctaatctctta	Protospacer
 *..*.* **************** * ****

558. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 8, identity: 0.75

atacactttttttgatttcttctactatcttc	CRISPR spacer
actcactctttttgatatcttctacttgctct	Protospacer
*. ****.******** *********  **..

559. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

atacactttttttgatttcttctactatcttc	CRISPR spacer
actcactctttttgatatcttctacttgctct	Protospacer
*. ****.******** *********  **..

560. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 8, identity: 0.75

atacactttttttgatttcttctactatcttc	CRISPR spacer
actcactctttttgatatcttctacttgctct	Protospacer
*. ****.******** *********  **..

561. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP053834 (Arcobacter cloacae strain LMG 26153 plasmid pACLO, complete sequence) position: , mismatch: 8, identity: 0.75

atacactttttttgatttcttctactatcttc	CRISPR spacer
atccttctttattgatttcttcttctatctga	Protospacer
** * ..*** ************ ******

562. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP013276 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-1-360K, complete sequence) position: , mismatch: 8, identity: 0.75

atacactttttttgatttcttctactatcttc	CRISPR spacer
gtgtattgtttttgatttcttctaatctctta	Protospacer
.*..*.* **************** * ****

563. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 8, identity: 0.75

atacactttttttgatttcttctactatcttc	CRISPR spacer
actcactctttttgatatcttctacttgctct	Protospacer
*. ****.******** *********  **..

564. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP039722 (Bacillus thuringiensis strain BT-59 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

atacactttttttgatttcttctactatcttc	CRISPR spacer
gtgtattgtttttgatttcttctaatctctta	Protospacer
.*..*.* **************** * ****

565. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

atacactttttttgatttcttctactatcttc	CRISPR spacer
actcactctttttgatatcttctacttgctct	Protospacer
*. ****.******** *********  **..

566. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

atacactttttttgatttcttctactatcttc	CRISPR spacer
actcactctttttgatatcttctacttgctct	Protospacer
*. ****.******** *********  **..

567. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

atacactttttttgatttcttctactatcttc	CRISPR spacer
actcactctttttgatatcttctacttgctct	Protospacer
*. ****.******** *********  **..

568. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

atacactttttttgatttcttctactatcttc	CRISPR spacer
actcactctttttgatatcttctacttgctct	Protospacer
*. ****.******** *********  **..

569. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

atacactttttttgatttcttctactatcttc	CRISPR spacer
actcactctttttgatatcttctacttgctct	Protospacer
*. ****.******** *********  **..

570. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

atacactttttttgatttcttctactatcttc	CRISPR spacer
actcactctttttgatatcttctacttgctct	Protospacer
*. ****.******** *********  **..

571. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

atacactttttttgatttcttctactatcttc	CRISPR spacer
actcactctttttgatatcttctacttgctct	Protospacer
*. ****.******** *********  **..

572. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP009349 (Bacillus thuringiensis HD1002 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.75

atacactttttttgatttcttctactatcttc	CRISPR spacer
gtgtattgtttttgatttcttctaatctctta	Protospacer
.*..*.* **************** * ****

573. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

atacactttttttgatttcttctactatcttc	CRISPR spacer
actcactctttttgatatcttctacttgctct	Protospacer
*. ****.******** *********  **..

574. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

atacactttttttgatttcttctactatcttc	CRISPR spacer
actcactctttttgatatcttctacttgctct	Protospacer
*. ****.******** *********  **..

575. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

atacactttttttgatttcttctactatcttc	CRISPR spacer
actcactctttttgatatcttctacttgctct	Protospacer
*. ****.******** *********  **..

576. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP045023 (Bacillus thuringiensis strain JW-1 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

atacactttttttgatttcttctactatcttc	CRISPR spacer
gtgtattgtttttgatttcttctaatctctta	Protospacer
.*..*.* **************** * ****

577. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 8, identity: 0.75

atacactttttttgatttcttctactatcttc	CRISPR spacer
actcactctttttgatatcttctacttgctct	Protospacer
*. ****.******** *********  **..

578. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

atacactttttttgatttcttctactatcttc	CRISPR spacer
actcactctttttgatatcttctacttgctct	Protospacer
*. ****.******** *********  **..

579. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to AJ748296 (Sulfolobus islandicus rudivirus 1 variant XX, complete genome) position: , mismatch: 8, identity: 0.75

atacactttttttgatttcttctactatcttc	CRISPR spacer
ttaaactttttatgatttcttctatttgactc	Protospacer
 ** ******* ************.*   .**

580. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to L35061 (Bacteriophage phi-41 orfs L1-12, complete cds's, orf 13, 5' end) position: , mismatch: 8, identity: 0.75

atacactttttttgatttcttctactatcttc	CRISPR spacer
tttctttaatttttatttcttctcctatcttc	Protospacer
 * * .*  **** ********* ********

581. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NZ_CP009317 (Bacillus cereus 03BB102 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.7

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
tccaaaaccagagactaagccagcagtacc	Protospacer
  ************* ******* *..

582. spacer 1.4|33922|30|NZ_CP011350|CRT matches to NC_012473 (Bacillus cereus 03BB102 plasmid p03BB102_179, complete sequence) position: , mismatch: 9, identity: 0.7

gacaaaaccagagacaaagccagaaactaa	CRISPR spacer
tccaaaaccagagactaagccagcagtacc	Protospacer
  ************* ******* *..

583. spacer 2.2|697254|41|NZ_CP011350|CRISPRCasFinder matches to CP024689 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-5-125K, complete sequence) position: , mismatch: 9, identity: 0.78

tataaggtgcgacttcttttgatccgtaagaacgttccatt	CRISPR spacer
ttttttctaatacttcttttgatccataagaacgttccatt	Protospacer
* *    *.  **************.***************

584. spacer 2.2|697254|41|NZ_CP011350|CRISPRCasFinder matches to NC_017206 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence) position: , mismatch: 9, identity: 0.78

tataaggtgcgacttcttttgatccgtaagaacgttccatt	CRISPR spacer
ttttttctaatacttcttttgatccgtaaaaacgttccatt	Protospacer
* *    *.  ******************.***********

585. spacer 2.2|697254|41|NZ_CP011350|CRISPRCasFinder matches to NC_020383 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence) position: , mismatch: 9, identity: 0.78

tataaggtgcgacttcttttgatccgtaagaacgttccatt	CRISPR spacer
ttttttctaatacttcttttgatccgtaaaaacgttccatt	Protospacer
* *    *.  ******************.***********

586. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to AP013489 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G19, isolate: uvMED-CGR-C30A-MedDCM-OCT-S45-C81) position: , mismatch: 9, identity: 0.719

atacactttttttgatttcttctactatcttc	CRISPR spacer
catttctttttttgatttcttcgaccatctca	Protospacer
   . ***************** **.****.

587. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to MN698245 (Pelagibacter phage HTVC111P, complete genome) position: , mismatch: 9, identity: 0.719

atacactttttttgatttcttctactatcttc	CRISPR spacer
catttctttttttgatttcttcgaccatctca	Protospacer
   . ***************** **.****.

588. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to AP013487 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G19, isolate: uvMED-CGR-C30A-MedDCM-OCT-S33-C83) position: , mismatch: 9, identity: 0.719

atacactttttttgatttcttctactatcttc	CRISPR spacer
catttctttttttgatttcttcgaccatctca	Protospacer
   . ***************** **.****.

589. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_021794 (Cellulophaga phage phi18:3, complete genome) position: , mismatch: 9, identity: 0.719

atacactttttttgatttcttctactatcttc	CRISPR spacer
cttattgtttattgatttcttctactatattt	Protospacer
 *   . *** ***************** **.

590. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

atacactttttttgatttcttctactatcttc	CRISPR spacer
actcactctttttgatatcttctacttgcact	Protospacer
*. ****.******** *********  * ..

591. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to MN693376 (Marine virus AFVG_25M306, complete genome) position: , mismatch: 9, identity: 0.719

atacactttttttgatttcttctactatcttc	CRISPR spacer
aaatctatttgttggtttcttctactatctct	Protospacer
* *. . *** ***.***************..

592. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to KY065482 (Streptococcus phage IPP42, complete genome) position: , mismatch: 9, identity: 0.719

atacactttttttgatttcttctactatcttc	CRISPR spacer
ctaatatttttttgattttttcaactatccat	Protospacer
 **   ************.*** ******. .

593. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to KY065483 (Streptococcus phage IPP43, complete genome) position: , mismatch: 9, identity: 0.719

atacactttttttgatttcttctactatcttc	CRISPR spacer
ctaatatttttttgattttttcaactatccat	Protospacer
 **   ************.*** ******. .

594. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to MH853357 (Streptococcus phage LF3, partial genome) position: , mismatch: 9, identity: 0.719

atacactttttttgatttcttctactatcttc	CRISPR spacer
ctaatatttttttgattttttcaactatccat	Protospacer
 **   ************.*** ******. .

595. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to KY363359 (Streptococcus phage Str03, complete genome) position: , mismatch: 9, identity: 0.719

atacactttttttgatttcttctactatcttc	CRISPR spacer
ctaatatttttttgattttttcaactatccat	Protospacer
 **   ************.*** ******. .

596. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to MK448731 (Streptococcus phage Javan33, complete genome) position: , mismatch: 9, identity: 0.719

atacactttttttgatttcttctactatcttc	CRISPR spacer
ctaatatttttttgattttttcaactatccat	Protospacer
 **   ************.*** ******. .

597. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to KY065489 (Streptococcus phage IPP51, complete genome) position: , mismatch: 9, identity: 0.719

atacactttttttgatttcttctactatcttc	CRISPR spacer
ctaatatttttttgattttttcaactatccat	Protospacer
 **   ************.*** ******. .

598. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to KY065484 (Streptococcus phage IPP44, complete genome) position: , mismatch: 9, identity: 0.719

atacactttttttgatttcttctactatcttc	CRISPR spacer
ctaatatttttttgattttttcaactatccat	Protospacer
 **   ************.*** ******. .

599. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to MK448992 (Streptococcus phage Javan6, complete genome) position: , mismatch: 9, identity: 0.719

atacactttttttgatttcttctactatcttc	CRISPR spacer
ctaatatttttttgattttttcaactatccat	Protospacer
 **   ************.*** ******. .

600. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to MT774388 (CrAssphage cr112_1, complete genome) position: , mismatch: 9, identity: 0.719

atacactttttttgatttcttctactatcttc	CRISPR spacer
gtattaaccttttgatttcttctgctaccttc	Protospacer
.**.   ..**************.***.****

601. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_030946 (Streptococcus phage phiARI0923, complete genome) position: , mismatch: 9, identity: 0.719

atacactttttttgatttcttctactatcttc	CRISPR spacer
ctaatatttttttgattttttcaactatccat	Protospacer
 **   ************.*** ******. .

602. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to MK448734 (Streptococcus phage Javan347, complete genome) position: , mismatch: 9, identity: 0.719

atacactttttttgatttcttctactatcttc	CRISPR spacer
ctaatatttttttgattttttcaactatccat	Protospacer
 **   ************.*** ******. .

603. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to MN693062 (Marine virus AFVG_25M389, complete genome) position: , mismatch: 9, identity: 0.719

atacactttttttgatttcttctactatcttc	CRISPR spacer
aaatcaatttgttggtttcttctactatctct	Protospacer
* *.   *** ***.***************..

604. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to KY065481 (Streptococcus phage IPP41, complete genome) position: , mismatch: 9, identity: 0.719

atacactttttttgatttcttctactatcttc	CRISPR spacer
ctaatatttttttgattttttcaactatccat	Protospacer
 **   ************.*** ******. .

605. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to MK448888 (Streptococcus phage Javan26, complete genome) position: , mismatch: 9, identity: 0.719

atacactttttttgatttcttctactatcttc	CRISPR spacer
ctaatatttttttgattttttcaactatccat	Protospacer
 **   ************.*** ******. .

606. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to MK448863 (Streptococcus phage Javan18, complete genome) position: , mismatch: 9, identity: 0.719

atacactttttttgatttcttctactatcttc	CRISPR spacer
ctaatatttttttgattttttcaactatccat	Protospacer
 **   ************.*** ******. .

607. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NC_027396 (Streptococcus phage SpSL1, complete genome) position: , mismatch: 9, identity: 0.719

atacactttttttgatttcttctactatcttc	CRISPR spacer
ctaatatttttttgattttttcaactatccat	Protospacer
 **   ************.*** ******. .

608. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to KY065449 (Streptococcus phage IPP5, complete genome) position: , mismatch: 9, identity: 0.719

atacactttttttgatttcttctactatcttc	CRISPR spacer
ctaatatttttttgattttttcaactatccat	Protospacer
 **   ************.*** ******. .

609. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.762

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
agttgaaaaagaaacaaaaccagagacaaagccagaaactaa	Protospacer
... .*.  *********.*****.*****************

610. spacer 1.2|33826|42|NZ_CP011350|CRT matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.762

gacaaagccagaaacaaagccagaaacaaagccagaaactaa	CRISPR spacer
agttgaaaaagaaacaaaaccagagacaaagccagaaactaa	Protospacer
... .*.  *********.*****.*****************

611. spacer 2.2|697254|41|NZ_CP011350|CRISPRCasFinder matches to NC_022877 (Bacillus thuringiensis YBT-1518 plasmid pBMB0232, complete sequence) position: , mismatch: 10, identity: 0.756

tataaggtgcgacttcttttgatccgtaagaacgttccatt	CRISPR spacer
ttttttctaatacttcttttgatccataagatcgttccatt	Protospacer
* *    *.  **************.***** *********

612. spacer 2.2|697254|41|NZ_CP011350|CRISPRCasFinder matches to NC_022882 (Bacillus thuringiensis YBT-1518 plasmid pBMB0233, complete sequence) position: , mismatch: 10, identity: 0.756

tataaggtgcgacttcttttgatccgtaagaacgttccatt	CRISPR spacer
ttttttctaatacttcttttgatccataagatcgttccatt	Protospacer
* *    *.  **************.***** *********

613. spacer 2.2|697254|41|NZ_CP011350|CRISPRCasFinder matches to NC_022782 (Bacillus toyonensis BCT-7112 plasmid pBCT77, complete sequence) position: , mismatch: 10, identity: 0.756

tataaggtgcgacttcttttgatccgtaagaacgttccatt	CRISPR spacer
ttttttctaatacttcttttgatccataagatcgttccatt	Protospacer
* *    *.  **************.***** *********

614. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to AP014291 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S25-C40, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 10, identity: 0.688

atacactttttttgatttcttctactatcttc	CRISPR spacer
ctactcttgttttgatttcttctatatggtgt	Protospacer
 *** *** ***************.    * .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

57892 : 101865

Pseudomonas_phage(66.67%)

transposase,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033679421.1\|57892_58771_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_000899000.1\|59492_59987_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_016090328.1\|61282_61702_+	hypothetical protein	NA	NA	NA	NA
WP_016090329.1\|61768_62119_+	PrgI family protein	NA	NA	NA	NA
WP_016090330.1\|62119_63034_+	hypothetical protein	NA	NA	NA	NA
WP_016090331.1\|63036_65136_+	DUF87 domain-containing protein	NA	NA	NA	NA
WP_000108316.1\|70868_72674_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	5.5e-31	28.1
WP_003275463.1\|73729_75526_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	6.9e-34	27.1
WP_044157302.1\|75594_75786_+	hypothetical protein	NA	NA	NA	NA
WP_001149935.1\|76361_78185_+	maturase	A0A0U4J920	Pseudomonas_phage	2.5e-23	33.8
WP_016090655.1\|79229_79805_+	hypothetical protein	NA	NA	NA	NA
WP_016090654.1\|80082_80772_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_000377268.1\|81190_81655_+	redoxin domain-containing protein	NA	NA	NA	NA
WP_000589597.1\|81668_82115_+	hypothetical protein	NA	NA	NA	NA
WP_016090652.1\|82618_83062_+	hypothetical protein	NA	NA	NA	NA
WP_016090651.1\|83058_83493_+	hypothetical protein	NA	NA	NA	NA
WP_000499523.1\|83702_84896_-\|transposase	IS110-like element ISBth13 family transposase	A0A0U3ULR1	Bacillus_phage	1.1e-24	26.1
WP_016090650.1\|85192_85450_+	hypothetical protein	NA	NA	NA	NA
WP_016090649.1\|85537_85795_+	hypothetical protein	NA	NA	NA	NA
WP_016090648.1\|85885_86125_+	DUF3961 domain-containing protein	NA	NA	NA	NA
WP_033679633.1\|86159_86663_+	hypothetical protein	NA	NA	NA	NA
WP_016090646.1\|86727_87084_+	hypothetical protein	NA	NA	NA	NA
WP_016090645.1\|87714_88539_+	thioesterase family protein	NA	NA	NA	NA
WP_016090644.1\|88798_89386_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_016090643.1\|89519_90248_+	hypothetical protein	NA	NA	NA	NA
WP_016090642.1\|90439_91375_+	DMT family transporter	NA	NA	NA	NA
WP_001053969.1\|91641_93078_-\|transposase	IS4-like element IS231C family transposase	NA	NA	NA	NA
WP_016090641.1\|93264_93636_+	hypothetical protein	NA	NA	NA	NA
WP_000364215.1\|93923_94334_+	DUF1878 family protein	NA	NA	NA	NA
WP_000116992.1\|94482_95913_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_016090640.1\|96248_97169_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_001100112.1\|98517_98697_+	hypothetical protein	NA	NA	NA	NA
WP_000169374.1\|98870_100178_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	8.6e-26	29.7
WP_000647561.1\|100511_100958_-	hypothetical protein	NA	NA	NA	NA
WP_044157304.1\|101265_101865_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.8e-34	42.1

DBSCAN-SWA_2

113049 : 183550

Bacillus_phage(31.25%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000275580.1\|113049_114345_-\|transposase	IS21-like element IS232 family transposase	A0A059NT83	Lactococcus_phage	1.0e-42	31.0
WP_016090632.1\|114379_115267_+	hypothetical protein	NA	NA	NA	NA
WP_016090630.1\|116001_116193_-	hypothetical protein	NA	NA	NA	NA
WP_016090629.1\|117467_118229_+	hypothetical protein	NA	NA	NA	NA
WP_074628990.1\|118339_118762_+	DoxX family protein	NA	NA	NA	NA
WP_016090627.1\|118944_120297_-	long-chain fatty acid--CoA ligase	NA	NA	NA	NA
WP_016090626.1\|120335_120653_-	hypothetical protein	NA	NA	NA	NA
WP_016090625.1\|120817_121906_-	hypothetical protein	NA	NA	NA	NA
WP_016090624.1\|121934_123257_-	hypothetical protein	NA	NA	NA	NA
WP_016090623.1\|123425_125510_-	hypothetical protein	NA	NA	NA	NA
WP_001187351.1\|126464_127718_+	MFS transporter	NA	NA	NA	NA
WP_016090622.1\|127828_128410_+	hypothetical protein	NA	NA	NA	NA
WP_016090621.1\|129064_129385_+	TM2 domain-containing protein	A0A127AZ85	Bacillus_phage	1.6e-10	40.9
WP_016090620.1\|129852_132321_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_016090619.1\|132317_133031_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.0e-33	35.1
WP_016090618.1\|133052_133853_-	hypothetical protein	NA	NA	NA	NA
WP_016090617.1\|134554_135247_+	response regulator transcription factor	NA	NA	NA	NA
WP_016090616.1\|135251_136484_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	2.8e-18	25.1
WP_016090615.1\|137562_137823_-	hypothetical protein	NA	NA	NA	NA
WP_016090614.1\|138467_139172_+	hypothetical protein	NA	NA	NA	NA
WP_016090613.1\|139311_140157_+	hypothetical protein	NA	NA	NA	NA
WP_087942842.1\|140211_141556_+\|transposase	IS3-like element ISBth10 family transposase	A0A1B1P773	Bacillus_phage	3.6e-112	74.4
WP_016097411.1\|142398_142833_+	CDP-diacylglycerol--serine O-phosphatidyltransferase	NA	NA	NA	NA
WP_130055941.1\|143101_143302_-	hypothetical protein	NA	NA	NA	NA
WP_016090611.1\|143846_144182_-	hypothetical protein	NA	NA	NA	NA
WP_000958635.1\|145963_146257_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_016090610.1\|146649_146850_+	hypothetical protein	NA	NA	NA	NA
WP_033679611.1\|149626_150736_+	tetratricopeptide repeat protein	A0A2H4J8G3	uncultured_Caudovirales_phage	5.8e-92	46.1
WP_016090607.1\|150732_150864_+	hypothetical protein	NA	NA	NA	NA
WP_016097410.1\|151146_152259_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A288TXV8	Enterococcus_phage	1.1e-79	47.9
WP_000762752.1\|152270_152669_-\|transposase	IS200/IS605 family transposase	A0A286QN76	Streptococcus_phage	3.1e-51	68.9
WP_071686443.1\|152859_153039_+	RNA-binding protein Hfq	NA	NA	NA	NA
WP_001206759.1\|153581_153995_-	hypothetical protein	NA	NA	NA	NA
WP_000210390.1\|154541_154835_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000084567.1\|155463_155676_-	hypothetical protein	NA	NA	NA	NA
WP_001004894.1\|155748_155952_-	hypothetical protein	NA	NA	NA	NA
WP_016090603.1\|156003_156600_-	thermonuclease family protein	NA	NA	NA	NA
WP_016090602.1\|157388_158246_+	glucose uptake protein glcU	NA	NA	NA	NA
WP_016090601.1\|158262_159048_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	3.0e-26	33.5
WP_016090600.1\|159413_159701_-	hypothetical protein	NA	NA	NA	NA
WP_016090599.1\|159735_161445_-	ABC transporter ATP-binding protein	F2Y302	Organic_Lake_phycodnavirus	6.0e-19	30.1
WP_033679607.1\|161609_162998_-	radical SAM/SPASM domain-containing protein	NA	NA	NA	NA
WP_000706800.1\|164052_164436_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_001103609.1\|164432_165299_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.6e-20	30.6
WP_000906771.1\|165288_165936_+	ABC-2 transporter permease	NA	NA	NA	NA
WP_016090598.1\|166156_167554_+	S8 family serine peptidase	A0A2H4PQH1	Staphylococcus_phage	2.2e-88	43.6
WP_016090597.1\|168329_169073_-	epoxyqueuosine reductase QueH	NA	NA	NA	NA
WP_016090596.1\|169364_170003_-	NERD domain-containing protein	A0A2R2ZH57	Clostridioides_phage	2.8e-22	35.1
WP_016090595.1\|170019_170403_-	hypothetical protein	NA	NA	NA	NA
WP_016090594.1\|170699_171335_-	hypothetical protein	NA	NA	NA	NA
WP_000582601.1\|171331_171964_-	hypothetical protein	NA	NA	NA	NA
WP_016090593.1\|173600_174527_-	hypothetical protein	NA	NA	NA	NA
WP_016090592.1\|175535_177152_-	SH3 domain-containing protein	A0A1J0MS59	Bacillus_phage	4.3e-43	54.3
WP_001236345.1\|178502_179732_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.5e-85	49.4
WP_000219740.1\|180082_180379_+	hypothetical protein	NA	NA	NA	NA
WP_087971388.1\|180532_180658_+	Phr family secreted Rap phosphatase inhibitor	NA	NA	NA	NA
WP_016090591.1\|181445_182120_+	hypothetical protein	NA	NA	NA	NA
WP_144406502.1\|182207_183550_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	6.3e-32	37.3

DBSCAN-SWA_3

317083 : 375498

Bacillus_phage(64.29%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_040120033.1\|317083_318202_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	8.9e-173	80.9
WP_000500291.1\|318556_318835_-	hypothetical protein	NA	NA	NA	NA
WP_000725639.1\|318970_319129_-	Phr family secreted Rap phosphatase inhibitor	NA	NA	NA	NA
WP_001102657.1\|319128_320220_-	hypothetical protein	A0A2H4J8G3	uncultured_Caudovirales_phage	8.6e-96	49.9
WP_016090531.1\|320803_321316_+	hypothetical protein	O64031	Bacillus_phage	4.8e-33	45.6
WP_001158653.1\|321365_321740_+	hypothetical protein	D2XQ01	Bacillus_virus	1.9e-26	46.6
WP_000491768.1\|322186_322582_+	DUF3221 domain-containing protein	NA	NA	NA	NA
WP_016090530.1\|322638_324165_-	hypothetical protein	NA	NA	NA	NA
WP_000540371.1\|325137_325248_+	YjcZ family sporulation protein	NA	NA	NA	NA
WP_000301804.1\|325337_325637_-	hypothetical protein	NA	NA	NA	NA
WP_033679600.1\|325877_326612_-	DUF874 family protein	NA	NA	NA	NA
WP_000240396.1\|326957_327176_-	hypothetical protein	NA	NA	NA	NA
WP_000413130.1\|327464_327935_-	hypothetical protein	NA	NA	NA	NA
WP_000116660.1\|327936_328134_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000369592.1\|328673_329162_+	hypothetical protein	NA	NA	NA	NA
WP_016090528.1\|330357_330597_-	hypothetical protein	NA	NA	NA	NA
WP_016090527.1\|331277_332171_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_016097404.1\|332352_334179_-	asparagine synthase (glutamine-hydrolyzing)	A0A1V0SGM7	Hokovirus	2.4e-34	27.5
WP_000593069.1\|334583_335153_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_040120046.1\|335408_336530_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	2.0e-172	81.2
WP_016090522.1\|337070_338933_-	ABC transporter permease	NA	NA	NA	NA
WP_016090521.1\|338949_339711_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-34	40.0
WP_016090519.1\|341028_341715_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.4e-40	40.2
WP_016099961.1\|342947_344366_-	S-layer protein/peptidoglycan endo-beta-N-acetylglucosaminidase	G3MAW8	Bacillus_virus	7.1e-26	42.3
WP_016090516.1\|344683_345256_-	hypothetical protein	NA	NA	NA	NA
WP_000708212.1\|345491_346061_-	hypothetical protein	NA	NA	NA	NA
WP_016090515.1\|346094_347717_-	hypothetical protein	A0A2H4J389	uncultured_Caudovirales_phage	1.4e-25	33.8
WP_016090514.1\|347713_348076_-	DUF3958 domain-containing protein	NA	NA	NA	NA
WP_130055928.1\|348481_348703_+	hypothetical protein	NA	NA	NA	NA
WP_103656474.1\|349030_349315_+	EndoU domain-containing protein	A0A0A7RVN1	Clostridium_phage	2.6e-12	43.3
WP_016090510.1\|349318_349660_+	hypothetical protein	NA	NA	NA	NA
WP_016090508.1\|351998_352346_+	hypothetical protein	NA	NA	NA	NA
WP_016090507.1\|352678_353488_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_040120032.1\|353903_355025_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	1.1e-170	80.4
WP_000914230.1\|355274_355607_-	hypothetical protein	NA	NA	NA	NA
WP_154214417.1\|355789_355930_-	hypothetical protein	NA	NA	NA	NA
WP_087942837.1\|356395_357764_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	2.2e-93	65.3
WP_000420168.1\|358432_358633_+	hypothetical protein	NA	NA	NA	NA
WP_047225421.1\|358700_358940_+	hypothetical protein	NA	NA	NA	NA
WP_016090505.1\|358954_359299_+	hypothetical protein	NA	NA	NA	NA
WP_000765882.1\|359392_359836_-	DUF5065 family protein	NA	NA	NA	NA
WP_000922179.1\|360458_361034_-	hypothetical protein	NA	NA	NA	NA
WP_040120045.1\|361380_362502_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	8.3e-163	77.2
WP_016090503.1\|362747_363803_-	N-acetylmuramoyl-L-alanine amidase	A0A1B0T6C8	Bacillus_phage	6.2e-152	72.1
WP_000570185.1\|363799_364039_-	hypothetical protein	A0A0A7AR38	Bacillus_phage	2.7e-26	75.9
WP_000499523.1\|364336_365530_+\|transposase	IS110-like element ISBth13 family transposase	A0A0U3ULR1	Bacillus_phage	1.1e-24	26.1
WP_016090502.1\|365624_365858_-	XpaF1 protein	A0A2H4J382	uncultured_Caudovirales_phage	8.1e-12	83.8
WP_000405795.1\|366048_366933_-	N-acetylmuramoyl-L-alanine amidase family protein	A0A0S2MVR5	Bacillus_phage	4.2e-77	52.4
WP_001051379.1\|367205_368027_-	M23 family metallopeptidase	A0A218KCJ1	Bacillus_phage	4.9e-27	43.8
WP_016099955.1\|368168_369137_-	lysozyme family protein	A0A223LKM8	Bacillus_phage	4.5e-32	41.7
WP_000460733.1\|369374_369761_-	hypothetical protein	A0A288WG73	Bacillus_phage	2.6e-47	69.8
WP_016090275.1\|369863_370790_-	DnaD domain protein	A0A1C8E9B4	Bacillus_phage	3.7e-76	63.5
WP_000527101.1\|370862_371099_-	helix-turn-helix transcriptional regulator	W8CYU0	Bacillus_phage	9.7e-13	60.0
WP_000579788.1\|371235_371664_+	helix-turn-helix transcriptional regulator	Q786F1	Bacillus_phage	9.3e-30	51.4
WP_000673778.1\|371686_372115_+	ImmA/IrrE family metallo-endopeptidase	Q9T201	Bacillus_phage	7.3e-35	55.1
WP_016090274.1\|372379_373591_-	S-layer homology domain-containing protein	NA	NA	NA	NA
WP_000762755.1\|373975_374374_+\|transposase	IS200/IS605-like element ISBth16 family transposase	A0A286QN76	Streptococcus_phage	2.3e-51	69.7
WP_016097395.1\|374385_375498_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A288TXV8	Enterococcus_phage	7.9e-81	48.3

DBSCAN-SWA_4

463136 : 515000

Bacillus_phage(40.0%)

transposase,integrase,protease

attL 496020:496079|attR 515068:516722

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001098031.1\|463136_464072_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_000502626.1\|464161_464431_-	hypothetical protein	NA	NA	NA	NA
WP_000869334.1\|464544_464748_+	hypothetical protein	NA	NA	NA	NA
WP_001180021.1\|464804_464990_+	hypothetical protein	NA	NA	NA	NA
WP_001216652.1\|465106_465526_+	hypothetical protein	NA	NA	NA	NA
WP_001233517.1\|465592_465943_+	PrgI family protein	NA	NA	NA	NA
WP_000892000.1\|465943_466858_+	hypothetical protein	NA	NA	NA	NA
WP_016090237.1\|466860_468969_+	DUF87 domain-containing protein	NA	NA	NA	NA
WP_000890337.1\|468999_473019_+	hypothetical protein	NA	NA	NA	NA
WP_000108316.1\|474684_476490_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	5.5e-31	28.1
WP_003275463.1\|477545_479342_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	6.9e-34	27.1
WP_000043048.1\|479410_479602_+	hypothetical protein	NA	NA	NA	NA
WP_001149932.1\|480177_482001_+	maturase	A0A0U4J920	Pseudomonas_phage	5.6e-23	33.3
WP_014481869.1\|482160_483036_+	peptidoglycan DD-metalloendopeptidase family protein	A7KUS1	Bacillus_phage	3.5e-15	38.3
WP_000757464.1\|483052_483628_+	hypothetical protein	NA	NA	NA	NA
WP_001242518.1\|483789_484173_+	hypothetical protein	NA	NA	NA	NA
WP_000104242.1\|484169_484469_+	DUF2325 domain-containing protein	NA	NA	NA	NA
WP_000659905.1\|484597_484906_+	hypothetical protein	NA	NA	NA	NA
WP_000343609.1\|484945_485671_+	hypothetical protein	NA	NA	NA	NA
WP_000342852.1\|485721_485967_+	hypothetical protein	NA	NA	NA	NA
WP_001065855.1\|486298_486982_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_001186844.1\|487438_488584_-	DUF418 domain-containing protein	NA	NA	NA	NA
WP_000725572.1\|488624_489107_-	thioredoxin family protein	NA	NA	NA	NA
WP_000523962.1\|489717_491064_+	hypothetical protein	NA	NA	NA	NA
WP_000025329.1\|491063_491492_+	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_001102776.1\|491804_492878_-	hypothetical protein	A0A2H4J8G3	uncultured_Caudovirales_phage	1.8e-77	44.2
WP_000802626.1\|493127_494618_+	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_000888766.1\|495597_495849_-	YolD-like family protein	NA	NA	NA	NA
496020:496079	attL	NA	NA	NA	NA
WP_001053969.1\|496146_497583_-\|transposase	IS4-like element IS231C family transposase	NA	NA	NA	NA
WP_000351941.1\|498470_499370_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_000020440.1\|499492_500080_+	flavodoxin family protein	NA	NA	NA	NA
WP_016090335.1\|500094_501024_+	DMT family transporter	NA	NA	NA	NA
WP_000650425.1\|501452_502427_-	DUF4179 domain-containing protein	NA	NA	NA	NA
WP_000955500.1\|502430_502961_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_000898260.1\|503503_503743_+	hypothetical protein	NA	NA	NA	NA
WP_000417392.1\|503795_504047_+	hypothetical protein	NA	NA	NA	NA
WP_001154608.1\|504265_504640_-	hypothetical protein	D2XQ01	Bacillus_virus	4.8e-30	52.5
WP_000238290.1\|504688_504997_-	YolD-like family protein	NA	NA	NA	NA
WP_000794364.1\|505293_506082_+	hypothetical protein	A0A288WG17	Bacillus_phage	2.8e-64	51.4
WP_000027993.1\|506170_506944_+	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_000349585.1\|506984_507776_+	glyoxalase	A0A288WG17	Bacillus_phage	6.8e-103	68.4
WP_000247457.1\|507844_508249_-	hypothetical protein	NA	NA	NA	NA
WP_001028065.1\|508241_510251_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_000477499.1\|510247_511345_-\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	6.5e-11	30.3
WP_000272577.1\|511525_512791_-	Y-family DNA polymerase	O64031	Bacillus_phage	4.2e-102	46.7
WP_001053969.1\|513563_515000_+\|transposase	IS4-like element IS231C family transposase	NA	NA	NA	NA
515068:516722	attR	NA	NA	NA	NA

DBSCAN-SWA_5

522415 : 593864

Bacillus_phage(28.57%)

transposase,integrase,holin

attL 515110:515131|attR 537720:537741

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
515110:515131	attL	NA	NA	NA	NA
WP_001021539.1\|522415_523459_-\|integrase	tyrosine-type recombinase/integrase	A0A0E3T6D9	Bacillus_phage	1.2e-09	23.1
WP_000149389.1\|523690_524041_+	zinc-finger domain-containing protein	NA	NA	NA	NA
WP_000121085.1\|524062_524575_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_001053969.1\|525847_527284_-\|transposase	IS4-like element IS231C family transposase	NA	NA	NA	NA
WP_000532004.1\|527448_528753_+	WXG100 family type VII secretion target	NA	NA	NA	NA
WP_047225423.1\|528775_529021_+	hypothetical protein	NA	NA	NA	NA
WP_000790837.1\|529066_529459_-	DUF4878 domain-containing protein	NA	NA	NA	NA
WP_001236345.1\|529814_531044_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.5e-85	49.4
WP_000997955.1\|531774_532524_+	hypothetical protein	NA	NA	NA	NA
WP_000065268.1\|532811_533036_-	hypothetical protein	NA	NA	NA	NA
WP_016090373.1\|533212_534046_+	hypothetical protein	NA	NA	NA	NA
WP_001103226.1\|534551_535646_-	tetratricopeptide repeat protein	A0A2H4J8G3	uncultured_Caudovirales_phage	1.5e-92	48.8
WP_000844156.1\|535990_536239_+	hypothetical protein	NA	NA	NA	NA
WP_000845491.1\|536375_536585_+	hypothetical protein	NA	NA	NA	NA
WP_001032039.1\|537137_537437_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_016099974.1\|538003_539020_+	exosporium leader peptide-containing protein	NA	NA	NA	NA
537720:537741	attR	NA	NA	NA	NA
WP_000520933.1\|541152_542025_+	DMT family transporter	NA	NA	NA	NA
WP_000169371.1\|543018_544326_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.3e-26	31.0
WP_001100112.1\|544499_544679_-	hypothetical protein	NA	NA	NA	NA
WP_014481860.1\|546264_546576_-	mono-ADP-ribosyltransferase C3 (Exoenzyme C3)	NA	NA	NA	NA
WP_014481859.1\|546535_547072_-	ADP-ribosyltransferase	NA	NA	NA	NA
WP_000954716.1\|548604_549447_+	N-hydroxyarylamine O-acetyltransferase	NA	NA	NA	NA
WP_001255046.1\|549736_550084_+	DUF4064 domain-containing protein	A0A0S2MVJ2	Bacillus_phage	2.5e-25	54.1
WP_003319651.1\|550276_550639_-\|transposase	IS3 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	6.0e-14	45.7
WP_001025593.1\|551435_554507_-\|transposase	Tn3 family transposase	Q1MVP5	Enterobacteria_phage	4.3e-44	22.3
WP_001224533.1\|554757_555381_+	recombinase family protein	Q1MVP4	Enterobacteria_phage	4.4e-12	33.7
WP_000798699.1\|555632_556385_-	AAA family ATPase	A0A059NT77	Lactococcus_phage	7.0e-57	47.3
WP_044157363.1\|556416_557670_-\|transposase	IS21-like element IS232 family transposase	A0A059NT83	Lactococcus_phage	9.7e-43	31.0
WP_002133690.1\|558215_558467_+	hypothetical protein	NA	NA	NA	NA
WP_016090366.1\|559090_562624_-	pesticidal crystal protein cry1Ac	NA	NA	NA	NA
WP_000215667.1\|562913_563870_-	N-acetylmuramoyl-L-alanine amidase	A0A0S2MV84	Bacillus_phage	6.9e-49	39.5
WP_001053956.1\|565661_567098_+\|transposase	IS4-like element IS231B family transposase	NA	NA	NA	NA
WP_000275580.1\|567305_568601_+\|transposase	IS21-like element IS232 family transposase	A0A059NT83	Lactococcus_phage	1.0e-42	31.0
WP_000798699.1\|568590_569343_+	AAA family ATPase	A0A059NT77	Lactococcus_phage	7.0e-57	47.3
WP_016090469.1\|569504_569948_-\|transposase	IS200/IS605 family transposase	A0A286QN76	Streptococcus_phage	9.6e-46	65.6
WP_016099948.1\|570346_571342_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	1.1e-137	79.7
WP_016097421.1\|571517_572060_-	recombinase family protein	A0A219YA40	Aeromonas_phage	3.4e-13	31.5
WP_016097422.1\|572240_573704_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	8.1e-142	57.2
WP_016090463.1\|573726_574146_+	universal stress protein	NA	NA	NA	NA
WP_016090464.1\|574232_575900_+	ribonuclease J	NA	NA	NA	NA
WP_140159901.1\|576258_577188_-	collagen-like protein	NA	NA	NA	NA
WP_016090232.1\|578728_579325_+	DUF421 domain-containing protein	NA	NA	NA	NA
WP_016090231.1\|579603_580014_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_016090230.1\|580143_580905_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_016090229.1\|581032_581419_-	DUF202 domain-containing protein	NA	NA	NA	NA
WP_016090228.1\|581451_582264_-	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_016090227.1\|582580_583126_+	recombinase family protein	M9Q1K0	Clostridium_phage	1.1e-30	41.0
WP_016090226.1\|583168_586117_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	6.1e-80	26.6
WP_016090225.1\|587831_588134_+	hypothetical protein	A0A0S2MVJ2	Bacillus_phage	5.0e-14	47.3
WP_001243454.1\|588299_589349_-	Fic family protein	NA	NA	NA	NA
WP_000495521.1\|590544_590949_+	DUF3221 domain-containing protein	NA	NA	NA	NA
WP_000892197.1\|593441_593864_+\|holin	phage holin family protein	A0A0S2MVC4	Bacillus_phage	1.3e-52	77.3

DBSCAN-SWA_6

655709 : 729494

Bacillus_phage(18.18%)

transposase,integrase

attL 678198:678214|attR 728497:728513

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033679397.1\|655709_656831_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	1.9e-170	80.4
WP_000369347.1\|657508_658420_-	DMT family transporter	NA	NA	NA	NA
WP_000701098.1\|658531_659605_-	hypothetical protein	NA	NA	NA	NA
WP_015406625.1\|660961_662080_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	3.0e-173	81.5
WP_000929144.1\|663196_663493_-	hypothetical protein	NA	NA	NA	NA
WP_033679387.1\|664741_665146_-\|transposase	IS200/IS605 family transposase	A0A286QN76	Streptococcus_phage	1.4e-40	67.6
WP_087942375.1\|665558_667119_+\|transposase	IS3 family transposase	A0A0C5AEA5	Paenibacillus_phage	4.9e-68	57.6
WP_071686411.1\|667402_667531_-	hypothetical protein	NA	NA	NA	NA
WP_000954720.1\|667711_668527_-	N-hydroxyarylamine O-acetyltransferase	NA	NA	NA	NA
WP_001206763.1\|668923_669337_-	hypothetical protein	NA	NA	NA	NA
WP_033679394.1\|670054_670357_+	hypothetical protein	NA	NA	NA	NA
WP_000763085.1\|671874_672390_-	hypothetical protein	NA	NA	NA	NA
WP_000682816.1\|672473_672851_-	hypothetical protein	NA	NA	NA	NA
WP_024927926.1\|672847_673165_-	hypothetical protein	NA	NA	NA	NA
WP_001017354.1\|673472_674564_-	tetratricopeptide repeat protein	A0A2H4J8G3	uncultured_Caudovirales_phage	9.2e-90	45.6
WP_000207869.1\|674753_675047_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000420420.1\|675120_675558_-	disulfide bond formation protein B	NA	NA	NA	NA
WP_000887510.1\|675548_676007_-	hypothetical protein	NA	NA	NA	NA
WP_000081052.1\|676030_676318_-	hypothetical protein	NA	NA	NA	NA
WP_001014119.1\|676393_676594_-	hypothetical protein	NA	NA	NA	NA
WP_000708139.1\|676626_677271_-	thermonuclease family protein	A0A2P1JU10	Anoxybacillus_phage	3.7e-06	34.0
WP_000520732.1\|677699_680363_-	type IA DNA topoisomerase	A0A1V0SIB2	Klosneuvirus	4.5e-13	20.9
678198:678214	attL	NA	NA	NA	NA
WP_000312314.1\|681334_681535_+	hypothetical protein	NA	NA	NA	NA
WP_000866011.1\|682120_682759_-	NERD domain-containing protein	A0A2R2ZH57	Clostridioides_phage	3.3e-23	35.6
WP_015406623.1\|682775_683159_-	hypothetical protein	NA	NA	NA	NA
WP_000916413.1\|683284_683869_+	hypothetical protein	NA	NA	NA	NA
WP_078405438.1\|683888_684467_+	hypothetical protein	NA	NA	NA	NA
WP_000817905.1\|684517_685153_-	hypothetical protein	NA	NA	NA	NA
WP_001024816.1\|685152_685782_-	hypothetical protein	NA	NA	NA	NA
WP_000494364.1\|686118_686832_-	hypothetical protein	NA	NA	NA	NA
WP_103653709.1\|686848_689251_-	DEAD/DEAH box helicase	NA	NA	NA	NA
WP_000654328.1\|689528_691394_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.4e-37	30.9
WP_000114815.1\|693120_693348_-	hypothetical protein	NA	NA	NA	NA
WP_001219637.1\|693363_694455_-	methyltransferase	NA	NA	NA	NA
WP_000710696.1\|694718_695144_-	hypothetical protein	NA	NA	NA	NA
WP_113623483.1\|696083_696239_-	hypothetical protein	NA	NA	NA	NA
WP_000853368.1\|698343_699204_-	type I-C CRISPR-associated protein Cas7/Csd2	NA	NA	NA	NA
WP_000118651.1\|699206_701126_-	type I-C CRISPR-associated protein Cas8c/Csd1	NA	NA	NA	NA
WP_003319726.1\|701126_701846_-	type I-C CRISPR-associated protein Cas5	NA	NA	NA	NA
WP_014481878.1\|702051_704421_-	CRISPR-associated helicase/endonuclease Cas3	NA	NA	NA	NA
WP_000335059.1\|705514_707317_-	hypothetical protein	NA	NA	NA	NA
WP_000373088.1\|707726_708644_-	hypothetical protein	NA	NA	NA	NA
WP_000610947.1\|708658_709441_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_000724860.1\|709533_709926_-	hypothetical protein	NA	NA	NA	NA
WP_000459233.1\|711723_712533_+	hypothetical protein	NA	NA	NA	NA
WP_000372481.1\|712914_714639_-	hypothetical protein	NA	NA	NA	NA
WP_000372779.1\|714674_716144_-	hypothetical protein	NA	NA	NA	NA
WP_000520262.1\|716830_718540_+	hypothetical protein	NA	NA	NA	NA
WP_000041871.1\|719766_720714_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_000677976.1\|720823_721219_+	helix-turn-helix transcriptional regulator	A0A0A8WJ60	Clostridium_phage	4.3e-05	44.4
WP_000968739.1\|721343_723116_-	phosphoadenosine phosphosulfate reductase family protein	NA	NA	NA	NA
WP_001244154.1\|723238_723652_-	HEPN domain-containing protein	NA	NA	NA	NA
WP_000282361.1\|723638_724025_-	nucleotidyltransferase domain-containing protein	NA	NA	NA	NA
WP_047225424.1\|723976_724417_-	hypothetical protein	NA	NA	NA	NA
WP_016090214.1\|724436_725273_-	hypothetical protein	NA	NA	NA	NA
WP_000209412.1\|725285_725687_-	hypothetical protein	NA	NA	NA	NA
WP_001061019.1\|725737_726703_-	hypothetical protein	NA	NA	NA	NA
WP_000859310.1\|726751_727396_-	hypothetical protein	NA	NA	NA	NA
WP_016090213.1\|727373_727985_-	hypothetical protein	NA	NA	NA	NA
WP_000275580.1\|728198_729494_+\|transposase	IS21-like element IS232 family transposase	A0A059NT83	Lactococcus_phage	1.0e-42	31.0
728497:728513	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr_ID: NZ_CP011350.1|WP_000500291.1|318556_318835_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: NZ_CP011350.1|WP_000369592.1|328673_329162_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: NZ_CP011350.1|WP_000914230.1|355274_355607_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: NZ_CP011350.1|WP_154214417.1|355789_355930_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: NZ_CP011350.1|WP_000570185.1|363799_364039_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: NZ_CP011350.1|WP_000929144.1|663196_663493_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP011350.1|WP_000500291.1|318556_318835_-|hypothetical-protein

318556_318835_-

92 aa aa

HTH_OrfB_IS605

Identity	Hit_domain_coverage
0.5106382978723404	1.0

317083-375498

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP011350_1	Orphan	1.1\|33790\|18\|NZ_CP011350\|CRT	33790-33807	18	372977-372960	2

1. spacer 1.1|33790|18|NZ_CP011350|CRT matches to NZ_CP011350 position: 372977-372960, mismatch: 2

aagaaaaccagagacaaa	CRISPR spacer
aacaaaaccagagccaaa	Protospacer
** ********** ****

NZ_CP011350.1|WP_000369592.1|328673_329162_+|hypothetical-protein

328673_329162_+

162 aa aa

HTH_XRE,HTH_OrfB_IS605

Identity	Hit_domain_coverage
0.45614035087719296	0.9827586206896551

317083-375498

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP011350_1	Orphan	1.1\|33790\|18\|NZ_CP011350\|CRT	33790-33807	18	372977-372960	2

1. spacer 1.1|33790|18|NZ_CP011350|CRT matches to NZ_CP011350 position: 372977-372960, mismatch: 2

aagaaaaccagagacaaa	CRISPR spacer
aacaaaaccagagccaaa	Protospacer
** ********** ****

NZ_CP011350.1|WP_000914230.1|355274_355607_-|hypothetical-protein

355274_355607_-

110 aa aa

HTH_21,HTH_OrfB_IS605

Identity	Hit_domain_coverage
0.5254237288135594	1.0

317083-375498

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP011350_1	Orphan	1.1\|33790\|18\|NZ_CP011350\|CRT	33790-33807	18	372977-372960	2

1. spacer 1.1|33790|18|NZ_CP011350|CRT matches to NZ_CP011350 position: 372977-372960, mismatch: 2

aagaaaaccagagacaaa	CRISPR spacer
aacaaaaccagagccaaa	Protospacer
** ********** ****

NZ_CP011350.1|WP_154214417.1|355789_355930_-|hypothetical-protein

355789_355930_-

46 aa aa

HTH_21,HTH_OrfB_IS605

Identity	Hit_domain_coverage
0.5254237288135594	1.0

317083-375498

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP011350_1	Orphan	1.1\|33790\|18\|NZ_CP011350\|CRT	33790-33807	18	372977-372960	2

1. spacer 1.1|33790|18|NZ_CP011350|CRT matches to NZ_CP011350 position: 372977-372960, mismatch: 2

aagaaaaccagagacaaa	CRISPR spacer
aacaaaaccagagccaaa	Protospacer
** ********** ****

NZ_CP011350.1|WP_000570185.1|363799_364039_-|hypothetical-protein

363799_364039_-

79 aa aa

HTH_OrfB_IS605

Identity	Hit_domain_coverage
0.5	0.9787234042553191

317083-375498

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP011350_1	Orphan	1.1\|33790\|18\|NZ_CP011350\|CRT	33790-33807	18	372977-372960	2

1. spacer 1.1|33790|18|NZ_CP011350|CRT matches to NZ_CP011350 position: 372977-372960, mismatch: 2

aagaaaaccagagacaaa	CRISPR spacer
aacaaaaccagagccaaa	Protospacer
** ********** ****

NZ_CP011350.1|WP_000929144.1|663196_663493_-|hypothetical-protein

663196_663493_-

98 aa aa

HTH_21,HTH_OrfB_IS605

Identity	Hit_domain_coverage
0.4067796610169492	1.0

655709-729494

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP011350_1	Orphan	1.1\|33790\|18\|NZ_CP011350\|CRT	33790-33807	18	677786-677769	2

1. spacer 1.1|33790|18|NZ_CP011350|CRT matches to NZ_CP011350 position: 677786-677769, mismatch: 2

aagaaaaccagagacaaa	CRISPR spacer
aagaaaaccggagaaaaa	Protospacer
*********.**** ***

2. NZ_CP011358

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

10955 : 60269

uncultured_Caudovirales_phage(28.57%)

transposase,integrase

attL 46726:46743|attR 65258:65275

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000275580.1\|10955_12251_+\|transposase	IS21-like element IS232 family transposase	A0A059NT83	Lactococcus_phage	1.0e-42	31.0
WP_000798699.1\|12240_12993_+	AAA family ATPase	A0A059NT77	Lactococcus_phage	7.0e-57	47.3
WP_000412868.1\|13658_14078_-	hypothetical protein	NA	NA	NA	NA
WP_012008613.1\|14483_15050_-	hypothetical protein	NA	NA	NA	NA
WP_000230191.1\|15110_16382_-	ParM/StbA family protein	NA	NA	NA	NA
WP_001200537.1\|16607_17027_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_016097290.1\|17042_17336_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_016090467.1\|17891_18434_-	recombinase family protein	A0A219YA40	Aeromonas_phage	4.5e-13	31.5
WP_080708804.1\|18602_19247_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	2.0e-60	64.1
WP_142388634.1\|19084_20875_-	collagen-like protein	NA	NA	NA	NA
WP_016090232.1\|22046_22643_+	DUF421 domain-containing protein	NA	NA	NA	NA
WP_016090231.1\|22921_23332_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_016090230.1\|23461_24223_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_016090229.1\|24350_24737_-	DUF202 domain-containing protein	NA	NA	NA	NA
WP_016090228.1\|24769_25582_-	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_016090227.1\|25898_26444_+	recombinase family protein	M9Q1K0	Clostridium_phage	1.1e-30	41.0
WP_016090226.1\|26486_29435_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	6.1e-80	26.6
WP_002133690.1\|30131_30383_-	hypothetical protein	NA	NA	NA	NA
WP_001224533.1\|31029_31653_-	recombinase family protein	Q1MVP4	Enterobacteria_phage	4.4e-12	33.7
WP_001025593.1\|31903_34975_+\|transposase	Tn3 family transposase	Q1MVP5	Enterobacteria_phage	4.3e-44	22.3
WP_000190466.1\|35084_35501_-	hypothetical protein	A0A2H4J4V0	uncultured_Caudovirales_phage	5.9e-29	44.9
WP_016097345.1\|35520_36678_-	WXG100 family type VII secretion target	A0A2H4J389	uncultured_Caudovirales_phage	2.9e-142	65.8
WP_012008607.1\|37110_38643_-	replication protein ori43	NA	NA	NA	NA
WP_012008606.1\|39419_40118_+	response regulator transcription factor	NA	NA	NA	NA
WP_012008605.1\|40228_40873_-	hypothetical protein	NA	NA	NA	NA
WP_012008604.1\|41019_41202_-	hypothetical protein	NA	NA	NA	NA
WP_003272553.1\|41229_41496_-	hypothetical protein	NA	NA	NA	NA
WP_000217377.1\|41687_42002_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000876891.1\|42083_42635_-	hypothetical protein	NA	NA	NA	NA
WP_012008603.1\|43594_43888_-	hypothetical protein	NA	NA	NA	NA
WP_040120061.1\|43946_44270_-	hypothetical protein	NA	NA	NA	NA
WP_012008601.1\|44430_44802_-	hypothetical protein	NA	NA	NA	NA
WP_012008600.1\|44884_45259_-	hypothetical protein	NA	NA	NA	NA
WP_012008599.1\|45305_45920_-	hypothetical protein	NA	NA	NA	NA
WP_012008598.1\|45986_46256_-	hypothetical protein	NA	NA	NA	NA
WP_001004369.1\|46299_46632_-	hypothetical protein	NA	NA	NA	NA
46726:46743	attL	NA	NA	NA	NA
WP_000651963.1\|46865_47051_+	RNA chaperone Hfq	NA	NA	NA	NA
WP_000751784.1\|47725_47860_-	hypothetical protein	NA	NA	NA	NA
WP_000287770.1\|47856_48969_-	tetratricopeptide repeat protein	A0A2H4J8G3	uncultured_Caudovirales_phage	3.4e-92	47.8
WP_016097343.1\|49186_49621_-	hypothetical protein	NA	NA	NA	NA
WP_000382147.1\|49782_50637_+	TnP I resolvase	S5M9V8	Brevibacillus_phage	4.4e-23	26.4
WP_000538375.1\|50655_53619_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	4.1e-201	39.2
WP_001053969.1\|53811_55248_-\|transposase	IS4-like element IS231C family transposase	NA	NA	NA	NA
WP_016099920.1\|55225_55699_-	hypothetical protein	NA	NA	NA	NA
WP_000946495.1\|55713_56088_-	hypothetical protein	NA	NA	NA	NA
WP_012008596.1\|56135_58790_-	type IA DNA topoisomerase	NA	NA	NA	NA
WP_000432938.1\|59342_60269_-\|integrase	tyrosine-type recombinase/integrase	S5M9V8	Brevibacillus_phage	2.2e-36	34.2
65258:65275	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP011355

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

612 : 14745

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016090425.1\|612_1206_+	hypothetical protein	S5Z7C9	Bacillus_phage	4.7e-80	77.9
WP_016090424.1\|1237_1576_+	helix-turn-helix domain-containing protein	S5Y6I2	Bacillus_phage	7.6e-43	78.6
WP_016090423.1\|1709_1976_+	hypothetical protein	S5YPF7	Bacillus_phage	1.3e-26	66.3
WP_016100035.1\|1950_2322_+	hypothetical protein	Q5ILC3	Bacillus_phage	3.3e-15	96.7
WP_016097524.1\|2309_2894_+	hypothetical protein	Q5ILC2	Bacillus_phage	4.3e-70	99.5
WP_016090421.1\|3239_3878_+	hypothetical protein	Q5ILB9	Bacillus_phage	1.9e-124	99.5
WP_016090418.1\|4310_4580_+	hypothetical protein	Q5ILB5	Bacillus_phage	8.7e-42	98.9
WP_016090417.1\|4579_5650_+	hypothetical protein	Q5ILB4	Bacillus_phage	3.5e-203	99.7
WP_000523934.1\|5691_5922_+	hypothetical protein	Q5ILB3	Bacillus_phage	9.4e-37	100.0
WP_015976770.1\|6157_6589_+	hypothetical protein	Q5ILB0	Bacillus_phage	1.5e-56	100.0
WP_015976771.1\|6916_7192_+	hypothetical protein	Q5ILA7	Bacillus_phage	2.2e-48	100.0
WP_015976772.1\|7195_7810_+	hypothetical protein	Q5ILA6	Bacillus_phage	4.5e-78	100.0
WP_015976773.1\|7813_8566_+	lytic enzyme	Q5ILA5	Bacillus_phage	4.5e-136	100.0
WP_015976774.1\|8513_9026_+	hypothetical protein	Q5ILA4	Bacillus_phage	1.7e-91	100.0
WP_015976775.1\|9039_9933_+	hypothetical protein	Q5ILA3	Bacillus_phage	2.2e-150	100.0
WP_015976776.1\|9936_10818_+	hypothetical protein	Q5ILA2	Bacillus_phage	2.5e-170	100.0
WP_016090416.1\|10834_11626_+	N-acetylmuramoyl-L-alanine amidase	Q5ILA1	Bacillus_phage	7.3e-129	100.0
WP_016090415.1\|12048_14745_-	hypothetical protein	S5Z7F3	Bacillus_phage	0.0e+00	82.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP011352

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 46634

Bacillus_phage(100.0%)

integrase,head,holin,terminase,portal,tail

attL 1914:1938|attR 46379:46403

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016049870.1\|0_46634_+	hypothetical protein	A0A0S2MVC8	Bacillus_phage	2.3e-39	100.0
46379:46403	attR	NA	NA	NA	NA
WP_016049871.1\|397_640_+	DUF2829 domain-containing protein	A0A0S2MV73	Bacillus_phage	8.6e-41	100.0
WP_016049872.1\|639_903_+	DUF2829 domain-containing protein	A0A0S2MVC6	Bacillus_phage	9.0e-44	100.0
WP_016049873.1\|1162_1483_+	hypothetical protein	A0A0S2MVH6	Bacillus_phage	4.8e-55	100.0
WP_016049874.1\|1510_1894_+	hypothetical protein	I7J6Y9	Bacillus_phage	2.2e-67	100.0
1914:1938	attL	NA	NA	NA	NA
WP_016049845.1\|1926_2256_+	hypothetical protein	A0A0S2MVB8	Bacillus_phage	1.7e-52	100.0
WP_000762692.1\|2242_2455_+	hypothetical protein	A0A0S2MV92	Bacillus_phage	7.1e-31	100.0
WP_016049846.1\|2605_3520_+\|terminase	phage terminase small subunit	A0A0S2MVB6	Bacillus_phage	2.5e-141	100.0
WP_016049847.1\|3509_4784_+\|terminase	PBSX family phage terminase large subunit	A0A0S2MVC1	Bacillus_phage	2.4e-254	100.0
WP_016049848.1\|4796_6230_+\|portal	phage portal protein	A0A0S2MVB2	Bacillus_phage	8.5e-277	100.0
WP_016090413.1\|6303_7071_+	hypothetical protein	A0A0S2MVF0	Bacillus_phage	1.1e-142	100.0
WP_016049850.1\|7070_7343_+	DUF2829 domain-containing protein	A0A0S2MV93	Bacillus_phage	2.5e-49	100.0
WP_016049851.1\|7422_8103_+	DUF4355 domain-containing protein	A0A0S2MVA2	Bacillus_phage	9.7e-106	100.0
WP_016049852.1\|8120_8963_+	hypothetical protein	A0A0S2MVF8	Bacillus_phage	2.2e-155	100.0
WP_016049853.1\|9013_9322_+	phage related protein gp15	A0A0S2MVF2	Bacillus_phage	3.1e-51	100.0
WP_016049854.1\|9318_9663_+\|head,tail	phage head-tail adaptor	A0A0S2MVD7	Bacillus_phage	6.7e-63	100.0
WP_016049855.1\|9637_10045_+	HK97 gp10 family phage protein	A0A0S2MVE4	Bacillus_phage	1.4e-67	100.0
WP_016049856.1\|10050_10413_+	hypothetical protein	A0A0S2MV90	Bacillus_phage	1.1e-63	100.0
WP_016049857.1\|10427_11021_+	hypothetical protein	A0A0S2MV81	Bacillus_phage	1.6e-109	100.0
WP_016049858.1\|11067_11496_+	hypothetical protein	A0A0S2MV94	Bacillus_phage	1.5e-72	100.0
WP_044129691.1\|11600_11807_+	hypothetical protein	A0A0S2MV68	Bacillus_phage	5.6e-33	100.0
WP_016049860.1\|11807_14747_+\|tail	phage tail tape measure protein	A0A0S2MVC9	Bacillus_phage	0.0e+00	100.0
WP_016049861.1\|14759_16238_+\|tail	phage tail fiber protein	A0A0S2MVB9	Bacillus_phage	9.9e-297	100.0
WP_016090411.1\|16234_20944_+	phage minor structural protein	A0A0S2MVH9	Bacillus_phage	0.0e+00	100.0
WP_016090410.1\|21043_22003_+\|integrase	tyrosine-type recombinase/integrase	A0A068EP13	Bacillus_phage	4.8e-183	100.0
WP_016090409.1\|22018_22258_+	hypothetical protein	A0A0S2MVH5	Bacillus_phage	4.8e-36	100.0
WP_016090408.1\|22300_22531_+\|holin	phage holin	A0A0S2MVE8	Bacillus_phage	1.1e-34	100.0
WP_016090407.1\|22547_23483_+	L-alanyl-D-glutamate peptidase	A0A0S2MVR5	Bacillus_phage	5.7e-189	100.0
WP_016090406.1\|23777_24062_-	hypothetical protein	A0A0S2MVK9	Bacillus_phage	2.7e-49	100.0
WP_000539769.1\|24496_24730_-	helix-turn-helix transcriptional regulator	A0A0S2MVM0	Bacillus_phage	7.3e-37	100.0
WP_016090405.1\|24815_25346_-	hypothetical protein	A0A0S2MVP2	Bacillus_phage	7.1e-96	100.0
WP_031303572.1\|25357_25738_-	hypothetical protein	A0A0S2MVE7	Bacillus_phage	2.8e-62	100.0
WP_016090403.1\|25855_26188_-	hypothetical protein	A0A0S2MVL6	Bacillus_phage	4.6e-53	99.1
WP_016090402.1\|26147_27179_-	ParM/StbA family protein	A0A0S2MVG2	Bacillus_phage	1.1e-196	100.0
WP_016090401.1\|27461_28124_-	hypothetical protein	A0A0S2MVD6	Bacillus_phage	5.3e-125	100.0
WP_016090400.1\|28147_29251_-	hypothetical protein	A0A0S2MVK1	Bacillus_phage	1.5e-172	100.0
WP_016090399.1\|29850_30195_-	DUF4064 domain-containing protein	A0A0S2MVJ2	Bacillus_phage	5.3e-52	100.0
WP_016090398.1\|30214_30742_-	DUF4352 domain-containing protein	A0A0S2MVG4	Bacillus_phage	2.0e-90	100.0
WP_016090397.1\|31352_31670_-	helix-turn-helix transcriptional regulator	A0A0S2MVM8	Bacillus_phage	5.8e-53	100.0
WP_016090396.1\|32234_33422_+	helix-turn-helix transcriptional regulator	A0A0S2MVK2	Bacillus_phage	4.6e-220	100.0
WP_016090393.1\|33909_34260_-	helix-turn-helix transcriptional regulator	A0A0S2MVD3	Bacillus_phage	4.7e-56	100.0
WP_016090392.1\|34473_34671_+	helix-turn-helix transcriptional regulator	A0A0S2MVJ7	Bacillus_phage	1.4e-28	100.0
WP_016090391.1\|34737_35466_+	rha family phage regulatory protein	A0A0S2MVD8	Bacillus_phage	2.6e-133	100.0
WP_016090390.1\|35477_35852_+	hypothetical protein	A0A0S2MVH3	Bacillus_phage	5.6e-63	100.0
WP_016090389.1\|35875_36583_+	hypothetical protein	A0A0S2MVI5	Bacillus_phage	1.0e-129	100.0
WP_016090388.1\|36582_36762_+	hypothetical protein	A0A0S2MVI7	Bacillus_phage	5.4e-24	100.0
WP_016090387.1\|36751_37081_+	hypothetical protein	A0A0S2MVM3	Bacillus_phage	8.1e-50	100.0
WP_016090386.1\|37226_37730_+	hypothetical protein	A0A0S2MVD2	Bacillus_phage	8.5e-91	100.0
WP_016090385.1\|37698_38082_+	hypothetical protein	A0A0S2MVI0	Bacillus_phage	1.1e-69	100.0
WP_016090384.1\|38101_38458_+	hypothetical protein	A0A0S2MVL2	Bacillus_phage	5.1e-66	100.0
WP_016090383.1\|38481_38949_+	hypothetical protein	A0A0S2MVF1	Bacillus_phage	1.3e-85	100.0
WP_016090382.1\|39062_39500_+	hypothetical protein	A0A0S2MVD9	Bacillus_phage	1.0e-76	100.0
WP_016090381.1\|39499_39952_+	hypothetical protein	A0A0S2MVJ1	Bacillus_phage	7.9e-88	100.0
WP_016090380.1\|39948_40530_+	hypothetical protein	A0A0S2MVD0	Bacillus_phage	3.0e-108	100.0
WP_016090379.1\|40551_41034_+	hypothetical protein	A0A0S2MVE6	Bacillus_phage	2.5e-87	100.0
WP_016090378.1\|41167_41467_+	hypothetical protein	A0A0S2MVI8	Bacillus_phage	1.1e-50	100.0
WP_016090376.1\|41695_42103_+	hypothetical protein	A0A0S2MVF6	Bacillus_phage	6.9e-75	100.0
WP_016090479.1\|42704_42950_+	hypothetical protein	A0A0S2MVC7	Bacillus_phage	8.4e-36	100.0
WP_016090480.1\|42999_43224_+	hypothetical protein	A0A0S2MVG0	Bacillus_phage	4.5e-36	100.0
WP_016090481.1\|43265_43643_+	hypothetical protein	A0A0S2MVH4	Bacillus_phage	1.1e-50	100.0
WP_016090449.1\|43767_43950_+	hypothetical protein	A0A0S2MVH2	Bacillus_phage	4.3e-29	100.0
WP_016049864.1\|43980_44511_+	Holliday junction resolvase RecU	A0A0S2MVB5	Bacillus_phage	1.2e-98	100.0
WP_016090448.1\|44530_44854_+	hypothetical protein	A0A0S2MV86	Bacillus_phage	3.3e-56	100.0
WP_016090447.1\|44998_45499_+	sigma-70 family RNA polymerase sigma factor	A0A0S2MVE1	Bacillus_phage	1.2e-89	100.0
WP_016049869.1\|46391_46634_+	hypothetical protein	A0A0S2MVA9	Bacillus_phage	2.9e-36	100.0

Anti-CRISPR protein detection

Acr_ID: NZ_CP011352.1|WP_016090405.1|24815_25346_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: NZ_CP011352.1|WP_031303572.1|25357_25738_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: NZ_CP011352.1|WP_016090403.1|25855_26188_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: NZ_CP011352.1|WP_016090399.1|29850_30195_-|DUF4064-domain-containing-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP011352.1|WP_016090405.1|24815_25346_-|hypothetical-protein

24815_25346_-

176 aa aa

HTH_XRE

Identity	Hit_domain_coverage
0.43137254901960786	0.8620689655172413

0-46634

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP011350_3	TypeI	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	37079-37048	0

1. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP011352 position: 37079-37048, mismatch: 0

atacactttttttgatttcttctactatcttc	CRISPR spacer
atacactttttttgatttcttctactatcttc	Protospacer
********************************

NZ_CP011352.1|WP_031303572.1|25357_25738_-|hypothetical-protein

25357_25738_-

126 aa aa

HTH_XRE

Identity	Hit_domain_coverage
0.43137254901960786	0.8620689655172413

0-46634

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP011350_3	TypeI	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	37079-37048	0

1. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP011352 position: 37079-37048, mismatch: 0

atacactttttttgatttcttctactatcttc	CRISPR spacer
atacactttttttgatttcttctactatcttc	Protospacer
********************************

NZ_CP011352.1|WP_016090403.1|25855_26188_-|hypothetical-protein

25855_26188_-

110 aa aa

HTH_XRE

Identity	Hit_domain_coverage
0.43137254901960786	0.8620689655172413

0-46634

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP011350_3	TypeI	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	37079-37048	0

1. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP011352 position: 37079-37048, mismatch: 0

atacactttttttgatttcttctactatcttc	CRISPR spacer
atacactttttttgatttcttctactatcttc	Protospacer
********************************

NZ_CP011352.1|WP_016090399.1|29850_30195_-|DUF4064-domain-containing-protein

29850_30195_-

114 aa aa

HTH_3,HTH_XRE

Identity	Hit_domain_coverage
0.425	0.7272727272727273

0-46634

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP011350_3	TypeI	3.7\|704929\|32\|NZ_CP011350\|CRISPRCasFinder,CRT	704929-704960	32	37079-37048	0

1. spacer 3.7|704929|32|NZ_CP011350|CRISPRCasFinder,CRT matches to NZ_CP011352 position: 37079-37048, mismatch: 0

atacactttttttgatttcttctactatcttc	CRISPR spacer
atacactttttttgatttcttctactatcttc	Protospacer
********************************

5. NZ_CP011349

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP011349_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011349_1

3093813-3093963

Orphan

Consensus_repeat	Method
CGCCGATATATTTTGAAAATCGCTGATATAA	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP011349_1

>merge|NZ_CP011349|1|3093813-3093963|CRISPRCasFinder
AATCGATATATTTTGAAAATCGCTGATATAATCTGAGTTACGCCGATATATTTTGAAAATCGCTGATATAATCTGAGTTACGCCGATATATTTTGAAAATCGCTGATATAATCTGAGTTACGCCGATATATTTTGAAAATCGCTGATATAA

>NZ_CP011349|1|1|3093813-3093963|CRISPRCasFinder
AATCGATATATTTTGAAAATCGCTGATATAA	TCTGAGTTACGCCGATATATTTTGAAAAT
CGCTGATATAATCTGAGTTACGCCGATATAT	TTTGAAAATCGCTGATATAATCTGAGTTA
CGCCGATATATTTTGAAAATCGCTGATATAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011349.1\|WP_000145762.1\|3089835_3091161_+\|6-phospho-beta-glucosidase	unknown	unknown	gnl\|CDD\|133432
NZ_CP011349.1\|WP_000856213.1\|3091953_3093135_-\|chromate-transporter	unknown	unknown	gnl\|CDD\|273350
NZ_CP011349.1\|WP_000617782.1\|3085725_3087027_+\|PTS-cellobiose-transporter-subunit-IIC	unknown	unknown	gnl\|CDD\|273034
NZ_CP011349.1\|WP_002101558.1\|3103994_3104837_+\|DegV-family-protein	unknown	unknown	gnl\|CDD\|273257
NZ_CP011349.1\|WP_001168848.1\|3088019_3089327_+\|PTS-cellobiose-transporter-subunit-IIC	unknown	unknown	gnl\|CDD\|224372
NZ_CP011349.1\|WP_000597152.1\|3096820_3097558_-\|polysaccharide-deacetylase	unknown	unknown	gnl\|CDD\|200569
NZ_CP011349.1\|WP_000378321.1\|3097757_3098831_-\|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase	unknown	unknown	gnl\|CDD\|133463
NZ_CP011349.1\|WP_000926665.1\|3103122_3103758_-\|YigZ-family-protein	unknown	unknown	gnl\|CDD\|129359
NZ_CP011349.1\|WP_000499473.1\|3105472_3106885_+\|C40-family-peptidase	unknown	unknown	gnl\|CDD\|366353
NZ_CP011349.1\|WP_000392787.1\|3101915_3103040_-\|LCP-family-protein	unknown	unknown	gnl\|CDD\|224235
NZ_CP011349.1\|WP_000820970.1\|3094040_3096716_-\|sigma-54-dependent-transcriptional-regulator	unknown	unknown	gnl\|CDD\|226443
NZ_CP011349.1\|WP_001023567.1\|3087700_3088003_+\|PTS-sugar-transporter-subunit-IIB	unknown	unknown	gnl\|CDD\|99906
NZ_CP011349.1\|WP_000593487.1\|3091210_3091915_+\|chitin-disaccharide-deacetylase	unknown	unknown	gnl\|CDD\|235007
NZ_CP011349.1\|WP_000140145.1\|3100762_3101878_+\|UDP-N-acetylglucosamine-2-epimerase-(non-hydrolyzing)	unknown	unknown	gnl\|CDD\|223458
NZ_CP011349.1\|WP_000379645.1\|3087036_3087354_+\|PTS-lactose/cellobiose-transporter-subunit-IIA	unknown	unknown	gnl\|CDD\|376749
NZ_CP011349.1\|WP_000989059.1\|3089508_3089832_+\|PTS-lactose/cellobiose-transporter-subunit-IIA	unknown	unknown	gnl\|CDD\|238133
NZ_CP011349.1\|WP_001023554.1\|3085408_3085711_+\|PTS-sugar-transporter-subunit-IIB	unknown	unknown	gnl\|CDD\|99906
NZ_CP011349.1\|WP_000207046.1\|3093322_3093736_+\|CHRD-domain-containing-protein	unknown	unknown	gnl\|CDD\|214804
NZ_CP011349.1\|WP_000400857.1\|3105009_3105324_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP011349.1\|WP_000704918.1\|3099362_3100688_+\|UDP-glucose/GDP-mannose-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|223936

Protein	Function_ID	Function_description	E-value
NZ_CP011349.1\|WP_000145762.1\|3089835_3091161_+\|6-phospho-beta-glucosidase	gnl\|CDD\|133432	cd05296, GH4_P_beta_glucosidase, Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.	0
NZ_CP011349.1\|WP_000856213.1\|3091953_3093135_-\|chromate-transporter	gnl\|CDD\|273350	TIGR00937, Chromate_transport_protein, chromate transporter, chromate ion transporter (CHR) family. Members of this family probably act as chromate transporters, and are found in Pseudomonas aeruginosa, Alcaligenes eutrophus, Vibrio cholerae, Bacillus subtilis, Ochrobactrum tritici, cyanobacteria and archaea. The protein reduces chromate accumulation and is essential for chromate resistance. [Transport and binding proteins, Anions].	5.64932e-141
NZ_CP011349.1\|WP_000617782.1\|3085725_3087027_+\|PTS-cellobiose-transporter-subunit-IIC	gnl\|CDD\|273034	TIGR00359, NN'-diacetylchitobiose_permease_IIC_component, phosphotransferase system, cellobiose specific, IIC component. The family consists of the cellobiose specific form of the phosphotransferase system (PTS), IIC component. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids, Signal transduction, PTS].	1.85092e-180
NZ_CP011349.1\|WP_002101558.1\|3103994_3104837_+\|DegV-family-protein	gnl\|CDD\|273257	TIGR00762, DegV, EDD domain protein, DegV family. This family of proteins is related to DegV of Bacillus subtilis and includes paralogous sets in several species (B. subtilis, Deinococcus radiodurans, Mycoplasma pneumoniae) that are closer in percent identity to each than to most homologs from other species. This suggests both recent paralogy and diversity of function. DegV itself is encoded immediately downstream of DegU, a transcriptional regulator of degradation, but is itself uncharacterized. Crystallography suggested a lipid-binding site, while comparison of the crystal structure to dihydroxyacetone kinase and to a mannose transporter EIIA domain suggests a conserved domain, EDD, with phosphotransferase activity. [Unknown function, General].	2.05797e-131
NZ_CP011349.1\|WP_001168848.1\|3088019_3089327_+\|PTS-cellobiose-transporter-subunit-IIC	gnl\|CDD\|224372	COG1455, CelB, Phosphotransferase system cellobiose-specific component IIC [Carbohydrate transport and metabolism].	1.81788e-164
NZ_CP011349.1\|WP_000597152.1\|3096820_3097558_-\|polysaccharide-deacetylase	gnl\|CDD\|200569	cd10944, CE4_SmPgdA_like, Catalytic NodB homology domain of Streptococcus mutans polysaccharide deacetylase PgdA, Bacillus subtilis YheN, and similar proteins. This family is represented by a putative polysaccharide deacetylase PgdA from the oral pathogen Streptococcus mutans (SmPgdA) and Bacillus subtilis YheN (BsYheN), which are members of the carbohydrate esterase 4 (CE4) superfamily. SmPgdA is an extracellular metal-dependent polysaccharide deacetylase with a typical CE4 fold, with metal bound to a His-His-Asp triad. It possesses de-N-acetylase activity toward a hexamer of chitooligosaccharide N-acetylglucosamine, but not shorter chitooligosaccharides or a synthetic peptidoglycan tetrasaccharide. SmPgdA plays a role in tuning cell surface properties and in interactions with (salivary) agglutinin, an essential component of the innate immune system, most likely through deacetylation of an as-yet-unidentified polysaccharide. SmPgdA shows significant homology to the catalytic domains of peptidoglycan deacetylases from Streptococcus pneumoniae (SpPgdA) and Listeria monocytogenes (LmPgdA), both of which are involved in the bacterial defense mechanism against human mucosal lysozyme. The Bacillus subtilis genome contains six polysaccharide deacetylase gene homologs: pdaA, pdaB (previously known as ybaN), yheN, yjeA, yxkH and ylxY. The biological function of BsYheN is still unknown. This family also includes many uncharacterized polysaccharide deacetylases mainly found in bacteria.	3.79782e-82
NZ_CP011349.1\|WP_000378321.1\|3097757_3098831_-\|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase	gnl\|CDD\|133463	cd06853, GT_WecA_like, This subfamily contains Escherichia coli WecA, Bacillus subtilis TagO and related proteins. WecA is an UDP-N-acetylglucosamine (GlcNAc):undecaprenyl-phosphate (Und-P) GlcNAc-1-phosphate transferase that catalyzes the formation of a phosphodiester bond between a membrane-associated undecaprenyl-phosphate molecule and N-acetylglucosamine 1-phosphate, which is usually donated by a soluble UDP-N-acetylglucosamine precursor. WecA participates in the biosynthesis of O antigen LPS in many enteric bacteria and is also involved in the biosynthesis of enterobacterial common antigen. A conserved short sequence motif and a conserved arginine at a cytosolic loop of this integral membrane protein were shown to be critical in recognition of substrate UDP-N-acetylglucosamine.	9.38398e-90
NZ_CP011349.1\|WP_000926665.1\|3103122_3103758_-\|YigZ-family-protein	gnl\|CDD\|129359	TIGR00257, IMPACT_family_member_HI_0722, uncharacterized protein, YigZ family. This uncharacterized protein family includes YigZ, which has been crystallized, from E. coli. YigZ is homologous to the protein product of the mouse IMPACT gene. Crystallography shows a two-domain stucture, and the C-terminal domain is suggested to bind nucleic acids. The function is unknown. Note that the ortholog from E. coli was shown fused to the pepQ gene in GenBank entry X54687. This caused occasional misidentification of this protein as pepQ; this family is found in a number of species that lack pepQ. [Unknown function, General].	2.89702e-83
NZ_CP011349.1\|WP_000499473.1\|3105472_3106885_+\|C40-family-peptidase	gnl\|CDD\|366353	pfam00877, NLPC_P60, NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.	1.46388e-34
NZ_CP011349.1\|WP_000392787.1\|3101915_3103040_-\|LCP-family-protein	gnl\|CDD\|224235	COG1316, LytR, Transcriptional regulator [Transcription].	2.50941e-86
NZ_CP011349.1\|WP_000820970.1\|3094040_3096716_-\|sigma-54-dependent-transcriptional-regulator	gnl\|CDD\|226443	COG3933, COG3933, Transcriptional antiterminator [Transcription].	3.72519e-94
NZ_CP011349.1\|WP_001023567.1\|3087700_3088003_+\|PTS-sugar-transporter-subunit-IIB	gnl\|CDD\|99906	cd05564, PTS_IIB_chitobiose_lichenan, PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS). In these systems, EII is either a lichenan- or an N,N-diacetylchitobiose-specific permease with two cytoplasmic domains (IIA and IIB) and a transmembrane channel IIC domain. In the chitobiose system, these subunits are expressed as separate proteins from chbA, chbB, and chbC of the chb operon (formerly the cel (cellulose) operon). In the lichenan system, these subunits are expressed from licA, licB, and licC of the lic operon. The lic operon of Bacillus subtilis is required for the transport and degradation of oligomeric beta-glucosides, which are produced by extracellular enzymes on substrates such as lichenan or barley glucan. The lic operon is transcribed from a gammaA-dependent promoter and is inducible by lichenan, lichenan hydrolysate, and cellobiose. The IIB domain fold includes a central four-stranded parallel open twisted beta-sheet flanked by alpha-helices on both sides. The seven major PTS systems with this IIB fold include chitobiose/lichenan, ascorbate, lactose, galactitol, mannitol, fructose, and a sensory system with similarity to the bacterial bgl system.	4.90006e-47
NZ_CP011349.1\|WP_000593487.1\|3091210_3091915_+\|chitin-disaccharide-deacetylase	gnl\|CDD\|235007	PRK02134, PRK02134, chitin disaccharide deacetylase.	1.41761e-133
NZ_CP011349.1\|WP_000140145.1\|3100762_3101878_+\|UDP-N-acetylglucosamine-2-epimerase-(non-hydrolyzing)	gnl\|CDD\|223458	COG0381, WecB, UDP-N-acetylglucosamine 2-epimerase [Cell envelope biogenesis, outer membrane].	0
NZ_CP011349.1\|WP_000379645.1\|3087036_3087354_+\|PTS-lactose/cellobiose-transporter-subunit-IIA	gnl\|CDD\|376749	pfam02255, PTS_IIA, PTS system, Lactose/Cellobiose specific IIA subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. The lactose/cellobiose-specific family are one of four structurally and functionally distinct group IIA PTS system enzymes. This family of proteins normally function as a homotrimer, stabilized by a centrally located metal ion. Separation into subunits is thought to occur after phosphorylation.	1.48527e-43
NZ_CP011349.1\|WP_000989059.1\|3089508_3089832_+\|PTS-lactose/cellobiose-transporter-subunit-IIA	gnl\|CDD\|238133	cd00215, PTS_IIA_lac, PTS_IIA, PTS system, lactose/cellobiose specific IIA subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. This family is one of four structurally and functionally distinct group IIA PTS system cytoplasmic enzymes, necessary for the uptake of carbohydrates across the cytoplasmic membrane and their phosphorylation. This family of proteins normally function as a homotrimer, stabilized by a centrally located metal ion. Separation into subunits is thought to occur after phosphorylation.	4.71348e-39
NZ_CP011349.1\|WP_001023554.1\|3085408_3085711_+\|PTS-sugar-transporter-subunit-IIB	gnl\|CDD\|99906	cd05564, PTS_IIB_chitobiose_lichenan, PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS). In these systems, EII is either a lichenan- or an N,N-diacetylchitobiose-specific permease with two cytoplasmic domains (IIA and IIB) and a transmembrane channel IIC domain. In the chitobiose system, these subunits are expressed as separate proteins from chbA, chbB, and chbC of the chb operon (formerly the cel (cellulose) operon). In the lichenan system, these subunits are expressed from licA, licB, and licC of the lic operon. The lic operon of Bacillus subtilis is required for the transport and degradation of oligomeric beta-glucosides, which are produced by extracellular enzymes on substrates such as lichenan or barley glucan. The lic operon is transcribed from a gammaA-dependent promoter and is inducible by lichenan, lichenan hydrolysate, and cellobiose. The IIB domain fold includes a central four-stranded parallel open twisted beta-sheet flanked by alpha-helices on both sides. The seven major PTS systems with this IIB fold include chitobiose/lichenan, ascorbate, lactose, galactitol, mannitol, fructose, and a sensory system with similarity to the bacterial bgl system.	2.00226e-45
NZ_CP011349.1\|WP_000207046.1\|3093322_3093736_+\|CHRD-domain-containing-protein	gnl\|CDD\|214804	smart00754, CHRD, A domain in the BMP inhibitor chordin and in microbial proteins.	3.88884e-32
NZ_CP011349.1\|WP_000400857.1\|3105009_3105324_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	9.54836e-36
NZ_CP011349.1\|WP_000704918.1\|3099362_3100688_+\|UDP-glucose/GDP-mannose-dehydrogenase-family-protein	gnl\|CDD\|223936	COG1004, Ugd, Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane].	0

>NZ_CP011349.1|WP_000207046.1|3093322_3093736_+|CHRD-domain-containing-protein
MTTHFFARLTGKREVPPVNTEAFGVAEFIFSDDLTKLHYRVILKNIEKVTSCQIHLGKSTQIGPVVLYLYGPLEQGISLNEGSITGVVNVEDFEGPLQGKSFVHLLQEIIQANVYVNVHTKSQKRGEIRGRVRKVKK
>NZ_CP011349.1|WP_000856213.1|3091953_3093135_-|chromate-transporter
MKTNKYTFHTLLEIFLVSFKLGLTSFGGPVAHLGYFHHEYVQKRKWMDERSYGDLVALCQFLPGPASSQVGMGVGLLRGGLLGAIISWIGFTLPSVLVLVFFASFLNQFDLGSAGWIHGLKLVAVAIVAHAIWGMARKLTPDRNRATIAIVTAAIALLWPSSWTQVILIIICGFIGWFLYRNQPISQSQNIRVPISKKIAVSCLVLFFGLLLLLPILRPFSYYIALFDSFYRSGALVFGGGHVVLPLLEGEFVQNGMMTKEQFLAGYGLTQAVPGPLFTFASYIGAVLNGTLGAIIATIAIFLPAFLLVIGVLPFWNNVRKISFIQGALLGVNAAVVGILIAAFYDPIWTSTIINASDFVFASLLFCLLAFWKAPPWVIVILGAFGGYILSIL
>NZ_CP011349.1|WP_000593487.1|3091210_3091915_+|chitin-disaccharide-deacetylase
MIKLIVNADDFGLTEGTNYGIIDGHINGLVNSTTMMMNMPGTEHAVRLAKEYNLLGVGVHLVLTAGEPLLGDVPSLVGSDGSFHKQSVVREGNINPEEVEREWTAQIEKFLSYGLTPTHLDSHHHVHGLPILHDVLERLAAKYNVPIRRCGEDRAVHPFSDVFYSDFYADGVTEDYFMKLKERVQGEQTVEIMVHPAYIDPELVKRSSYVMDRVKELRILTESELPEGIELVKF
>NZ_CP011349.1|WP_000145762.1|3089835_3091161_+|6-phospho-beta-glucosidase
MTGIKIATIGGGSSYTPELIEGFIKRYDELPVREIWLVDIEAGKEKLEIVGNLAKRMVKKSGLPIEVHLTLDRREALKDADFVTTQLRVGLLEARAKDEAIPLKYDVIGQETNGPGGLFKALRTIPVILDICKDMEELCPNAWLINFANPAGMVTEAVLRYTNIQRVVGLCNVPIGIRMGLARLLEVDASRVHVDFAGLNHMVYGLDVYLDGVSVMDRVLELVTDPEKQITMENIAALNWEPDFIRGLRAIPCPYHRYYYKTREMLEEEKEASVEKGTRAEVVKQLENDLFELYKDPNLDIKPPQLEKRGGAYYSDAACSLITSIYNNKGDIQPVNTRNNGTIASLPHDSAVEVNCIITKEGPKPIAVGDLPVPVRGLVQQIKSFERTTIEAAVTGDYHKALLAMTINPLVPSDKVAKQILDEMLEAHKEYLPQFFKKVEK
>NZ_CP011349.1|WP_000989059.1|3089508_3089832_+|PTS-lactose/cellobiose-transporter-subunit-IIA
MMTTAEQIPFQLILNSGNARSFAMEALQFAKQGKMVEADEAMVKAKEAINEAHHFQTELIQSEARGEKTEVSVLLIHAQDHLMNAITVKELAAEFIDLYKKLEAKGE
>NZ_CP011349.1|WP_001168848.1|3088019_3089327_+|PTS-cellobiose-transporter-subunit-IIC
MQKFIAFMEKYLVPVAGRIGSQRHLVAIRDGFIAVMPLILVGSFAVLINNLPIDAFQNFMKGTFGDAWKDVGGGMWTGSFAILALIVAVGISYNLAKSYGVDALSAAIITFGALIIISPTTPKEGGIDLAWTGAQGLFVSIIVALLVTEVFRFFVQRDITIKMPDGVPPAVMKSFAALVPAFVILIVTAGIQLAVKLAGTSIHKMVFETIQLPLQGLAGTLPSAIIIALLIHVLWFFGLHGPNIIGGIIDPIYLPALEKNMKLFNDGMSAYDVPHIFTKPFFDVYVYIGGSGATLAFLVAVMLVAKSAQLRGVGRVSIGPGFFNINEPVIFGTPIVLNPTLIIPFVLTPVVLVITSYTAITLGWVPKTVALVPWTMPPIFSGYLVSGGSIAGAALQVVNFAIAVVIYYPFVLMCDRTYVQAAKAETKGSDNSVSL
>NZ_CP011349.1|WP_001023567.1|3087700_3088003_+|PTS-sugar-transporter-subunit-IIB
MNILLCCSAGMSTSLLVTKMEAAAKARGLEGKIWAVSGDAVKTNIDQADVLLLGPQVRYMLSSMKTLADEKNVGIDVINPMHYGMMNGEAVLDHALTLKK
>NZ_CP011349.1|WP_000379645.1|3087036_3087354_+|PTS-lactose/cellobiose-transporter-subunit-IIA
MDTIETKAFHLILHGGNARSCSMEAIDCAKRGEFTEAEAKLQEALEELKEAHRVQTELIQKEAGGEKTEVTLLMVHAQDHLMNAITVKELASEFVELYRKMSVDE
>NZ_CP011349.1|WP_000617782.1|3085725_3087027_+|PTS-cellobiose-transporter-subunit-IIC
MIRFLEKYVMPVAGKVAEQRHLQAIRDGIILTMPFLIIGSFFLIISALPIPGYNDFMAGLFGENWQRALGYPVSATFNIMALIAVFGIAYRLGEYYKVDALASGALSLVTFLLATPFQVAYIIPSTKESVLVEGAIPAALMGSQGLFVAMIIALISTELYRFIVQKKIIIKMPETVPPAVTRSFAALVPGFIVVTVIWILRLIIENTSFGSIHNIVGQILQEPLSVLGASLWGAIIAVILVHVLWSCGIHGATIVGGVMSPVWLSLMDQNRVAFQAGQDVPNTITAQFFDLWIYMGGSGATLALVVGMLLFARSQQLKSLGRLSIAPGIFNINEMVTFGMPIVMNPLLLIPFILVPVVLTIVSYFAMEWGWVARPSGAAVPWTTPILFSGYLGSGGKISGVILQLVNFALAFFIYLPFLKIWDKQKLAEEKGE
>NZ_CP011349.1|WP_001023554.1|3085408_3085711_+|PTS-sugar-transporter-subunit-IIB
MNILLCCAAGMSSSLIVTKMEKAAEARGIEVTIWAVSGSEVNSHIDKADVLLLGPQVRYLLPKMKELCKDKGIPVDVIQSVHYGLCNGEAILQAALLMKP
>NZ_CP011349.1|WP_000820970.1|3094040_3096716_-|sigma-54-dependent-transcriptional-regulator
MKRIDLIFNAIQKGNYTEGVTASELATFLQLDRANVSSDLNKLVKDKRLLKTNTRPVRFYIETNTSLETHSKDITSLDTFAIENTSLKIAIEKAKASILYPPNGMHTLLLGETGVGKSMFASLMHEYAIEVEQLPKDAPFIVFNCADYANNPQLLLGQLFGIKKGAYTGASDQKGLIEKAHEGILFLDEVHRLPPEGQEMLFTFIDRGVYRRLGETENERKAQVLIITATTEEPNSFLLKTFTRRIPMTVTLPPLRERTHKERFALLQRFFTNEAIRLRKDIHVSPNAMRAFVFYNCPNNIGQLKTDVQIACAKAYSDLVTKKRDSVYVSSSDLPWYMKEGLFIERKSRHLYQIPNETFVFTGEEGWSNHKTEDEKRSSIYDYIDYKYEELQARGIEEEELELLIENDVQSFFVQYFNQISKKTSHENVFKIVDRNIVSVCEKIAELAEKHLSKTFDEKVFLALSLHVQTTLQRLQSGKQIHHPQLNQIRTKYKEAFSVAMQCIQLLEEELQITMPIDEAGFLTMFFVVDPIPASQTEVKVLILAHGNGIATEMANVANELLGIEEVTGIDMPLHESPKDFLERVKVYMKTLQNVNGLLLLVDMGSLAYIGDILETEFKIPVRVLSMTSTPHALEAARKAQLGYSLDALYETVKNLTPFYLNVQEEKKKPLSPMKSVILTACLTGEGSALAIQKMLENYLRFDKDLIEIIPISIVHEKDLTKMIENIKKERNIICIVTNFDVQVPCLTYHFQDIVNYTAIQPIQELITYEETYAKMADILEQQMQRNDGALLIKTIRYALNTIQELISLQLTPDSLMGVILHMSCMVDRLQKGESLLPHPDKEKRRQDEYWMYMKVKKALQPIENTFEIQIPDDEVFYVMDFFIKNQPVKN
>NZ_CP011349.1|WP_000597152.1|3096820_3097558_-|polysaccharide-deacetylase
MIKRVFQCIILFLTITMYVSSNTEATTVIPAEYHPNTETTSPTQKIAYLTFDDGPNKYTTQILNILKEKNGKATFFVIGGKVPHYTKTMQRLIKEGHYIGLHSMSHDVKRLYTGDPSTLIAEMEQTQSIVQQVTKLNTHLVRVPYGSMPYLKKNYRDALVSAQYKMWDWTIDTYDWKSYDNPSAILERVRNQSDEQVEVILMHDSSVTVQILPKVIDYLQSQGYKLLPYNPSSHLKVNFWKDTRL
>NZ_CP011349.1|WP_000378321.1|3097757_3098831_-|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase
MDSQVIYAILASFITVLVVTPLVIKLAFKIGATDKPNARKVHQKIMPRLGGLAIFIGVAVGFVVGGLYEQRMLSITLGAIIIVIIGILDDMYELSARVKFGGQLLVAMMIVKSGLLVQVLYIPFLGDTELGWLAYPITVFWLVGITNAINLIDGLDGLSAGISSIVLATLAYMAFTSPWGTGTAIILPLALIILASTIGFLFYNFHPAKIFMGDTGALFLGYCISVISLLGLYKSVTLFSFIVPIIILGVPIFDTIFAIIRRIVNKKPISAPDKSHLHHRLLAMGFSHRKTVLIIYAFGIFFSVNAIIFTSATLWLSIILLFALIFFTEIIAEIIGLVHERYKPIISFYKKVKKRED
>NZ_CP011349.1|WP_000704918.1|3099362_3100688_+|UDP-glucose/GDP-mannose-dehydrogenase-family-protein
MKITIVGTGYVGLITGVGLAKLGHSVTCFDIDDEKIERIKQGDLPIYEARLHELINYAYENNALTFTSNKEEAFDDVEFIFIAVGTPPLLDGTADLTYIQSACNDIGLYATNDIIVVTKSTVPVGTNDVMKGWIEEKLKGRHTVHIVSNPEFLREGSGIYDFFHGDRIVIGADSEEVARRVESLYSELCLETYVTDIKSAEMIKYASNAFLATKISFINEISNICEKVGANVLDVAKGMGMDKRIGASFLNAGIGYGGSCFPKDTKALVQIAGNVAHDFRLLKAVIEVNNKQQLLLIEKAKKVMNMNKKRIAVLGASFKPNTDDIREASSLIIIEALINIGADIVLYDPKAIQYVKNIFGDAIQYSRCIDESIRDASAVFIVTEWGDIQTYPLEKYVQLMREPILFDGRNCYTDEDVKKQKIDYYSVGRKSICNRKVSVMR
>NZ_CP011349.1|WP_000140145.1|3100762_3101878_+|UDP-N-acetylglucosamine-2-epimerase-(non-hydrolyzing)
MTERLKVMTIFGTRPEAIKMAPLVLELQKHPEKIESIVTVTAQHRQMLDQVLSIFGITPDFDLNIMKDRQTLIDVTTRGLEGLDKVMKEAKPDIVLVHGDTTTTFIASLAAFYNQIPVGHVEAGLRTWDKYSPYPEEMNRQLTGVMADLHFSPTAKSATNLQKENKDESRIFITGNTAIDALQTTVKETYSHPVLEKLGNDRLVLMTAHRRENLGEPMRNMFRAIKRLVDKHEDVQVVYPVHMNPVVREIANEILGEHNRIHLIEPLDVIDFHNVAARSYLMLTDSGGVQEEAPSLGVPVLVLRDTTERPEGIEAGTLKLAGTDEETIFGLADELLSDKEAHDKMAKASNPYGDGRASERIVEAILQHFNK
>NZ_CP011349.1|WP_000392787.1|3101915_3103040_-|LCP-family-protein
MEERYYHLQNSRIKKKRRRKLFFFLIFAFLFGSIGVYVLNSYSSLMGMYSGFTREKSDLRNEDVEITKEPFTILIMGIEDYATDGQNGRTDSLMFATVNPKTKKVSLMSIPRDSRVPIVGKGKEDKINAAHAYGGEEMAIKTVEGFLKVPVDHYIKIDFQGFKGIVDAVGGVTVDVPFDFWERSDVDYYKKIQFKQGQQNLNGEEALAYVRMRKQDPNGDYGRAARQRQLLAAVAQKLNSTSTVFKIKDLTTVVGKYIKTDIPISDGLALYNKLSGFDPSTIQTLKLEGEDKKIGGIYYFLPDPISVETVRNEIEKELGEKAKNPTTKNNSNPDSNSSSNSNEQTKKATNQNKTPTDPPPSTNAHAEWIMRNQP
>NZ_CP011349.1|WP_000926665.1|3103122_3103758_-|YigZ-family-protein
MLLQYFTIKDYGEHEIVIQKSRFICYISRATTEEEAQEFIQKIKKQHWNATHNCSAYLIGEQDHIQKANDDGEPSGTAGVPMLEVLKKRGLKDTVVVVTRYFGGIKLGAGGLIRAYGKCTSEGINHVGVVQRKLMRVMQTEIDYTLLGKVENELRNSKYAIKDIHYLENVTFDTYVEEDGKQAFTDWMIELTNGKCTITEGDMLYLEQDVI
>NZ_CP011349.1|WP_002101558.1|3103994_3104837_+|DegV-family-protein
MKIAIVTDSTAYIPKQIRDELNIYMIPLNVVFGTESYQEEAEISADDFYVKVREQEELPKTSQPAIGKFVELYEELAKDYDAVISIHLSSGISGTYQTSTTAGQMVEGIDVYTYDSEISCEVQGFYVREGAKLASEGKNPKEIIARFDEMKKTMDAYFVVDDLHHLQRGGRLNSAQAFIGSLLQVKPVLYFRDKIIIAFEKIRTRKKALKRIIEIFDEQASKGVPMEAVIIHAQREEEANEWKKELEAKYPHVTIRTGYFGAVIGTHLGEGALGLGWYTK
>NZ_CP011349.1|WP_000400857.1|3105009_3105324_+|helix-turn-helix-transcriptional-regulator
MEHNSCLCPKFESAFTLLSKKWTGLIIKSLLEESKRFREIADIIPNMSDRMLSERLKELESEGIVVRNVYPEVPVRIEYGLTDKGKALESVMDEVQNWAEKWMK
>NZ_CP011349.1|WP_000499473.1|3105472_3106885_+|C40-family-peptidase
MFYKNVTLAKKIPNYGINFIGYIRKKKKESGVKNKMKKLKMASCALVAGLMFSGLTPNVFAEDKISDVKSQINTQNDTLHKQQQERDELQKQMNDLNKTIQGLDKSVQENAAKLDETMKKVSDTEQLIEKKNKDIAELQTKIAKREELLRKRLVALQEQPNTNVVTEVLVNSKNVADLVDRLTSVSKILESDEDIMKTQQEDQASVKKDVATVKEKQKELKEAQAQIETAKKELDAEKEKKATAVNDLSGKMDTVVTSMTSTEGQLKELEKQALQLQRIAEEEAQAKAAQEAAAQKQAEQAAKAAQAQPAQAPAEQAAPANNGGQAQKEEPKKEEPKKEEPKKEAPKQEEKKPAPNVGGVIGKAQSYLGLPYVWGSASPSNGGFDCSGFISYIFGVGRQDVRGYWNSVSKVDSPQPGDLVFFQGTYKAGPSHIGIYVGNGQMIHASDKGIAYGDINSSYNQKHFLGYGRF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP011349_1	1.1\|3093844\|29\|NZ_CP011349\|CRISPRCasFinder	3093844-3093872	29	NZ_CP011349.1	3093964-3093992	2	0.931
NZ_CP011349_1	1.1\|3093844\|29\|NZ_CP011349\|CRISPRCasFinder	3093844-3093872	29	NZ_CP011349.1	3671389-3671417	2	0.931

1. spacer 1.1|3093844|29|NZ_CP011349|CRISPRCasFinder matches to position: 3093964-3093992, mismatch: 2, identity: 0.931

tctgagttacgccgatatattttgaaaat	CRISPR spacer
tctgggttgcgccgatatattttgaaaat	Protospacer
****.***.********************

2. spacer 1.1|3093844|29|NZ_CP011349|CRISPRCasFinder matches to position: 3671389-3671417, mismatch: 2, identity: 0.931

tctgagttacgccgatatattttgaaaat	CRISPR spacer
tccgagttacgccgatatattttgataat	Protospacer
**.********************** ***

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

426873 : 489225

Orpheovirus(18.18%)

integrase,tRNA,transposase

attL 470705:470720|attR 494972:494987

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000377332.1\|426873_428172_-\|tRNA	aspartate--tRNA(Asn) ligase	A0A2I2L4Y8	Orpheovirus	1.8e-76	38.5
WP_001167912.1\|428713_429193_+	hypothetical protein	NA	NA	NA	NA
WP_087942842.1\|429335_430680_+\|transposase	IS3-like element ISBth10 family transposase	A0A1B1P773	Bacillus_phage	3.6e-112	74.4
WP_000482274.1\|430737_432249_-	peptidase M36	NA	NA	NA	NA
WP_000045222.1\|432579_433164_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_001093123.1\|433165_434251_+	DUF1624 domain-containing protein	NA	NA	NA	NA
WP_000754899.1\|434301_437403_-\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	5.7e-153	31.9
WP_000275558.1\|442329_442821_-	hypothetical protein	NA	NA	NA	NA
WP_000498601.1\|442932_443151_-	hypothetical protein	NA	NA	NA	NA
WP_000621475.1\|443180_443510_-	DUF2085 domain-containing protein	NA	NA	NA	NA
WP_000384921.1\|443622_445311_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	8.1e-77	32.9
WP_000637451.1\|445611_446388_-	hypothetical protein	NA	NA	NA	NA
WP_000063706.1\|446437_446872_-	BrxA/BrxB family bacilliredoxin	NA	NA	NA	NA
WP_000634884.1\|446955_447339_-	DUF393 domain-containing protein	NA	NA	NA	NA
WP_000692580.1\|447342_448470_-	PBS lyase	NA	NA	NA	NA
WP_000714949.1\|448887_449448_+	AAA family ATPase	NA	NA	NA	NA
WP_001082769.1\|449784_450117_-	single-stranded DNA-binding protein	A0A059T5E0	Listeria_phage	1.1e-33	61.1
WP_001259000.1\|450457_451549_-	hypothetical protein	NA	NA	NA	NA
WP_001089284.1\|452824_453334_-	hypothetical protein	NA	NA	NA	NA
WP_000021280.1\|453647_453884_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000734833.1\|454042_458104_-	ATP-binding protein	A0A2H4PQT3	Staphylococcus_phage	2.9e-96	34.7
WP_000239530.1\|458326_459280_-	DUF4238 domain-containing protein	NA	NA	NA	NA
WP_000829601.1\|459571_460669_-	hypothetical protein	NA	NA	NA	NA
WP_000451337.1\|461492_462230_-	hypothetical protein	NA	NA	NA	NA
WP_000520934.1\|466609_467338_-	hypothetical protein	NA	NA	NA	NA
WP_001289510.1\|467339_469049_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_000249670.1\|469041_471786_-	hypothetical protein	NA	NA	NA	NA
470705:470720	attL	NA	NA	NA	NA
WP_000266759.1\|471766_472390_-	hypothetical protein	NA	NA	NA	NA
WP_000275580.1\|472531_473827_+\|transposase	IS21-like element IS232 family transposase	A0A2L1IVA1	Escherichia_phage	5.3e-12	28.8
WP_000798699.1\|473816_474569_+	AAA family ATPase	A0A059NT77	Lactococcus_phage	7.0e-57	47.3
WP_001053969.1\|475567_477004_+\|transposase	IS4-like element IS231C family transposase	NA	NA	NA	NA
WP_000364215.1\|477323_477734_+	DUF1878 family protein	NA	NA	NA	NA
WP_000116992.1\|477882_479313_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_000975140.1\|479669_479924_-	DUF4318 domain-containing protein	NA	NA	NA	NA
WP_001260655.1\|480029_480761_-	Bax inhibitor-1/YccA family protein	NA	NA	NA	NA
WP_000783186.1\|480836_482732_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2H4UUX5	Bodo_saltans_virus	2.2e-46	25.5
WP_000165969.1\|482728_483376_-	HD domain-containing protein	S4W232	Pandoravirus	9.5e-10	28.3
WP_000499723.1\|483485_484250_+	hypothetical protein	NA	NA	NA	NA
WP_000709202.1\|484546_484672_-	hypothetical protein	NA	NA	NA	NA
WP_000109863.1\|484668_485742_-	tetratricopeptide repeat protein	A0A2H4J8G3	uncultured_Caudovirales_phage	1.8e-74	43.7
WP_001028065.1\|487215_489225_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
494972:494987	attR	NA	NA	NA	NA

DBSCAN-SWA_2

583963 : 645233

Bacillus_phage(90.91%)

portal,bacteriocin,integrase,protease,terminase,capsid,head,transposase,tail

attL 583602:583620|attR 630512:630530

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
583602:583620	attL	NA	NA	NA	NA
WP_000730123.1\|583963_584788_+	helix-turn-helix domain-containing protein	A0A2H4J969	uncultured_Caudovirales_phage	2.1e-99	66.9
WP_000551102.1\|584797_585418_-	hypothetical protein	H0USY2	Bacillus_phage	8.3e-112	96.1
WP_000891545.1\|585359_586541_-	cell division protein FtsK	H0USY1	Bacillus_phage	1.9e-213	93.4
WP_000170790.1\|586656_586839_-	hypothetical protein	A0A288WGN6	Bacillus_phage	1.1e-21	90.0
WP_001257568.1\|586835_587150_-	hypothetical protein	H0USY0	Bacillus_phage	7.7e-50	96.2
WP_000941958.1\|587338_587545_+	helix-turn-helix transcriptional regulator	A0A288WG80	Bacillus_phage	4.1e-07	41.5
WP_000669561.1\|587544_588348_+	hypothetical protein	A6M971	Geobacillus_virus	5.4e-23	41.3
WP_000751888.1\|588416_589481_-	N-acetylmuramoyl-L-alanine amidase	A0A2H4JAS1	uncultured_Caudovirales_phage	5.4e-196	93.8
WP_000389067.1\|589477_589708_-\|bacteriocin	bacteriocin biosynthesis protein	A0A1B1P7Q9	Bacillus_phage	5.3e-32	93.4
WP_000499524.1\|590003_591197_+\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	1.2e-23	25.1
WP_000822831.1\|591331_592291_-\|integrase	site-specific integrase	A0A0U3B271	Bacillus_phage	1.2e-173	94.4
WP_038413468.1\|592392_596418_-	phage minor structural protein	A0A0S2GLH1	Bacillus_phage	0.0e+00	89.9
WP_038413466.1\|596414_597899_-\|tail	phage tail protein	A0A0S2GLF9	Bacillus_phage	1.9e-295	99.4
WP_038415467.1\|597910_601759_-\|tail	phage tail tape measure protein	A0A288WG88	Bacillus_phage	0.0e+00	88.8
WP_078405533.1\|601773_602037_-	hypothetical protein	I3WTY5	Bacillus_phage	5.3e-20	88.7
WP_000169371.1\|602580_603888_-	group II intron reverse transcriptase/maturase	H7BV92	unidentified_phage	1.7e-10	24.2
WP_001100112.1\|604061_604241_-	hypothetical protein	NA	NA	NA	NA
WP_015382186.1\|605615_605933_-	hypothetical protein	W8CYN3	Bacillus_phage	1.3e-52	98.1
WP_000896775.1\|605980_606586_-\|tail	tail protein	A0A288WG55	Bacillus_phage	1.1e-95	88.6
WP_015382185.1\|606586_606946_-	DUF3168 domain-containing protein	A0A2H4JAR3	uncultured_Caudovirales_phage	2.7e-59	95.8
WP_015382184.1\|606942_607377_-	HK97 gp10 family phage protein	H0USW9	Bacillus_phage	2.3e-76	99.3
WP_015382183.1\|607369_607693_-\|head	phage head closure protein	H0USW8	Bacillus_phage	7.4e-56	98.1
WP_000244586.1\|607679_607967_-\|head,tail	phage gp6-like head-tail connector protein	A0A0S2GLH6	Bacillus_phage	1.8e-45	100.0
WP_000361137.1\|607987_609154_-\|capsid	phage major capsid protein	W8CYN2	Bacillus_phage	4.0e-208	96.6
WP_001259159.1\|609191_609902_-\|protease	Clp protease ClpP	W8CYT5	Bacillus_phage	2.4e-123	95.8
WP_000577489.1\|609888_611142_-\|portal	phage portal protein	A0A0S2GLJ4	Bacillus_phage	1.7e-241	99.3
WP_000621131.1\|611330_613025_-\|terminase	terminase large subunit	A0A0S2GLF0	Bacillus_phage	0.0e+00	99.6
WP_000233390.1\|613026_613530_-\|terminase	phage terminase small subunit P27 family	A0A0S2GLF2	Bacillus_phage	1.0e-88	99.4
WP_001139454.1\|613659_614037_-	HNH endonuclease	A0A0S2GLI5	Bacillus_phage	2.1e-65	94.4
WP_000870105.1\|614026_614281_-	hypothetical protein	W8CYT4	Bacillus_phage	1.3e-42	97.6
WP_000773601.1\|614415_614628_-	hypothetical protein	H0USV9	Bacillus_phage	1.0e-29	97.1
WP_000002725.1\|614644_614884_-	hypothetical protein	W8CZ42	Bacillus_phage	1.1e-16	93.7
WP_000443965.1\|614918_615098_-	hypothetical protein	W8CYF7	Bacillus_phage	6.0e-23	98.3
WP_000464752.1\|615143_615371_-	hypothetical protein	NA	NA	NA	NA
WP_000017440.1\|615407_615695_-	hypothetical protein	H0USV6	Bacillus_phage	1.7e-43	91.6
WP_015382276.1\|616097_616343_-	hypothetical protein	W8CYG8	Bacillus_phage	6.5e-36	97.5
WP_001012176.1\|616549_617092_-\|integrase	site-specific integrase	A0A0S2GLG4	Bacillus_phage	3.3e-96	100.0
WP_000166155.1\|617088_617574_-	ArpU family transcriptional regulator	A0A0S2GLJ9	Bacillus_phage	1.8e-85	99.4
WP_000965619.1\|617931_618213_-	hypothetical protein	A0A0S2GLD3	Bacillus_phage	8.7e-45	100.0
WP_000404184.1\|619621_620029_-	hypothetical protein	A0A0S2GLF8	Bacillus_phage	4.9e-73	100.0
WP_155403433.1\|620052_620226_-	hypothetical protein	W8CYZ6	Bacillus_phage	2.0e-28	100.0
WP_001098845.1\|620382_620682_-	hypothetical protein	A0A0S2GLL5	Bacillus_phage	2.7e-52	100.0
WP_000705118.1\|620832_621132_+	hypothetical protein	A0A0S2GLD6	Bacillus_phage	1.9e-50	100.0
WP_001025406.1\|621128_621344_-	hypothetical protein	A0A0S2GLC6	Bacillus_phage	8.7e-37	100.0
WP_000817807.1\|621361_621526_-	DUF3954 domain-containing protein	A0A0S2GLF5	Bacillus_phage	1.0e-24	100.0
WP_000436951.1\|621597_621864_-	hypothetical protein	A0A0S2GLK4	Bacillus_phage	7.7e-43	100.0
WP_002133989.1\|621905_622718_-	hypothetical protein	A0A0S2GLK2	Bacillus_phage	1.2e-155	100.0
WP_015382274.1\|622680_623697_-	hypothetical protein	A0A0S2GLI6	Bacillus_phage	2.0e-187	97.6
WP_038415676.1\|623940_624588_-	sigma-70 family RNA polymerase sigma factor	A0A0S2GLJ1	Bacillus_phage	3.9e-112	96.3
WP_000176230.1\|624611_624920_-	hypothetical protein	W8CYU1	Bacillus_phage	2.2e-41	92.6
WP_015382272.1\|625081_625825_-	phage regulatory protein	A0A0S2GLP8	Bacillus_phage	2.9e-103	76.4
WP_003284082.1\|625870_626041_-	hypothetical protein	I7J4K2	Bacillus_phage	2.8e-22	94.1
WP_000549467.1\|626050_626239_-	helix-turn-helix transcriptional regulator	W8CYN7	Bacillus_phage	1.4e-25	95.2
WP_000714354.1\|626314_626521_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000258007.1\|626696_627041_+	helix-turn-helix domain-containing protein	H0UST7	Bacillus_phage	1.2e-14	40.6
WP_000936291.1\|627439_628660_-	hypothetical protein	A0A0U3TNF6	Bacillus_phage	2.2e-108	49.5
WP_000237493.1\|629399_630491_+\|integrase	site-specific integrase	A0A0S2GLI2	Bacillus_phage	8.1e-163	79.8
WP_001166434.1\|630822_631413_-	histidine phosphatase family protein	NA	NA	NA	NA
630512:630530	attR	NA	NA	NA	NA
WP_002004921.1\|631502_632657_-	stage II sporulation protein P	NA	NA	NA	NA
WP_000226253.1\|632727_633696_-	SPFH/Band 7/PHB domain protein	NA	NA	NA	NA
WP_000741975.1\|633698_634127_-	NfeD family protein	NA	NA	NA	NA
WP_001245226.1\|634401_635619_+	MFS transporter	NA	NA	NA	NA
WP_000405394.1\|635668_637144_-	amidase	NA	NA	NA	NA
WP_000178288.1\|637326_637773_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_000747647.1\|637796_638537_-	M15 family metallopeptidase	NA	NA	NA	NA
WP_000617573.1\|638548_639046_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_001079274.1\|639301_640456_-	stage II sporulation protein P	NA	NA	NA	NA
WP_000770738.1\|640544_640841_+	hypothetical protein	NA	NA	NA	NA
WP_016109792.1\|640845_641151_+	hypothetical protein	NA	NA	NA	NA
WP_000435828.1\|641123_641690_-	DUF1572 domain-containing protein	NA	NA	NA	NA
WP_001263016.1\|641670_642000_-	chaperone CsaA	NA	NA	NA	NA
WP_000839661.1\|642065_643412_-	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_087942842.1\|643888_645233_+\|transposase	IS3-like element ISBth10 family transposase	A0A1B1P773	Bacillus_phage	3.6e-112	74.4

DBSCAN-SWA_3

659043 : 719156

Bacillus_phage(23.53%)

coat,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000937997.1\|659043_660120_-\|coat	spore coat protein CotH	NA	NA	NA	NA
WP_000817485.1\|660301_660844_+	hypothetical protein	NA	NA	NA	NA
WP_000858822.1\|660890_661502_-	phosphoserine phosphatase 1	NA	NA	NA	NA
WP_000943769.1\|662074_662491_-	FosB/FosD family fosfomycin resistance bacillithiol transferase	Q2LI91	Bacillus_phage	1.3e-39	64.8
WP_000824280.1\|662550_664212_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002098546.1\|664296_665283_-	DUF2628 domain-containing protein	NA	NA	NA	NA
WP_000283913.1\|665308_665761_-	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	1.1e-25	41.0
WP_001083648.1\|665894_666932_+	NADPH dehydrogenase NamA	NA	NA	NA	NA
WP_001042736.1\|666961_667621_-	oxidoreductase	NA	NA	NA	NA
WP_000169371.1\|668452_669760_-	group II intron reverse transcriptase/maturase	H7BV92	unidentified_phage	1.7e-10	24.2
WP_001100112.1\|669933_670113_-	hypothetical protein	NA	NA	NA	NA
WP_002132987.1\|671300_671522_-	hypothetical protein	NA	NA	NA	NA
WP_001126151.1\|671786_672737_+	zinc ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_001048676.1\|672875_673346_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000613420.1\|673458_674409_-	GTP-binding protein	NA	NA	NA	NA
WP_001040871.1\|674506_675976_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	G3MB42	Bacillus_virus	2.7e-68	41.7
WP_000376357.1\|676237_677140_+	aldo/keto reductase family oxidoreductase	NA	NA	NA	NA
WP_001068749.1\|677164_677749_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_001168116.1\|677833_679297_-	flavin monoamine oxidase family protein	A0A2K9L022	Tupanvirus	1.2e-15	22.3
WP_000683357.1\|679474_679666_+	DUF3896 domain-containing protein	NA	NA	NA	NA
WP_000594031.1\|679770_680772_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_087942833.1\|680884_682226_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	6.3e-32	37.3
WP_000798320.1\|682287_683232_-	hypothetical protein	NA	NA	NA	NA
WP_000488206.1\|683447_683903_-	DUF3939 domain-containing protein	NA	NA	NA	NA
WP_000105199.1\|684005_684449_-	DNA starvation/stationary phase protection protein	A0A0A7RTZ1	Clostridium_phage	6.2e-45	62.1
WP_000370203.1\|684689_685730_+	membrane protein	NA	NA	NA	NA
WP_000965059.1\|685764_686130_-	DUF3979 domain-containing protein	NA	NA	NA	NA
WP_000539571.1\|686452_686758_-	hypothetical protein	NA	NA	NA	NA
WP_000517294.1\|686954_688937_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.5e-23	31.0
WP_001073075.1\|689137_690190_-	ribosome small subunit-dependent GTPase A	NA	NA	NA	NA
WP_000426317.1\|691095_691443_+	DUF4257 domain-containing protein	NA	NA	NA	NA
WP_000162602.1\|691527_691752_+	hypothetical protein	NA	NA	NA	NA
WP_001198794.1\|691951_692314_-	DUF805 domain-containing protein	NA	NA	NA	NA
WP_001101741.1\|692457_692664_-	hypothetical protein	NA	NA	NA	NA
WP_001082497.1\|692712_693888_-	MFS transporter	NA	NA	NA	NA
WP_000874082.1\|693935_694871_-	aldo/keto reductase	NA	NA	NA	NA
WP_001259906.1\|694977_695286_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000099756.1\|695327_696275_-\|protease	serine protease	A0A127AWU5	Bacillus_phage	1.4e-94	57.4
WP_000648325.1\|696549_696837_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	1.2e-12	56.5
WP_001026002.1\|696952_698833_-	ABC transporter permease	NA	NA	NA	NA
WP_000174901.1\|699108_699927_+	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	1.7e-93	63.3
WP_000024999.1\|699976_700438_-	NUDIX hydrolase	A0A2I6PFL2	Proteus_phage	8.5e-05	35.1
WP_001048102.1\|700469_700667_-	DUF4083 domain-containing protein	NA	NA	NA	NA
WP_000520856.1\|700772_701933_-	peptidase	NA	NA	NA	NA
WP_001034835.1\|702083_702836_-	DUF1963 domain-containing protein	NA	NA	NA	NA
WP_000540423.1\|703059_703200_+	YjcZ family sporulation protein	NA	NA	NA	NA
WP_000686789.1\|703287_704253_+	patatin-like phospholipase family protein	A0A1V0SKV5	Klosneuvirus	1.1e-25	31.2
WP_000816391.1\|704366_704534_-	DUF3933 domain-containing protein	NA	NA	NA	NA
WP_000439399.1\|704546_705989_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_001287305.1\|706107_706722_+	amino acid transporter	NA	NA	NA	NA
WP_033667350.1\|706775_708005_-	MFS transporter	NA	NA	NA	NA
WP_000113545.1\|708240_708447_-	alpha/beta-type small acid-soluble spore protein	Q77YX0	Bacillus_phage	3.4e-14	63.1
WP_000877670.1\|708571_709414_-	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
WP_000200704.1\|709451_710435_-	hypothetical protein	NA	NA	NA	NA
WP_001250558.1\|710458_710725_-	petrobactin biosynthesis protein AsbD	NA	NA	NA	NA
WP_000909581.1\|710721_711960_-	AMP-binding protein	NA	NA	NA	NA
WP_000275580.1\|713270_714566_+\|transposase	IS21-like element IS232 family transposase	A0A2L1IVA1	Escherichia_phage	5.3e-12	28.8
WP_000798699.1\|714555_715308_+	AAA family ATPase	A0A059NT77	Lactococcus_phage	7.0e-57	47.3
WP_001163356.1\|716033_717842_-	Petrobactin biosynthesis protein AsbA	NA	NA	NA	NA
WP_000710470.1\|717998_719156_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q331V1	Clostridium_botulinum_C_phage	1.8e-123	59.0

DBSCAN-SWA_4

739115 : 747266

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001258538.1\|739115_739988_-	aminoglycoside 6-adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	2.1e-65	44.7
WP_000818979.1\|740278_740998_-	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
WP_001231621.1\|741287_742361_-	HAMP domain-containing sensor histidine kinase	W8CYF6	Bacillus_phage	6.1e-187	98.0
WP_000612414.1\|742357_743035_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.1e-122	99.1
WP_000453861.1\|743120_744881_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.4e-273	98.0
WP_001194306.1\|745121_745886_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_000755525.1\|745985_747266_-	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	3.4e-11	31.5

DBSCAN-SWA_5

1410172 : 1485239

Bacillus_phage(46.15%)

portal,holin,protease,tRNA,terminase,capsid,head,transposase,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000110985.1\|1410172_1411162_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_000966128.1\|1411442_1412189_-	DUF3603 family protein	A0A0A0RP53	Bacillus_phage	8.0e-45	40.5
WP_000513275.1\|1412332_1413121_-	hypothetical protein	NA	NA	NA	NA
WP_000412656.1\|1413227_1414466_-	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_001100533.1\|1414497_1415430_-	beta-ketoacyl-ACP synthase III	NA	NA	NA	NA
WP_001986215.1\|1415967_1416144_-	competence protein ComG	NA	NA	NA	NA
WP_000487722.1\|1416198_1417071_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_001211116.1\|1417990_1418173_+	YjzD family protein	NA	NA	NA	NA
WP_000365401.1\|1418211_1420812_-	ATP-dependent chaperone ClpB	K4FB40	Cronobacter_phage	2.4e-120	33.1
WP_000531421.1\|1421021_1421201_-	YjzC family protein	NA	NA	NA	NA
WP_001041232.1\|1421692_1422502_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_000516816.1\|1422607_1422748_+	hypothetical protein	NA	NA	NA	NA
WP_000527407.1\|1422748_1422946_+	DUF3813 domain-containing protein	NA	NA	NA	NA
WP_000364432.1\|1422971_1423829_-	YitT family protein	NA	NA	NA	NA
WP_001120849.1\|1423929_1424079_+	DUF3941 domain-containing protein	NA	NA	NA	NA
WP_001214215.1\|1424208_1425066_+	peptidylprolyl isomerase PrsA	NA	NA	NA	NA
WP_001153798.1\|1425105_1425369_-	hypothetical protein	NA	NA	NA	NA
WP_000548429.1\|1425588_1426074_-	hypothetical protein	NA	NA	NA	NA
WP_000281260.1\|1426492_1427347_-	hypothetical protein	NA	NA	NA	NA
WP_001040149.1\|1427577_1428069_+	YajQ family cyclic di-GMP-binding protein	NA	NA	NA	NA
WP_000397871.1\|1428930_1429242_-	hypothetical protein	NA	NA	NA	NA
WP_103580702.1\|1429542_1430784_-	alpha-amylase	NA	NA	NA	NA
WP_000367127.1\|1431057_1432293_+	ammonium transporter	NA	NA	NA	NA
WP_000076219.1\|1432413_1433055_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_001238640.1\|1433231_1433468_-	hypothetical protein	NA	NA	NA	NA
WP_003283577.1\|1433488_1434115_-	sporulation membrane protein YtaF	NA	NA	NA	NA
WP_000148974.1\|1434222_1434456_-	hypothetical protein	NA	NA	NA	NA
WP_000619724.1\|1434445_1434742_-	hypothetical protein	NA	NA	NA	NA
WP_001190887.1\|1434755_1439294_-	HAD-IC family P-type ATPase	A0A1J0FA34	Only_Syngen_Nebraska_virus	7.2e-72	28.1
WP_000486133.1\|1439339_1439690_-	YtxH domain-containing protein	NA	NA	NA	NA
WP_001069180.1\|1440501_1441968_-	catalase	A0A2K9L572	Tupanvirus	1.0e-123	47.4
WP_000163133.1\|1442027_1442987_-	ferrochelatase	NA	NA	NA	NA
WP_000730207.1\|1443465_1444299_+	hypothetical protein	A0A2H4J6G7	uncultured_Caudovirales_phage	2.6e-121	81.9
WP_000100788.1\|1444316_1444607_-	hypothetical protein	A0A1C8E992	Bacillus_phage	9.3e-42	90.7
WP_001016122.1\|1444631_1444850_-	hypothetical protein	A0A2H4JC50	uncultured_Caudovirales_phage	3.6e-30	90.3
WP_000742862.1\|1444989_1445556_+	hypothetical protein	A6XML2	Bacillus_virus	5.9e-24	45.7
WP_000405773.1\|1445721_1446654_-	N-acetylmuramoyl-L-alanine amidase	A0A0S2MVR5	Bacillus_phage	3.3e-157	84.2
WP_000373898.1\|1446653_1447079_-\|holin	phage holin family protein	A0A0S2MVC4	Bacillus_phage	2.6e-72	100.0
WP_001004976.1\|1447116_1447491_-	hypothetical protein	A0A0S2MVE0	Bacillus_phage	2.7e-65	98.4
WP_015382232.1\|1447506_1452351_-	hypothetical protein	A0A0S2MVB4	Bacillus_phage	0.0e+00	83.4
WP_000094123.1\|1452347_1453817_-\|tail	phage tail protein	A0A0S2MV63	Bacillus_phage	2.8e-235	79.6
WP_015382231.1\|1453858_1457491_-	hypothetical protein	A0A2H4JAI2	uncultured_Caudovirales_phage	2.4e-182	84.1
WP_000415929.1\|1457721_1458084_-	hypothetical protein	A0A2H4JAG8	uncultured_Caudovirales_phage	6.8e-42	70.0
WP_001004921.1\|1458090_1458684_-\|tail	phage tail protein	A0A2H4JDV4	uncultured_Caudovirales_phage	6.7e-103	93.3
WP_000172080.1\|1458684_1459014_-	hypothetical protein	A0A2H4JAG4	uncultured_Caudovirales_phage	2.9e-47	83.5
WP_001273706.1\|1459010_1459367_-	HK97 gp10 family phage protein	D2XR21	Bacillus_phage	3.0e-34	60.7
WP_000998123.1\|1459359_1459659_-\|head	phage head closure protein	NA	NA	NA	NA
WP_000600950.1\|1459655_1459928_-	DNA-packaging protein	R9TMB7	Paenibacillus_phage	3.0e-18	53.9
WP_001016250.1\|1459924_1460182_-	hypothetical protein	A6XMJ7	Bacillus_virus	1.1e-06	43.2
WP_001031425.1\|1460197_1461382_-\|capsid	phage major capsid protein	A0A2I4R671	Erysipelothrix_phage	5.1e-09	24.4
WP_000361708.1\|1461398_1461983_-\|head,protease	HK97 family phage prohead protease	A0A2I7SBY1	Paenibacillus_phage	2.7e-32	44.6
WP_000499523.1\|1462279_1463473_+\|transposase	IS110-like element ISBth13 family transposase	A0A0U3ULR1	Bacillus_phage	1.1e-24	26.1
WP_000522435.1\|1463567_1464746_-\|portal	phage portal protein	A0A0A8WJ25	Clostridium_phage	5.5e-141	61.6
WP_033676369.1\|1464759_1466448_-\|terminase	terminase large subunit	A0A290GJW3	Caldibacillus_phage	3.9e-249	72.6
WP_001282601.1\|1466456_1466819_-	hypothetical protein	A0A290GJQ7	Caldibacillus_phage	2.4e-18	43.5
WP_001149928.1\|1466911_1467307_-	hypothetical protein	NA	NA	NA	NA
WP_001051281.1\|1467309_1467612_-	HNH endonuclease	A0A1B0YEC6	Lactobacillus_phage	1.5e-18	48.5
WP_000196707.1\|1467628_1467829_-	hypothetical protein	NA	NA	NA	NA
WP_000499523.1\|1468100_1469294_-\|transposase	IS110-like element ISBth13 family transposase	A0A0U3ULR1	Bacillus_phage	1.1e-24	26.1
WP_071686481.1\|1469590_1469773_+	type II toxin-antitoxin system HicA family toxin	A0A0U4KLG1	Pseudomonas_phage	9.4e-16	67.2
WP_000711196.1\|1469824_1470244_+	HicB family protein	A0A2H4J4X8	uncultured_Caudovirales_phage	7.6e-61	79.9
WP_033676375.1\|1470626_1471028_-	hypothetical protein	A0A1C8E9D1	Bacillus_phage	1.8e-67	98.5
WP_038413362.1\|1471065_1471392_-	hypothetical protein	A0A1C8E9C1	Bacillus_phage	2.3e-57	97.2
WP_000540088.1\|1471388_1471916_-	Holliday junction resolvase RecU	A0A1C8E9C3	Bacillus_phage	5.4e-96	98.3
WP_000590880.1\|1471951_1472263_-	hypothetical protein	A0A0A7AR06	Bacillus_phage	2.9e-41	83.5
WP_000389429.1\|1472496_1472901_-	hypothetical protein	I6TG10	Staphylococcus_virus	7.7e-10	37.1
WP_000356654.1\|1473060_1473243_-	hypothetical protein	NA	NA	NA	NA
WP_001093039.1\|1473327_1474119_-	prohibitin family protein	A0A1C8E9A9	Bacillus_phage	6.8e-143	100.0
WP_001268033.1\|1474265_1474556_-	hypothetical protein	A0A1C8EA94	Bacillus_phage	8.4e-51	94.8
WP_001010921.1\|1474614_1475049_-	hypothetical protein	A0A1C8E9B0	Bacillus_phage	1.3e-76	95.1
WP_015382228.1\|1475087_1475645_-	hypothetical protein	A0A1B1P7A6	Bacillus_phage	4.0e-65	71.4
WP_000139235.1\|1475668_1475899_-	hypothetical protein	A0A1C8E9C2	Bacillus_phage	2.5e-34	100.0
WP_000933912.1\|1475891_1476371_-	hypothetical protein	A0A2H4J396	uncultured_Caudovirales_phage	1.3e-80	93.7
WP_000510888.1\|1476382_1477336_-	DnaD domain protein	A0A0S2MVA0	Bacillus_phage	6.4e-148	90.2
WP_038413358.1\|1477429_1477768_-	hypothetical protein	A0A0S2MVH7	Bacillus_phage	2.6e-51	96.4
WP_015382226.1\|1477700_1477916_-	hypothetical protein	A0A1C8E9A6	Bacillus_phage	5.5e-31	97.2
WP_000178947.1\|1477915_1478629_-	hypothetical protein	A0A0S2MV99	Bacillus_phage	1.0e-126	98.3
WP_000453494.1\|1478647_1479082_-	hypothetical protein	A0A0S2MVA8	Bacillus_phage	1.1e-73	99.3
WP_001186272.1\|1479108_1479297_-	hypothetical protein	A0A2H4J4V8	uncultured_Caudovirales_phage	6.1e-26	96.8
WP_000372563.1\|1479308_1480061_-	phage regulatory protein	A0A2H4JBC7	uncultured_Caudovirales_phage	4.8e-106	81.0
WP_000385074.1\|1480543_1480816_-	helix-turn-helix transcriptional regulator	A0A141E0W0	Streptococcus_phage	3.0e-10	50.0
WP_000130922.1\|1480965_1481649_+	LexA family transcriptional regulator	D7RWF2	Brochothrix_phage	1.3e-22	34.2
WP_000289677.1\|1481664_1481883_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000650392.1\|1482026_1483430_+	recombinase family protein	A0A2I7SDG6	Paenibacillus_phage	1.5e-113	44.8
WP_000333967.1\|1483460_1485239_-	asparagine synthase (glutamine-hydrolyzing)	A0A1V0SGM7	Hokovirus	1.6e-22	27.3

DBSCAN-SWA_6

1956946 : 2011321

Bacillus_phage(92.98%)

portal,integrase,protease,terminase,capsid,head,transposase,tail

attL 1959563:1959581|attR 2001556:2001574

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000948949.1\|1956946_1958263_-	FAD-binding protein	A0A2K9L0J9	Tupanvirus	5.3e-07	22.1
WP_000373746.1\|1958250_1959423_-	amino acid deaminase/aldolase	NA	NA	NA	NA
1959563:1959581	attL	NA	NA	NA	NA
WP_000730127.1\|1959920_1960802_+	HTH domain-containing protein	I7ILW0	Bacillus_phage	1.5e-159	100.0
WP_000842173.1\|1960806_1961415_-	hypothetical protein	A0A0S2GLL8	Bacillus_phage	3.3e-113	100.0
WP_000511371.1\|1961404_1962571_-	DNA translocase FtsK	A0A0S2GLG9	Bacillus_phage	9.4e-226	100.0
WP_000495118.1\|1962581_1962902_-	hypothetical protein	A0A0S2GLK1	Bacillus_phage	1.9e-51	100.0
WP_000467327.1\|1963364_1963586_+	helix-turn-helix transcriptional regulator	A0A0S2GLH4	Bacillus_phage	2.9e-35	100.0
WP_000423300.1\|1963654_1963984_+	hypothetical protein	A0A0S2GLG3	Bacillus_phage	2.4e-54	100.0
WP_000542506.1\|1964024_1964843_-	N-acetylmuramoyl-L-alanine amidase	A0A0S2GLD4	Bacillus_phage	3.2e-164	100.0
WP_001076454.1\|1964842_1965055_-	hypothetical protein	A0A0S2GM50	Bacillus_phage	1.4e-34	100.0
WP_000151530.1\|1965057_1965339_-	hypothetical protein	A0A0S2GM64	Bacillus_phage	9.1e-42	100.0
WP_000822820.1\|1965352_1966312_-\|integrase	site-specific integrase	A0A0S2GLC8	Bacillus_phage	3.1e-182	99.7
WP_015382189.1\|1966408_1970434_-	minor structural protein	A0A0S2GLH1	Bacillus_phage	0.0e+00	100.0
WP_000232880.1\|1970430_1971915_-\|tail	phage tail protein	A0A0S2GLF9	Bacillus_phage	9.9e-297	100.0
WP_038413316.1\|1971926_1975853_-\|tail	phage tail tape measure protein	A0A0S2GLG8	Bacillus_phage	0.0e+00	100.0
WP_000344048.1\|1975867_1976044_-	hypothetical protein	I3WTY5	Bacillus_phage	1.1e-26	100.0
WP_000779042.1\|1976073_1976391_-	hypothetical protein	A0A0S2GLH2	Bacillus_phage	8.9e-54	100.0
WP_000896661.1\|1976437_1977043_-\|tail	tail protein	A0A0S2GLI0	Bacillus_phage	9.2e-100	100.0
WP_000609197.1\|1977043_1977403_-	DUF3168 domain-containing protein	A0A0S2GLE3	Bacillus_phage	3.5e-62	100.0
WP_000763223.1\|1977399_1977837_-	HK97 gp10 family phage protein	A0A0S2GLH3	Bacillus_phage	7.9e-77	100.0
WP_001068030.1\|1977829_1978153_-\|head	phage head closure protein	H0USW8	Bacillus_phage	1.1e-56	100.0
WP_000244586.1\|1978139_1978427_-\|head,tail	phage gp6-like head-tail connector protein	A0A0S2GLH6	Bacillus_phage	1.8e-45	100.0
WP_015382182.1\|1978447_1979614_-\|capsid	phage major capsid protein	A0A0S2GLG0	Bacillus_phage	3.3e-210	100.0
WP_015382181.1\|1979651_1980362_-\|protease	Clp protease ClpP	A0A0S2GLD5	Bacillus_phage	5.5e-128	100.0
WP_015382180.1\|1980348_1981602_-\|portal	phage portal protein	A0A0S2GLJ4	Bacillus_phage	3.5e-242	99.8
WP_015382179.1\|1981790_1983485_-\|terminase	terminase large subunit	A0A0S2GLF0	Bacillus_phage	0.0e+00	100.0
WP_000233388.1\|1983486_1983990_-\|terminase	phage terminase small subunit P27 family	A0A0S2GLF2	Bacillus_phage	8.0e-89	100.0
WP_001139459.1\|1984118_1984496_-	HNH endonuclease	A0A0S2GLI5	Bacillus_phage	6.8e-69	100.0
WP_001198493.1\|1984485_1984740_-	hypothetical protein	A0A0S2GLL6	Bacillus_phage	3.9e-44	100.0
WP_000778983.1\|1984875_1985088_-	hypothetical protein	A0A0S2GM40	Bacillus_phage	2.7e-30	100.0
WP_000002720.1\|1985104_1985344_-	hypothetical protein	A0A0S2GLE8	Bacillus_phage	5.2e-22	98.7
WP_000443964.1\|1985372_1985558_-	hypothetical protein	A0A0S2GLH7	Bacillus_phage	8.6e-25	100.0
WP_001050326.1\|1985606_1986473_-	hypothetical protein	A0A0S2GLF7	Bacillus_phage	2.8e-166	100.0
WP_000792998.1\|1986554_1986737_-	hypothetical protein	A0A0S2GLH0	Bacillus_phage	3.1e-27	100.0
WP_015382178.1\|1987108_1987354_-	hypothetical protein	A0A0S2GLK0	Bacillus_phage	9.0e-38	100.0
WP_001012176.1\|1987560_1988103_-\|integrase	site-specific integrase	A0A0S2GLG4	Bacillus_phage	3.3e-96	100.0
WP_015382492.1\|1988099_1988585_-	transcription regulator	A0A0S2GLJ9	Bacillus_phage	7.9e-86	100.0
WP_000965619.1\|1988942_1989224_-	hypothetical protein	A0A0S2GLD3	Bacillus_phage	8.7e-45	100.0
WP_000404184.1\|1990631_1991039_-	hypothetical protein	A0A0S2GLF8	Bacillus_phage	4.9e-73	100.0
WP_155403433.1\|1991062_1991236_-	hypothetical protein	W8CYZ6	Bacillus_phage	2.0e-28	100.0
WP_001098845.1\|1991392_1991692_-	hypothetical protein	A0A0S2GLL5	Bacillus_phage	2.7e-52	100.0
WP_000705118.1\|1991842_1992142_+	hypothetical protein	A0A0S2GLD6	Bacillus_phage	1.9e-50	100.0
WP_001025406.1\|1992138_1992354_-	hypothetical protein	A0A0S2GLC6	Bacillus_phage	8.7e-37	100.0
WP_000817807.1\|1992371_1992536_-	DUF3954 domain-containing protein	A0A0S2GLF5	Bacillus_phage	1.0e-24	100.0
WP_000436951.1\|1992607_1992874_-	hypothetical protein	A0A0S2GLK4	Bacillus_phage	7.7e-43	100.0
WP_002133989.1\|1992915_1993728_-	hypothetical protein	A0A0S2GLK2	Bacillus_phage	1.2e-155	100.0
WP_015382176.1\|1993690_1994707_-	hypothetical protein	A0A0S2GLI6	Bacillus_phage	2.8e-189	100.0
WP_000123128.1\|1994930_1995578_-	sigma-70 family RNA polymerase sigma factor	A0A0S2GLJ1	Bacillus_phage	1.8e-117	100.0
WP_000218620.1\|1995852_1996167_-	hypothetical protein	A0A0S2GLB6	Bacillus_phage	1.1e-51	100.0
WP_015382175.1\|1996328_1997108_-	phage regulatory protein	A0A0S2GLP8	Bacillus_phage	1.6e-141	100.0
WP_000549466.1\|1997333_1997522_-	helix-turn-helix transcriptional regulator	A0A0S2GLE9	Bacillus_phage	3.2e-27	100.0
WP_000813892.1\|1997554_1997791_-	helix-turn-helix transcriptional regulator	A0A0S2GLE0	Bacillus_phage	8.7e-38	100.0
WP_000511082.1\|1997939_1998284_+	helix-turn-helix transcriptional regulator	I7J6V3	Bacillus_phage	4.2e-57	100.0
WP_000466636.1\|1998683_1999922_-	hypothetical protein	I7J4K0	Bacillus_phage	8.2e-236	100.0
WP_000262047.1\|2000439_2001540_+\|integrase	site-specific integrase	A0A0S2GLI2	Bacillus_phage	8.6e-205	100.0
WP_000676802.1\|2001478_2002525_-	sphingomyelin phosphodiesterase	A0A1P8L6H7	Staphylococcus_phage	1.1e-87	59.0
2001556:2001574	attR	NA	NA	NA	NA
WP_000730997.1\|2002601_2003453_-	phospholipase C	NA	NA	NA	NA
WP_087970930.1\|2003794_2004953_+\|transposase	IS3-like element ISBth8 family transposase	A0A0C5AEA5	Paenibacillus_phage	2.5e-37	42.0
WP_000948209.1\|2004997_2005342_-	two pore domain potassium channel family protein	NA	NA	NA	NA
WP_000645827.1\|2005461_2006514_-	(R,R)-butanediol dehydrogenase	E3SJ82	Synechococcus_phage	3.9e-21	27.6
WP_000873276.1\|2006739_2007894_+	MFS transporter	NA	NA	NA	NA
WP_000964468.1\|2007814_2008240_-	hypothetical protein	NA	NA	NA	NA
WP_000658667.1\|2008261_2008603_-	hypothetical protein	NA	NA	NA	NA
WP_001252962.1\|2008921_2011321_-\|protease	M6 family metalloprotease domain-containing protein	NA	NA	NA	NA

DBSCAN-SWA_7

2282229 : 2396835

118

Bacillus_phage(59.32%)

portal,integrase,protease,tRNA,terminase,capsid,head,transposase,tail

attL 2331213:2331241|attR 2379098:2379126

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000275580.1\|2282229_2283525_-\|transposase	IS21-like element IS232 family transposase	A0A2L1IVA1	Escherichia_phage	5.3e-12	28.8
WP_000619194.1\|2283976_2284660_-	hypothetical protein	NA	NA	NA	NA
WP_001081906.1\|2284816_2285506_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_000113948.1\|2285707_2286670_-	carbamate kinase	NA	NA	NA	NA
WP_000503399.1\|2286707_2288123_-	arginine-ornithine antiporter	NA	NA	NA	NA
WP_000930287.1\|2288222_2289221_-	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_000682331.1\|2289251_2290484_-	arginine deiminase	NA	NA	NA	NA
WP_000711827.1\|2290752_2291202_-	arginine repressor	NA	NA	NA	NA
WP_000410233.1\|2291348_2292641_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	9.1e-12	42.7
WP_000616925.1\|2292851_2293574_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-33	40.8
WP_000823769.1\|2293696_2294491_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_003283038.1\|2294534_2295290_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_000661226.1\|2295343_2296429_-	acyl-CoA desaturase	NA	NA	NA	NA
WP_001053969.1\|2297774_2299211_+\|transposase	IS4-like element IS231C family transposase	NA	NA	NA	NA
WP_001182683.1\|2300346_2301648_+	aromatic acid/H+ symport family MFS transporter	NA	NA	NA	NA
WP_000147471.1\|2302554_2303664_-	hypothetical protein	NA	NA	NA	NA
WP_000862985.1\|2304010_2304643_+	cyclase family protein	NA	NA	NA	NA
WP_000424119.1\|2304670_2305051_-	hypothetical protein	NA	NA	NA	NA
WP_001046104.1\|2305279_2306506_-	two-component sensor histidine kinase	NA	NA	NA	NA
WP_000434752.1\|2306643_2307909_-	hypothetical protein	NA	NA	NA	NA
WP_001004265.1\|2308147_2308816_-	hypothetical protein	NA	NA	NA	NA
WP_000443836.1\|2308977_2309427_-	hypothetical protein	NA	NA	NA	NA
WP_000051528.1\|2309447_2309957_-	hypothetical protein	NA	NA	NA	NA
WP_000276022.1\|2310192_2310423_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_000235475.1\|2310618_2310987_+	hypothetical protein	NA	NA	NA	NA
WP_001078266.1\|2311182_2312232_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_000732593.1\|2312565_2313483_+	iron-hydroxamate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002100683.1\|2313531_2314572_+	iron ABC transporter permease	NA	NA	NA	NA
WP_000983744.1\|2314568_2315576_+	iron ABC transporter permease	NA	NA	NA	NA
WP_000926553.1\|2315621_2316263_-	L-fuculose-phosphate aldolase	NA	NA	NA	NA
WP_033679657.1\|2316316_2317363_-	S-methyl-5-thioribose-1-phosphate isomerase	NA	NA	NA	NA
WP_000033255.1\|2317372_2318602_-	S-methyl-5-thioribose kinase	NA	NA	NA	NA
WP_000924420.1\|2319193_2319757_+	peroxiredoxin	NA	NA	NA	NA
WP_000599501.1\|2319771_2321298_+	alkyl hydroperoxide reductase subunit F	A0A1W6JNB4	Lactococcus_phage	1.2e-18	30.8
WP_001005631.1\|2321331_2321937_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_000853511.1\|2322171_2323287_-	amidohydrolase	NA	NA	NA	NA
WP_000972812.1\|2324989_2326261_-	hypothetical protein	NA	NA	NA	NA
WP_000704490.1\|2326354_2327464_+	dipeptide epimerase	Q6A202	Oenococcus_phage	5.0e-19	25.6
WP_000217543.1\|2327478_2328174_+	hypothetical protein	NA	NA	NA	NA
WP_000233735.1\|2328374_2329082_-	M48 family metallopeptidase	NA	NA	NA	NA
WP_001251702.1\|2329177_2329696_-	DUF1456 family protein	Q9EYF4	Enterobacteria_phage	4.3e-21	36.5
WP_000566707.1\|2330046_2331036_-\|tRNA	tRNA-dihydrouridine synthase	NA	NA	NA	NA
2331213:2331241	attL	NA	NA	NA	NA
WP_000477499.1\|2331695_2332793_+\|integrase	tyrosine-type recombinase/integrase	A0A0E3M2X0	Bacillus_phage	2.1e-09	23.4
WP_001028065.1\|2332789_2334799_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_000247457.1\|2334791_2335196_+	hypothetical protein	NA	NA	NA	NA
WP_000349585.1\|2335264_2336056_-	glyoxalase	A0A288WG17	Bacillus_phage	6.8e-103	68.4
WP_000027993.1\|2336096_2336870_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_000794364.1\|2336958_2337747_-	hypothetical protein	A0A288WG17	Bacillus_phage	2.8e-64	51.4
WP_002133890.1\|2338043_2338352_+	YolD-like family protein	NA	NA	NA	NA
WP_000542507.1\|2338396_2339215_-	N-acetylmuramoyl-L-alanine amidase	A0A0S2GLD4	Bacillus_phage	1.6e-158	95.6
WP_000159646.1\|2339214_2339421_-	hypothetical protein	D2XR32	Bacillus_phage	1.3e-32	97.1
WP_000215408.1\|2339423_2339705_-	hypothetical protein	A0A0S2GM64	Bacillus_phage	2.4e-34	81.7
WP_000354142.1\|2339741_2340119_-	hypothetical protein	A0A0S2MVE0	Bacillus_phage	8.4e-35	59.5
WP_015382161.1\|2340135_2344530_-	hypothetical protein	A0A0S2MVB4	Bacillus_phage	0.0e+00	63.6
WP_015382160.1\|2344526_2345996_-	hypothetical protein	A0A0S2MV63	Bacillus_phage	6.5e-232	78.3
WP_044157404.1\|2346035_2351033_-\|tail	phage tail protein	A0A2H4JI37	uncultured_Caudovirales_phage	0.0e+00	81.6
WP_015382157.1\|2351197_2351572_-	hypothetical protein	A0A2H4JBU8	uncultured_Caudovirales_phage	1.8e-53	86.8
WP_001251821.1\|2351628_2352213_-\|tail	tail protein	A0A2H4JET9	uncultured_Caudovirales_phage	2.9e-98	93.3
WP_001243517.1\|2352228_2352591_-	DUF3168 domain-containing protein	A0A2H4JBW1	uncultured_Caudovirales_phage	2.4e-55	84.2
WP_000818832.1\|2352587_2353025_-	hypothetical protein	A0A2H4JBV5	uncultured_Caudovirales_phage	4.5e-64	80.7
WP_001068032.1\|2353012_2353357_-\|head	phage head closure protein	A0A2H4JHA9	uncultured_Caudovirales_phage	7.0e-44	71.1
WP_000904085.1\|2353353_2353647_-	hypothetical protein	A0A0A7S0C9	Clostridium_phage	4.6e-12	39.6
WP_001123701.1\|2353681_2354854_-\|capsid	phage major capsid protein	A0A2H4JHG1	uncultured_Caudovirales_phage	2.4e-128	62.5
WP_002134054.1\|2354891_2355590_-\|protease	Clp protease ClpP	A0A0A7RTN2	Clostridium_phage	2.7e-71	59.0
WP_000499523.1\|2355880_2357074_+\|transposase	IS110-like element ISBth13 family transposase	A0A0U3ULR1	Bacillus_phage	1.1e-24	26.1
WP_000264107.1\|2357168_2358389_-\|portal	phage portal protein	A6M949	Geobacillus_virus	5.4e-123	53.0
WP_001082759.1\|2358402_2360118_-\|terminase	terminase large subunit	A0A0A7RVS5	Clostridium_phage	5.3e-217	63.2
WP_000113652.1\|2360127_2360649_-\|terminase	phage terminase small subunit P27 family	Q9ZXG2	Bacillus_phage	5.6e-53	63.7
WP_000924768.1\|2360747_2361161_-	HNH endonuclease	Q0SPJ9	Clostridium_phage	1.6e-23	43.0
WP_000869623.1\|2361141_2361387_-	hypothetical protein	NA	NA	NA	NA
WP_001091354.1\|2361389_2361554_-	helix-turn-helix domain-containing protein	A0A142F1N8	Bacillus_phage	2.0e-09	64.4
WP_002134055.1\|2361558_2361786_-	hypothetical protein	NA	NA	NA	NA
WP_000002735.1\|2361782_2362217_-	hypothetical protein	A0A0A7AQA1	Bacillus_phage	4.3e-14	55.0
WP_000370222.1\|2362209_2362452_-	hypothetical protein	A0A0S2MVA9	Bacillus_phage	1.1e-30	87.5
WP_016090301.1\|2363097_2363640_-\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	1.3e-89	92.2
WP_000166188.1\|2363639_2364122_-	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	1.1e-71	83.1
WP_001226456.1\|2364448_2364835_-	hypothetical protein	I7I4E2	Bacillus_phage	5.2e-72	100.0
WP_000873130.1\|2364954_2365233_-	hypothetical protein	I7J4K9	Bacillus_phage	8.1e-43	100.0
WP_000351065.1\|2365229_2365427_-	hypothetical protein	I7IDJ9	Bacillus_phage	5.6e-30	100.0
WP_002134061.1\|2365672_2366038_-	hypothetical protein	I7J6W4	Bacillus_phage	3.6e-59	100.0
WP_000350118.1\|2366278_2366707_-	hypothetical protein	NA	NA	NA	NA
WP_000670920.1\|2367048_2367258_-	hypothetical protein	A0A068EPB6	Bacillus_phage	2.4e-07	47.1
WP_001268380.1\|2367297_2367570_-	hypothetical protein	I7J4K9	Bacillus_phage	2.7e-19	58.1
WP_000455138.1\|2367613_2367997_-	hypothetical protein	Q2LI92	Bacillus_phage	1.1e-24	44.1
WP_001030635.1\|2368026_2368560_-	hypothetical protein	U5PUK4	Bacillus_phage	4.4e-53	59.4
WP_000323893.1\|2368552_2368750_-	hypothetical protein	NA	NA	NA	NA
WP_000331942.1\|2368785_2369175_-	hypothetical protein	NA	NA	NA	NA
WP_001134294.1\|2369219_2369693_-	hypothetical protein	A0A0H3UZ60	Geobacillus_virus	2.7e-30	57.5
WP_001054607.1\|2369733_2370243_-	dUTPase	A0A1L2JY27	Aeribacillus_phage	1.4e-27	44.9
WP_000109543.1\|2370262_2370514_-	hypothetical protein	A0A0K2CNP4	Brevibacillus_phage	2.2e-07	42.2
WP_000717829.1\|2370539_2370707_-	DUF3954 domain-containing protein	A0A1B0T6B8	Bacillus_phage	9.5e-15	64.2
WP_001125972.1\|2370725_2371085_-	hypothetical protein	A0A1B1P7A1	Bacillus_phage	4.9e-32	54.2
WP_000799098.1\|2371077_2371356_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	1.6e-11	59.3
WP_000337984.1\|2371372_2371567_-	hypothetical protein	A0A0U3K3J8	Bacillus_phage	6.5e-23	81.2
WP_001148230.1\|2371569_2372433_-	ATP-binding protein	A0A1B0T6C3	Bacillus_phage	3.1e-133	94.9
WP_000190244.1\|2372380_2373121_-	DnaD domain protein	A0A1B0T6C0	Bacillus_phage	2.4e-81	82.5
WP_000969632.1\|2373331_2373499_-	hypothetical protein	A0A0U3B230	Bacillus_phage	6.0e-17	79.6
WP_001246222.1\|2373495_2373846_-	helix-turn-helix domain-containing protein	A0A1B0T6C2	Bacillus_phage	7.5e-54	87.1
WP_000022043.1\|2373842_2374085_-	helix-turn-helix transcriptional regulator	A0A1B0T6B2	Bacillus_phage	1.1e-24	83.3
WP_000172107.1\|2374306_2374660_+	helix-turn-helix transcriptional regulator	A0A1B0T6A7	Bacillus_phage	9.6e-49	85.5
WP_000838797.1\|2375173_2376313_-	hypothetical protein	H0UST6	Bacillus_phage	1.6e-124	58.6
WP_000703672.1\|2376874_2377738_+	hypothetical protein	NA	NA	NA	NA
WP_000679465.1\|2377896_2379021_+\|integrase	site-specific integrase	A0A1B0T6A8	Bacillus_phage	2.0e-212	98.1
WP_000105033.1\|2379079_2380459_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	3.8e-117	46.7
2379098:2379126	attR	NA	NA	NA	NA
WP_001200489.1\|2380884_2382081_+	NupC family nucleoside transporter	NA	NA	NA	NA
WP_000875595.1\|2382127_2382835_-	hypothetical protein	NA	NA	NA	NA
WP_001233712.1\|2383371_2384454_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_000007357.1\|2384569_2385799_+	aminopeptidase	NA	NA	NA	NA
WP_003283018.1\|2385844_2386351_-	DUF4352 domain-containing protein	NA	NA	NA	NA
WP_000263262.1\|2386467_2386791_-	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_000358128.1\|2386838_2388290_-	NADP-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_000225143.1\|2388282_2389650_-	PAS domain-containing protein	NA	NA	NA	NA
WP_155403438.1\|2389765_2391208_-	4-aminobutyrate--2-oxoglutarate transaminase	NA	NA	NA	NA
WP_000416667.1\|2391283_2392027_-	HAD family hydrolase	NA	NA	NA	NA
WP_000977679.1\|2392166_2393072_-	diacylglycerol kinase	A0A1V0SBJ0	Catovirus	4.1e-27	30.8
WP_001047685.1\|2393629_2395057_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_000051441.1\|2395071_2396529_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_000086999.1\|2396544_2396835_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA

DBSCAN-SWA_8

2417911 : 2426287

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000088589.1\|2417911_2418499_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	9.1e-28	37.4
WP_001262439.1\|2418495_2419536_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.2e-67	45.9
WP_000879025.1\|2419641_2421057_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	3.3e-55	35.4
WP_000055562.1\|2421041_2423261_-	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	2.6e-163	41.2
WP_000666789.1\|2423244_2423928_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_000278823.1\|2423924_2424179_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_001170544.1\|2424171_2424891_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	4.0e-49	44.3
WP_000625682.1\|2424979_2426287_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.9e-21	25.3

DBSCAN-SWA_9

2438945 : 2537037

Bacillus_phage(52.46%)

portal,holin,integrase,protease,tRNA,terminase,capsid,head,transposase,tail

attL 2515399:2515416|attR 2528329:2528346

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000275580.1\|2438945_2440241_-\|transposase	IS21-like element IS232 family transposase	A0A2L1IVA1	Escherichia_phage	5.3e-12	28.8
WP_002134075.1\|2440275_2441043_+	RNA methyltransferase	A0A288WG17	Bacillus_phage	7.4e-62	51.9
WP_000405117.1\|2441262_2441985_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_001058693.1\|2442012_2442885_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_000690999.1\|2443108_2444185_+	glycosyl transferase	NA	NA	NA	NA
WP_000651991.1\|2449461_2450175_+	response regulator transcription factor	W8CYM9	Bacillus_phage	3.4e-37	38.1
WP_000845334.1\|2450164_2451178_+	HAMP domain-containing histidine kinase	A0A2K9L4R6	Tupanvirus	3.1e-07	21.6
WP_000074580.1\|2451246_2452176_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.3e-41	44.2
WP_000247716.1\|2452168_2452906_+	ABC transporter permease	NA	NA	NA	NA
WP_001279960.1\|2452923_2453721_+	undecaprenyl-diphosphate phosphatase UppP	NA	NA	NA	NA
WP_001072418.1\|2454083_2454542_+	ASCH domain-containing protein	NA	NA	NA	NA
WP_000687949.1\|2459729_2460461_-	DsbA family oxidoreductase	NA	NA	NA	NA
WP_000723976.1\|2460660_2461620_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_000719210.1\|2466964_2468470_-	aminopeptidase AmpS	W8CYF6	Bacillus_phage	7.8e-31	30.0
WP_000929880.1\|2468453_2469155_-	response regulator transcription factor	W8CYM9	Bacillus_phage	9.5e-40	36.0
WP_000833096.1\|2469298_2470624_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	4.1e-44	29.4
WP_002134197.1\|2471341_2472232_+	hypothetical protein	A0A0S2MVF4	Bacillus_phage	1.9e-85	63.0
WP_000741567.1\|2472395_2473472_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	1.2e-171	86.6
WP_000956437.1\|2474020_2474287_+	hypothetical protein	NA	NA	NA	NA
WP_000579579.1\|2475290_2476541_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	2.7e-69	41.9
WP_000403436.1\|2476992_2477931_-	N-acetylmuramoyl-L-alanine amidase	A0A0S2MV84	Bacillus_phage	3.3e-136	94.7
WP_000373855.1\|2477930_2478356_-\|holin	phage holin family protein	A0A1B1P787	Bacillus_phage	4.8e-71	97.2
WP_000390477.1\|2478431_2478656_-	hypothetical protein	A0A1B1P780	Bacillus_phage	1.1e-26	89.2
WP_015382147.1\|2478782_2479148_-	hypothetical protein	A0A0S2MVE0	Bacillus_phage	3.7e-35	59.0
WP_015382146.1\|2479164_2484729_-	hypothetical protein	A0A0S2MVB4	Bacillus_phage	0.0e+00	64.1
WP_000093847.1\|2484725_2486195_-\|tail	phage tail protein	A0A0S2MV63	Bacillus_phage	1.1e-231	78.3
WP_001173498.1\|2486234_2491232_-\|tail	phage tail protein	A0A2H4JI37	uncultured_Caudovirales_phage	0.0e+00	80.5
WP_015382157.1\|2491396_2491771_-	hypothetical protein	A0A2H4JBU8	uncultured_Caudovirales_phage	1.8e-53	86.8
WP_001251821.1\|2491827_2492412_-\|tail	tail protein	A0A2H4JET9	uncultured_Caudovirales_phage	2.9e-98	93.3
WP_000793436.1\|2492427_2492790_-	DUF3168 domain-containing protein	A0A2H4JBW1	uncultured_Caudovirales_phage	1.4e-55	85.0
WP_000818829.1\|2492786_2493224_-	hypothetical protein	A0A2H4JBV5	uncultured_Caudovirales_phage	7.4e-75	93.1
WP_001182260.1\|2493211_2493586_-\|head	phage head closure protein	A0A2H4JHA9	uncultured_Caudovirales_phage	1.1e-58	90.3
WP_001243199.1\|2493587_2493884_-	hypothetical protein	A0A2H4JF26	uncultured_Caudovirales_phage	1.6e-41	87.8
WP_000234863.1\|2493896_2495060_-	hypothetical protein	A0A2H4JH29	uncultured_Caudovirales_phage	1.7e-211	96.9
WP_000216402.1\|2495080_2495857_-\|protease	Clp protease ClpP	A0A0A7RWX3	Clostridium_phage	2.5e-57	57.7
WP_044157418.1\|2495840_2496947_-\|portal	phage portal protein	A0A2H4JAJ1	uncultured_Caudovirales_phage	2.4e-186	89.9
WP_000615714.1\|2497012_2498671_-\|terminase	terminase large subunit	A0A2H4JHE9	uncultured_Caudovirales_phage	1.0e-257	79.3
WP_000124848.1\|2498667_2499003_-	hypothetical protein	A0A1B1P762	Bacillus_phage	2.3e-07	31.2
WP_000666403.1\|2499152_2499488_-	HNH endonuclease	D2XR61	Bacillus_phage	1.0e-52	91.9
WP_000336221.1\|2499484_2499889_-	hypothetical protein	Q2I8B8	Bacillus_phage	2.7e-47	75.0
WP_000124642.1\|2500030_2500291_-	hypothetical protein	NA	NA	NA	NA
WP_001012113.1\|2500966_2501509_-\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	1.3e-89	92.2
WP_000166182.1\|2501508_2501991_-	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	1.9e-71	82.5
WP_000525861.1\|2502304_2502586_-	hypothetical protein	NA	NA	NA	NA
WP_000234108.1\|2503084_2503267_-	hypothetical protein	NA	NA	NA	NA
WP_000365653.1\|2503453_2503672_-	hypothetical protein	NA	NA	NA	NA
WP_000397931.1\|2504393_2504660_-	hypothetical protein	D2XR50	Bacillus_phage	2.2e-13	42.7
WP_000805074.1\|2504835_2505258_-	hypothetical protein	A0A1B1P7B4	Bacillus_phage	2.3e-65	82.9
WP_000387671.1\|2505282_2505681_-	hypothetical protein	A0A068ELY9	Bacillus_phage	2.8e-57	79.1
WP_002134037.1\|2505732_2505918_-	hypothetical protein	NA	NA	NA	NA
WP_000665841.1\|2505962_2506175_-	hypothetical protein	A0A1B0T6B5	Bacillus_phage	1.5e-25	93.5
WP_002134040.1\|2506201_2506666_-	hypothetical protein	A0A2H4J8I5	uncultured_Caudovirales_phage	4.4e-17	35.4
WP_000811696.1\|2506674_2506929_-	hypothetical protein	A0A1B0T6B9	Bacillus_phage	1.4e-36	88.1
WP_000805170.1\|2506943_2507117_-	DUF3954 domain-containing protein	A0A1B1P7U5	Bacillus_phage	2.6e-23	91.2
WP_000337986.1\|2507142_2507337_-	hypothetical protein	A0A0U3K3J8	Bacillus_phage	1.0e-20	76.6
WP_000235015.1\|2507352_2508228_-	ATP-binding protein	Q2I8C8	Bacillus_phage	4.3e-66	47.2
WP_000073375.1\|2508166_2509054_-	DnaD domain protein	W8CYG5	Bacillus_phage	6.8e-43	41.7
WP_000665325.1\|2509467_2509665_-	hypothetical protein	NA	NA	NA	NA
WP_000359729.1\|2509677_2510493_-	hypothetical protein	A0A0S2MV65	Bacillus_phage	6.1e-123	81.6
WP_000383685.1\|2510718_2510907_-	hypothetical protein	A0A0S2MV91	Bacillus_phage	4.5e-29	100.0
WP_001042666.1\|2510920_2511175_-	DUF739 family protein	A0A0S2MVA3	Bacillus_phage	5.5e-38	98.8
WP_000435973.1\|2511360_2511840_+	helix-turn-helix transcriptional regulator	A0A0S2MVI1	Bacillus_phage	6.9e-82	99.4
WP_000654304.1\|2511853_2512294_+	ImmA/IrrE family metallo-endopeptidase	A0A0S2MV59	Bacillus_phage	6.5e-79	97.9
WP_001123356.1\|2512320_2513388_+\|integrase	site-specific integrase	A0A0S2MV79	Bacillus_phage	3.3e-201	99.7
WP_000743906.1\|2513453_2514992_-	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	8.8e-22	31.7
2515399:2515416	attL	NA	NA	NA	NA
WP_016090283.1\|2515711_2515921_-	hypothetical protein	NA	NA	NA	NA
WP_016090284.1\|2515933_2516263_-\|head	phage head closure protein	NA	NA	NA	NA
WP_044157420.1\|2516279_2517872_-\|terminase	terminase large subunit	A0A290GJW3	Caldibacillus_phage	2.8e-156	52.6
WP_016090286.1\|2517924_2518272_-	hypothetical protein	A0A290GJQ7	Caldibacillus_phage	3.9e-18	43.9
WP_016090287.1\|2518398_2518689_-	HNH endonuclease	R9TNN2	Paenibacillus_phage	1.6e-25	53.2
WP_016090288.1\|2518681_2518969_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_016090289.1\|2519035_2520298_-\|capsid	phage major capsid protein	NA	NA	NA	NA
WP_016090290.1\|2520302_2520881_-\|head,protease	HK97 family phage prohead protease	Q8SBP9	Clostridium_phage	2.6e-11	30.2
WP_016090291.1\|2520877_2522074_-\|portal	phage portal protein	A0A1L2BY94	Clostridium_phage	5.0e-65	35.9
WP_016090293.1\|2522227_2522455_-	hypothetical protein	NA	NA	NA	NA
WP_016090294.1\|2522786_2525216_-	DUF927 domain-containing protein	Q4ZE73	Staphylococcus_phage	2.2e-83	32.6
WP_016090295.1\|2525317_2525644_-	hypothetical protein	NA	NA	NA	NA
WP_016090297.1\|2525946_2526216_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_016090298.1\|2526438_2527023_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_016090299.1\|2527071_2528250_+\|integrase	site-specific integrase	S6C485	Thermus_phage	8.0e-140	62.9
WP_001029993.1\|2528328_2529963_-	chaperonin GroEL	A0A219YK78	uncultured_virus	1.5e-157	58.0
2528329:2528346	attR	NA	NA	NA	NA
WP_000917311.1\|2530001_2530286_-	co-chaperone GroES	A0A221S3C8	uncultured_virus	1.2e-20	54.8
WP_000745326.1\|2530676_2531426_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_001246200.1\|2531422_2531614_+	YdiK family protein	NA	NA	NA	NA
WP_000372699.1\|2531643_2532273_-	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_001987845.1\|2532406_2534386_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	2.8e-52	29.9
WP_000414585.1\|2534871_2535888_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.9e-68	43.4
WP_000367190.1\|2535887_2536331_-	ribosomal-protein-alanine N-acetyltransferase	NA	NA	NA	NA
WP_000865756.1\|2536344_2537037_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA

DBSCAN-SWA_10

3140963 : 3217324

Bacillus_phage(48.28%)

portal,holin,integrase,protease,terminase,capsid,head,transposase,tail

attL 3157229:3157249|attR 3199768:3199788

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047225409.1\|3140963_3141374_+\|holin	phage holin family protein	NA	NA	NA	NA
WP_001127250.1\|3141499_3142429_+	HPr(Ser) kinase/phosphatase	NA	NA	NA	NA
WP_000922850.1\|3142455_3143268_+	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_002097946.1\|3143335_3143986_+	pyrophosphatase PpaX	NA	NA	NA	NA
WP_001255073.1\|3144019_3144532_+	acyltransferase	NA	NA	NA	NA
WP_000517720.1\|3144670_3146182_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_001288079.1\|3146267_3147224_+	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	4.0e-89	53.6
WP_000455200.1\|3147389_3148196_+	DUF368 domain-containing protein	NA	NA	NA	NA
WP_001190080.1\|3148425_3148884_+	8-oxo-dGTP diphosphatase	NA	NA	NA	NA
WP_000138459.1\|3148904_3149786_+	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	4.6e-07	28.9
WP_000712186.1\|3149789_3150743_+	YvcK family protein	A1IMD5	Streptococcus_phage	1.7e-63	42.8
WP_000250307.1\|3151804_3152053_+	HPr family phosphocarrier protein	NA	NA	NA	NA
WP_001049162.1\|3152380_3152962_-	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	1.3e-55	56.5
WP_000018924.1\|3153202_3154072_-	DUF421 domain-containing protein	NA	NA	NA	NA
WP_000215909.1\|3154092_3154299_-	DUF1657 domain-containing protein	NA	NA	NA	NA
WP_000575919.1\|3154310_3154661_-	stage V sporulation protein AE	NA	NA	NA	NA
WP_000938972.1\|3154657_3155674_-	stage V sporulation protein AD	NA	NA	NA	NA
WP_000095408.1\|3155674_3156151_-	stage V sporulation protein AC	NA	NA	NA	NA
WP_001226064.1\|3156180_3156669_-	hypothetical protein	NA	NA	NA	NA
WP_000216166.1\|3156762_3156969_-	DUF1657 domain-containing protein	NA	NA	NA	NA
3157229:3157249	attL	NA	NA	NA	NA
WP_000135757.1\|3157383_3158520_-\|integrase	site-specific integrase	A8ATX2	Listeria_phage	6.8e-96	48.0
WP_001037137.1\|3158550_3159018_-	hypothetical protein	NA	NA	NA	NA
WP_002133807.1\|3159028_3159421_-	helix-turn-helix transcriptional regulator	A0A1Q1PVX8	Staphylococcus_phage	3.2e-13	58.5
WP_000216290.1\|3159585_3159816_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000711864.1\|3159851_3160085_+	DUF771 domain-containing protein	Q9MBW7	Lactococcus_phage	5.6e-05	43.5
WP_001016247.1\|3160438_3161194_+	phage regulatory protein	A0A2H4JBC7	uncultured_Caudovirales_phage	1.9e-110	83.4
WP_001187283.1\|3161205_3161394_+	hypothetical protein	A0A2H4J4V8	uncultured_Caudovirales_phage	2.6e-13	62.9
WP_000453495.1\|3161420_3161864_+	hypothetical protein	A0A0S2MVA8	Bacillus_phage	9.8e-67	90.5
WP_015382506.1\|3161881_3162595_+	hypothetical protein	A0A0S2MV99	Bacillus_phage	1.4e-126	98.3
WP_000355713.1\|3162594_3162810_+	hypothetical protein	A0A1C8E9A6	Bacillus_phage	1.1e-31	98.6
WP_002133909.1\|3162739_3163081_+	hypothetical protein	A0A0S2MVH7	Bacillus_phage	9.9e-51	97.3
WP_000510889.1\|3163174_3164128_+	DnaD domain protein	A0A0S2MVA0	Bacillus_phage	8.4e-148	90.2
WP_000933908.1\|3164139_3164619_+	hypothetical protein	A0A1C8E9A8	Bacillus_phage	4.3e-84	97.5
WP_000139235.1\|3164611_3164842_+	hypothetical protein	A0A1C8E9C2	Bacillus_phage	2.5e-34	100.0
WP_001245738.1\|3164865_3165423_+	hypothetical protein	A0A1B1P7A6	Bacillus_phage	2.0e-64	70.8
WP_000775809.1\|3165461_3165896_+	hypothetical protein	A0A2H4JBD8	uncultured_Caudovirales_phage	2.2e-71	89.6
WP_001268031.1\|3165954_3166245_+	hypothetical protein	A0A1C8EA94	Bacillus_phage	2.5e-50	93.8
WP_000520932.1\|3167267_3167522_+	hypothetical protein	I7ILU4	Staphylococcus_phage	1.2e-40	100.0
WP_000858114.1\|3167557_3168253_+	hypothetical protein	A0A1I9S6E4	Bacillus_phage	3.2e-112	81.5
WP_000590881.1\|3168297_3168609_+	hypothetical protein	A0A0A7AR06	Bacillus_phage	1.0e-41	84.5
WP_000540086.1\|3168644_3169172_+	Holliday junction resolvase RecU	A0A1C8E9C3	Bacillus_phage	4.1e-96	97.7
WP_015670520.1\|3169168_3169495_+	hypothetical protein	A0A1C8E9C1	Bacillus_phage	4.7e-58	98.1
WP_003308641.1\|3169532_3169934_+	hypothetical protein	A0A1C8E9D1	Bacillus_phage	1.1e-67	99.2
WP_000711194.1\|3170317_3170737_-	HicB family protein	A0A2H4J4X8	uncultured_Caudovirales_phage	4.5e-61	79.9
WP_071686389.1\|3170788_3170971_-	type II toxin-antitoxin system HicA family toxin	A0A0U4KLG1	Pseudomonas_phage	3.9e-14	64.9
WP_000650576.1\|3171150_3171375_+	hypothetical protein	NA	NA	NA	NA
WP_000343502.1\|3171388_3171592_+	hypothetical protein	NA	NA	NA	NA
WP_001002014.1\|3171597_3172032_+	hypothetical protein	Q2I8B8	Bacillus_phage	9.8e-19	61.5
WP_001177575.1\|3172100_3172310_+	hypothetical protein	NA	NA	NA	NA
WP_000378699.1\|3172316_3172574_+	hypothetical protein	NA	NA	NA	NA
WP_001177571.1\|3172564_3172939_+	hypothetical protein	NA	NA	NA	NA
WP_000666398.1\|3172904_3173240_+	HNH endonuclease	D2XR61	Bacillus_phage	1.6e-53	91.0
WP_000301150.1\|3173363_3173675_+\|terminase	terminase	D2XR14	Bacillus_phage	4.7e-39	86.3
WP_000595321.1\|3173671_3175357_+\|terminase	terminase large subunit	D2XR15	Bacillus_phage	5.5e-275	85.7
WP_000118683.1\|3175377_3176529_+\|portal	phage portal protein	A8AT96	Listeria_phage	1.8e-104	51.1
WP_000791073.1\|3176518_3177244_+\|protease	Clp protease ClpP	A0A2H4J8Y7	uncultured_Caudovirales_phage	1.7e-44	53.2
WP_000245092.1\|3177270_3178437_+\|capsid	phage major capsid protein	A0A2H4JH29	uncultured_Caudovirales_phage	9.6e-162	77.7
WP_000361981.1\|3178449_3178743_+	hypothetical protein	A0A2H4JG04	uncultured_Caudovirales_phage	2.7e-36	76.3
WP_001247297.1\|3178744_3179095_+\|head	phage head closure protein	D2XR20	Bacillus_phage	3.7e-53	87.9
WP_000997537.1\|3179096_3179441_+	HK97 gp10 family phage protein	A0A2H4JAH8	uncultured_Caudovirales_phage	1.7e-45	80.5
WP_000219080.1\|3179437_3179773_+	hypothetical protein	A0A2H4JAG4	uncultured_Caudovirales_phage	3.2e-54	94.5
WP_001004920.1\|3179773_3180367_+\|tail	phage tail protein	A0A2H4JDV4	uncultured_Caudovirales_phage	3.7e-101	91.8
WP_000415931.1\|3180373_3180736_+	hypothetical protein	A0A2H4JAG8	uncultured_Caudovirales_phage	1.4e-42	71.7
WP_000897021.1\|3180966_3182202_+	hypothetical protein	A0A2H4JAI2	uncultured_Caudovirales_phage	3.6e-151	73.1
WP_002133928.1\|3182479_3184861_+	hypothetical protein	A0A2H4JC82	uncultured_Caudovirales_phage	3.7e-43	44.1
WP_015382503.1\|3184902_3186372_+	hypothetical protein	A0A0S2MV63	Bacillus_phage	2.6e-236	80.2
WP_015382502.1\|3186368_3190751_+	phage minor structural protein	A0A0S2MVB4	Bacillus_phage	0.0e+00	58.4
WP_016090170.1\|3190767_3191139_+	hypothetical protein	A0A0S2MVE0	Bacillus_phage	2.2e-35	58.4
WP_000499524.1\|3191259_3192453_-\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	1.2e-23	25.1
WP_042991251.1\|3192747_3193191_+\|holin	phage holin family protein	A0A0S2MVC4	Bacillus_phage	1.8e-68	97.8
WP_000499524.1\|3193252_3194446_-\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	1.2e-23	25.1
WP_000405783.1\|3194743_3195679_+	N-acetylmuramoyl-L-alanine amidase	A0A0S2MVR5	Bacillus_phage	1.8e-155	82.3
WP_000993515.1\|3195882_3196998_+	tetratricopeptide repeat protein	A0A2H4J8G3	uncultured_Caudovirales_phage	4.0e-109	54.9
WP_000734384.1\|3196997_3197216_+	hypothetical protein	A0A2H4JBB8	uncultured_Caudovirales_phage	1.7e-16	73.8
WP_000742864.1\|3197394_3197961_-	hypothetical protein	A6XML2	Bacillus_virus	4.8e-26	45.7
WP_001016121.1\|3198104_3198323_+	hypothetical protein	A0A2H4JC50	uncultured_Caudovirales_phage	7.3e-31	93.1
WP_001273481.1\|3198347_3198641_+	hypothetical protein	A0A1C8E992	Bacillus_phage	2.7e-41	87.6
WP_000412580.1\|3198656_3199484_-	hypothetical protein	A0A1C8EA76	Bacillus_phage	7.6e-137	90.9
WP_000647955.1\|3200046_3201354_+	RNA polymerase factor sigma-54	NA	NA	NA	NA
3199768:3199788	attR	NA	NA	NA	NA
WP_000869730.1\|3201363_3201609_+	glutaredoxin family protein	NA	NA	NA	NA
WP_001258185.1\|3201744_3202773_+	gapA transcriptional regulator CggR	NA	NA	NA	NA
WP_000161236.1\|3202799_3203804_+	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_001036350.1\|3203943_3205128_+	phosphoglycerate kinase	NA	NA	NA	NA
WP_001231038.1\|3205160_3205916_+	triose-phosphate isomerase	NA	NA	NA	NA
WP_001231158.1\|3205912_3207442_+	2,3-bisphosphoglycerate-independent phosphoglycerate mutase	NA	NA	NA	NA
WP_000103951.1\|3207472_3208768_+	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	1.1e-182	75.4
WP_001125064.1\|3208819_3209770_-	nucleoside hydrolase	NA	NA	NA	NA
WP_000673222.1\|3210122_3210491_+\|holin	CidA/LrgA family holin-like protein	NA	NA	NA	NA
WP_000078304.1\|3210487_3211180_+	LrgB family protein	NA	NA	NA	NA
WP_000557264.1\|3211274_3211508_+	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_000976870.1\|3211666_3212410_+	carboxylesterase	NA	NA	NA	NA
WP_000391097.1\|3212552_3214991_+	ribonuclease R	Q0GXV6	Lactococcus_phage	1.7e-91	40.6
WP_001123919.1\|3215117_3215585_+	SsrA-binding protein	W5RAM5	Staphylococcus_phage	5.4e-47	63.2
WP_000915084.1\|3216391_3217324_-\|holin	choline-binding protein A	NA	NA	NA	NA

DBSCAN-SWA_11

3348881 : 3442795

Bacillus_phage(79.69%)

portal,integrase,holin,protease,tRNA,terminase,capsid,head,coat,transposase,tail

attL 3361466:3361485|attR 3448250:3448269

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000241505.1\|3348881_3349994_-\|protease	cysteine protease StiP family protein	NA	NA	NA	NA
WP_000856300.1\|3349999_3351346_-	hypothetical protein	NA	NA	NA	NA
WP_001106091.1\|3351290_3352394_-	HpcH/HpaI aldolase/citrate lyase family protein	NA	NA	NA	NA
WP_000351148.1\|3352556_3353084_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000665094.1\|3353107_3353599_-	phosphatidylglycerophosphatase A	G3MBC5	Bacillus_virus	3.5e-41	53.8
WP_000614218.1\|3353719_3354721_+\|coat	spore coat protein CotS	NA	NA	NA	NA
WP_001125494.1\|3354782_3354998_-	hypothetical protein	NA	NA	NA	NA
WP_000431159.1\|3355192_3355429_-	NifU family protein	Q58MC7	Prochlorococcus_phage	2.0e-10	46.6
WP_002101505.1\|3355984_3356779_+	DUF4111 domain-containing protein	NA	NA	NA	NA
WP_000049707.1\|3356901_3357570_+	hypothetical protein	NA	NA	NA	NA
WP_002101500.1\|3357620_3358259_-	DUF4304 domain-containing protein	NA	NA	NA	NA
WP_000843107.1\|3358245_3358716_-	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_000383681.1\|3358805_3359060_+	hypothetical protein	NA	NA	NA	NA
WP_000607080.1\|3359096_3359480_+	hypothetical protein	NA	NA	NA	NA
WP_003285671.1\|3359768_3360566_+	DUF2628 domain-containing protein	NA	NA	NA	NA
WP_000622258.1\|3360635_3360917_+	hypothetical protein	NA	NA	NA	NA
WP_000212737.1\|3361076_3361418_+	alkylphosphonate utilization operon protein PhnA	NA	NA	NA	NA
3361466:3361485	attL	NA	NA	NA	NA
WP_000679246.1\|3361638_3362436_-	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
WP_000470265.1\|3362419_3363079_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.3e-22	35.7
WP_001054089.1\|3363134_3363308_-	aspartyl-phosphate phosphatase Spo0E family protein	NA	NA	NA	NA
WP_000682077.1\|3363541_3364612_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_000595026.1\|3364958_3365198_+	YuzB family protein	NA	NA	NA	NA
WP_000077397.1\|3365466_3366333_+	diaminopimelate epimerase	NA	NA	NA	NA
WP_000573825.1\|3366374_3366728_+	iron-sulfur cluster assembly accessory protein	A0A2H4N7M3	Lake_Baikal_phage	3.7e-16	43.3
WP_087942842.1\|3366809_3368155_-\|transposase	IS3-like element ISBth10 family transposase	A0A1B1P773	Bacillus_phage	3.6e-112	74.4
WP_000834606.1\|3368580_3369345_+	hypothetical protein	NA	NA	NA	NA
WP_000833145.1\|3369968_3370322_+	YxeA family protein	A0A0K2CYS5	Paenibacillus_phage	4.5e-14	39.7
WP_000237487.1\|3370410_3371472_-\|integrase	site-specific integrase	A0A1B2AQ00	Phage_Wrath	3.5e-171	83.9
WP_000896931.1\|3372434_3372665_+	hypothetical protein	H0UST5	Bacillus_phage	8.5e-30	90.8
WP_001164934.1\|3372832_3373963_+	hypothetical protein	NA	NA	NA	NA
WP_000005253.1\|3374365_3374695_-	helix-turn-helix transcriptional regulator	H0UST7	Bacillus_phage	5.6e-51	97.2
WP_000368216.1\|3374942_3375188_+	hypothetical protein	NA	NA	NA	NA
WP_000277643.1\|3375332_3375521_+	helix-turn-helix domain-containing protein	A0A1B2APY7	Phage_Wrath	2.6e-21	80.6
WP_000960416.1\|3375838_3376555_+	hypothetical protein	Q3HL19	Bacillus_phage	6.4e-100	78.2
WP_000218620.1\|3376716_3377031_+	hypothetical protein	A0A0S2GLB6	Bacillus_phage	1.1e-51	100.0
WP_015382495.1\|3377305_3377953_+	sigma-70 family RNA polymerase sigma factor	A0A0S2GLJ1	Bacillus_phage	8.9e-117	99.5
WP_015382176.1\|3378176_3379193_+	hypothetical protein	A0A0S2GLI6	Bacillus_phage	2.8e-189	100.0
WP_002133989.1\|3379155_3379968_+	hypothetical protein	A0A0S2GLK2	Bacillus_phage	1.2e-155	100.0
WP_000436951.1\|3380009_3380276_+	hypothetical protein	A0A0S2GLK4	Bacillus_phage	7.7e-43	100.0
WP_000817807.1\|3380347_3380512_+	DUF3954 domain-containing protein	A0A0S2GLF5	Bacillus_phage	1.0e-24	100.0
WP_001025406.1\|3380529_3380745_+	hypothetical protein	A0A0S2GLC6	Bacillus_phage	8.7e-37	100.0
WP_000705118.1\|3380741_3381041_-	hypothetical protein	A0A0S2GLD6	Bacillus_phage	1.9e-50	100.0
WP_038413787.1\|3381191_3381491_+	hypothetical protein	A0A0S2GLL5	Bacillus_phage	1.8e-51	99.0
WP_155403433.1\|3381647_3381821_+	hypothetical protein	W8CYZ6	Bacillus_phage	2.0e-28	100.0
WP_000404184.1\|3381844_3382252_+	hypothetical protein	A0A0S2GLF8	Bacillus_phage	4.9e-73	100.0
WP_000965619.1\|3383660_3383942_+	hypothetical protein	A0A0S2GLD3	Bacillus_phage	8.7e-45	100.0
WP_000166155.1\|3384299_3384785_+	ArpU family transcriptional regulator	A0A0S2GLJ9	Bacillus_phage	1.8e-85	99.4
WP_001012176.1\|3384781_3385324_+\|integrase	site-specific integrase	A0A0S2GLG4	Bacillus_phage	3.3e-96	100.0
WP_015382276.1\|3385530_3385776_+	hypothetical protein	W8CYG8	Bacillus_phage	6.5e-36	97.5
WP_000017440.1\|3386178_3386466_+	hypothetical protein	H0USV6	Bacillus_phage	1.7e-43	91.6
WP_000464752.1\|3386502_3386730_+	hypothetical protein	NA	NA	NA	NA
WP_000443965.1\|3386775_3386955_+	hypothetical protein	W8CYF7	Bacillus_phage	6.0e-23	98.3
WP_000002725.1\|3386989_3387229_+	hypothetical protein	W8CZ42	Bacillus_phage	1.1e-16	93.7
WP_000773601.1\|3387245_3387458_+	hypothetical protein	H0USV9	Bacillus_phage	1.0e-29	97.1
WP_000870105.1\|3387592_3387847_+	hypothetical protein	W8CYT4	Bacillus_phage	1.3e-42	97.6
WP_001139454.1\|3387836_3388214_+	HNH endonuclease	A0A0S2GLI5	Bacillus_phage	2.1e-65	94.4
WP_000233390.1\|3388342_3388846_+\|terminase	phage terminase small subunit P27 family	A0A0S2GLF2	Bacillus_phage	1.0e-88	99.4
WP_000621131.1\|3388847_3390542_+\|terminase	terminase large subunit	A0A0S2GLF0	Bacillus_phage	0.0e+00	99.6
WP_000577489.1\|3390730_3391984_+\|portal	phage portal protein	A0A0S2GLJ4	Bacillus_phage	1.7e-241	99.3
WP_001259159.1\|3391970_3392681_+\|protease	Clp protease ClpP	W8CYT5	Bacillus_phage	2.4e-123	95.8
WP_000361137.1\|3392718_3393885_+\|capsid	phage major capsid protein	W8CYN2	Bacillus_phage	4.0e-208	96.6
WP_000244586.1\|3393905_3394193_+\|head,tail	phage gp6-like head-tail connector protein	A0A0S2GLH6	Bacillus_phage	1.8e-45	100.0
WP_015382490.1\|3394179_3394503_+\|head	phage head closure protein	H0USW8	Bacillus_phage	3.3e-56	99.1
WP_000763219.1\|3394495_3394930_+	HK97 gp10 family phage protein	H0USW9	Bacillus_phage	1.8e-76	100.0
WP_000609194.1\|3394926_3395286_+	DUF3168 domain-containing protein	H0USX0	Bacillus_phage	2.5e-60	96.6
WP_000896769.1\|3395286_3395895_+\|tail	tail protein	W8CYT6	Bacillus_phage	1.3e-98	94.1
WP_015382489.1\|3395941_3396259_+	hypothetical protein	W8CYN3	Bacillus_phage	4.9e-52	97.1
WP_000344049.1\|3396288_3396465_+	hypothetical protein	W8CYG0	Bacillus_phage	6.7e-27	100.0
WP_015382488.1\|3396479_3400403_+\|tail	phage tail tape measure protein	I3WTY6	Bacillus_phage	0.0e+00	99.3
WP_000517105.1\|3400417_3401899_+\|tail	phage tail protein	W8CYY9	Bacillus_phage	5.4e-295	99.6
WP_001260185.1\|3401895_3405921_+	hypothetical protein	H0USX5	Bacillus_phage	0.0e+00	93.6
WP_000373903.1\|3406345_3406771_+\|holin	phage holin family protein	H0USX7	Bacillus_phage	7.0e-70	97.2
WP_000405777.1\|3406770_3407472_+	N-acetylmuramoyl-L-alanine amidase	W8CZ46	Bacillus_phage	6.4e-121	89.8
WP_000119484.1\|3409448_3409787_-	hypothetical protein	A0A1B1P7R0	Bacillus_phage	4.6e-48	92.9
WP_000043398.1\|3409840_3410419_-	hypothetical protein	H0USX9	Bacillus_phage	2.2e-95	88.5
WP_001137905.1\|3410424_3410604_-	hypothetical protein	NA	NA	NA	NA
WP_000649833.1\|3410612_3410810_-	helix-turn-helix transcriptional regulator	A0A288WG80	Bacillus_phage	3.4e-19	76.2
WP_001257569.1\|3410992_3411310_+	hypothetical protein	H0USY0	Bacillus_phage	6.4e-52	98.1
WP_000170777.1\|3411306_3411489_+	hypothetical protein	Q2I8E2	Bacillus_phage	1.4e-22	90.0
WP_000891535.1\|3411604_3412786_+	cell division protein FtsK	H0USY1	Bacillus_phage	9.0e-216	94.4
WP_000551103.1\|3412727_3413348_+	hypothetical protein	H0USY2	Bacillus_phage	6.5e-109	93.2
WP_000710530.1\|3413357_3414185_-	hypothetical protein	A0A2H4J6G7	uncultured_Caudovirales_phage	1.8e-101	69.5
WP_000635484.1\|3414507_3414969_-	DUF523 domain-containing protein	NA	NA	NA	NA
WP_000535259.1\|3415048_3415930_+	decarboxylase	NA	NA	NA	NA
WP_000391942.1\|3415947_3417195_-	MFS transporter	NA	NA	NA	NA
WP_000902159.1\|3417360_3417840_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_000829788.1\|3428393_3429383_-	NAD(P)/FAD-dependent oxidoreductase	Q9JRK7	Streptococcus_phage	3.0e-31	52.4
WP_000856612.1\|3429844_3431053_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_000415321.1\|3431176_3431683_+	NUDIX hydrolase	NA	NA	NA	NA
WP_000027016.1\|3431679_3431997_+	hypothetical protein	NA	NA	NA	NA
WP_000920098.1\|3432083_3432710_+	hypothetical protein	A0A0H3UZG2	Geobacillus_virus	6.1e-14	42.1
WP_000487942.1\|3432869_3434354_+	cytosol aminopeptidase	Q6GYZ8	Mycoplasma_phage	8.7e-59	36.9
WP_000545253.1\|3434528_3435134_-	hypothetical protein	NA	NA	NA	NA
WP_001104221.1\|3435277_3437002_+	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	1.6e-176	53.5
WP_002097988.1\|3437109_3437997_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	7.0e-80	54.1
WP_001252163.1\|3438042_3438636_-	biotin transporter BioY	NA	NA	NA	NA
WP_001140612.1\|3439524_3439908_+	hotdog fold thioesterase	NA	NA	NA	NA
WP_087942833.1\|3439962_3441305_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	6.3e-32	37.3
WP_000287147.1\|3441418_3442795_-\|tRNA	glycine--tRNA ligase	A0A1V0SIF1	Klosneuvirus	5.8e-49	27.9
3448250:3448269	attR	NA	NA	NA	NA

DBSCAN-SWA_12

3792628 : 3800314

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001036847.1\|3792628_3793612_+	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	2.5e-17	27.2
WP_000403760.1\|3793601_3794372_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	7.6e-14	28.6
WP_001086121.1\|3794404_3795169_+	class B sortase	NA	NA	NA	NA
WP_000587826.1\|3795241_3795565_-	heme oxygenase	NA	NA	NA	NA
WP_001255971.1\|3795860_3797060_+	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	1.6e-71	41.2
WP_001014310.1\|3797098_3797293_-	YwbE family protein	NA	NA	NA	NA
WP_000018029.1\|3797635_3798328_+	response regulator transcription factor	W8CYM9	Bacillus_phage	3.7e-36	38.2
WP_000609140.1\|3798329_3799265_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	9.2e-22	24.8
WP_000221066.1\|3799390_3800314_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.5e-45	43.5

DBSCAN-SWA_13

3832628 : 3893934

Klosneuvirus(22.22%)

tRNA,coat,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001236345.1\|3832628_3833858_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.5e-85	49.4
WP_000919605.1\|3834210_3834882_+	type 1 glutamine amidotransferase domain-containing protein	NA	NA	NA	NA
WP_000774010.1\|3835157_3835967_+	glutamate racemase	NA	NA	NA	NA
WP_001126749.1\|3836148_3837198_+	spore germination protein GerM	NA	NA	NA	NA
WP_001261771.1\|3837329_3838067_+	ribonuclease PH	NA	NA	NA	NA
WP_000815943.1\|3838078_3838687_+	XTP/dITP diphosphatase	A0A0P0A2M4	Ugandan_cassava_brown_streak_virus	2.0e-14	34.4
WP_000645506.1\|3838700_3839204_+	metallophosphoesterase	NA	NA	NA	NA
WP_000124460.1\|3839887_3840088_+	hypothetical protein	NA	NA	NA	NA
WP_000473868.1\|3840182_3840797_-	hypothetical protein	NA	NA	NA	NA
WP_001983650.1\|3841316_3841565_+	hypothetical protein	NA	NA	NA	NA
WP_000358278.1\|3841762_3842761_+	hypothetical protein	NA	NA	NA	NA
WP_000105215.1\|3843070_3844348_+	trigger factor	NA	NA	NA	NA
WP_000472289.1\|3844612_3845872_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.0e-148	66.3
WP_000119180.1\|3845978_3847649_+\|protease	ATP-dependent protease LonB	E3T4F6	Cafeteria_roenbergensis_virus	6.7e-15	33.5
WP_000097285.1\|3847830_3850161_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	1.2e-176	43.5
WP_000869116.1\|3850157_3850754_+	ribosome biogenesis GTP-binding protein YsxC	NA	NA	NA	NA
WP_000359781.1\|3850787_3851204_-	organic hydroperoxide resistance protein	NA	NA	NA	NA
WP_000133923.1\|3851206_3851659_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_000547867.1\|3852075_3853410_+\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_000008991.1\|3853427_3854261_+	cytochrome c assembly protein	NA	NA	NA	NA
WP_001226396.1\|3854276_3855206_+	hydroxymethylbilane synthase	NA	NA	NA	NA
WP_000992340.1\|3855208_3855961_+	uroporphyrinogen-III synthase	NA	NA	NA	NA
WP_001087065.1\|3855981_3856971_+	porphobilinogen synthase	NA	NA	NA	NA
WP_000712943.1\|3856970_3858260_+	glutamate-1-semialdehyde 2,1-aminomutase	A0A1V0SKB7	Klosneuvirus	1.7e-05	34.1
WP_003285397.1\|3858338_3859349_+	stage VI sporulation protein D	NA	NA	NA	NA
WP_000350653.1\|3859415_3860441_+\|coat	spore coat protein YsxE	NA	NA	NA	NA
WP_000072250.1\|3860964_3863610_+\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	1.2e-164	42.8
WP_000582068.1\|3863703_3865005_+	bifunctional tetrahydrofolate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_000361014.1\|3865170_3866121_+	hypothetical protein	NA	NA	NA	NA
WP_001226291.1\|3866353_3866929_+	septum formation inhibitor Maf	NA	NA	NA	NA
WP_001013391.1\|3866975_3867653_+	DNA repair protein RadC	NA	NA	NA	NA
WP_000466736.1\|3867810_3868830_+	rod shape-determining protein MreB	NA	NA	NA	NA
WP_001135490.1\|3868871_3869723_+	rod shape-determining protein MreC	NA	NA	NA	NA
WP_000975766.1\|3869737_3870283_+	rod shape-determining protein MreD	NA	NA	NA	NA
WP_000503309.1\|3871006_3871804_+	septum site-determining protein MinD	NA	NA	NA	NA
WP_000797471.1\|3871937_3872684_+	stage IV sporulation protein SpoIVFA	NA	NA	NA	NA
WP_000599055.1\|3872676_3873537_+	stage IV sporulation protein SpoIVFB	NA	NA	NA	NA
WP_000855488.1\|3873604_3874993_+	Rne/Rng family ribonuclease	NA	NA	NA	NA
WP_000270907.1\|3875162_3875471_+	50S ribosomal protein L21	NA	NA	NA	NA
WP_002001054.1\|3875482_3875827_+\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_000944958.1\|3875830_3876121_+	50S ribosomal protein L27	NA	NA	NA	NA
WP_001003584.1\|3876184_3876733_+	sporulation protein	NA	NA	NA	NA
WP_000497128.1\|3876732_3878019_+	GTPase ObgE	NA	NA	NA	NA
WP_001986640.1\|3878159_3878867_+	response regulator transcription factor	NA	NA	NA	NA
WP_000865415.1\|3878856_3879939_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_000114529.1\|3880032_3880809_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-29	38.4
WP_001011422.1\|3880783_3882706_+	ABC transporter permease	NA	NA	NA	NA
WP_001026366.1\|3882755_3884669_+	ABC transporter permease	NA	NA	NA	NA
WP_000621701.1\|3884765_3885617_+	prephenate dehydratase	NA	NA	NA	NA
WP_000510665.1\|3885722_3886370_-	MOSC domain-containing protein	NA	NA	NA	NA
WP_000812272.1\|3886450_3886993_-	transcription repressor NadR	NA	NA	NA	NA
WP_000973772.1\|3886992_3888135_-	aminotransferase class V-fold PLP-dependent enzyme	A0A1X7QGF3	Faustovirus	5.0e-30	29.2
WP_001138529.1\|3888287_3889817_+	L-aspartate oxidase	NA	NA	NA	NA
WP_001092208.1\|3889836_3890670_+	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
WP_000025344.1\|3890700_3891807_+	quinolinate synthase NadA	NA	NA	NA	NA
WP_038413747.1\|3892032_3893934_+\|coat	spore coat assembly protein ExsA	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

6. NZ_CP011351

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

49520 : 75418

Bacillus_phage(25.0%)

transposase,integrase,protease

attL 66345:66358|attR 74787:74800

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001025593.1\|49520_52592_-\|transposase	Tn3 family transposase	Q1MVP5	Enterobacteria_phage	4.3e-44	22.3
WP_001224533.1\|52842_53466_+	recombinase family protein	Q1MVP4	Enterobacteria_phage	4.4e-12	33.7
WP_002133690.1\|54112_54364_+	hypothetical protein	NA	NA	NA	NA
WP_044157348.1\|54699_55536_+\|integrase	tyrosine-type recombinase/integrase	S5M9V8	Brevibacillus_phage	3.7e-22	27.0
WP_000538375.1\|55554_58518_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	4.1e-201	39.2
WP_016097342.1\|58547_59321_-	hypothetical protein	NA	NA	NA	NA
WP_016097341.1\|59523_61065_-	replication initiation protein RepS	NA	NA	NA	NA
WP_016097340.1\|61935_62862_+	AAA family ATPase	F0PIG8	Enterococcus_phage	1.1e-30	35.4
WP_016097339.1\|62824_63148_+	hypothetical protein	NA	NA	NA	NA
WP_016097338.1\|63280_63514_+	hypothetical protein	NA	NA	NA	NA
WP_016097337.1\|63529_63859_+	hypothetical protein	NA	NA	NA	NA
WP_016097336.1\|64016_64742_-	hypothetical protein	A0A0A7AR45	Bacillus_phage	7.8e-61	54.9
WP_016097335.1\|64808_66449_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
66345:66358	attL	NA	NA	NA	NA
WP_016097333.1\|67293_68409_-	transcriptional regulator	A0A2H4J8G3	uncultured_Caudovirales_phage	1.2e-92	52.2
WP_016097332.1\|68551_69187_-	DUF3967 domain-containing protein	A0A1Z1LZN4	Bacillus_phage	8.7e-08	28.4
WP_016097331.1\|69646_70021_+	hypothetical protein	D2XQ01	Bacillus_virus	1.5e-28	51.3
WP_090782881.1\|70172_71331_+\|transposase	IS3 family transposase	A0A0C5AEA5	Paenibacillus_phage	1.5e-37	41.6
WP_016097328.1\|71427_71673_-	hypothetical protein	NA	NA	NA	NA
WP_016097327.1\|71749_72334_+	hypothetical protein	NA	NA	NA	NA
WP_016097326.1\|72994_73612_+	recombinase family protein	A0A1V0E035	Clostridioides_phage	2.7e-14	32.0
WP_016097325.1\|73583_74582_+\|integrase	site-specific integrase	A0A1B1P793	Bacillus_phage	3.1e-36	35.1
WP_016097323.1\|74971_75418_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
74787:74800	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage