CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP011301	Burkholderia cepacia strain LO6 chromosome, complete genome	3 crisprs	csa3,DinG,DEDDh,cas3,WYL	2	4	8	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP011301_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011301_1

295214-295311

Orphan

Consensus_repeat	Method
GAATCGAGATTGCTGTTCGTGGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP011301_1

>merge|NZ_CP011301|1|295214-295311|CRISPRCasFinder
GAATCGAGATTGCTGTTCGTGGTGGAAAGGCCGGTGCTCAGGCTCGATGCCGTCGTGCTCGTGGACGTGCTGAGCGAATCGAGGTTGCTGTTCGTGGT

>NZ_CP011301|1|1|295214-295311|CRISPRCasFinder
GAATCGAGATTGCTGTTCGTGGT	GGAAAGGCCGGTGCTCAGGCTCGATGCCGTCGTGCTCGTGGACGTGCTGAGC
GAATCGAGGTTGCTGTTCGTGGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011301.1\|WP_035975607.1\|308688_310005_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340926
NZ_CP011301.1\|WP_035975599.1\|280409_281396_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011301.1\|WP_159101935.1\|293728_293986_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011301.1\|WP_105773888.1\|283212_284076_-\|peptidyl-prolyl-cis-trans-isomerase	unknown	unknown	gnl\|CDD\|379040
NZ_CP011301.1\|WP_006767194.1\|287694_288393_-\|OmpA-family-protein	unknown	unknown	gnl\|CDD\|143586
NZ_CP011301.1\|WP_006767189.1\|281392_283216_-\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|274350
NZ_CP011301.1\|WP_035975603.1\|299179_299446_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011301.1\|WP_035975605.1\|301438_304147_+\|NAD-dependent-epimerase/dehydratase-family-protein	unknown	unknown	gnl\|CDD\|368333
NZ_CP011301.1\|WP_081293700.1\|288477_288663_-\|YadA-C-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|377158
NZ_CP011301.1\|WP_052688638.1\|279611_279935_-\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|315619
NZ_CP011301.1\|WP_035975606.1\|307391_308507_-\|DUF4331-family-protein	unknown	unknown	gnl\|CDD\|379511
NZ_CP011301.1\|WP_006767192.1\|285287_286391_-\|DUF2827-domain-containing-protein	unknown	unknown	gnl\|CDD\|371305
NZ_CP011301.1\|WP_123806782.1\|298630_299032_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011301.1\|WP_123806781.1\|299976_300378_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011301.1\|WP_006767199.1\|305255_306161_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187632
NZ_CP011301.1\|WP_035975600.1\|286387_287530_-\|DUF2827-family-protein	unknown	unknown	gnl\|CDD\|371305
NZ_CP011301.1\|WP_006767198.1\|304371_305112_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187620
NZ_CP011301.1\|WP_035975608.1\|310001_311321_-\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_CP011301.1\|WP_006767191.1\|284106_285252_-\|DUF2827-domain-containing-protein	unknown	unknown	gnl\|CDD\|371305
NZ_CP011301.1\|WP_081293523.1\|306206_307319_-\|HoxN/HupN/NixA-family-nickel/cobalt-transporter	unknown	unknown	gnl\|CDD\|225911

Protein	Function_ID	Function_description	E-value
NZ_CP011301.1\|WP_035975607.1\|308688_310005_-\|MFS-transporter	gnl\|CDD\|340926	cd17368, MFS_CitA, Citrate-proton symporter of the Major Facilitator Superfamily of transporters. Citrate-proton symporter, also called citrate carrier protein or citrate transporter or citrate utilization protein A (CitA), is a proton symporter that functions in the uptake of citrate across the boundary membrane. It allows the utilization of citrate as a sole source of carbon and energy. In Klebsiella pneumoniae, the gene encoding this protein is called citH, instead of citA, which is the case for Escherichia coli and other organisms. CitA belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.02578e-86
NZ_CP011301.1\|WP_105773888.1\|283212_284076_-\|peptidyl-prolyl-cis-trans-isomerase	gnl\|CDD\|379040	pfam13145, Rotamase_2, PPIC-type PPIASE domain.	8.3265e-11
NZ_CP011301.1\|WP_006767194.1\|287694_288393_-\|OmpA-family-protein	gnl\|CDD\|143586	cd07185, OmpA_C-like, Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA. OmpA-like domains (named after the C-terminal domain of Escherichia coli OmpA protein) have been shown to non-covalently associate with peptidoglycan, a network of glycan chains composed of disaccharides, which are crosslinked via short peptide bridges. Well-studied members of this family include the Escherichia coli outer membrane protein OmpA, the Escherichia coli lipoprotein PAL, Neisseria meningitdis RmpM, which interact with the outer membrane, as well as the Escherichia coli motor protein MotB, and the Vibrio flagellar motor proteins PomB and MotY, which interact with the inner membrane.	1.98722e-43
NZ_CP011301.1\|WP_006767189.1\|281392_283216_-\|tetratricopeptide-repeat-protein	gnl\|CDD\|274350	TIGR02917, TPR_domain_protein, putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.	9.05733e-19
NZ_CP011301.1\|WP_035975605.1\|301438_304147_+\|NAD-dependent-epimerase/dehydratase-family-protein	gnl\|CDD\|368333	pfam05199, GMC_oxred_C, GMC oxidoreductase. This domain found associated with pfam00732.	1.78612e-25
NZ_CP011301.1\|WP_081293700.1\|288477_288663_-\|YadA-C-terminal-domain-containing-protein	gnl\|CDD\|377158	pfam03895, YadA_anchor, YadA-like membrane anchor domain. This region represents the C-terminal 120 amino acids of a family of surface-exposed bacterial proteins. YadA, an adhesin from Yersinia, was the first member of this family to be characterized. UspA2 from Moraxella was second. The Eib immunoglobulin-binding proteins from E. coli were third, followed by the DsrA proteins of Haemophilus ducreyi and others. These proteins are homologous at their C-terminal and have predicted signal sequences, but they diverge elsewhere. The C-terminal 9 amino acids, consisting of alternating hydrophobic amino acids ending in F or W, comprise a targeting motif for the outer membrane of the Gram negative cell envelope. This region is important for oligomerization.	8.57986e-08
NZ_CP011301.1\|WP_052688638.1\|279611_279935_-\|cupin-domain-containing-protein	gnl\|CDD\|315619	pfam12973, Cupin_7, ChrR Cupin-like domain. Members of this family are part of the cupin superfamily. This family includes the transcriptional activator ChrR.	2.84526e-17
NZ_CP011301.1\|WP_035975606.1\|307391_308507_-\|DUF4331-family-protein	gnl\|CDD\|379511	pfam14224, DUF4331, Domain of unknown function (DUF4331). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 223 and 526 amino acids in length. There is a conserved FPY sequence motif.	2.95025e-18
NZ_CP011301.1\|WP_006767192.1\|285287_286391_-\|DUF2827-domain-containing-protein	gnl\|CDD\|371305	pfam10933, DUF2827, Protein of unknown function (DUF2827). This is a family of uncharacterized proteins found in Burkholderia.	0
NZ_CP011301.1\|WP_081293523.1\|306206_307319_-\|HoxN/HupN/NixA-family-nickel/cobalt-transporter	gnl\|CDD\|225911	COG3376, HoxN, High-affinity nickel permease [Inorganic ion transport and metabolism].	2.36191e-118
NZ_CP011301.1\|WP_006767199.1\|305255_306161_-\|SDR-family-oxidoreductase	gnl\|CDD\|187632	cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs. 17beta-hydroxysteroid dehydrogenases are a group of isozymes that catalyze activation and inactivation of estrogen and androgens. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	4.38387e-83
NZ_CP011301.1\|WP_035975600.1\|286387_287530_-\|DUF2827-family-protein	gnl\|CDD\|371305	pfam10933, DUF2827, Protein of unknown function (DUF2827). This is a family of uncharacterized proteins found in Burkholderia.	2.58227e-147
NZ_CP011301.1\|WP_006767198.1\|304371_305112_-\|SDR-family-oxidoreductase	gnl\|CDD\|187620	cd05362, THN_reductase-like_SDR_c, tetrahydroxynaphthalene/trihydroxynaphthalene reductase-like, classical (c) SDRs. 1,3,6,8-tetrahydroxynaphthalene reductase (4HNR) of Magnaporthe grisea and the related 1,3,8-trihydroxynaphthalene reductase (3HNR) are typical members of the SDR family containing the canonical glycine rich NAD(P)-binding site and active site tetrad, and function in fungal melanin biosynthesis. This subgroup also includes an SDR from Norway spruce that may function to protect against both biotic and abitoic stress. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.4684e-110
NZ_CP011301.1\|WP_035975608.1\|310001_311321_-\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	1.65493e-37
NZ_CP011301.1\|WP_006767191.1\|284106_285252_-\|DUF2827-domain-containing-protein	gnl\|CDD\|371305	pfam10933, DUF2827, Protein of unknown function (DUF2827). This is a family of uncharacterized proteins found in Burkholderia.	3.50252e-172

>NZ_CP011301.1|WP_159101935.1|293728_293986_+|hypothetical-protein
MANAPVPFAVLFAPTVTAPVPVAELGSPIATAPSPLAVCWLPIATALPLSTADFDPIATEPGPAVAATVLLSPTATLDAASACEL
>NZ_CP011301.1|WP_081293700.1|288477_288663_-|YadA-C-terminal-domain-containing-protein
MIPDVDQGKTLALGIGGASFQGYGATAIGFTARITNNLKVRAGVGISSGGQSYGVGASYQW
>NZ_CP011301.1|WP_006767194.1|287694_288393_-|OmpA-family-protein
MSAKSLFILWATALLAACSSSQGPTWNAYRVGLPNGQQAYRVDCHGLFEGQQTCFSQAAEICGKKQVQPLEQVAPLGDEQNPRDVRILTFQCAAPPQSAPAVVAKPAPAPAAAVAAPAPAKRITLDSDANFDTDRATLKPDARDRLDVLIDAARGTTFQTVAIAGYTDSTGTAEHNQRLSERRAQAVAQYLREHGLRAQKFDVRGYGESNPVATNTTAAGRAKNRRVDITLE
>NZ_CP011301.1|WP_035975600.1|286387_287530_-|DUF2827-family-protein
MKIGISVLTHTGQSIWENGLGQNIFYFLQLLRELPFVTDIVLLNCGDQRSLPPEAEALAGDVPLVAPRELAELPDVIFEMGGGLDVEWLDYARARGKKVVFFCCGQPYVGLIEPSVFQRDGYFSRATRCDEIWILGKDRALMPMLRTLHRCPVFEVPFLWDSTFIEQRIQAVEQAGLRFGYEPRSARGETGPRGLRFAVFEPNISVVKCCVIPMLVGEAAFRADTNAVRSLHVLNSAHMRDHPSFSFMLGSMDLNRHERVRIDGRHDFAGFMSQNADAVIAHQWQNDQNILYLDALYGGYPLIHNSPWLSNLGYYYADSDIEAGAVQLLRAVQHHDTDHKYYTQRARSFLMSLAPRANANCSVYARRLLALTAENAGVPA
>NZ_CP011301.1|WP_006767192.1|285287_286391_-|DUF2827-domain-containing-protein
MSKLKVGVTIYLRNGQQSIWENGIFQNCYFLTMLLKHAPNVEAAYLVNGGDGDPAAAAQFLEFAPVPVIDLDTARQTLDVVIELSAQLNPDWARAFCDKGGRVIGMRVANDYVIDIERMMFALPHGMLVSGTPYSAIWTLPAFEKTCAGYYETALRAPVTAMQHLWSPALVERAANGAFGYRPGRPRWRVAVLEPNICMVKTSHIPMLVADLAHRQQPDLIEYLRVFNTMQLKGDAQFVGFARSLDLVVQGRATFEPRLPVHEILTQQADAIVSHTWENAQNYVYYEALHGGYPLVHNSDLLGGCGYRYADFDCEDGALALREAFAVHDACVDDYRASARAFLATLDPLARANVEQYSAAIAAVVNG
>NZ_CP011301.1|WP_006767191.1|284106_285252_-|DUF2827-domain-containing-protein
MKFPCGLRIGITIGLRHADESLWVNGIKQNALYLAMLFQSSPLCHDVVLVNTTDVPVTFALPWDLERFPTCTFEDAKDTLDVLIELGGQISNEQTAYLKACDTKIVSYCCGPEYVQMTEAMIFGRRLTDHVFINQNYDQVWVIPQVMETTAGFLGVLRRQKVVPVPFVWHPMCVEMRTKHLPFAGEYRPGKTAARVSIMEPNIDVLKFCLNPLLIAESAYRQVGDKLGFVHVTNAEHLARDCPEFIGIAHYLDLVRDNKVSFVGRHDTPQFLAEHTDIVVSHQWGLALNYFYFDVAWNGYALVHNAHLCKDIGYYYAESDIEAGARQLVRAIEHHNDDWEAYRERQRAAIRPFLATHEPLVARYDELLGELLAARDVPVAA
>NZ_CP011301.1|WP_105773888.1|283212_284076_-|peptidyl-prolyl-cis-trans-isomerase
MQAVRTPRIMRGALLALAAAALHAPIALAAKPSIESADAGDVVATVNGVAVHRAELDEAMIGRQESMRPQVLQGLVARELLRQAAERDGLGNTEPVRAAMRKARIDTENRLYIARHVSTEPVTDTDVRRRYDEIAGQFGPYQYQVSRMTFTDEPTARFALALLGSGESFANVAARTHATDVQTDWISFKTPPAEGRTQGLPLPLAQTIAAMNAGDITHTPVRAGDRFIVARLDDRRDAVVPSFAQASGAMRNALERKRADDAFAALIAQLAQKAAIRPAQLMKDGSK
>NZ_CP011301.1|WP_006767189.1|281392_283216_-|tetratricopeptide-repeat-protein
MKWLADVETRITRSDLIGASRLLDTGRAIKSGKPRALVACGRLMTLRGRLGEAQDLFDRALDIEPDNVDALIERARLSIRVGDDADACTWFHRIGFRETHGDSWLIDWFDASLRCGRIEDAIAIATGLCRHFAADAGNWFRLGLAQQAARRHAQALDAYRHAASMNPRLPMLRNNWGAAYLELGRHDEARQLLEATLAEDPDHAFAWTNLASVLLKTGKIDDGLVAAERACALAPNYVTALQTYSYVLREHRQFDAALEVAQRALGIEPHNPSIVWTVAMLQLLLGDYENGWRNHEARWAGSPELRDVSPNLPAPRWNGEPLAGKTLFVWGEQGNGDALQFVRFVPAIADYVTRQGGKLVYCCFSSLHALFVRSLGTAVETIVAHDRRPLPAFDFHLPVGSLPLVLGVRLDELPSAPYLAADPAKVAASRAALADGRKLRVGITWSGSKTHQRNPLRSVDPMDYVRAFAGVGDMTFVNLQMDAERDVLRLQTAGLPLVDPTPELSSFDDTAALVGSLDLVITVCTSIAHLAGGLGIPTWVLLDANPHWIWMSERNDSPWYPNTRLYRQPAYGEWAPVFEALARDLAVLAFNRETQDQMTTNATGSLH
>NZ_CP011301.1|WP_035975599.1|280409_281396_-|hypothetical-protein
MKRINLPTALGACVDDVVREKIAHKVGLPASAIEQVFSRAGSIVVAALAVRASEGRDETIAVFGALMSRDINPRIRDECTTLVDSTGKLKELEHAGFTLVAHATGNDATELSDYVASEVGVPAQATCALTCICAAIVGGIVKHHVLIEQGDVSELPGLFAAQLPSISGHLNDGAIDVLGYLHADVNGFLDNVAVRLTSVAGEFEPPRPRVSERAEPAQRQPPQPQIPAHNRYEIGKVFVNDIRFTSAMQPSTFGPMKREQPRSRRTWKVFALTTTAVLIAVLASTKVYRWPDVRSALAQMTTSTTAQSRSDTLVSGVISPGAATTAGK
>NZ_CP011301.1|WP_052688638.1|279611_279935_-|cupin-domain-containing-protein
MVTPEMFDRAHIDDIEEFEAAPGIFVKMVHHTDEGVMVRVIRFAPGAVLPVEDIHDLGLEIVYVLDGTLTDNAGSYPAGSILYGKKGSSHIPASPEGCTVFSINFVD
>NZ_CP011301.1|WP_123806782.1|298630_299032_-|hypothetical-protein
MNRRRNDPAADLRSASRSFLSADGFVIGPASRRAGQFEEVTACRADGGDSMAPTGVVQRPTDIGGSIGTCQGQWNCSGVAAIREPPCDRSLASVGHAGIDLFSSEMLGKLSGDPGFCNAAVCSAYQNNHRIPG
>NZ_CP011301.1|WP_035975603.1|299179_299446_+|hypothetical-protein
MNKFQLKPRLSADESTPGNPMDFMVGAALVQSQAAKARPEKPIRLNLDITPSVHRLLKLYALENGMSVSEVVRTLIDQLVRPEHRQQR
>NZ_CP011301.1|WP_123806781.1|299976_300378_+|hypothetical-protein
MSTAKTQKLRNATAPAKRAKGSTSKASTANRDLFGHDGNTGSESAPATKRGRAEPATKRTTASRASTAQKPAKSAPRSVANTGSVRINFDLERVVHKRLKMLAVEADMTIADWMRQLIQKALEHIDKTERRGR
>NZ_CP011301.1|WP_035975605.1|301438_304147_+|NAD-dependent-epimerase/dehydratase-family-protein
MTHFIDFEADELSGDEWSASFDLIVVGGGAAGLTIIRELSGIGLKILLLESGDVEESAEHEALNDVDVDGSLEDAALQRSRHASHAFQLKYWRAQTQKFGVRCRVLGGSTAGWAGKVAPFDPLDFAAREWIPDSGWPIADTDIAPYVERAARRLDVGPIVGGQAFWHAAKLREPAEMARMRHVSSFFWQLARSHRNLTDVMRFGPDFRSESHPGVTVVLNATACAIHADAAGVTGVEIVSSLSGKRRRVLASRHVVLAAGAIENARLLLMSRDADGRALGNAHDVVGRYLTDHPCMSIGTFSPDSQASAAALLGFFSLQRDYRAFMYSHGLALRPEVQQQRRLPNMAAYANARISDDDPVVALKRLAKRQSKRPLADLLLVLQRSGVVVSFVGRRIVGSSILPRRLRRLIVDTVIRLDANFVARDYVAKGTGRKIEKVTLDVICEQPPLRDNRVTLSSRCDRLGLPVAHVTWEPGSLMKEAVVTFAQLLESDLREAGIRGFELRRDISAGDVSGIALHDMAHTAGTTRMGRDPATSVVDANCRVHDVDGLYVAGASVFPTSGHANPTMVIMALAIRLADHLKSRLVERRIAALKPPVATDDARPLVLVTGATGNLGADVVGQLIRHGYRVRGQFHRKVPSDSRVEWVAVDFSDANLADAALDRLVDGVAAVVHLAGGLPGTPHLETINVTNLKRLADACVRNGVGYFGHASSMVVYGSPCRRLVDENAPLLDVSRPIERQYFESPQMREYARSKRIGEDVLSRYAERMHVDLYRIALAQQPGYLEASLQWNRTKRLFALYRNSHYISPRNVARAIVHLLRRSLDRGARSGIEAFNIADTASPTYEEVYRRAGRKPLVHVPLLADVVKSVAVGKRVAKRFPMGFYRLDDRKLRSTGFMLDRDS
>NZ_CP011301.1|WP_006767198.1|304371_305112_-|SDR-family-oxidoreductase
MSESSGKIAIVTGSSRGIGADIAVRLAHDGFKVVVNYASNAAPAEEVAARIREGGGDALLVKADIADPAATIALFDATEKAYGGVDVVVNSAGVMHQARLAEFDDATFDRTVAINFKGAFNVSREAARRVRDGGRIMNLTTSVTGVRLPTYAVYIATKCAVEGLTQVLAQELRGRGISVNAVAPGPVATELFLAGKSAELIDRMAKMNPLERLGQPADISAVVAFLASPEGAWINGQVVRANGGMC
>NZ_CP011301.1|WP_006767199.1|305255_306161_-|SDR-family-oxidoreductase
MSKVILVTGASSGFGRLTAEALAHAGHTVYASMRDTGARNAPVVEQMRALARDAHVDLRPLELDVQSDASIDRAVEQLVAQAGRIDVLIHNAGHMAFGPAEAFTPEQYAQLYDINVLSTQRVNRAVLPHLRAQRQGLLIWVSSSSAAGGTPPYLAPYFGAKAAMDAIAVLYARELSRWGIETSIVVPGAFTQGTNHFAHASAPADAARAAEYDAGPYPDFGREVQDAFAAIVPADAHASLVADAIVDVVAAPAGKRPFRVHIDPTEDGANVGFAVLDRLRAEMLHRVGLSDLLSPRIRTSD
>NZ_CP011301.1|WP_081293523.1|306206_307319_-|HoxN/HupN/NixA-family-nickel/cobalt-transporter
MLARRHLPPATGVAPAAHARVRSIDLSALWIVAFIVLLHVVGWGTLIALIVPQHLSVGSRAFGIGAGITAYSLGMRHAFDADHIAAIDNTTRKLLGEGQRSASVGFWFSFGHSSVVFGLAVLISLGMHSVSTHVVDAGSTLRALTSVLGATVSSVFLYAIAALNVAAFYDLYRAFRAMRTGRFDEAQLERRLESRGIVARVLAPLMRIVRKPAQMYFVGLLFGLGFDTATEIALLVLTGSGAASGLPWYAILCLPVLFAAGMLLFDTIDGSFMHVAYGWALARPVRKIYYNLVVTGLSIGVALVIGTIEMLGLLNHALGMHGAFGAWLSALDLNDVGFAIVGLFVATWAISVAIWKFGRIEQRWAAGPDA
>NZ_CP011301.1|WP_035975606.1|307391_308507_-|DUF4331-family-protein
MSYANVHLRDRPNGTSRPTQPPFGQDRTMSHHLDSPLARQDIRLDITDLYCFRGEIGTVLVINVCHSIAGDVPTPGYHPEGFYEFKLDLDGDAIEDVTYRIRFDARDAAGVQRFELRRIAGAAATDPHADGELVLRGRTDETAGAGSGVRVWAGKAGDPFWIEPDVLHAVGHAFQDGTPLDLGTWEPSHARNLFAGHTVYSIVLEVPDADLVGNAATNRKVGVWAVATLATDAGGWRSINRVGLPMIHPLFTQYNEDLGDRLNAGCPADDFATYGETVIASVAGAVRANGTAEDPVGYATAVAHRFLPNVLPYTIGTPAVFGMAEWNGRSLTDNAPDVMFTIASNTPIRLGIGKESVTSKPTSTFPYVPKA
>NZ_CP011301.1|WP_035975607.1|308688_310005_-|MFS-transporter
MKREPVVPDADVAPAIAGHTDRRTPERRILATIVIANALEFFDYFSYAVFAAFITRTFFPHVADGYGTLLSLGTFAAGFLSRPIGALAIGVHADAAGRKPALLLTAALVTAGSFGLAVIPGYATLGIAAPIAVLLCRILQGIAIGGEMGASGALLIERCPPDRKCTYAGWLMAGQGLALVAAGACGVALHATLSAAQIERWGWRVPFALAAALIPVQIYLRRHIDETWEARRATLAFGALLGRHRGRWLLAIALIFGGTVPTYVATYATTFGVAGPPPSAYASFVTTAAVGAVTLVLSIAGGCAADRIGRIRTIVLARALTMAVVLPAFYYAAVHPHPLALLGVVALFAGLSALAGAPSIVAILDMFPARGRAAALSVVYATGVALFGGTAPFVVASVGVWAGTHRAAGWYVFVSAAVTLIAIAAARAAGEPTSTARR
>NZ_CP011301.1|WP_035975608.1|310001_311321_-|HAMP-domain-containing-histidine-kinase
MNEPHAATGSIRDRETRAADDRAAADDARVDALFRSAPIPILIEDWSGIKRWIDTLKARGVTDLEAYLDAHPDVIDEVRRLHAFVDANDATLALFDAQSKDAFFAAAQRLLPASRLSNSQVLHAMFEGRSSCQGERTLATLSGRKVPIVWRCALPADDDAYRRLHFYAFDVTEYKENSERLDALRAQLARTARASMMGQLVASITHEIGQPLGAIRTALDAAVRWLDRAEPNVAEATAAFRHASRWTDDMANICRRLRGFLAGAPVEAVALDCAEVVASAMQLIASEAGTHGIALGSEVAPGTTAHADRIQLQQVLTNLLINGIHAIDATRDDGRERRLHVRAGRYDDTHTLFEVADTGCGIASTPPDAIFQPFSSTKRDGMGMGLPISKSIVEAHGGAIWIGDTGAHGTRFCFTLPSAPRANGSTADAAQRDRRQGAQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP011301_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011301_2

1436545-1436729

Orphan

Consensus_repeat	Method
CGAAGCCGAAGCCGAAGCCGATGGCGATG	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP011301_2

>merge|NZ_CP011301|2|1436545-1436729|CRISPRCasFinder
CGGCGCGGAAGCCGGTGCCGAAGGCCCCGACGGCGCGGCGGCGGGCGGCGACTGTGTCGATTCTGCCGATGGCGAAGCCGAAGCCGAAGCCGATGGCGATGCCGAAGCCGAAGCCGAAGCCGAAGCCGAAGCCGAAGCCGAAGCCGATGGCGATGGCGATGGCGATGGCGATGGCGATGGCGATG

>NZ_CP011301|2|2|1436545-1436729|CRISPRCasFinder
CGGCGCGGAAGCCGGTGCCGAAGGCCCCG	ACGGCGCGGCGGCGGGCGGCGACTGTGTCGA
TTCTGCCGATGGCGAAGCCGAAGCCGAAG	CCGATGGCGATGCCGAAGC
CGAAGCCGAAGCCGAAGCCGAAGCCGAAG	CCGAAGCCGATGGCGATGG
CGATGGCGATGGCGATGGCGATGGCGATG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011301.1\|WP_006763267.1\|1434654_1435725_-\|homocysteine-S-methyltransferase-family-protein	unknown	unknown	gnl\|CDD\|236539
NZ_CP011301.1\|WP_035973257.1\|1423266_1424916_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NZ_CP011301.1\|WP_006763266.1\|1431893_1434611_-\|methionine-synthase	unknown	unknown	gnl\|CDD\|236539
NZ_CP011301.1\|WP_006763264.1\|1429500_1431282_-\|arginine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234964
NZ_CP011301.1\|WP_035971638.1\|1438031_1438898_-\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
NZ_CP011301.1\|WP_035971637.1\|1431482_1431806_+\|DUF1840-domain-containing-protein	unknown	unknown	gnl\|CDD\|378087
NZ_CP011301.1\|WP_035971639.1\|1441131_1441917_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237030
NZ_CP011301.1\|WP_035971640.1\|1441941_1443168_+\|patatin-like-phospholipase-family-protein	unknown	unknown	gnl\|CDD\|132848
NZ_CP011301.1\|WP_006763272.1\|1440227_1441055_+\|enoyl-CoA-hydratase/isomerase-family-protein	unknown	unknown	gnl\|CDD\|235991
NZ_CP011301.1\|WP_006763274.1\|1444684_1445161_+\|D-glycero-beta-D-manno-heptose-1-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|131254
NZ_CP011301.1\|WP_006763261.1\|1427021_1427795_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235910
NZ_CP011301.1\|WP_006763262.1\|1427814_1428453_-\|thiol:disulfide-interchange-protein-DsbA/DsbL	unknown	unknown	gnl\|CDD\|239317
NZ_CP011301.1\|WP_006763273.1\|1443643_1444525_+\|ferritin-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|153097
NZ_CP011301.1\|WP_035971634.1\|1425106_1426702_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173858
NZ_CP011301.1\|WP_035971641.1\|1445941_1446184_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011301.1\|WP_035971643.1\|1447297_1448218_-\|biotin--[acetyl-CoA-carboxylase]-ligase	unknown	unknown	gnl\|CDD\|235896
NZ_CP011301.1\|WP_035971642.1\|1446512_1447301_-\|type-III-pantothenate-kinase	unknown	unknown	gnl\|CDD\|237352
NZ_CP011301.1\|WP_035971636.1\|1428522_1429383_-\|SPOR-domain-containing-protein	unknown	unknown	gnl\|CDD\|225629
NZ_CP011301.1\|WP_006763271.1\|1439025_1440018_+\|fumarylacetoacetate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|223257
NZ_CP011301.1\|WP_009693455.1\|1436041_1436299_-\|DUF3567-domain-containing-protein	unknown	unknown	gnl\|CDD\|378810

Protein	Function_ID	Function_description	E-value
NZ_CP011301.1\|WP_006763267.1\|1434654_1435725_-\|homocysteine-S-methyltransferase-family-protein	gnl\|CDD\|236539	PRK09490, metH, B12-dependent methionine synthase; Provisional.	0
NZ_CP011301.1\|WP_035973257.1\|1423266_1424916_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	9.9781e-111
NZ_CP011301.1\|WP_006763266.1\|1431893_1434611_-\|methionine-synthase	gnl\|CDD\|236539	PRK09490, metH, B12-dependent methionine synthase; Provisional.	0
NZ_CP011301.1\|WP_006763264.1\|1429500_1431282_-\|arginine--tRNA-ligase	gnl\|CDD\|234964	PRK01611, argS, arginyl-tRNA synthetase; Reviewed.	0
NZ_CP011301.1\|WP_035971638.1\|1438031_1438898_-\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	8.37601e-52
NZ_CP011301.1\|WP_035971637.1\|1431482_1431806_+\|DUF1840-domain-containing-protein	gnl\|CDD\|378087	pfam08895, DUF1840, Domain of unknown function (DUF1840). This family of proteins are functionally uncharacterized.	1.45778e-34
NZ_CP011301.1\|WP_035971639.1\|1441131_1441917_+\|hypothetical-protein	gnl\|CDD\|237030	PRK12270, kgd, multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.	5.3402e-07
NZ_CP011301.1\|WP_035971640.1\|1441941_1443168_+\|patatin-like-phospholipase-family-protein	gnl\|CDD\|132848	cd07209, Pat_hypo_Ecoli_Z1214_like, Hypothetical patatin similar to Z1214 protein of Escherichia coli. Patatin-like phospholipase similar to Z1214 protein of Escherichia coli. This family predominantly consists of bacterial patatin glycoproteins and some representatives from eukaryotes and archaea. The patatin protein accounts for up to 40% of the total soluble protein in potato tubers. Patatin is a storage protein, but it also has the enzymatic activity of a lipid acyl hydrolase, catalyzing the cleavage of fatty acids from membrane lipids. Members of this family have also been found in vertebrates.	1.30202e-32
NZ_CP011301.1\|WP_006763272.1\|1440227_1441055_+\|enoyl-CoA-hydratase/isomerase-family-protein	gnl\|CDD\|235991	PRK07327, PRK07327, enoyl-CoA hydratase/isomerase family protein.	0
NZ_CP011301.1\|WP_006763274.1\|1444684_1445161_+\|D-glycero-beta-D-manno-heptose-1-phosphate-adenylyltransferase	gnl\|CDD\|131254	TIGR02199, rfaE_dom_II, rfaE bifunctional protein, domain II. RfaE is a protein involved in the biosynthesis of ADP-L-glycero-D-manno-heptose, a precursor for LPS inner core biosynthesis. RfaE is a bifunctional protein in E. coli, and separate proteins in some other genome. Domain I (TIGR02198) is suggested to act in D-glycero-D-manno-heptose 1-phosphate biosynthesis, while domain II (this family) adds ADP to yield ADP-D-glycero-D-manno-heptose. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	1.38751e-74
NZ_CP011301.1\|WP_006763261.1\|1427021_1427795_-\|SDR-family-oxidoreductase	gnl\|CDD\|235910	PRK07024, PRK07024, SDR family oxidoreductase.	6.75886e-154
NZ_CP011301.1\|WP_006763262.1\|1427814_1428453_-\|thiol:disulfide-interchange-protein-DsbA/DsbL	gnl\|CDD\|239317	cd03019, DsbA_DsbA, DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold. It is involved in the oxidative protein folding pathway in prokaryotes, and is the strongest thiol oxidant known, due to the unusual stability of the thiolate anion form of the first cysteine in the CXXC motif. The highly unstable oxidized form of DsbA directly donates disulfide bonds to reduced proteins secreted into the bacterial periplasm. This rapid and unidirectional process helps to catalyze the folding of newly-synthesized polypeptides. To regain catalytic activity, reduced DsbA is then reoxidized by the membrane protein DsbB, which generates its disulfides from oxidized quinones, which in turn are reoxidized by the electron transport chain.	6.89939e-73
NZ_CP011301.1\|WP_006763273.1\|1443643_1444525_+\|ferritin-like-domain-containing-protein	gnl\|CDD\|153097	cd00657, Ferritin_like, Ferritin-like superfamily of diiron-containing four-helix-bundle proteins. Ferritin-like, diiron-carboxylate proteins participate in a range of functions including iron regulation, mono-oxygenation, and reactive radical production. These proteins are characterized by the fact that they catalyze dioxygen-dependent oxidation-hydroxylation reactions within diiron centers; one exception is manganese catalase, which catalyzes peroxide-dependent oxidation-reduction within a dimanganese center. Diiron-carboxylate proteins are further characterized by the presence of duplicate metal ligands, glutamates and histidines (ExxH) and two additional glutamates within a four-helix bundle. Outside of these conserved residues there is little obvious homology. Members include bacterioferritin, ferritin, rubrerythrin, aromatic and alkene monooxygenase hydroxylases (AAMH), ribonucleotide reductase R2 (RNRR2), acyl-ACP-desaturases (Acyl_ACP_Desat), manganese (Mn) catalases, demethoxyubiquinone hydroxylases (DMQH), DNA protecting proteins (DPS), and ubiquinol oxidases (AOX), and the aerobic cyclase system, Fe-containing subunit (ACSF).	0.0061599
NZ_CP011301.1\|WP_035971634.1\|1425106_1426702_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173858	cd08493, PBP2_DppA_like, The substrate-binding component of an ABC-type dipeptide import system contains the type 2 periplasmic binding fold. This family represents the substrate-binding domain of an ATP-binding cassette (ABC)-type dipeptide import system. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP011301.1\|WP_035971643.1\|1447297_1448218_-\|biotin--[acetyl-CoA-carboxylase]-ligase	gnl\|CDD\|235896	PRK06955, PRK06955, biotin--[acetyl-CoA-carboxylase] ligase.	6.48601e-138
NZ_CP011301.1\|WP_035971642.1\|1446512_1447301_-\|type-III-pantothenate-kinase	gnl\|CDD\|237352	PRK13328, PRK13328, type III pantothenate kinase.	7.84449e-118
NZ_CP011301.1\|WP_035971636.1\|1428522_1429383_-\|SPOR-domain-containing-protein	gnl\|CDD\|225629	COG3087, FtsN, Cell division protein [Cell division and chromosome partitioning].	1.31984e-20
NZ_CP011301.1\|WP_006763271.1\|1439025_1440018_+\|fumarylacetoacetate-hydrolase-family-protein	gnl\|CDD\|223257	COG0179, MhpD, 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) [Secondary metabolites biosynthesis, transport, and catabolism].	2.33421e-57
NZ_CP011301.1\|WP_009693455.1\|1436041_1436299_-\|DUF3567-domain-containing-protein	gnl\|CDD\|378810	pfam12091, DUF3567, Protein of unknown function (DUF3567). This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are about 90 amino acids in length. This protein has a conserved EIVDK sequence motif.	1.65512e-47

>NZ_CP011301.1|WP_009693455.1|1436041_1436299_-|DUF3567-domain-containing-protein
MQMIYNSPNYCVVEFAPQAGHHLMNAGGYEIVDKNAQREIFIDGELAERFRAHVKQLIEEEPSLDEVDEFLGQFDSLMMMPVVLH
>NZ_CP011301.1|WP_006763267.1|1434654_1435725_-|homocysteine-S-methyltransferase-family-protein
MSATPSAASAAPLDAHYTRGAELPALLNSRILILDGAMGTMIQRYKLDEAAYRGERFKDFPRDVKGNNELLSITQPQVIREIHDQYFAAGADIVETNTFGATSVAQADYGMEDLVVEMNVASAKLARESAAKYATPDKPRFVAGAIGPTPKTASISPDVNDPGARNVTFDELRDAYYTQAKALLDGGVDLFLVETIFDTLNAKAALFALDQLFEDTGERLPIMISGTVTDASGRILSGQTVEAFWNSLRHAKPLTFGLNCALGAALMRPYIAELAKLCDTYVSCYPNAGLPNPMADTGFDETPDVTSGLLKEFAQAGLVNLAGGCCGTTPEHIAEIAKALADVKPRRWPSQYSEAA
>NZ_CP011301.1|WP_006763266.1|1431893_1434611_-|methionine-synthase
MTDHMMRLAGLEPFNVTPGTLFINVGERTNVTGSKAFARMILNGQFDEALAVARQQVENGAQVIDVNMDEAMLDSKAAMVRFLNLIASEPDIARVPIMIDSSKWDVIEAGLKCVQGKAIVNSISLKEGEEAFRHHAKLIRRYGAAAVVMAFDEQGQADTFARKTEICKRSYDFLVNEVGFPPEDIIFDPNIFAVATGIEEHNNYAVDFIEATRWIKQNLPYAKVSGGVSNVSFSFRGNDPVREAIHTVFLYHAIQAGMDMGIVNAGQLGVYAELDPELRERVEDVILNRRPDSTDRLLEIADKFKTGAAKKEENLEWRNQPVEKRLAHALVHGITNFIVEDTEEARVKIAAAGGRPINVIEGPLMDGMNIVGDLFGQGKMFLPQVVKSARVMKQAVAHLIPFIEEEKRLLAEAGGDVRAKGKIVIATVKGDVHDIGKNIVSVVLQCNNFEVVNMGVMVPCNEILAKAKVEGADIVGLSGLITPSLEEMAYVASEMQRDDYFRVKKIPLLIGGATTSRVHTAVKIAPNYEGPVVYVPDASRSVSVASSLLSDEGAAKYLDELKADYERIRDQHANRKAQPMVTLAEARANKTKIDWANYTPVKPKFIGRRVFRNYDLNELANYIDWGPFFQTWDLAGPYPAILNDEIVGESARRVFSDAKSMLARLIQGRWLTANGVIALLPANTVNDDDIEIYTDDSRSEVLLTWRNLRQQSVRPVVDGVMRPNRSLADFIAPKASGVADYIGMFAVTAGLGVDAKEKQFEADHDDYSAIMLKALADRFAEAFAEAMHARVRRELWGYASGETLDNDALIAEKYTGIRPAPGYPACPDHLVKRDMFAALQADEIGMSVTDSLAMLPAASVSGFYLAHPDSRYFSVGKIGQDQLEDYAQRMALSLDDARRALAPQL
>NZ_CP011301.1|WP_035971637.1|1431482_1431806_+|DUF1840-domain-containing-protein
MITFKSKAAQDLDVLKDFAVYVLGLVGKQLGERGVITHEELDHAIAKLEDAVAQAKQERAEHAGHYHEDEADHAHHEVPPSLAQRVAPFLTMLREAKAAQADVHWGF
>NZ_CP011301.1|WP_006763264.1|1429500_1431282_-|arginine--tRNA-ligase
MLPAHKQTLEALLADSVKQVAHALKGADAAFVPPAITLERPKVAAHGDVACNVAMQLAKPLGTNPRQLAEQIVAAVNAHPAAQGLVEAAEIAGPGFINLRLTAAAKQAVIGAVFAQGSAFGTSDREKGKRVLLEFVSANPTGPLHVGHGRQAALGDVLANVIASQGYAVHREFYYNDAGVQIGNLAISTQARARGLKPGDAGWPEAAYNGEYIADIARDYMNCETVAAKDGEPVKGAGDVDDLDAIRKFAVAYLRHEQDMDLQAFGVKFDQYYLESSLYSEGRVEKTVDALIKAGMTYEQDGALWLRTTDEGDDKDRVMRKSDGTYTYFVPDVAYHVTKWERGFTKVINIQGSDHHGTIARVRAGLQGLHIGIPKGYPDYVLHKMVTVMRDGQEVKISKRAGSYVTVRDLIEWSGGAAPGQEAAPDLIDEATITRGRDAVRFFLISRKADTEFVFDIDLALKQNDENPVYYVQYAHARICSVLNEWQSRYNGDLAQLPHADLSQLTSAQAASLMQKLAEYPDMLTHAANELAPHAVAFYLRDLAGEFHSFYNAERVLVDDEAPRNARAALLAATRQVLANGLAMLGVSAPAKM
>NZ_CP011301.1|WP_035971636.1|1428522_1429383_-|SPOR-domain-containing-protein
MAQPRRTSKQSKQAGGTFLGIVLGLIVGLAIAVVVALYITRSPSPFVSKVAPPSADNGASQPQQFDPNRALQGKTPGQPVPQAAQPAPPNTAPGQAANQTQGGLLPEPQIVEVPPSASSAGSTSASNNASNNGVAVAPKPAENTPPKKTQPPAGEDDLARFAAQKQAQQQAAAQKQQQQQQQAANASKPTSSATAAAAAKPPSANDANTGYFLQVGAYKTEGDAEQQRARLGFQGFESKVSKRDVSGVTYYRVRVGPFSKFEDMNSARQRLSDAGVDTAVIRFTKQ
>NZ_CP011301.1|WP_006763262.1|1427814_1428453_-|thiol:disulfide-interchange-protein-DsbA/DsbL
MKKLLSTLLLSLGLVAGLAHATPAAPVAGKDFEVMKSPQPVSAPAGKVEVIEFFWYGCPHCYEFEPTIEAWVKKQGSNIDFKRVPVAFRDDFVPHSKLFYAVSALGIAEKVTPAIFNAIHKQKNYLLTPQAQADFLATQGVDKKQFMDAYNSFSVQSQVKQSAELLKNYAIDGVPTIVVQGKYKTGPAYTNSIPGTAQVLDYLVKQVQDKKL
>NZ_CP011301.1|WP_006763261.1|1427021_1427795_-|SDR-family-oxidoreductase
MTAPLKVFITGASSGLGLAIADEYARQGATLALVARRVDALEAFARRFPKLSISIYAADVRDADALATAAASFIAAHGCPDVVIANAGISQGAVTGQGDLATFRDVMDVNYYGMVATFEPFVGPMTAARHGTLVGIASVAGVRGLPGSGAYSASKSAAIKYLEALRVELRPAGVGVVTIAPGYIRTPMTEHNPYRMPFLMDADRFAAHAARAIARQHAFRVIPWQMGIVAKVLHVLPRWLYDRLFEKAPRKPKAGTH
>NZ_CP011301.1|WP_035971634.1|1425106_1426702_-|ABC-transporter-substrate-binding-protein
MHVKLFAAAAIAAALAAPGVVAAKPLTVCTESSPDGFDVVQYNSLVTTNASADVIFNSLVSYDEAAKKVVPALADKWEASADGLTYTFHLRPNVAFQTTDYFKPSRPLNADDVVFTFSRMLDDSNPWHKVAGASGFPHAQSMGLTKLVKSVTKVDDSTVKFVLNEPNATFVPILTMGFASIYSAEYADQLLKAGKQADLNAKPIGTGPFVLKSYTKDALIRYDVNPTYWGPKPKIDRLIYAITPDPSVRMQKVKAGECQIALSPKPQDVLAAKGESALKVVQTPAFMTAFVALNTQKKPLDNDKVREALNLAFDRATYLKVVFDNTATAANNPYPPNTWSYAKDVAPYPYDPAKAKQLLASAGFPNGFSTTIWTRPTGSVLNPNPKAGAELLQADLAKIGVKADVKVIEWGELIKQAKLGQHDMLFMGWAGDNGDPDNYLTPLFSCNAVKSGINFARFCDAQLDKLIADGKTTADQAKRAKLYEAAQKIIHDEALWIPLGYPTAAALTRANVSGYRVSPFGRQNFTTVAVQ
>NZ_CP011301.1|WP_035973257.1|1423266_1424916_-|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MAAATPTGALVALHHVSFRFDDGFTLFDSLDLVVDRVPTGIVGRNGAGKSVLAQLIAGRCAPSSGAIDRQTSVAYVAQQHADMPAGSQSVAAIAELDVPLAALARLAQGEADAHDFDSIGERWDLAERLRAALDAAGLHDVQPDAAADTLSGGQLARVALIGALLSGAGLLVLDEPTNHLDAPGRAWLRAALDGWRGGLVVVSHDRALLGSLQRIVEVTPHGVRSYGGNYALYRAQRDAEDAAAQAALDHARAGRSREKKRLEREHDTIQRHAAGSLRDAKTANLSSMARQSRKGAARSIMGTVRRHHGELKATLDERVHEAAARVDAGAPVLVSLPGTEVSARRQLFTLECAQPPWPADADAPPITWSASGAVRIALTGPNGCGKSTLLRMLAGELAPRAGECRTHVSAAYLDQRLALLDRDRSIVEQLGLLDTPLAEGELRSRLALLQLDASRATQPVHRLSGGERLKAALACALWRGTPAQLLLLDEPTNHLDLESVRAIEAALTGFPGAIVVASHDAAFLAALDPTHTMQWHRDGWRYEPVASLA
>NZ_CP011301.1|WP_035971638.1|1438031_1438898_-|IclR-family-transcriptional-regulator
MPASPPPDDDLVDPDTDDAASGDNGEKVRSGIQSIEVGFRLLDVLTSEPRAMMLRDLAQRAGMSPAKAHRYLVSFSRLGVVSQDPVSGRYELGGFALQMGLARLARVDGVKLARIALTEFRDRLDQTVGIAVWGNQGPTIVHWMESSHPAKASLKLGDVMPLLGSATGLLFAAYLPRSKTAAMIERELADTRRSPHHGGPRTLEEVEAVLADVRKHQAARVEGMLLPTIHAFCMPVFDAVGELALAIVALGQEGTFDIAWGGEIDTALRACAQKLSYELGYSSDARDA
>NZ_CP011301.1|WP_006763271.1|1439025_1440018_+|fumarylacetoacetate-hydrolase-family-protein
MKLASLKDGTRDGQLIVVSRDLHTAAIADAIAPTLQRVLDDWAFYAPQLRELYDALNHGRARNAFAFDAANCMAPLPRAFQWADGSAYVNHVELVRRARGAEMPPEFWTDPLMYQGGSDDFLGARDDIVCPSEAWGIDFEAEVAVITGDVPMSTSPDDALKAVRLVTLVNDVSLRNLIPAELAKGFGFFQSKPATAFAPVAVTPDELGDAWHDGRMHRPMIVHWNGKKVGQPDAGTDMVFHFGQLIAHAAKTRNLRAGSIVGSGTVSNKDAKRGYCCIAEKRCLETIEHGAPQTEFMRYGDTVRIEMFDAAGKSIFGAIEQSVAPPDGAA
>NZ_CP011301.1|WP_006763272.1|1440227_1441055_+|enoyl-CoA-hydratase/isomerase-family-protein
MADLAAYGSYEALKVTRRDHGVLDIVMSGEGANRSGLATADARMHRELADIWRDVDRDPDTRVAVIRGEGKGFSAGGDLALVEQMANDFDVRARVWREARDLVYNVINCSKPIVSAMHGPAVGAGLVAGLLADISIAAKDARIIDGHTRLGVAAGDHAAIVWPLLCGMAKAKYYLLLCEPVSGDEAERIGLVSLAVEPADLLPKAYEVAERLANGSQTAIRWTKYALNNWLRTAGPAFDTSLALEFMGFSGPDVHEGVRSLRERRPPDFRGDAPF
>NZ_CP011301.1|WP_035971639.1|1441131_1441917_+|hypothetical-protein
MTTDASGSNPFAGFAGFQPADMLDRMWEMMRMSPFGAMAPFPGAPAGLPPSLSAMSDMMAPLTSVEELDKRITDLRAVEQWLKLNLGMLQSAIQALEVQRATLATLRAFGAFAQSSMSAAEDAATAAAKAASAPLGEAPRQPDAAASAAAASATSGGDAAGSDASPEGGAAPQAFDPAGWWNLLQAQFNQLASLAMAQPGMQPAASGDGAAGAAAPPPEQPTPAAAAPRKPAAKRAKPAGSAAARAAAASSPETRPPKRST
>NZ_CP011301.1|WP_035971640.1|1441941_1443168_+|patatin-like-phospholipase-family-protein
MRLALVLMGGGARAAYQVGVLKALAEIAREADPQRHTLPFAVVCGSSAGAINATSIASHADDFSHGVRRLLEFWEHLRADYVYRTDWLGIAAAGARWLATMTFGWAARRSPRGLLDNTPLAHLLQRELSFHRIEQMLEARLLHALAVTALSYSSGRHLTFYQAAEPIQAWRRAQRTARLVDLSASHLLASSAIPFVFPAVPLVLDGQIEYFGDGSIRQIAPLSPAIHFGADCIVVVGAADPRPEIPAANGAGLVRGYPTLAQIGQQVLASVFLDSIGSDIERIEHINRMIEHLPHQVEVDSGWRHVDVLAIAPSERIELIAAKHLKQMPATMRGLLGAVGGSQPAGASFASYLLFEEAFTRELIELGYRDGRAQRDTLADWIARADGGGATAAGGVSDDGRTAGQIRV
>NZ_CP011301.1|WP_006763273.1|1443643_1444525_+|ferritin-like-domain-containing-protein
MNTMLYPELYKSLEAVRWDMEKDIPWDKFDASLLTDEQARTIKMNAITEWSALPATEMFLRDNQHDSDFSAFMSVWFFEEQKHSLVLMEYLRRFKPELVPTEEELHAVRFEFDPAPPLETLMLHFCGEIRLNHWYRCAADWHTEPVIKHIYETISRDEARHGGAYLRYMKKALNNCGDVARAAFAKIGVLMASARRTEKPLHPTNLHVNQALFPRDTVQSRLPDPEWLERWLDEQIRFDGEWEKKVVERILHNLSILFERTFATAQELNRYRKEVTSRLQATEGGPSSAAQPA
>NZ_CP011301.1|WP_006763274.1|1444684_1445161_+|D-glycero-beta-D-manno-heptose-1-phosphate-adenylyltransferase
MPATFERKLISRDALVAMRASLPSPVVFTNGVFDILHRGHVTYLADAKALGACLIVGVNSDASVRMLGKGDDRPINGEDDRMALLAALESADWVVKFEEKTPVSLIEAVRPDILVKGGDYDMDALPESAIVRGWGGRALAIPFEHDRSTTALLRKVRG
>NZ_CP011301.1|WP_035971641.1|1445941_1446184_-|hypothetical-protein
MLRWLIAILFLANLLAFVAARGVFGPLPAAGARDPDVLSRQVRPDALHATPLAQPTDQPLVGGPIAPPAVAAEPLAASAQ
>NZ_CP011301.1|WP_035971642.1|1446512_1447301_-|type-III-pantothenate-kinase
MSVTDLLIDAGNSRIKWALADAQRALVDTGTFGHVRDGGADPDWSTLPRPRSAWISNVAGADVAARLDALLDARWPGLPRTTIRARDAQCGVTNGYTLPEQLGSDRWAGLIGAHAAFPGEHLLIATFGTATTLEALRADGRFTGGLIAPGWALMMRSLGTHTAQLPTLTTDIASGLLAGAQADPFQVDTPRSLSAGCLYAQAGLIERAWRELADAWQAPVRLVLAGGAADDVARVLTLPHTRHDALILSGLALIAADAAAPG
>NZ_CP011301.1|WP_035971643.1|1447297_1448218_-|biotin--[acetyl-CoA-carboxylase]-ligase
MNTLTSPDTPEPGAAHIARSRLDAHLDAAPRAWPLDIVAATGSTNADLALRLKALPRTATALPAPLVRVAFEQTAGRGRQGRPWFAQPGNALLCSVGCIVPRPVDALGGLSIAIGVALAEGLATLPLDSGARVALKWPNDLLLTAADDGTPRIVGKLAGILIETVWTTADATAVVIGFGINVRGAEAVAAQVDALRAREATLASGLPPAALSAACASANLTDTLAASLNALTPALAQFAADGLAPFLPRWHALHAYAGREVVLLEQGVERARGIATGIDAAGQLLLDTPHGVQAIAAGDVSLREAQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP011301_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011301_3

4444339-4444567

Orphan

Consensus_repeat	Method
ANGCCGCCGCGCNGNCCGA	CRT

4 spacers

The CRISPR arrays of NZ_CP011301_3

>merge|NZ_CP011301|3|4444339-4444567|CRT
CCGCCGCCGCGCAGGCCGAAGCGGCCGCGCAACGCCACGCCGCGGCCGAAGCCGAAGCGCAGGCCGCCGCGCAGCGCCACGCGCAGGCGGCCGCCGAAGCCGAAGCCGCCACCCAACGCCACGCCGCCGCGATCGCCGCGGCGGAAGCCGCCGCACAACGCCATACGGACGCCGCCGCGCAGGCCGAAGCCGCGGTGCAGCGCCACGCGGAAGCGACCGCGCTGACCGA

>NZ_CP011301|3|1|4444339-4444567|CRT
CCGCCGCCGCGCAGGCCGA	AGCGGCCGCGCAACGCCACGCCGCGGCCGAAGCCGAAGCGC
AGGCCGCCGCGCAGCGCCA	CGCGCAGGCGGCCGCCGAAGCCGAAGCCGCCACCCAACGCC
ACGCCGCCGCGATCGCCGC	GGCGGAAGCCGCCGCACAACGCCATACGG
ACGCCGCCGCGCAGGCCGA	AGCCGCGGTGCAGCGCCACGCGG
AAGCGACCGCGCTGACCGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011301.1\|WP_035975396.1\|4440181_4441306_-\|OpgC-domain-containing-protein	unknown	unknown	gnl\|CDD\|378405
NZ_CP011301.1\|WP_006766648.1\|4451832_4453911_-\|carbon-starvation-protein-A	unknown	unknown	gnl\|CDD\|184976
NZ_CP011301.1\|WP_006766634.1\|4435419_4437033_-\|peptide-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173869
NZ_CP011301.1\|WP_035974731.1\|4438294_4439812_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|181969
NZ_CP011301.1\|WP_006766633.1\|4434469_4435408_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|181886
NZ_CP011301.1\|WP_006766646.1\|4450804_4451425_-\|hemolysin-III-family-protein	unknown	unknown	gnl\|CDD\|273425
NZ_CP011301.1\|WP_006766644.1\|4449869_4450223_+\|DOPA-4,5-dioxygenase-family-protein	unknown	unknown	gnl\|CDD\|378079
NZ_CP011301.1\|WP_006766638.1\|4441688_4442588_-\|EamA-family-transporter-RarD	unknown	unknown	gnl\|CDD\|225510
NZ_CP011301.1\|WP_035974734.1\|4439927_4440134_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011301.1\|WP_035974738.1\|4445783_4446971_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|213815
NZ_CP011301.1\|WP_006766640.1\|4443113_4444121_+\|NAD-dependent-epimerase/dehydratase-family-protein	unknown	unknown	gnl\|CDD\|163279
NZ_CP011301.1\|WP_123806741.1\|4455284_4455479_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011301.1\|WP_035974745.1\|4454246_4455131_+\|RNA-polymerase-sigma-70-factor	unknown	unknown	gnl\|CDD\|132002
NZ_CP011301.1\|WP_035974742.1\|4450324_4450750_+\|nuclear-transport-factor-2-family-protein	unknown	unknown	gnl\|CDD\|378915
NZ_CP011301.1\|WP_035974729.1\|4437212_4437794_-\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|380339
NZ_CP011301.1\|WP_006766647.1\|4451612_4451819_-\|YbdD/YjiX-family-protein	unknown	unknown	gnl\|CDD\|377308
NZ_CP011301.1\|WP_006766643.1\|4448348_4449509_+\|adenosyl-hopene-transferase-HpnH	unknown	unknown	gnl\|CDD\|274595
NZ_CP011301.1\|WP_035974740.1\|4447394_4448336_+\|4-hydroxy-3-methylbut-2-enyl-diphosphate-reductase	unknown	unknown	gnl\|CDD\|234893
NZ_CP011301.1\|WP_006766632.1\|4433553_4434456_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|185304
NZ_CP011301.1\|WP_006766639.1\|4442605_4442902_-\|acylphosphatase	unknown	unknown	gnl\|CDD\|184674

Protein	Function_ID	Function_description	E-value
NZ_CP011301.1\|WP_035975396.1\|4440181_4441306_-\|OpgC-domain-containing-protein	gnl\|CDD\|378405	pfam10129, OpgC_C, OpgC protein. This domain, found in various hypothetical and OpgC prokaryotic proteins. It is likely to act as an acyltransferase enzyme.	8.05002e-105
NZ_CP011301.1\|WP_006766648.1\|4451832_4453911_-\|carbon-starvation-protein-A	gnl\|CDD\|184976	PRK15015, PRK15015, carbon starvation protein CstA.	0
NZ_CP011301.1\|WP_006766634.1\|4435419_4437033_-\|peptide-ABC-transporter-substrate-binding-protein	gnl\|CDD\|173869	cd08504, PBP2_OppA, The substrate-binding component of an ABC-type oligopetide import system contains the type 2 periplasmic binding fold. This family represents the periplasmic substrate-binding component of an ATP-binding cassette (ABC)-type oligopeptide transport system comprised of 5 subunits. The transport system OppABCDEF contains two homologous integral membrane proteins OppB and OppF that form the translocation pore; two homologous nucleotide-binding domains OppD and OppF that drive the transport process through binding and hydrolysis of ATP; and the substrate-binding protein or receptor OppA that determines the substrate specificity of the transport system. The dipeptide (DppA) and oligopeptide (OppA) binding proteins differ in several ways. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP011301.1\|WP_035974731.1\|4438294_4439812_+\|MFS-transporter	gnl\|CDD\|181969	PRK09584, tppB, dipeptide/tripeptide permease DtpA.	5.69905e-136
NZ_CP011301.1\|WP_006766633.1\|4434469_4435408_-\|ABC-transporter-permease-subunit	gnl\|CDD\|181886	PRK09471, oppB, oligopeptide ABC transporter permease OppB.	9.73359e-124
NZ_CP011301.1\|WP_006766646.1\|4450804_4451425_-\|hemolysin-III-family-protein	gnl\|CDD\|273425	TIGR01065, Hypothetical_UPF0073_protein_yqfA., channel protein, hemolysin III family. This family includes proteins from pathogenic and non-pathogenic bacteria, Homo sapiens and Drosophila. In Bacillus cereus, a pathogen, it has been show to function as a channel-forming cytolysin. The human protein is expressed preferentially in mature macrophages, consistent with a role cytolytic role.	2.07657e-67
NZ_CP011301.1\|WP_006766644.1\|4449869_4450223_+\|DOPA-4,5-dioxygenase-family-protein	gnl\|CDD\|378079	pfam08883, DOPA_dioxygen, Dopa 4,5-dioxygenase family. This family of proteins are related to a DOPA 4,5-dioxygenase that is involved in synthesis of betalain. DOPA-dioxygenase is the key enzyme involved in betalain biosynthesis. It converts 3,4-dihydroxyphenylalanine to betalamic acid, a yellow chromophore.	6.37043e-46
NZ_CP011301.1\|WP_006766638.1\|4441688_4442588_-\|EamA-family-transporter-RarD	gnl\|CDD\|225510	COG2962, RarD, Predicted permeases [General function prediction only].	1.253e-72
NZ_CP011301.1\|WP_006766643.1\|4448348_4449509_+\|adenosyl-hopene-transferase-HpnH	gnl\|CDD\|274595	TIGR03470, HpnH, hopanoid biosynthesis associated radical SAM protein HpnH. The sequences represented by this model are members of the radical SAM superfamily of enzymes (pfam04055). These enzymes utilize an iron-sulfur redox cluster and S-adenosylmethionine to carry out diverse radical mediated reactions. The members of this clade are frequently found in the same locus as squalene-hopene cyclase (SHC, TIGR01507) and other genes associated with the biosynthesis of hopanoid natural products. The linkage between SHC and this radical SAM enzyme is strong; one is nearly always observed in the same genome where the other is found. A hopanoid biosynthesis locus was described in Zymomonas mobilis consisting of the genes HpnA-E and SHC (HpnF). Continuing past SHC are found a phosphorylase enzyme (ZMO0873, i.e. HpnG, TIGR03468) and this radical SAM enzyme (ZMO0874) which we name here HpnH. Granted, in Z. mobilis, HpnH is in a convergent orientation with respect to HpnA-G, but one gene beyond HpnH and running in the same convergent direction is IspH (ZM0875, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase), an essential enzyme of IPP biosynthesis and therefore essential for the biosynthesis of hopanoids. One of the well-described hopanoid intermediates is bacteriohopanetetrol. In the conversion from hopene several reactions must occur in the side chain for which a radical mechanism might be reasonable. These include the four (presumably anaerobic) hydroxylations and a methyl shift.	0
NZ_CP011301.1\|WP_035974738.1\|4445783_4446971_-\|glycosyltransferase	gnl\|CDD\|213815	TIGR03469, HpnB, hopene-associated glycosyltransferase HpnB. This family of genes include a glycosyl transferase, group 2 domain (pfam00535) which are responsible, generally for the transfer of nucleotide-diphosphate sugars to substrates such as polysaccharides and lipids. The genes of this family are often found in the same genetic locus with squalene-hopene cyclase genes, and are never associated with genes for the metabolism of phytoene. Indeed, the members of this family appear to never be found in a genome lacking squalene-hopene cyclase (SHC), although not all genomes encoding SHC have this glycosyl transferase. In the organism Zymomonas mobilis the linkage of this gene to hopanoid biosynthesis has been noted and the gene named HpnB. Hopanoids are known to feature polar glycosyl head groups in many organisms.	0
NZ_CP011301.1\|WP_035974740.1\|4447394_4448336_+\|4-hydroxy-3-methylbut-2-enyl-diphosphate-reductase	gnl\|CDD\|234893	PRK01045, ispH, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase; Reviewed.	3.00177e-176
NZ_CP011301.1\|WP_035974742.1\|4450324_4450750_+\|nuclear-transport-factor-2-family-protein	gnl\|CDD\|378915	pfam12680, SnoaL_2, SnoaL-like domain. This family contains a large number of proteins that share the SnoaL fold.	8.09059e-08
NZ_CP011301.1\|WP_035974729.1\|4437212_4437794_-\|cupin-domain-containing-protein	gnl\|CDD\|380339	cd02209, cupin_XRE_C, XRE (Xenobiotic Response Element) family transcriptional regulators, C-terminal cupin domain. This family contains transcriptional regulators containing an N-terminal XRE (Xenobiotic Response Element) family helix-turn-helix (HTH) DNA-binding domain and a C-terminal cupin domain. Included in this family is Escherichia coli transcription factor SutR (YdcN) that plays a regulatory role in sulfur utilization; it regulates a set of genes involved in the generation of sulfate and its reduction, the synthesis of cysteine, the synthesis of enzymes containing Fe-S as cofactors, and the modification of tRNA with use of sulfur-containing substrates. This family belongs to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	3.48065e-31
NZ_CP011301.1\|WP_006766647.1\|4451612_4451819_-\|YbdD/YjiX-family-protein	gnl\|CDD\|377308	pfam04328, Sel_put, Selenoprotein, putative. This entry includes a group of putative selenoproteins from Proteobacteria, Actinobacteria and Firmicutes. The invariant cysteine at the C-terminus is encoded by a TGA Sec codon in some Epsilonproteobacteria, suggesting a redox activity for the protein.	2.67358e-30
NZ_CP011301.1\|WP_035974745.1\|4454246_4455131_+\|RNA-polymerase-sigma-70-factor	gnl\|CDD\|132002	TIGR02957, putative_sigma_factor, RNA polymerase sigma-70 factor, TIGR02957 family. This group of sigma factors are members of the sigma-70 family (TIGR02937). They and appear by homology, tree building and bidirectional best hits, to represent a conserved family. This family is found in a limited number of bacterial lineages. This family includes apparent paralogous expansion in Streptomyces coelicolor A3(2), and multiple copies in Mycobacterium smegmatis MC2, Streptomyces avermitilis MA-4680 and Nocardia farcinica IFM10152.	1.68118e-134
NZ_CP011301.1\|WP_006766640.1\|4443113_4444121_+\|NAD-dependent-epimerase/dehydratase-family-protein	gnl\|CDD\|163279	TIGR03466, HpnA, hopanoid-associated sugar epimerase. The sequences in this family are members of the pfam01370 superfamily of NAD-dependent epimerases and dehydratases typically acting on nucleotide-sugar substrates. The genes of the family modeled here are generally in the same locus with genes involved in the biosynthesis and elaboration of hopene, the cyclization product of the polyisoprenoid squalene. This gene and its association with hopene biosynthesis in Zymomonas mobilis has been noted in the literature where the gene symbol hpnA was assigned. Hopanoids are known to be components of the plasma membrane and to have polar sugar head groups in Z. mobilis and other species.	0
NZ_CP011301.1\|WP_006766632.1\|4433553_4434456_-\|ABC-transporter-permease-subunit	gnl\|CDD\|185304	PRK15406, PRK15406, oligopeptide ABC transporter permease OppC; Provisional.	2.81344e-111
NZ_CP011301.1\|WP_006766639.1\|4442605_4442902_-\|acylphosphatase	gnl\|CDD\|184674	PRK14424, PRK14424, acylphosphatase; Provisional.	3.75063e-57

>NZ_CP011301.1|WP_006766640.1|4443113_4444121_+|NAD-dependent-epimerase/dehydratase-family-protein
MTDTSRDLVLVTGASGFVGSAVARIAQQKGFAVRVLVRPTSPRTNVADLDAQIVTGDMRDEASMRAALRGVRYLLHVAADYRLWAPDPHEIERANLEGAVATMRAARAEGVERIVYTSSVATLKVTSAGDPADENRPLTPEHAIGVYKRSKVLAERAVERMIADEGLPAVIVNPSTPIGPRDVKPTPTGRIIVEAALGKIPAFVDTGLNLVHVDDVAHGHFLALERGRIGERYILGGENLPLQQMLADIAQMTGRKAPTIALPRWPLYPLAVGAEAVAKLTKKEPFVTVDGLRMSKNKMYFTSAKAERELGYRARPYREGLRDALDWFRSAGYVK
>NZ_CP011301.1|WP_006766639.1|4442605_4442902_-|acylphosphatase
MSRNELDERIETYYVRVRGVVQGVGFRHATVREAHALKLRGWVANLEDGSVEAMIQGPAAQIDRMLAWLRHGPPSARVTEVTFEERPIDKRFERFQQQ
>NZ_CP011301.1|WP_006766638.1|4441688_4442588_-|EamA-family-transporter-RarD
MTGYPEAGRGILLSATASTMFALLSVYAKLLAPLTGLDIFAWRILWTAPGALALIALRGRWPALVALVSRSVRDWRLLIALPVSAELLGLQLWLFLWAPLHGRMLEVSLGYFLLPLTMVLVGRFYYHERLDPLQWAAVACAALGVAHEVWATRAFAWPTLVVALGYPPYFVLRRRINADSLAAFALEIVLLCPIALAMVATSTTQIGDRPLLWAALLPGLGVLSTLALASYLKASRMLPMALFGILGYVEPVLLVAVSLLLLGETLTVAQLATYGPIWIAVALTAWHSAMLMRRLPMRG
>NZ_CP011301.1|WP_035975396.1|4440181_4441306_-|OpgC-domain-containing-protein
MPVNASSSVPTRAPRSGRLIEVDFFRGIVLLMIVVDHIGASVLSRVTLHAFALCDAAEVFVFLGGFATASAYGAIAERHGARAAQRRFVHRAMQIYRAFLATSTLMLVVSAVLDHYGIDAPNLALDDVSVMLASPLTGLAELLTFQRQPYLASVLPMYVLFALASPVIVPFARRHPWLLVAFSAASWIAASWLGPELLDTDGFRWSFNPFAWQLMFVAGVLARCQPFYRRVALGRWGAAATGVACAIVLGCASYKLFSGLPVPEGVFKRDLALPRIVSFAAVAWLMADCVRYGWIARIAQAVRPVVAVGQRGLICFVAGAAISLVIDSLLHPVAQGAALRHVGVGLAADACALGLMIAVAGSGTWIARWRGAAA
>NZ_CP011301.1|WP_035974734.1|4439927_4440134_+|hypothetical-protein
MKSKTTRLLRILSDIRHAQRCTALRAARAAAEADAVLAQRDERAADERDDAEPDDDASVPRSRIGSPH
>NZ_CP011301.1|WP_035974731.1|4438294_4439812_+|MFS-transporter
MMHAPVSQTRSFTTVFLIELWERFGYYGMAALLVLFMVDRLGFTDSHANLTWGAFTALVYASPSIGGWIGDKVLGARRTMIIGAAVLSAGYLMLAVPNDALAYMYASLGVIVVGNGLFKANAANLVRRIYEGDDARIDSAFTIYYMAVNIGSTVSMLATPWIKDHWGWHTAFAVCCGGMLLAILNFMLMHRTLAHIGSQPDDEPIRWKRLGAVAAGGVALALITLYVLQHKQLAVASVWGAAFAILAIFAYMIVKSERSERAGLIAALVLTGQVILFFIFYVQMSTSLTLFALRNVDPRFIVFGTTLFTWSAAQFQALNPIWIMLLSPVLVWIYNAFSKGGRDLPVAAKYALGFGAVAAGYLVFTISGRYAVDGRVSSWFMVWGYGLYSLGELLVSGLGLAMVARYVPARMSGFMMGAYFVATGVSQYLGSVVANFAQMPSHELPATESLPLYLSLFEKLGWLAAIGMLLALLLLPTMNRLSRRHQRCVDERRDEAPDAQAVATR
>NZ_CP011301.1|WP_035974729.1|4437212_4437794_-|cupin-domain-containing-protein
MVPSTENSRPADAAAALGGKIRALRQRLKRTLDETATAAGISKPFLSQVERGLASPSLTSLAGIAHALGVTVQYFVDTPSEERSVCRGEQLRFFGFADSANLFARLTNVSEGRQLEAILVRMPPGQKRSEVTTHAGEEFLYVIEGEVSLTLEGKTFVLQAGDSSHYQSTVPHSWVNTAKIESVVVWVGTPRLF
>NZ_CP011301.1|WP_006766634.1|4435419_4437033_-|peptide-ABC-transporter-substrate-binding-protein
MKSLHAMSAVLAALVLTTPAARAVTVPSNVTLAPQQDLTRQVPAEVESLDPAHIESWTGNTIGLDLFEGLARIDAAGQLVPGVALSWERKTPQTWIFKLRRDAKWSNGQPVTAADFVYSWQRLVDPKTGSKYTILVEFVKNSKDIIAGKAAPSTLGVRAVDPYTLEVTTDVPVAFFPELTAMAPLAPVNKDVVAKFGDAWTRPGNIVSNGAYQLVDWQPNNRIVIAKDAKYWNAPKVVINKVTYLPIESDETAMRMYQAGQIDYSYSIPSGIFQQVSKQFGSELRPGLQLATYYYYLNNSDPALKDKRVRQALSMVIDRDVLTSKLTQAGEKPMYGLMPNGTKGVQPFTPEWASWPMARRVETAKNLLKQAGYSDAKPLSFTLTYNTNDLHKKVALFAASEWRTKLGINTKLENVEFKVLMKERHDGKVQIARDGWFADYNDAMTFFDLIRCGSSQNTVGYCNKQVDTLVDDGNQKLDDSARAALLTQAHDAAMKDTPMVPLFQYSADRLVKPYVGGYSLKNVIDMRASQDMYLIKH
>NZ_CP011301.1|WP_006766633.1|4434469_4435408_-|ABC-transporter-permease-subunit
MLAYALRRTLWAVPTILAVVTVCYLLLHFTPGGPFDTEKQLSAATLANLNAKYHLDEPLWKQYLLYLGSLLRGDLGPSFRYVDWSVNDLVKRALPVSLGVGGVSIPVSIVLGVLLGTVAAVRRDSVIDRFVMLIGNFGNVVPPFVLGPVLVWIFAILLKTSAGNGWLPAGGWGDGGWQYRLLPIVLLTFINVSLLARVMRGSMIETLSSNYIRTARAKGLPGSTIVLRHALKPALMPVVSLFGTVCITSITAAVVTESVFALPGLGQLVVNGAINRDYTLVLGLVVLTTVCAVLFNLLVDLAYAWLDPRIRY
>NZ_CP011301.1|WP_006766632.1|4433553_4434456_-|ABC-transporter-permease-subunit
MIPTTPAVGLPVPTDTPPRSRSPLALAFARFLHNRAALFSLVLLALITLACFAGPWLLAADPAASDWASISLPPTLANQHWFGTDELGRDLLVRTLIGGRVSIEVGLLGTLVSGLFGVAWGATAGFAGGRVDAVMMRIVDMMYAIPYLLIAILMMTLFGRSFMLVVLTISAFSWIDMARVVRGQTLSLRNREFVDAARAIGVSPASIVRRHVVPNLLGVVVVYATVSVPNIVLTESVLSFLGLGVQEPMTSWGVLIQDGAQKLESMPWLLLCPAVMLCVTLYCVNFVGDGLRDALDPKDR
>NZ_CP011301.1|WP_035974738.1|4445783_4446971_-|glycosyltransferase
MMLAIAFLVSGLSLLIWIVLLVARGGFWRAVPARALPPEARGAAAEAGWPAVVAVVPARNEADVIARAATSLLEQDYPGDFHLIIVDDHSDDGTADAARAAALAANRADRLTVLAAKPLPAGWSGKVWAQSQGIAAVRTLGLPADYLLLTDADIGHPPDAVAQLVTRAQAENRDLVSLMVRLRCDSFWEKALIPAFVFFFAKLYPFSWINDPRNKTAGAAGGCMLVKRTALEEAGGIESIRGALIDDCSLAAQIKHRGGGRHPIRLDLAERSVSLRPYDSWRDIWNMIARTAFTQLRYSPWLLAGTLLGMTIIYLVPPVAALAYGARAWPAWLAWASMCTAYAPMLRYYRRSPLWAPALPLVALFYVGATFASAWRYWRGKGGQWKARVQAPVER
>NZ_CP011301.1|WP_035974740.1|4447394_4448336_+|4-hydroxy-3-methylbut-2-enyl-diphosphate-reductase
MRVILAQPRGFCAGVVRAIEIVDRALQQHGAPVYVRHEIVHNRHVVENLRNKGARFVEELDEVPHGAVAIFSAHGVAQTVERDAQTRGLDVLDATCPLVTKVHVQGRQYVAAGRRLILIGHAGHPEVEGTIGQIPAEVILVQSEAEVDTLTLPVDTPVAYVTQTTLSVDDTRGIIEALQRRFTDIVGPDTRDICYATQNRQAAVRELSAQVDVLLVVGATNSSNSNRLREIGTESGVPSYLVADGSEVKAEWFAGVQTVGLTAGASAPEEMVEDVIGALRALGPVEVTTMAGREEKVEFKLPAKLTQAVAREV
>NZ_CP011301.1|WP_006766643.1|4448348_4449509_+|adenosyl-hopene-transferase-HpnH
MSIPLLQQVRVGAYIMRQHLSGNKRYPLALMLEPLFRCNLACNGCGKIDYPDPILNQRLSVEECLEAVDECGAPVVSIAGGEPLLHKEMPEIVKGIMKRKKFVYLCTNALLMEKKMDDYQPSPYFVWSVHLDGDKEMHDHSVSQEGVYDKAVAAIKEAKRRGFRVNINCTLFNDAIPERVAKFFDTLKPIGVDGITVSPGYAYERAPDQQHFLNRDKTKNLFREILKRGEGGKRWSFSQSSLFLDFLAGNQTYKCTPWGNPARTVFGWQKPCYLVGEGYVKTFKELMETTEWDNYGVGNYEKCADCMVHCGFEATAVMDTISHPLKALRVSRKGIRTDGPFAPDISIAKQRPAEYVFSRHVEIKLEEIQRAGKGKLQKPAKPATAA
>NZ_CP011301.1|WP_006766644.1|4449869_4450223_+|DOPA-4,5-dioxygenase-family-protein
MPNLDTAAIASWHAHVYFDAASRDRAWAFRETVDTRFGTIVELGRFHERLVGPHPAWSYQIAFGAARFDEVVPWLVLNHGALDIFLHPNTGDDLRDHRDSAVWIGKSYTLNLDALAG
>NZ_CP011301.1|WP_035974742.1|4450324_4450750_+|nuclear-transport-factor-2-family-protein
MTHADARHIHESWHAAVVSRDLDALMSLYADDAVLETPLVVVALPDHGSGVLHGKAAIRAFFAAGLRNPQNRLGRWYRTALFFSNGRQLVWEYPRATPDGDQVDLVEVMDLRDGLIAHHRVYWGWVGFNALRSAAPAAGRA
>NZ_CP011301.1|WP_006766646.1|4450804_4451425_-|hemolysin-III-family-protein
MHAGERFNSISHLVGAVLSVAGLVTLVTMGALKGDAYKVVSFSVYGAMLCVLYAISTLYHSVRNPRVKAILQKCDHSAIYLLIAGSYTPFTLVTLRGPWGWSLFGVSWGLAVFGIVQELTLGRRTRIVSMVLYVLMGWLALVAIGPLVHALPPIGTAWLVAGGVIYSAGIYFFINDERIRHGHGIWHLFVLAGSLCQFVSVAVYVA
>NZ_CP011301.1|WP_006766647.1|4451612_4451819_-|YbdD/YjiX-family-protein
MFSDLGSDLRSAGRYLGQALRLMVGLPDYDTYVAHMRDTHPDREPMTYEEFFRERQNARYGSGAGKCC
>NZ_CP011301.1|WP_006766648.1|4451832_4453911_-|carbon-starvation-protein-A
MNRASSTLIWIAVALLGAFAFGTIALAHGERVSALWIVIAAVCVYLIAYRFYSRFIASKVMQLDGLRMTPAVKYNDGLDYVPTNKYVLFGHHFAAIAGAGPLVGPVLAAQMGYTPGMLWILAGVVFAGAVQDFIVLFISTRRDGRSLGDLVKMELGTVPGVIALFGAFLIMVIILAVLALIVVKALTNSPWGTFTVAATIPIALFMGVYTRFIRPGRIGEVSIIGFVLLMASIAFGQTVHDSPTLAAWFTFSGTQLTWILIGYGFVASVLPVWLLLAPRDYLSTFLKIGTIVGLAIGILIVAPELKMPALTKFVDGSGPVWSGNLFPFLFITIACGAVSGFHALISSGTTPKLIDNETNARFIGYGAMLMESFVAIMALVAACVIEPGIYFAMNAPAAVLGSTPEAVANTVTQWGFVLTPDMLTQTAKAVGETTIIARAGGAPTLAVGMAHILHQVIGGEAMMAFWYHFAILFEALFILTAVDAGTRAGRFMLQDLLGTFHPALKRTESLPANLIATALCVAAWGYFLYQGVVDPLGGINTLWPLFGISNQMLAAIALVLGTVVLFKMKRERYAWVTIVPTAWLLICTLTAGWQKVFDSNPKVSFLAHAAKLQAAVDEGKVLAPAKSIAQMKRIIFNDYIDAALAGLFILVVVSIAVYGLIAVLRARREAKPTVRETPYEAMPAAQALGSGR
>NZ_CP011301.1|WP_035974745.1|4454246_4455131_+|RNA-polymerase-sigma-70-factor
MTDDAQTFHALRPRLQKIAYRMLGSVADAEDIVQDAWLRWHEAARDGIDNAEAWLVAVTTRLSIDRLRTAKIRRERYAGIWLPEPELGESPATPEELTERASDVSVAFLLLLERLTPEARAAFLLREVFDADYDEIASAIGKSEAACRQLVSRAKAQLRDDGRPHRAVPHETHRRLLQTFSHALARGDFPSIQALLAEDAMLIGDGGGKVQSFPKPMVGGRRVAQLFYATWLRYGSRVEMRAVILNGDWAMLRFIDGELEAAMSFETDGTRIARVLVQRNPDKLARIAAACAAG
>NZ_CP011301.1|WP_123806741.1|4455284_4455479_+|hypothetical-protein
MIRIQHATAAALADASVAPKPRRTLRERPGDLRAAGRDATRARLAALIAPPLQHNGVPVPAPER

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP011301_2	2.2\|1436634\|19\|NZ_CP011301\|CRISPRCasFinder	1436634-1436652	19	NZ_CP011301.1	5326855-5326873	1	0.947
NZ_CP011301_2	2.3\|1436682\|19\|NZ_CP011301\|CRISPRCasFinder	1436682-1436700	19	NZ_CP011301.1	3307008-3307026	1	0.947
NZ_CP011301_2	2.2\|1436634\|19\|NZ_CP011301\|CRISPRCasFinder	1436634-1436652	19	NZ_CP011301.1	3306828-3306846	2	0.895
NZ_CP011301_2	2.2\|1436634\|19\|NZ_CP011301\|CRISPRCasFinder	1436634-1436652	19	NZ_CP011301.1	3307014-3307032	2	0.895
NZ_CP011301_2	2.2\|1436634\|19\|NZ_CP011301\|CRISPRCasFinder	1436634-1436652	19	NZ_CP011301.1	5856021-5856039	2	0.895

1. spacer 2.2|1436634|19|NZ_CP011301|CRISPRCasFinder matches to position: 5326855-5326873, mismatch: 1, identity: 0.947

ccgatggcgatgccgaagc	CRISPR spacer
ccgatgccgatgccgaagc	Protospacer
****** ************

2. spacer 2.3|1436682|19|NZ_CP011301|CRISPRCasFinder matches to position: 3307008-3307026, mismatch: 1, identity: 0.947

ccgaagccgatggcgatgg	CRISPR spacer
ccgatgccgatggcgatgg	Protospacer
**** **************

3. spacer 2.2|1436634|19|NZ_CP011301|CRISPRCasFinder matches to position: 3306828-3306846, mismatch: 2, identity: 0.895

ccgatggcgatgccgaagc	CRISPR spacer
ccgatgccgatgccgacgc	Protospacer
****** ********* **

4. spacer 2.2|1436634|19|NZ_CP011301|CRISPRCasFinder matches to position: 3307014-3307032, mismatch: 2, identity: 0.895

ccgatggcgatgccgaagc	CRISPR spacer
ccgatggcgatggcgatgc	Protospacer
************ *** **

5. spacer 2.2|1436634|19|NZ_CP011301|CRISPRCasFinder matches to position: 5856021-5856039, mismatch: 2, identity: 0.895

ccgatggcgatgccgaagc	CRISPR spacer
ccgatcgcgacgccgaagc	Protospacer
***** ****.********

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP011301_2	2.3\|1436682\|19\|NZ_CP011301\|CRISPRCasFinder	1436682-1436700	19	NZ_CP015742	Shinella sp. HZN7 plasmid pShin-06, complete sequence	94723-94741	0	1.0
NZ_CP011301_3	3.4\|4444526\|23\|NZ_CP011301\|CRT	4444526-4444548	23	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	173895-173917	2	0.913
NZ_CP011301_3	3.4\|4444526\|23\|NZ_CP011301\|CRT	4444526-4444548	23	NZ_CP006570	Sodalis praecaptivus strain HS1 plasmid pHS1, complete sequence	219248-219270	2	0.913
NZ_CP011301_3	3.4\|4444526\|23\|NZ_CP011301\|CRT	4444526-4444548	23	NZ_CP035421	Leisingera sp. NJS204 plasmid unnamed4, complete sequence	35322-35344	2	0.913
NZ_CP011301_3	3.4\|4444526\|23\|NZ_CP011301\|CRT	4444526-4444548	23	NZ_CP038238	Leisingera sp. NJS201 plasmid unnamed4, complete sequence	78547-78569	2	0.913
NZ_CP011301_3	3.4\|4444526\|23\|NZ_CP011301\|CRT	4444526-4444548	23	NZ_CP038236	Leisingera sp. NJS201 plasmid unnamed2, complete sequence	43099-43121	3	0.87
NZ_CP011301_3	3.4\|4444526\|23\|NZ_CP011301\|CRT	4444526-4444548	23	NZ_CP017750	Cupriavidus sp. USMAA2-4 plasmid unnamed1, complete sequence	197291-197313	3	0.87
NZ_CP011301_3	3.4\|4444526\|23\|NZ_CP011301\|CRT	4444526-4444548	23	MK279884	Arthrobacter phage Supakev, complete genome	37550-37572	3	0.87
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	NZ_CP044550	Hydrogenophaga sp. BPS33 plasmid pBPS33-1, complete sequence	270814-270844	5	0.839
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	NC_015169	Deinococcus proteolyticus MRP plasmid pDEIPR01, complete sequence	236258-236288	6	0.806
NZ_CP011301_3	3.3\|4444478\|29\|NZ_CP011301\|CRT	4444478-4444506	29	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	1996126-1996154	6	0.793
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	NZ_CP005190	Sphingobium sp. MI1205 plasmid pMI1, complete sequence	89763-89793	7	0.774
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	NZ_CP013109	Sinorhizobium americanum strain CFNEI 73 plasmid B, complete sequence	170784-170814	7	0.774
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	496848-496878	7	0.774
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2220063-2220093	7	0.774
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	NC_022049	Paracoccus aminophilus JCM 7686 plasmid pAMI4, complete sequence	104590-104620	7	0.774
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	NZ_CP011515	Mitsuaria sp. 7 plasmid, complete sequence	146574-146604	7	0.774
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	NZ_LN832562	Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence	28492-28522	7	0.774
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	NZ_CP006990	Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence	24045-24075	7	0.774
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	CP007644	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence	22901-22931	7	0.774
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	MH479927	Gordonia phage TimTam, complete genome	22514-22544	7	0.774
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	KU963255	Gordonia phage Nymphadora, complete genome	22514-22544	7	0.774
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	MT889398	Gordonia phage Herod, complete genome	22514-22544	7	0.774
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	MK878898	Gordonia phage Zameen, complete genome	22511-22541	7	0.774
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	MK919483	Gordonia phage Suscepit, complete genome	22511-22541	7	0.774
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	MK112547	Gordonia phage Maridalia, complete genome	22511-22541	7	0.774
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	MT952844	Gordonia phage Bosnia, complete genome	22514-22544	7	0.774
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	MH479912	Gordonia phage Eviarto, complete genome	22514-22544	7	0.774
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	MK016492	Gordonia phage Bialota, complete genome	22526-22556	7	0.774
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	MK820642	Gordonia phage Polly, complete genome	21954-21984	7	0.774
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	MK814755	Gordonia phage Antonio, complete genome	22511-22541	7	0.774
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	MK875796	Gordonia phage Tayonia, complete genome	22511-22541	7	0.774
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	KU963249	Gordonia phage Yeezy, complete genome	21733-21763	7	0.774
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	KX557273	Gordonia phage BatStarr, complete genome	22514-22544	7	0.774
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	MT521999	Gordonia Phage Jablanski, complete genome	23105-23135	7	0.774
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	KU963257	Gordonia phage Kita, complete genome	22511-22541	7	0.774
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	NC_031097	Gordonia phage Zirinka, complete genome	22526-22556	7	0.774
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	MG872834	Gordonia phage Confidence, complete genome	22026-22056	7	0.774
NZ_CP011301_3	3.3\|4444478\|29\|NZ_CP011301\|CRT	4444478-4444506	29	MG869616	Polaromonas sp. E19S plasmid pE19SP1, complete sequence	18573-18601	7	0.759
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	NZ_CP013072	Sphingobium indicum B90A plasmid pSRL2, complete sequence	6664-6694	8	0.742
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	NZ_LR134447	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 5, complete sequence	241528-241558	8	0.742
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	NZ_CP011450	Sphingomonas sanxanigenens DSM 19645 = NX02 plasmid pNXO2, complete sequence	344978-345008	8	0.742
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	NZ_CP048816	Caulobacter rhizosphaerae strain KCTC 52515 plasmid unnamed	182485-182515	8	0.742
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1045617-1045647	8	0.742
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	767454-767484	8	0.742
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	NZ_CP005085	Sphingobium sp. TKS plasmid pTK1, complete sequence	297721-297751	8	0.742
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	NC_022049	Paracoccus aminophilus JCM 7686 plasmid pAMI4, complete sequence	186362-186392	8	0.742
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	NZ_CP015370	Methylobacterium phyllosphaerae strain CBMB27 plasmid CBMB27-p3, complete sequence	26531-26561	8	0.742
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	KY622015	Shewanella phage SppYZU01, complete genome	27889-27919	8	0.742
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	NC_049432	Ralstonia phage RsoM1USA, complete genome	17178-17208	8	0.742
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	NZ_CP047174	Rathayibacter sp. VKM Ac-2760 plasmid unnamed1, complete sequence	152449-152479	8	0.742
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	LN997845	Streptomyces reticuli genome assembly TUE45, plasmid : IV	3491-3521	9	0.71
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	NZ_CP031082	Paracoccus yeei strain CCUG 32053 plasmid pYEE4, complete sequence	46753-46783	9	0.71
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	NZ_CP024423	Paracoccus yeei strain TT13 plasmid pTT13-1, complete sequence	5583-5613	9	0.71
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	NZ_CP020441	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed1, complete sequence	20918-20948	9	0.71
NZ_CP011301_2	2.1\|1436574\|31\|NZ_CP011301\|CRISPRCasFinder	1436574-1436604	31	NZ_CP044080	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed3, complete sequence	5197-5227	9	0.71

1. spacer 2.3|1436682|19|NZ_CP011301|CRISPRCasFinder matches to NZ_CP015742 (Shinella sp. HZN7 plasmid pShin-06, complete sequence) position: , mismatch: 0, identity: 1.0

ccgaagccgatggcgatgg	CRISPR spacer
ccgaagccgatggcgatgg	Protospacer
*******************

2. spacer 3.4|4444526|23|NZ_CP011301|CRT matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 2, identity: 0.913

agccgcggtgcagcgccacgcgg	CRISPR spacer
cgccgcggtgcagcgcctcgcgg	Protospacer
 **************** *****

3. spacer 3.4|4444526|23|NZ_CP011301|CRT matches to NZ_CP006570 (Sodalis praecaptivus strain HS1 plasmid pHS1, complete sequence) position: , mismatch: 2, identity: 0.913

agccgcggtgcagcgccacgcgg	CRISPR spacer
cgccgcgctgcagcgccacgcgg	Protospacer
 ****** ***************

4. spacer 3.4|4444526|23|NZ_CP011301|CRT matches to NZ_CP035421 (Leisingera sp. NJS204 plasmid unnamed4, complete sequence) position: , mismatch: 2, identity: 0.913

agccgcggtgcagcgccacgcgg	CRISPR spacer
agccgcggtgcaggggcacgcgg	Protospacer
************* * *******

5. spacer 3.4|4444526|23|NZ_CP011301|CRT matches to NZ_CP038238 (Leisingera sp. NJS201 plasmid unnamed4, complete sequence) position: , mismatch: 2, identity: 0.913

agccgcggtgcagcgccacgcgg	CRISPR spacer
agccgcggtgcaggggcacgcgg	Protospacer
************* * *******

6. spacer 3.4|4444526|23|NZ_CP011301|CRT matches to NZ_CP038236 (Leisingera sp. NJS201 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.87

agccgcggtgcagcgccacgcgg	CRISPR spacer
agccgcggtgcagcgccacaaag	Protospacer
*******************. .*

7. spacer 3.4|4444526|23|NZ_CP011301|CRT matches to NZ_CP017750 (Cupriavidus sp. USMAA2-4 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.87

agccgcggtgcagcgccacgcgg	CRISPR spacer
cgccgcgctgcagcgccacgcgc	Protospacer
 ****** **************

8. spacer 3.4|4444526|23|NZ_CP011301|CRT matches to MK279884 (Arthrobacter phage Supakev, complete genome) position: , mismatch: 3, identity: 0.87

agccgcggtgcagcgccacgcgg	CRISPR spacer
tgccgcgatgcagcgccacgcga	Protospacer
 ******.**************.

9. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to NZ_CP044550 (Hydrogenophaga sp. BPS33 plasmid pBPS33-1, complete sequence) position: , mismatch: 5, identity: 0.839

acggcgcggcggcgggcggcgactgtgtcga-	CRISPR spacer
gcggcgcggcggcgggcgcggactg-gccgaa	Protospacer
.*****************  ***** *.***

10. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to NC_015169 (Deinococcus proteolyticus MRP plasmid pDEIPR01, complete sequence) position: , mismatch: 6, identity: 0.806

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
gcagcgcagcggcgggcggcgactttgtggc	Protospacer
.*.****.**************** *** *

11. spacer 3.3|4444478|29|NZ_CP011301|CRT matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 6, identity: 0.793

ggcggaagccgccgcacaacgccatacgg	CRISPR spacer
cgcggaagccgccgcgcagcgccagatag	Protospacer
 **************.**.***** *..*

12. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to NZ_CP005190 (Sphingobium sp. MI1205 plasmid pMI1, complete sequence) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
acggcgtggcggtgggcggcgactgcatgac	Protospacer
******.*****.************..* .

13. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to NZ_CP013109 (Sinorhizobium americanum strain CFNEI 73 plasmid B, complete sequence) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
ggcgggcggcggcgggcggcgagtatgtcgc	Protospacer
.  * ***************** *.*****

14. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
acggcgcggcggcgggcgtcgaatatcgggt	Protospacer
****************** *** *.*   *

15. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
acggcgcggcggctggcggcgatggtcgtgc	Protospacer
************* ********. **  .*

16. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to NC_022049 (Paracoccus aminophilus JCM 7686 plasmid pAMI4, complete sequence) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgcggtggcgggcggcgtctcttgcgt	Protospacer
 ********.*********** ** *  **

17. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to NZ_CP011515 (Mitsuaria sp. 7 plasmid, complete sequence) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga-	CRISPR spacer
tgggtgcggcggccggcggcgactg-gctgat	Protospacer
  **.******** *********** *..**

18. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to NZ_LN832562 (Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
acggcgctgcgccgggcggcgacgatgaccg	Protospacer
******* *** *********** .** * .

19. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to NZ_CP006990 (Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga----	CRISPR spacer
acagcgcggcggcgggcgtcgac----ccgaacct	Protospacer
**.*************** ****    .***

20. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to CP007644 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga----	CRISPR spacer
acagcgcggcggcgggcgtcgac----ccgaacct	Protospacer
**.*************** ****    .***

21. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to MH479927 (Gordonia phage TimTam, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggcggccggcgacttcgtgca	Protospacer
 ****** ******* ******** .**  *

22. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to KU963255 (Gordonia phage Nymphadora, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggcggccggcgacttcgtgca	Protospacer
 ****** ******* ******** .**  *

23. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to MT889398 (Gordonia phage Herod, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggcggccggcgacttcgtgca	Protospacer
 ****** ******* ******** .**  *

24. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to MK878898 (Gordonia phage Zameen, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggcggccggcgacttcgtgca	Protospacer
 ****** ******* ******** .**  *

25. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to MK919483 (Gordonia phage Suscepit, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggcggccggcgacttcgtgca	Protospacer
 ****** ******* ******** .**  *

26. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to MK112547 (Gordonia phage Maridalia, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggcggccggcgacttcgtgca	Protospacer
 ****** ******* ******** .**  *

27. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to MT952844 (Gordonia phage Bosnia, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggcggccggcgacttcgtgca	Protospacer
 ****** ******* ******** .**  *

28. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to MH479912 (Gordonia phage Eviarto, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggcggccggcgacttcgtgca	Protospacer
 ****** ******* ******** .**  *

29. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to MK016492 (Gordonia phage Bialota, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggcggccggcgacttcgtgca	Protospacer
 ****** ******* ******** .**  *

30. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to MK820642 (Gordonia phage Polly, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggccggcggcgacttcgtgca	Protospacer
 ****** ***** ********** .**  *

31. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to MK814755 (Gordonia phage Antonio, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggcggccggcgacttcgtgca	Protospacer
 ****** ******* ******** .**  *

32. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to MK875796 (Gordonia phage Tayonia, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggcggccggcgacttcgtgca	Protospacer
 ****** ******* ******** .**  *

33. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to KU963249 (Gordonia phage Yeezy, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggcggccggcgacttcgtgca	Protospacer
 ****** ******* ******** .**  *

34. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to KX557273 (Gordonia phage BatStarr, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggcggccggcgacttcgtgca	Protospacer
 ****** ******* ******** .**  *

35. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to MT521999 (Gordonia Phage Jablanski, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggtgcggcggccggcggcgacttcgtgca	Protospacer
 ***.******** ********** .**  *

36. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to KU963257 (Gordonia phage Kita, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggcggccggcgacttcgtgca	Protospacer
 ****** ******* ******** .**  *

37. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to NC_031097 (Gordonia phage Zirinka, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggcggccggcgacttcgtgca	Protospacer
 ****** ******* ******** .**  *

38. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to MG872834 (Gordonia phage Confidence, complete genome) position: , mismatch: 7, identity: 0.774

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgccgcggccggcggcgacttcgtgca	Protospacer
 ****** ***** ********** .**  *

39. spacer 3.3|4444478|29|NZ_CP011301|CRT matches to MG869616 (Polaromonas sp. E19S plasmid pE19SP1, complete sequence) position: , mismatch: 7, identity: 0.759

ggcggaagccgccgcacaacgccatacgg	CRISPR spacer
cgcggaagccgcagcacaaggccaagcca	Protospacer
 *********** ****** **** .* .

40. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to NZ_CP013072 (Sphingobium indicum B90A plasmid pSRL2, complete sequence) position: , mismatch: 8, identity: 0.742

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
gcggcgcggcgacgggcggcgacgcgatctg	Protospacer
.**********.***********   .** .

41. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to NZ_LR134447 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 5, complete sequence) position: , mismatch: 8, identity: 0.742

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
acggcgcggcggtgcgcggcgacccacgcgg	Protospacer
************.* ********.    **.

42. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to NZ_CP011450 (Sphingomonas sanxanigenens DSM 19645 = NX02 plasmid pNXO2, complete sequence) position: , mismatch: 8, identity: 0.742

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
acggcgcgccagcgggcggcgactccgctcc	Protospacer
******** *.************* .*..

43. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to NZ_CP048816 (Caulobacter rhizosphaerae strain KCTC 52515 plasmid unnamed) position: , mismatch: 8, identity: 0.742

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
cgggcgcggcggcgggccgcgacttttgggg	Protospacer
  *************** ****** *   *.

44. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 8, identity: 0.742

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgcggcggcgggcggtgaccgccgggc	Protospacer
 ******************.***.*.   *

45. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 8, identity: 0.742

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcggcgcggcggcgggcggtgaccgccgggc	Protospacer
 ******************.***.*.   *

46. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to NZ_CP005085 (Sphingobium sp. TKS plasmid pTK1, complete sequence) position: , mismatch: 8, identity: 0.742

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcgccgcggcggcgggcggcggctcggctaa	Protospacer
 ** *****************.**  *...*

47. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to NC_022049 (Paracoccus aminophilus JCM 7686 plasmid pAMI4, complete sequence) position: , mismatch: 8, identity: 0.742

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
gcggcgcggcggcgggcggggacggcgcttt	Protospacer
.****************** *** *.*..

48. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to NZ_CP015370 (Methylobacterium phyllosphaerae strain CBMB27 plasmid CBMB27-p3, complete sequence) position: , mismatch: 8, identity: 0.742

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
gcggcccggcggcgggcggcggcttcgccct	Protospacer
.**** ***************.** .*.*

49. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to KY622015 (Shewanella phage SppYZU01, complete genome) position: , mismatch: 8, identity: 0.742

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
gagtagaggcggcgggcgccgactgggtcgt	Protospacer
. *  * *********** ****** ****

50. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to NC_049432 (Ralstonia phage RsoM1USA, complete genome) position: , mismatch: 8, identity: 0.742

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
gcgcgctggcggcgggcggcgcctgggtcgt	Protospacer
.**   .************** *** ****

51. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to NZ_CP047174 (Rathayibacter sp. VKM Ac-2760 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
tcgtcgcggcggcgggcggcggctccttcag	Protospacer
 ** *****************.** . **..

52. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to LN997845 (Streptomyces reticuli genome assembly TUE45, plasmid : IV) position: , mismatch: 9, identity: 0.71

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
cccaattcccggcgggcggcgaccgtgtcga	Protospacer
 * .  .  **************.*******

53. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to NZ_CP031082 (Paracoccus yeei strain CCUG 32053 plasmid pYEE4, complete sequence) position: , mismatch: 9, identity: 0.71

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
acggggctgcggcgggcggcgacgatccgcg	Protospacer
**** ** *************** .* .  .

54. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to NZ_CP024423 (Paracoccus yeei strain TT13 plasmid pTT13-1, complete sequence) position: , mismatch: 9, identity: 0.71

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
acggggctgcggcgggcggcgacgatccgcg	Protospacer
**** ** *************** .* .  .

55. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to NZ_CP020441 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.71

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
acggggctgcggcgggcggcgacgatcagcg	Protospacer
**** ** *************** .*    .

56. spacer 2.1|1436574|31|NZ_CP011301|CRISPRCasFinder matches to NZ_CP044080 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.71

acggcgcggcggcgggcggcgactgtgtcga	CRISPR spacer
acggggctgcggcgggcggcgacgatccgcg	Protospacer
**** ** *************** .* .  .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

355440 : 379986

Burkholderia_phage(60.0%)

tail,integrase,transposase

attL 372904:372920|attR 391296:391312

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006767226.1\|355440_355947_+\|tail	phage tail protein	R4JGF0	Burkholderia_phage	8.3e-78	89.3
WP_006767227.1\|355951_357031_+	phage late control D family protein	R4JDM6	Burkholderia_phage	7.2e-180	88.6
WP_123806780.1\|357075_357831_-	hypothetical protein	NA	NA	NA	NA
WP_045552353.1\|357919_358447_-	hypothetical protein	R4JDM9	Burkholderia_phage	7.6e-42	51.7
WP_035974134.1\|358685_360176_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_035975634.1\|360772_361669_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_035975636.1\|362208_362514_-	hypothetical protein	NA	NA	NA	NA
WP_006767229.1\|362565_363627_-	aldo/keto reductase	NA	NA	NA	NA
WP_158380464.1\|364381_364858_+	universal stress protein	NA	NA	NA	NA
WP_158380465.1\|365038_366211_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_158380466.1\|366203_366923_+	HAD family phosphatase	NA	NA	NA	NA
WP_123806779.1\|366882_367896_+	hypothetical protein	NA	NA	NA	NA
WP_035975644.1\|368231_368417_+	DUF3563 family protein	NA	NA	NA	NA
WP_035975645.1\|368613_369000_-	VOC family protein	NA	NA	NA	NA
WP_035975646.1\|369241_369679_+	hypothetical protein	NA	NA	NA	NA
WP_006767235.1\|369869_370778_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_035975648.1\|371145_373020_+	amidohydrolase	NA	NA	NA	NA
372904:372920	attL	NA	NA	NA	NA
WP_006767237.1\|373279_373933_+	hydrolase	NA	NA	NA	NA
WP_128567397.1\|374197_375580_-	hypothetical protein	NA	NA	NA	NA
WP_035975650.1\|375597_377334_-	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_006764058.1\|377474_377738_+\|transposase	transposase	NA	NA	NA	NA
WP_045552354.1\|377764_378460_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_081293702.1\|378400_379669_-\|transposase	IS256-like element ISBcen18 family transposase	A0A218MNI5	uncultured_virus	1.7e-39	42.8
WP_158380467.1\|379749_379986_+\|transposase	transposase	S5WIU1	Leptospira_phage	1.5e-10	51.8
391296:391312	attR	NA	NA	NA	NA

DBSCAN-SWA_2

1172648 : 1248250

Vibrio_phage(22.22%)

plate,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035971520.1\|1172648_1173506_+\|protease	zinc metalloprotease HtpX	NA	NA	NA	NA
WP_035973232.1\|1173714_1175118_+	16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB	NA	NA	NA	NA
WP_006763077.1\|1175114_1175705_+	DUF4390 domain-containing protein	NA	NA	NA	NA
WP_035971521.1\|1175694_1178124_+	PAS domain-containing sensor histidine kinase	NA	NA	NA	NA
WP_035971523.1\|1178124_1178826_+	response regulator	NA	NA	NA	NA
WP_035971524.1\|1179300_1180035_+	7-cyano-7-deazaguanine synthase QueC	A0A1B0Z0B4	Vibrio_phage	2.1e-50	43.1
WP_035971525.1\|1180107_1180740_+	7-carboxy-7-deazaguanine synthase	R4TAH8	Halovirus	3.0e-08	35.3
WP_035971526.1\|1180758_1181211_+	6-carboxytetrahydropterin synthase QueD	A0A088FAL2	Vibrio_phage	3.4e-14	31.4
WP_035971527.1\|1181452_1182238_+	HpcH/HpaI aldolase/citrate lyase family protein	NA	NA	NA	NA
WP_035971528.1\|1182234_1183005_+	sel1 repeat family protein	NA	NA	NA	NA
WP_035971529.1\|1183128_1184277_-	rod shape-determining protein RodA	NA	NA	NA	NA
WP_035971530.1\|1184288_1186604_-	penicillin-binding protein 2	NA	NA	NA	NA
WP_006763080.1\|1186689_1187202_-	rod shape-determining protein MreD	NA	NA	NA	NA
WP_035971531.1\|1187198_1188296_-	rod shape-determining protein MreC	NA	NA	NA	NA
WP_004189550.1\|1188422_1189466_-	rod shape-determining protein	NA	NA	NA	NA
WP_006407213.1\|1189834_1190134_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_006763082.1\|1190201_1191692_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_006763083.1\|1191696_1193172_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_006763084.1\|1193288_1194128_+	polyphosphate kinase 2 family protein	NA	NA	NA	NA
WP_006763085.1\|1194171_1194945_+	exodeoxyribonuclease III	R4TWA8	Phaeocystis_globosa_virus	1.6e-27	32.3
WP_035971533.1\|1195071_1196124_-	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L339	Tupanvirus	1.2e-83	46.7
WP_006763087.1\|1196352_1197309_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_035973233.1\|1197368_1198403_-	M48 family metallopeptidase	NA	NA	NA	NA
WP_035971535.1\|1198392_1199814_-	AmpG family muropeptide MFS transporter	NA	NA	NA	NA
WP_006763089.1\|1199925_1200534_-	methionine biosynthesis protein MetW	NA	NA	NA	NA
WP_006763090.1\|1200530_1201676_-	homoserine O-acetyltransferase	NA	NA	NA	NA
WP_128567331.1\|1203552_1204572_-	hypothetical protein	NA	NA	NA	NA
WP_035971538.1\|1204743_1205331_+	type 1 fimbrial protein	NA	NA	NA	NA
WP_045552502.1\|1205472_1206153_+	fimbria/pilus periplasmic chaperone	NA	NA	NA	NA
WP_162487093.1\|1206410_1208939_+	fimbria/pilus outer membrane usher protein	NA	NA	NA	NA
WP_052688723.1\|1208978_1209542_+	type 1 fimbrial protein	NA	NA	NA	NA
WP_081293564.1\|1209576_1210272_+	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_006763095.1\|1210268_1211942_+	OmpA family protein	NA	NA	NA	NA
WP_006763096.1\|1212303_1212843_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_035971540.1\|1212885_1214385_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_035971542.1\|1214586_1215069_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_006763099.1\|1215205_1215745_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_006763100.1\|1215746_1217096_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_006763101.1\|1217092_1218388_+	type VI secretion system protein TssL	NA	NA	NA	NA
WP_006763102.1\|1218402_1222314_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_006763103.1\|1222719_1223283_+	hypothetical protein	NA	NA	NA	NA
WP_035971545.1\|1223376_1225956_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	2.1e-36	27.6
WP_035971546.1\|1226041_1226308_+	PAAR domain-containing protein	NA	NA	NA	NA
WP_035971547.1\|1226346_1229799_+	RHS repeat protein	NA	NA	NA	NA
WP_006763106.1\|1229877_1231230_-	hypothetical protein	A0A292GJ55	Xanthomonas_phage	4.3e-105	45.9
WP_006763107.1\|1231259_1232294_-	fimbrial protein	NA	NA	NA	NA
WP_006763108.1\|1232343_1233402_-	type VI secretion system ImpA family N-terminal domain-containing protein	NA	NA	NA	NA
WP_006763109.1\|1233398_1234460_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_006763110.1\|1234463_1236344_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_006763111.1\|1236345_1236867_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_035973237.1\|1236850_1237684_-	ImpE protein	NA	NA	NA	NA
WP_006763113.1\|1237707_1238370_-	TagK domain-containing protein	NA	NA	NA	NA
WP_006763114.1\|1238876_1241534_+	type VI secretion system ATPase TssH	A0A248SJW6	Salicola_phage	1.1e-72	31.0
WP_006763115.1\|1241635_1242307_-	nucleoid occlusion factor SlmA	NA	NA	NA	NA
WP_006763116.1\|1242273_1243065_-	pyrimidine 5'-nucleotidase	NA	NA	NA	NA
WP_006490510.1\|1243061_1243961_-	acetylglutamate kinase	NA	NA	NA	NA
WP_035973239.1\|1244252_1244477_+	cysteine-rich CWC family protein	NA	NA	NA	NA
WP_035971549.1\|1244582_1246016_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_006763117.1\|1246029_1246572_+	response regulator transcription factor	NA	NA	NA	NA
WP_035971551.1\|1246906_1248250_-\|protease	ATP-dependent protease ATPase subunit HslU	A0A191ZC11	Erwinia_phage	1.6e-43	29.2

DBSCAN-SWA_3

2010825 : 2026667

Burkholderia_virus(50.0%)

integrase

attL 2006462:2006478|attR 2036225:2036241

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2006462:2006478	attL	NA	NA	NA	NA
WP_006763729.1\|2010825_2013423_+	hypothetical protein	Q6J1R0	Burkholderia_virus	0.0e+00	78.4
WP_081293570.1\|2013419_2013914_+	HNH endonuclease	Q7Y5F9	Xanthomonas_virus	4.1e-29	43.1
WP_035971950.1\|2013923_2014316_+	hypothetical protein	NA	NA	NA	NA
WP_052688661.1\|2015984_2018351_+	hypothetical protein	Q6J1Q9	Burkholderia_virus	2.3e-69	51.0
WP_006763731.1\|2018363_2018699_+	hypothetical protein	Q6J1Q7	Burkholderia_virus	1.3e-50	95.5
WP_035971951.1\|2018695_2018974_+	hypothetical protein	Q6J1Q6	Burkholderia_virus	1.3e-40	91.1
WP_006763733.1\|2018960_2019380_+	glycoside hydrolase family protein	A0A1I9L2K1	Xanthomonas_phage	9.8e-16	39.0
WP_035971952.1\|2019376_2019874_+	DUF2514 family protein	Q6J1Q4	Burkholderia_virus	3.7e-54	76.7
WP_035971954.1\|2019870_2020842_+	hypothetical protein	NA	NA	NA	NA
WP_006763735.1\|2020838_2021897_-	acyltransferase	A9YX16	Burkholderia_phage	1.1e-23	33.5
WP_006763736.1\|2022069_2023272_-\|integrase	integrase arm-type DNA-binding domain-containing protein	B7SYF8	Stenotrophomonas_phage	5.2e-86	44.6
WP_006763737.1\|2023680_2023863_-	rubredoxin	NA	NA	NA	NA
WP_035971957.1\|2024087_2024492_+	DUF4399 domain-containing protein	NA	NA	NA	NA
WP_035971959.1\|2024717_2026667_+	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	4.1e-48	28.9
2036225:2036241	attR	NA	NA	NA	NA

DBSCAN-SWA_4

2399542 : 2437332

Stx2-converting_phage(23.08%)

transposase,protease,integrase

attL 2402185:2402205|attR 2448853:2448873

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972159.1\|2399542_2400913_+\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_006764032.1\|2400977_2403284_+	outer membrane protein assembly factor BamA	NA	NA	NA	NA
2402185:2402205	attL	NA	NA	NA	NA
WP_081293580.1\|2403318_2403846_+	OmpH family outer membrane protein	NA	NA	NA	NA
WP_006764034.1\|2403862_2404969_+	UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase	NA	NA	NA	NA
WP_006495559.1\|2405098_2405566_+	3-hydroxyacyl-ACP dehydratase FabZ	NA	NA	NA	NA
WP_006764035.1\|2405624_2406413_+	acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase	NA	NA	NA	NA
WP_035972165.1\|2406416_2407586_+	lipid-A-disaccharide synthase	NA	NA	NA	NA
WP_006764036.1\|2407582_2408230_+	ribonuclease HII	D2TEQ2	Emiliania_huxleyi_virus	2.7e-28	42.8
WP_006764037.1\|2408226_2409009_+	RNA methyltransferase	NA	NA	NA	NA
WP_035972167.1\|2409123_2409939_-	kinase/pyrophosphorylase	NA	NA	NA	NA
WP_006764039.1\|2410315_2412715_+	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	6.3e-168	35.7
WP_006764040.1\|2412839_2413274_+	NfeD family protein	NA	NA	NA	NA
WP_006764041.1\|2413307_2414243_+	SPFH/Band 7/PHB domain protein	NA	NA	NA	NA
WP_006764042.1\|2414396_2414843_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	1.0e-26	42.1
WP_006764043.1\|2414941_2415379_+	type II toxin-antitoxin system RatA family toxin	NA	NA	NA	NA
WP_006764044.1\|2415383_2415707_+	RnfH family protein	NA	NA	NA	NA
WP_006764045.1\|2415795_2416779_-	DMT family transporter	NA	NA	NA	NA
WP_006764046.1\|2416873_2417566_-	hypothetical protein	NA	NA	NA	NA
WP_035972169.1\|2417597_2418755_-	HTH domain-containing protein	NA	NA	NA	NA
WP_006764047.1\|2418868_2419633_+	DUF899 domain-containing protein	NA	NA	NA	NA
WP_045552515.1\|2419673_2420489_+	DUF2182 domain-containing protein	NA	NA	NA	NA
WP_006764048.1\|2420765_2422226_+	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	3.3e-95	39.6
WP_035972172.1\|2422232_2422850_+	hypothetical protein	NA	NA	NA	NA
WP_006764050.1\|2422965_2424585_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	2.5e-14	28.6
WP_006764051.1\|2424886_2426143_+\|integrase	tyrosine-type recombinase/integrase	A0A1X9TCT6	Enterobacter_phage	1.0e-116	52.8
WP_081293581.1\|2426203_2426479_+	hypothetical protein	NA	NA	NA	NA
WP_035973335.1\|2426483_2427008_+	DNA-binding protein	J9Q7G7	Salmonella_phage	2.4e-11	36.0
WP_035972174.1\|2427076_2430316_+	hypothetical protein	NA	NA	NA	NA
WP_158380473.1\|2430379_2431024_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	6.5e-43	45.8
WP_006764054.1\|2431114_2431522_+	IS66 family insertion sequence hypothetical protein	B6DZU5	Stx2-converting_phage	1.5e-13	45.1
WP_006764055.1\|2431518_2431866_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	1.2e-40	72.9
WP_006764056.1\|2431895_2433458_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	4.6e-151	54.3
WP_006765345.1\|2433498_2434095_+	plasmid pRiA4b ORF-3 family protein	A0A2H4PDG5	Mycobacterium_phage	6.0e-27	38.6
WP_006764058.1\|2434338_2434602_-\|transposase	transposase	NA	NA	NA	NA
WP_006763677.1\|2436072_2437332_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.9e-44	45.0
2448853:2448873	attR	NA	NA	NA	NA

DBSCAN-SWA_5

2876764 : 2930490

Burkholderia_phage(55.0%)

terminase,capsid,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045552434.1\|2876764_2877241_-	DUF2514 family protein	Q3HQV1	Burkholderia_phage	1.3e-56	85.7
WP_006764384.1\|2877240_2877738_-	lysozyme	Q3HQU9	Burkholderia_phage	4.3e-79	87.9
WP_045552435.1\|2877730_2877913_-	hypothetical protein	NA	NA	NA	NA
WP_134220896.1\|2878010_2879195_+	hypothetical protein	NA	NA	NA	NA
WP_045552437.1\|2879423_2880416_-	hypothetical protein	A9YX14	Burkholderia_phage	1.9e-62	37.0
WP_045552438.1\|2880479_2881145_-	DUF2612 domain-containing protein	A9YX13	Burkholderia_phage	1.4e-112	88.1
WP_006764386.1\|2881144_2882326_-\|plate	baseplate J/gp47 family protein	A9YX12	Burkholderia_phage	3.1e-192	91.6
WP_045552439.1\|2882322_2882676_-	hypothetical protein	A9YX11	Burkholderia_phage	2.8e-56	94.9
WP_052688677.1\|2882680_2883157_-	HNH endonuclease	A0A0E3M1E6	Bacillus_phage	4.1e-18	40.0
WP_006764388.1\|2883165_2883915_-	hypothetical protein	A9YX06	Burkholderia_phage	3.8e-127	93.6
WP_006764389.1\|2883918_2884296_+	hypothetical protein	A9YX05	Burkholderia_phage	2.6e-60	91.2
WP_045552440.1\|2884292_2885261_-	hypothetical protein	A9YX04	Burkholderia_phage	5.2e-145	88.6
WP_045552441.1\|2885257_2885575_-	hypothetical protein	NA	NA	NA	NA
WP_045552442.1\|2885574_2886150_-	hypothetical protein	A0A0M3ULD5	Salmonella_phage	2.0e-19	36.8
WP_006764391.1\|2886146_2888141_-	hypothetical protein	A0A0M4REK7	Salmonella_phage	9.7e-37	35.0
WP_045552443.1\|2888324_2888894_-	hypothetical protein	A0A0N7IRF3	Acinetobacter_phage	6.4e-18	35.4
WP_045552444.1\|2888902_2889400_-	HNH endonuclease	Q2NPG0	Xanthomonas_virus	2.7e-33	45.6
WP_006764395.1\|2889399_2889840_-	DUF3277 family protein	A0A0P0IKY2	Acinetobacter_phage	7.1e-41	57.5
WP_006764396.1\|2889855_2891331_-	DUF3383 domain-containing protein	A0A0P0I492	Acinetobacter_phage	1.1e-109	46.7
WP_158380477.1\|2891445_2891928_+	HNH endonuclease	A0A220GJG3	Streptococcus_phage	1.0e-16	38.2
WP_006764397.1\|2891915_2892494_-	hypothetical protein	A9YX29	Burkholderia_phage	2.0e-91	88.2
WP_045552446.1\|2892498_2892870_-	hypothetical protein	A9YX28	Burkholderia_phage	7.2e-63	94.3
WP_006764399.1\|2892931_2893414_-	hypothetical protein	A9YX26	Burkholderia_phage	4.2e-71	88.7
WP_006764400.1\|2893441_2893825_-	DUF4054 domain-containing protein	A9YX25	Burkholderia_phage	1.3e-59	90.6
WP_045552447.1\|2893884_2894370_-	hypothetical protein	A9YX24	Burkholderia_phage	3.5e-17	78.4
WP_006764401.1\|2894371_2895463_-	DUF2184 domain-containing protein	A9YX23	Burkholderia_phage	8.4e-152	92.0
WP_045552448.1\|2895530_2896037_-	hypothetical protein	NA	NA	NA	NA
WP_006764402.1\|2896046_2897498_-	DUF2213 domain-containing protein	A9YX03	Burkholderia_phage	4.3e-212	89.9
WP_045552449.1\|2897669_2897963_-	hypothetical protein	A9YWZ9	Burkholderia_phage	1.1e-53	92.8
WP_006764404.1\|2897964_2898720_-\|capsid	minor capsid protein	A9YWZ8	Burkholderia_phage	9.7e-131	96.0
WP_006764405.1\|2898716_2900183_-	DUF1073 domain-containing protein	A9YWZ7	Burkholderia_phage	5.8e-265	94.8
WP_006764406.1\|2900203_2901757_-\|terminase	phage terminase large subunit	H9C0C7	Vibrio_phage	8.7e-110	45.4
WP_006764407.1\|2901707_2902187_-	DUF2280 domain-containing protein	A9YWZ5	Burkholderia_phage	4.1e-58	78.9
WP_006764408.1\|2902204_2902858_-	hypothetical protein	A9YWZ4	Burkholderia_phage	1.1e-103	84.9
WP_045552450.1\|2902854_2903034_-	hypothetical protein	NA	NA	NA	NA
WP_045552451.1\|2903158_2903590_-	hypothetical protein	NA	NA	NA	NA
WP_081293711.1\|2903586_2903880_-	hypothetical protein	A9YWZ0	Burkholderia_phage	1.9e-21	61.2
WP_006764411.1\|2903926_2904397_-	RusA family crossover junction endodeoxyribonuclease	A9YWY9	Burkholderia_phage	1.4e-63	80.1
WP_045552453.1\|2904393_2904654_-	hypothetical protein	NA	NA	NA	NA
WP_045552520.1\|2904650_2905082_-	hypothetical protein	NA	NA	NA	NA
WP_045552454.1\|2905750_2906740_-	phosphoadenosine phosphosulfate reductase family protein	Q8W6P3	Burkholderia_virus	1.5e-139	73.3
WP_045552522.1\|2906724_2907195_-	hypothetical protein	Q6JIG5	Burkholderia_virus	9.8e-65	80.0
WP_045552455.1\|2907248_2907896_+	hypothetical protein	NA	NA	NA	NA
WP_045552523.1\|2907952_2908168_-	hypothetical protein	A9YWY0	Burkholderia_phage	3.0e-29	85.7
WP_045552456.1\|2908170_2908545_-	hypothetical protein	A9YWX9	Burkholderia_phage	1.7e-59	87.9
WP_045552457.1\|2908711_2909092_+	hypothetical protein	NA	NA	NA	NA
WP_045552458.1\|2909242_2909488_-	helix-turn-helix domain-containing protein	A0A0M3LQ90	Mannheimia_phage	2.2e-12	47.3
WP_045552459.1\|2909574_2909961_+	hypothetical protein	A9YWX7	Burkholderia_phage	2.4e-08	64.3
WP_006764415.1\|2910968_2911385_+	hypothetical protein	NA	NA	NA	NA
WP_123806838.1\|2911481_2912213_+	hypothetical protein	A0A291L9Z7	Bordetella_phage	2.3e-73	57.2
WP_094190562.1\|2912261_2912615_+	hypothetical protein	Q3HQW8	Burkholderia_phage	1.7e-13	66.2
WP_045552462.1\|2912614_2912905_+	hypothetical protein	Q6V7Q5	Burkholderia_virus	1.0e-24	60.8
WP_045552463.1\|2912901_2913081_+	hypothetical protein	A9YWW6	Burkholderia_phage	2.5e-13	69.0
WP_006764418.1\|2913384_2914194_+	PD-(D/E)XK nuclease family protein	J7HXJ4	Pseudomonas_phage	8.0e-91	60.9
WP_045552464.1\|2914208_2915408_+	hypothetical protein	J7HXB6	Pseudomonas_phage	1.1e-62	52.2
WP_045552465.1\|2915420_2917187_+	AAA family ATPase	J7HXJ7	Pseudomonas_phage	5.7e-73	37.0
WP_006764420.1\|2917183_2917819_+	hypothetical protein	A9YX18	Burkholderia_phage	2.1e-17	85.2
WP_105773984.1\|2918044_2919541_+	hypothetical protein	A0A0K2FMB2	Brevibacillus_phage	1.4e-80	45.3
WP_045552466.1\|2919546_2919999_+	hypothetical protein	A9YX19	Burkholderia_phage	6.3e-77	90.8
WP_045552467.1\|2919995_2920190_+	hypothetical protein	A9YX20	Burkholderia_phage	1.7e-18	82.1
WP_105773983.1\|2920194_2920674_+	hypothetical protein	A0A0K2FHI1	Achromobacter_phage	5.0e-32	48.2
WP_045552468.1\|2920813_2921137_+	hypothetical protein	A0A076G9A8	Mycobacterium_phage	2.7e-05	31.3
WP_006764424.1\|2921169_2921994_+	YfdQ family protein	I6NVL7	Burkholderia_virus	1.9e-39	37.5
WP_006764425.1\|2922223_2924233_+	DNA cytosine methyltransferase	A9YX21	Burkholderia_phage	2.9e-158	74.8
WP_006764426.1\|2924229_2925264_+	site-specific DNA-methyltransferase	Q8W6P4	Burkholderia_virus	1.2e-134	66.8
WP_045552470.1\|2926073_2927390_+	hypothetical protein	A4JWW2	Burkholderia_virus	1.0e-10	56.2
WP_123806839.1\|2927379_2927751_+	hypothetical protein	Q6JIJ2	Burkholderia_virus	5.6e-07	41.2
WP_006764430.1\|2927753_2927963_-	hypothetical protein	A9YWV5	Burkholderia_phage	2.8e-24	77.9
WP_045552471.1\|2927998_2928919_+	phage Gp37/Gp68 family protein	Q8W6R4	Burkholderia_virus	5.5e-128	66.9
WP_045552472.1\|2928921_2929257_-	hypothetical protein	NA	NA	NA	NA
WP_006764431.1\|2929294_2929783_+	DUF1643 domain-containing protein	B5WZV8	Pseudomonas_phage	5.4e-42	52.5
WP_006764432.1\|2929779_2930490_+	hypothetical protein	A0A0U1SZL2	Pseudomonas_phage	3.6e-34	42.9

DBSCAN-SWA_6

3339080 : 3406359

Leptospira_phage(28.57%)

transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045552534.1\|3339080_3340211_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_035972705.1\|3340727_3342176_-	NYN domain-containing protein	A0A2P0VNQ4	Tetraselmis_virus	2.9e-06	33.0
WP_006764722.1\|3342470_3343097_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_035972708.1\|3343152_3343701_-	peroxiredoxin	NA	NA	NA	NA
WP_035972710.1\|3343884_3345717_+	cyclic di-GMP phosphodiesterase CdpA	NA	NA	NA	NA
WP_035972712.1\|3345744_3347244_+	HDOD domain-containing protein	NA	NA	NA	NA
WP_035972714.1\|3347343_3348138_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_035972715.1\|3348443_3349502_-	succinylglutamate desuccinylase	NA	NA	NA	NA
WP_035972717.1\|3349485_3350826_-	N-succinylarginine dihydrolase	NA	NA	NA	NA
WP_035972719.1\|3350840_3352304_-	succinylglutamate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_035972720.1\|3352311_3353358_-	arginine N-succinyltransferase	NA	NA	NA	NA
WP_006764730.1\|3353354_3354422_-	arginine/ornithine succinyltransferase subunit alpha	NA	NA	NA	NA
WP_006764731.1\|3354452_3355685_-	aspartate aminotransferase family protein	NA	NA	NA	NA
WP_094190579.1\|3355878_3357008_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.9e-50	43.5
WP_123806846.1\|3357682_3360172_+	hypothetical protein	NA	NA	NA	NA
WP_094190580.1\|3360264_3361498_+\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	6.9e-102	64.8
WP_123806847.1\|3363158_3364112_-	hypothetical protein	NA	NA	NA	NA
WP_123806848.1\|3364656_3364920_+	hypothetical protein	NA	NA	NA	NA
WP_006764737.1\|3365037_3366078_-	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_006764738.1\|3366100_3366895_-	ATP-binding cassette domain-containing protein	M1H3A1	Paramecium_bursaria_Chlorella_virus	9.2e-07	23.1
WP_006764739.1\|3366916_3367630_-	ABC transporter permease	NA	NA	NA	NA
WP_035972727.1\|3367626_3368316_-	histidine ABC transporter permease HisQ	NA	NA	NA	NA
WP_006764740.1\|3368590_3369148_-	hypothetical protein	NA	NA	NA	NA
WP_035972729.1\|3369256_3370294_-	flippase-like domain-containing protein	NA	NA	NA	NA
WP_035972731.1\|3370290_3371175_-	hopanoid biosynthesis-associated protein HpnK	NA	NA	NA	NA
WP_035972733.1\|3371178_3372600_-	hopanoid biosynthesis associated radical SAM protein HpnJ	NA	NA	NA	NA
WP_035972735.1\|3372760_3373936_-	bacteriohopanetetrol glucosamine biosynthesis glycosyltransferase HpnI	NA	NA	NA	NA
WP_035972737.1\|3374566_3375565_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_006764746.1\|3375622_3376684_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_006764747.1\|3376858_3377719_+	pyridoxal kinase PdxY	NA	NA	NA	NA
WP_035972739.1\|3377977_3380119_+\|holin	phospholipase C, phosphocholine-specific	NA	NA	NA	NA
WP_006764750.1\|3380485_3381634_+	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_035972741.1\|3381859_3382621_-	FadR family transcriptional regulator	NA	NA	NA	NA
WP_006764752.1\|3383041_3384394_+	glucarate dehydratase	NA	NA	NA	NA
WP_006764753.1\|3384546_3385011_-	DUF2214 family protein	NA	NA	NA	NA
WP_006764754.1\|3385048_3385852_-	hypothetical protein	NA	NA	NA	NA
WP_006764755.1\|3386097_3387162_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_035972743.1\|3387730_3389563_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.6e-40	27.9
WP_006764757.1\|3389771_3391151_-	alpha,alpha-trehalose-phosphate synthase (UDP-forming)	NA	NA	NA	NA
WP_006764758.1\|3391147_3391900_-	trehalose-phosphatase	NA	NA	NA	NA
WP_035972744.1\|3392192_3392828_+	SCO family protein	NA	NA	NA	NA
WP_006764759.1\|3392836_3393277_+	copper chaperone PCu(A)C	NA	NA	NA	NA
WP_006764760.1\|3393287_3394157_+	cytochrome c oxidase assembly protein	NA	NA	NA	NA
WP_035972745.1\|3394181_3394673_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_035973394.1\|3394796_3395663_-	pirin family protein	NA	NA	NA	NA
WP_006764762.1\|3395772_3396690_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_006764764.1\|3396822_3397326_+	GAF domain-containing protein	NA	NA	NA	NA
WP_035972746.1\|3397498_3398305_-	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_035972748.1\|3398304_3398541_-	ParD-like family protein	NA	NA	NA	NA
WP_035972750.1\|3398687_3399311_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_006764767.1\|3399349_3399898_+	N-acetyltransferase	NA	NA	NA	NA
WP_052688700.1\|3402071_3402719_-	hypothetical protein	NA	NA	NA	NA
WP_094190582.1\|3402754_3403884_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.9e-50	43.5
WP_006763677.1\|3405099_3406359_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.9e-44	45.0

DBSCAN-SWA_7

3683798 : 3697840

Enterobacteria_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035972937.1\|3683798_3687524_-	glycosyltransferase	A0A1X9SJW0	Sulfolobus_islandicus_rod-shaped_virus	1.6e-05	26.3
WP_045552536.1\|3687524_3688853_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_006765006.1\|3689195_3690641_-	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	2.0e-52	28.2
WP_035972940.1\|3690863_3691754_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	7.6e-26	34.6
WP_035972942.1\|3691750_3692302_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	2.7e-50	53.6
WP_035972943.1\|3692286_3693180_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	1.3e-97	59.2
WP_006765010.1\|3693191_3694253_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	1.6e-86	47.3
WP_081293608.1\|3694749_3696102_+	FkbM family methyltransferase	NA	NA	NA	NA
WP_035973415.1\|3696098_3696722_+	acetyltransferase	NA	NA	NA	NA
WP_046377167.1\|3696736_3697840_+	DegT/DnrJ/EryC1/StrS family aminotransferase	A0A2K9L470	Tupanvirus	9.1e-45	33.7

DBSCAN-SWA_8

4061422 : 4131773

Stx2-converting_phage(25.0%)

transposase,plate,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006765301.1\|4061422_4062721_+\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_006765302.1\|4062803_4063886_+	peptide chain release factor 1	A0A0S4KWG0	Pseudomonas_phage	6.7e-08	46.6
WP_006765303.1\|4063893_4064736_+	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_006765304.1\|4064803_4065115_+	Grx4 family monothiol glutaredoxin	NA	NA	NA	NA
WP_006765305.1\|4065143_4065740_+	UbiX family flavin prenyltransferase	NA	NA	NA	NA
WP_006765306.1\|4065960_4066752_+	dioxygenase	NA	NA	NA	NA
WP_006765307.1\|4066863_4068462_-	APC family permease	NA	NA	NA	NA
WP_006477070.1\|4068885_4069089_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	1.4e-20	71.6
WP_045552539.1\|4069187_4070438_-	Hsp70 family protein	NA	NA	NA	NA
WP_035973132.1\|4070632_4071238_-	nitroreductase family protein	NA	NA	NA	NA
WP_035973134.1\|4071371_4072655_-	MFS transporter	NA	NA	NA	NA
WP_006765310.1\|4072875_4073496_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_035973136.1\|4073557_4074130_+	DUF1415 domain-containing protein	NA	NA	NA	NA
WP_006765312.1\|4074193_4075084_-	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_035973137.1\|4075173_4076307_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_035973138.1\|4076621_4077113_-	LEA type 2 family protein	NA	NA	NA	NA
WP_006765315.1\|4077757_4079926_+	peptidase M1	A0A0P0IY26	Acinetobacter_phage	1.4e-49	26.4
WP_035973435.1\|4080045_4081074_-	transporter	NA	NA	NA	NA
WP_006765317.1\|4081269_4082232_-	hypothetical protein	NA	NA	NA	NA
WP_006765318.1\|4082353_4083199_+	M15 family metallopeptidase	NA	NA	NA	NA
WP_006765319.1\|4083500_4087442_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_006765320.1\|4087438_4088428_+	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_006765321.1\|4088432_4089386_+	OmpA family protein	NA	NA	NA	NA
WP_006765322.1\|4089741_4090878_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_006765323.1\|4090919_4093586_-	type VI secretion system ATPase TssH	A0A223W0B1	Agrobacterium_phage	5.9e-90	31.6
WP_006765324.1\|4093630_4094731_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_006765325.1\|4094694_4096530_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_006765326.1\|4096607_4097093_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_006765327.1\|4097155_4097659_-	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_006765328.1\|4097729_4099220_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_006765329.1\|4099235_4099751_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_035973140.1\|4099788_4100421_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_006765331.1\|4100797_4101409_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_006765332.1\|4101511_4102858_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_006765333.1\|4102854_4103637_+	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_006765334.1\|4103709_4104018_-	hypothetical protein	NA	NA	NA	NA
WP_123806799.1\|4104348_4104942_-	hypothetical protein	NA	NA	NA	NA
WP_081293616.1\|4105465_4105669_-	hypothetical protein	NA	NA	NA	NA
WP_081293617.1\|4105793_4106123_-	hypothetical protein	NA	NA	NA	NA
WP_006765336.1\|4110747_4113924_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	5.4e-58	26.8
WP_006765337.1\|4114249_4115050_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_006765338.1\|4115159_4115363_-	hypothetical protein	NA	NA	NA	NA
WP_052688713.1\|4115957_4117712_+	beta-galactosidase	NA	NA	NA	NA
WP_094190595.1\|4117774_4118903_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.9e-50	43.5
WP_006765340.1\|4120003_4120711_-	pirin family protein	NA	NA	NA	NA
WP_035973142.1\|4120794_4121559_-	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	7.8e-11	29.3
WP_006765341.1\|4121697_4122615_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_006765343.1\|4122777_4123743_+	alpha/beta hydrolase	L7RDF8	Acanthamoeba_polyphaga_moumouvirus	5.9e-56	39.2
WP_035973143.1\|4123776_4124181_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_035973439.1\|4124451_4125882_-	hypothetical protein	NA	NA	NA	NA
WP_035973144.1\|4126421_4126997_-	recombinase family protein	A0A219Y912	Aeromonas_phage	1.2e-24	42.6
WP_035973145.1\|4127352_4127853_+	DUF4365 domain-containing protein	NA	NA	NA	NA
WP_035973146.1\|4127849_4128974_+	hypothetical protein	NA	NA	NA	NA
WP_105773880.1\|4129141_4129333_-	SH3 domain-containing protein	NA	NA	NA	NA
WP_006764054.1\|4129429_4129837_+	IS66 family insertion sequence hypothetical protein	B6DZU5	Stx2-converting_phage	1.5e-13	45.1
WP_006764055.1\|4129833_4130181_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	1.2e-40	72.9
WP_006764056.1\|4130210_4131773_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	4.6e-151	54.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP011301

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection