CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP005975	Pseudomonas simiae strain PICF7 chromosome, complete genome	1 crisprs	csa3,DinG,DEDDh,cas3,RT,WYL	0	1	5	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP005975_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP005975_1

5087020-5087120

Orphan

Consensus_repeat	Method
GGCAATTTCAAAAATGATCCCGAGCGCGCCGCCGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP005975_1

>merge|NZ_CP005975|1|5087020-5087120|CRISPRCasFinder
GGCAATTTCAAAAATGATCCCGAGCGCGCCGCCGAGGCCGGTAGCAAAGGCGGCCAGAACAGCGGGGGCAATTTCAAGAATGATCCCGAGCGCGCCGCCGA

>NZ_CP005975|1|1|5087020-5087120|CRISPRCasFinder
GGCAATTTCAAAAATGATCCCGAGCGCGCCGCCGA	GGCCGGTAGCAAAGGCGGCCAGAACAGCGGG
GGCAATTTCAAGAATGATCCCGAGCGCGCCGCCGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP005975.1\|WP_034103397.1\|5080969_5085115_+\|PAS-domain-S-box-protein	unknown	unknown	gnl\|CDD\|214534
NZ_CP005975.1\|WP_045792172.1\|5074416_5077290_-\|TAT-variant-translocated-molybdopterin-oxidoreductase	unknown	unknown	gnl\|CDD\|239165
NZ_CP005975.1\|WP_034103402.1\|5094491_5096465_+\|cytochrome-o-ubiquinol-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|131890
NZ_CP005975.1\|WP_027616394.1\|5096468_5097083_+\|cytochrome-o-ubiquinol-oxidase-subunit-III	unknown	unknown	gnl\|CDD\|182628
NZ_CP005975.1\|WP_027616397.1\|5092849_5093164_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP005975.1\|WP_027616408.1\|5079813_5080671_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187613
NZ_CP005975.1\|WP_027616412.1\|5073062_5074427_-\|polysulfide-reductase-NrfD	unknown	unknown	gnl\|CDD\|309148
NZ_CP005975.1\|WP_080758260.1\|5091384_5092647_-\|amino-acid-permease	unknown	unknown	gnl\|CDD\|129987
NZ_CP005975.1\|WP_027616409.1\|5078002_5079796_-\|thiamine-pyrophosphate-requiring-protein	unknown	unknown	gnl\|CDD\|181344
NZ_CP005975.1\|WP_027616403.1\|5087291_5087843_+\|Clp-protease	unknown	unknown	gnl\|CDD\|223811
NZ_CP005975.1\|WP_045792173.1\|5089291_5090125_+\|DUF2892-domain-containing-protein	unknown	unknown	gnl\|CDD\|176859
NZ_CP005975.1\|WP_027616396.1\|5093565_5094489_+\|ubiquinol-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|182518
NZ_CP005975.1\|WP_034103399.1\|5085602_5085845_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP005975.1\|WP_027616406.1\|5085306_5085606_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP005975.1\|WP_033865883.1\|5072545_5073070_-\|DUF3341-domain-containing-protein	unknown	unknown	gnl\|CDD\|378727
NZ_CP005975.1\|WP_027616402.1\|5087872_5088112_+\|DUF2934-domain-containing-protein	unknown	unknown	gnl\|CDD\|378572
NZ_CP005975.1\|WP_027616401.1\|5088308_5088524_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP005975.1\|WP_027616405.1\|5086381_5086555_+\|general-stress-protein	unknown	unknown	gnl\|CDD\|226252
NZ_CP005975.1\|WP_027616399.1\|5090124_5091294_+\|glutathione-dependent-formaldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|176243
NZ_CP005975.1\|WP_034103394.1\|5077286_5077943_-\|cytochrome-c3-family-protein	unknown	unknown	gnl\|CDD\|173979

Protein	Function_ID	Function_description	E-value
NZ_CP005975.1\|WP_034103397.1\|5080969_5085115_+\|PAS-domain-S-box-protein	gnl\|CDD\|214534	smart00138, MeTrc, Methyltransferase, chemotaxis proteins. Methylates methyl-accepting chemotaxis proteins to form gamma-glutamyl methyl ester residues.	8.7444e-103
NZ_CP005975.1\|WP_045792172.1\|5074416_5077290_-\|TAT-variant-translocated-molybdopterin-oxidoreductase	gnl\|CDD\|239165	cd02764, MopB_PHLH, The MopB_PHLH CD includes a group of related uncharacterized putative hydrogenase-like homologs (PHLH) of molybdopterin binding (MopB) proteins. This CD is of the PHLH region homologous to the catalytic molybdopterin-binding subunit of MopB homologs.	3.56449e-85
NZ_CP005975.1\|WP_034103402.1\|5094491_5096465_+\|cytochrome-o-ubiquinol-oxidase-subunit-I	gnl\|CDD\|131890	TIGR02843, Cytochrome_bo3_ubiquinol_oxidase_subunit_1, cytochrome o ubiquinol oxidase, subunit I. Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain which reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane. Also known as the cytochrome bo complex, cytochrome o ubiquinol oxidase contains four subunits, two heme b cofactors and a copper atom which is believed to be the oxygen active site. This complex is structurally related to the cytochrome caa3 oxidases which utilize cytochrome c as the reductant and contain heme a cofactors, as well as the intermediate form aa3 oxidases which also react directly with quinones as the reductant. [Energy metabolism, Electron transport].	0
NZ_CP005975.1\|WP_027616394.1\|5096468_5097083_+\|cytochrome-o-ubiquinol-oxidase-subunit-III	gnl\|CDD\|182628	PRK10663, PRK10663, cytochrome o ubiquinol oxidase subunit III; Provisional.	4.57457e-112
NZ_CP005975.1\|WP_027616408.1\|5079813_5080671_-\|SDR-family-oxidoreductase	gnl\|CDD\|187613	cd05355, SDR_c1, classical (c) SDR, subgroup 1. These proteins are members of the classical SDR family, with a canonical active site tetrad and a typical Gly-rich NAD-binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	5.8113e-151
NZ_CP005975.1\|WP_027616412.1\|5073062_5074427_-\|polysulfide-reductase-NrfD	gnl\|CDD\|309148	pfam03916, NrfD, Polysulphide reductase, NrfD. NrfD is an integral transmembrane protein with loops in both the periplasm and the cytoplasm. NrfD is thought to participate in the transfer of electrons, from the quinone pool into the terminal components of the Nrf pathway.	6.82852e-17
NZ_CP005975.1\|WP_080758260.1\|5091384_5092647_-\|amino-acid-permease	gnl\|CDD\|129987	TIGR00909, putative_amino_acid_transporter, amino acid transporter. [Transport and binding proteins, Amino acids, peptides and amines].	8.37865e-44
NZ_CP005975.1\|WP_027616403.1\|5087291_5087843_+\|Clp-protease	gnl\|CDD\|223811	COG0740, ClpP, Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion].	3.7348e-31
NZ_CP005975.1\|WP_045792173.1\|5089291_5090125_+\|DUF2892-domain-containing-protein	gnl\|CDD\|176859	cd07817, SRPBCC_8, Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins. Uncharacterized group of the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands. SRPBCC domains include the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of mammalian STARD1-STARD15, the C-terminal catalytic domains of the alpha oxygenase subunit of Rieske-type non-heme iron aromatic ring-hydroxylating oxygenases (RHOs_alpha_C), Class I and II phosphatidylinositol transfer proteins (PITPs), Bet v 1 (the major pollen allergen of white birch, Betula verrucosa), CoxG, CalC, and related proteins. Other members of the superfamily include PYR/PYL/RCAR plant proteins, the aromatase/cyclase (ARO/CYC) domains of proteins such as Streptomyces glaucescens tetracenomycin, and the SRPBCC domains of Streptococcus mutans Smu.440 and related proteins.	3.59306e-13
NZ_CP005975.1\|WP_027616396.1\|5093565_5094489_+\|ubiquinol-oxidase-subunit-II	gnl\|CDD\|182518	PRK10525, PRK10525, cytochrome o ubiquinol oxidase subunit II; Provisional.	6.0533e-138
NZ_CP005975.1\|WP_027616409.1\|5078002_5079796_-\|thiamine-pyrophosphate-requiring-protein	gnl\|CDD\|181344	PRK08273, PRK08273, thiamine pyrophosphate protein; Provisional.	0
NZ_CP005975.1\|WP_027616405.1\|5086381_5086555_+\|general-stress-protein	gnl\|CDD\|226252	COG3729, GsiB, General stress protein [General function prediction only].	0.000302733
NZ_CP005975.1\|WP_033865883.1\|5072545_5073070_-\|DUF3341-domain-containing-protein	gnl\|CDD\|378727	pfam11821, DUF3341, Protein of unknown function (DUF3341). This family of proteins are functionally uncharacterized. This family is found in bacteria. Proteins in this family are about 170 amino acids in length.	3.95142e-46
NZ_CP005975.1\|WP_027616402.1\|5087872_5088112_+\|DUF2934-domain-containing-protein	gnl\|CDD\|378572	pfam11154, DUF2934, Protein of unknown function (DUF2934). This bacterial family of proteins has no known function.	1.39776e-10
NZ_CP005975.1\|WP_027616399.1\|5090124_5091294_+\|glutathione-dependent-formaldehyde-dehydrogenase	gnl\|CDD\|176243	cd08283, FDH_like_1, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc-dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit.	0
NZ_CP005975.1\|WP_034103394.1\|5077286_5077943_-\|cytochrome-c3-family-protein	gnl\|CDD\|173979	cd08168, Cytochrom_C3, Heme-binding domain of the class III cytochrome C family and related proteins. This alignment models heme binding core motifs as encountered in the cytochrome C3 family and related proteins. Cytochrome C3 is a tetraheme protein found in sulfate-reducing bacteria which use either thiosulfate or sulfate as the ultimate electron acceptors. C3 is an integral part of a complex electron transfer chain. The model also contains triheme cytochromes C7 which function in electron transfer during Fe(III) respiration by Geobacter sulfurreducens (PpcA, PpcB, PpcC, PpcD, and PpcE) and four repeated core motifs as found in the 16-heme cytochrome C HmcA of Desulfovibrio vulgaris Hildenborough which plays a role in electron transfer through the membrane following periplasmic oxidation of hydrogen (resulting in sulfate reduction in the cytoplasm).	3.22189e-14

>NZ_CP005975.1|WP_027616405.1|5086381_5086555_+|general-stress-protein
MTTSNKNPGNFANDHEKASEAGKKGGQASGGNFANDREKASEAGRKGGQNSHGGGRK
>NZ_CP005975.1|WP_034103399.1|5085602_5085845_+|hypothetical-protein
MMKNSQRAWDLAMVLIANGKIPFDPANLSGSLKILARHLEALETALREEAILAETSLAENLGQRCLQKQVGRSRALVGAD
>NZ_CP005975.1|WP_027616406.1|5085306_5085606_+|hypothetical-protein
MQHNDIDAKMMACRQLAMEQNQKLFNEANALSRSAFDLLEQPDFDSEMFDEYLRLRGKAEALFREAIDHLGVLNKHFPLPTVSVVADGGKVARREKEIA
>NZ_CP005975.1|WP_034103397.1|5080969_5085115_+|PAS-domain-S-box-protein
MKSAPLRSPNVPQRKDLIPSDLDFPVVGIGASAGGLQAVKAFFEHMPKDCGMAFVVILHLSPDHQSVADKIIQESTRLPVSQVNNTTPIEKNQVYVISPAHHLKMNDGYLAVSPSTREGGSHIAIDLFFRDLADAHKERAFCVILSGTGADGAVGLSRIKEQGGITLVQSPEDAEFDGMPLAAIETQMADLVLPVVEMPQKLLELWRNAQSIILPTADDPEIKTTPPATERDAAVAEQLLLDILIQLRAITGHDFKHYKRATVLRRIERRLQVTAQPDLAAYYNFLQGHPDETEALLGDMLIGVTNFFRDREAFEALERDVIPNLVKSLEDSVPHREQVRIWSAGCSTGEEAYSLAMLVAEQLALDASGAKMQVFATDIDERAITHGRNGVYPEAIITDVPPPRLRQYFAKEKNQHYRVRKEIREKVLFAKHSLLADPPFSQIDLIVCRNLLIYLDREVQRDILQMFHFALRPGGYLFLGSSESADGCLDLFVPVDKRNRIFRVRAGSSGIRRAPTIPRGGYLRPSAPSIALENKAPNKVSFADIHLRALEKAAPPSVIVDIHAQILHMSEGAGRFLRYVAGEITHNLLALVHPDLRLDIRTTLFQVQQSNMPVTSRKIRVQREQAPFMVDITARPYRDDATESDYVLVIFQESPFDPQQTDSTAVSHAENAIMGNLEQELQRTKLHLQDTIEQSEVSSEELKASNEEMQAVNEELRSATEELETSKEELQSINEELLTVNYELKTKVEETDKVNDYLTNLIASTDIATVFVDRNMRIRWFTPRATDIFSMLPVDTGRSLMDITHRLDYPEITEDAATVFESLSMIEREISGKDNRWYIARLLPYRSSEDHIDGTVLTFIDITKRRQAEEELRLGEERMRLVAESTHDFAIIILDDHGAITDWNTGAELIFGYTKDEVLGAYYDLIFSPEDRSSGVPESELRAAREHGRGEDERWHVRKDGSRFYCSGEVTLLKSNSLQGYVKIARDLTGHKRTQDEQSQRLMETQTKSHLKDEFFAVMSHELKHPLNLIQLNAELLRRLPATKAAGSATKAVNTICEAVSSQARIIDDLLDVARVRTGKLKLKKQQVDLIRTLQDIHGVVLADGHRRQVTLQTPSDHASLIVDVDPTRIEQVIWNLVNNALKFTPEGGQVQLVLSRSEGRAQLDVIDSGIGLADDSLEKIFDLFGQAENQHLTHQREGLGIGLSLVRQLVEAHEGSVSVHSKGLGFGCTFSIWLPLCEQQDHLPLSDAEQDADERLHGVKVLLVDDSAEVLEVLNLLLEMEGAQVSAFNDPQTALETARDAQYDLIISDIGMPKMNGHELMRKLRTIGHLRQVPAIALTGYGAGSDQKKAAESGFTSHLSKPVVHDSLIVLIEKLCCLRR
>NZ_CP005975.1|WP_027616408.1|5079813_5080671_-|SDR-family-oxidoreductase
MNSYPKPPFKTQQQPVPGEQRKMDPMPDCGEQTYKGSGRLANKIALVTGADSGIGRAVAIAFAREGADVAVAYLDEHEDAKETARWVEAAGRQCLLLPGDLGDADQCTAIVSDTVEKFGRIDVLVNNAAFQMTYESLEDIPDEDWLKTFNVNVTAMFRICKAALPHMAEGSSIINTSSVNSDAPNPTLLPYAASKGAIANFTAGLAQMLGKRGIRVNSVAPGPIWTPLIVSTMTEDSVKNFGGNTPLGRPGQPVEVSPIYVLLASDEGSYISGERYGVTGGKPIL
>NZ_CP005975.1|WP_027616409.1|5078002_5079796_-|thiamine-pyrophosphate-requiring-protein
MTMTVGDFLVDRLSQWGVTRIFGYPGDGINGVFGALSRAQAKIEFIQARHEEMAAFMASAHAKFTGELGVCIATSGPGASHLITGLYDARMDHMPVLAIVGQQARAALGGHYQQELDLVSMFKDVAGAFVQQATVPSQVRHLVDRAVRTAVGERRVTAIILPNDLQEATYEPPARAHGTVHSGVGYSKPRVVPYEADLQRAADVLNAGEKVAILVGAGALAATDEVIAVAEALGAGVAKALLGKAAVPDDLPWVTGSIGLLGTEPSYKLMTECDTLLMIGSGFPYSEFLPKEGQARGVQIDLQPDMLSLRYPMEVNLVGDAAETLVALLPLLTHKTQRKWRKKVEGWCASWEKTLEKRALAKAKPINPQRVVYELSPRLPDHAIITSDSGSCANWYARDLKIRRGMQCSLSGGLASMGAAVPYAIAAKFAQPQNTVIALVGDGAMQMNNMAELITVAKYWRQWQSPNWICAVFNNEDLNQVTWEQRVMEGDPKFKASQTIPDVPYHLFAISLGLKGIFVDREEDVAAAWGQALASDVPVLIEFKTDPDVPPLPPHIKLEQAKKFATTWLKGDPDEAGVIVQTAKQVLASVLPGGAKK
>NZ_CP005975.1|WP_034103394.1|5077286_5077943_-|cytochrome-c3-family-protein
MTQIFRRSADTWLRVGLLLLIAGLSGGLLVALTLDSTDYRTGRNWVVEQPLPFSHAHHAGELKIDCRYCHSAVQSSAMASLPPTETCMSCHSQVWTHTDVLEPLRKSLRELEPLHWQRVAKLPDYVYFHHGVHVNAGVGCSECHGQVDRMQLMFKAQPLNMGQCLACHRDPAPHLRPLEQVTNMQWKPSEDRRQLGERLMTARHIDTRGLTDCGTCHR
>NZ_CP005975.1|WP_045792172.1|5074416_5077290_-|TAT-variant-translocated-molybdopterin-oxidoreductase
MSKPLDFSVVREQLAGLEGQAYWRGLEALAESPDAQALIEAEFAGVAPLMDRRRFLQLMAASIAMAGLAACGKTPEQAVTAVSQPVNLTPGVPAWYATVIPFVGVAQPVLGKTVAGRPIKLEGNPDHPVSGGACDAFTQAAILQLYDPDRSQAPRCKGREASWPDVRAALAHEQQVLDSARGKGLHIVCGASSSPTLKRQLDQLQQRWPEARLYHGEPFAETAALRASERAFGQPLAAQVHLEQAEVLVCLEYDPLGSGPYQTVLQRGWAERRRQAANGEGAALVFVAESVPSLTGAAATARLPTAPSQLPGLLLALGQALGQDLPGTPRLNSAQRQWVQDAVAALKTHPGRGLIGISQQASEALQAQVMQLNQRLGHAGRALDWQVPRLLGYEPNQSWGSLAQLSQEAVTHLLILDCNPVLNAYMQDVLPQAPFRLHAGLYYDESAAQCHWHLPLNHALDGWSDGRAADGSVCIVQPLIEPMYSTRTLHQVLELLMHSTEADALALVRATWAHIAQQQWREALANGWIEPAPAPVKVEEMTPITLAAADVGEGLEAVIRPDPTVWDGRFANSGWLQELPKPISTLTWTNVIGLSPHLAEQLGVSNGDGIEVTLAEQTVRGPAWVEPGQADQVIALYTGYGRSHAGRVGDGLGYAVRPTEQFSVSASLRSTGEHFLLAATQSHHRLPEAQEPPIRVVSRAKPQLATQAIPASLYSPVADSGPQWGMVIDLDLCTGCNACVVACQAENNIAVVGAEQVGQGRSMHWLRIDHYYQGPLEAPRSRFQPLPCMHCEQAPCETGCPVNATVHSRDGLNQMVYNRCIGTRTCASYCPYKVRRFNWLDWSADAAPSIQAQRNPEVTVRSRGVMEKCTYCIQRISNARTDDKQHGDDFDPSAVITACQQTCPSQAIQFGDINAPASAVSLARRDPRHYRLLEALGTRPRTSYLARIEEEGAGDEG
>NZ_CP005975.1|WP_027616412.1|5073062_5074427_-|polysulfide-reductase-NrfD
MKAEPLLHATGHFLPKDLSDQQVSRQVFGPLQQFPRRVAWRWMFGVGLVLLLVYLGSVVVLLGNGVGMWGNNQPVHWGFGILNYIWWLGIGHAGTFISALLLLIERPWRHTLNRLAELMTLMAVICAALYPILHLGRPWLFYWTMPYPNEMGLWPQFKSPTAWDMFAILSYLTVSVLFLMVGAIPDFASARDRASTPLRQTVYGLLALGWRGSQRHWALWRRTTRVLAILAIPLVFAVSSGYSFLLTMGTQSGWHSTLFPAYFVAGAVFSGFALVALLAIAARWLLCIQSLITPRHLDMLGRLLLATGWMTTYGYLADLFMPFYSGDAHEIEVLLARISGAHAWSFWLAIVCNVGVLQALWWRNVRQSPPRLALVALAVLVGMWAERFMLLIPPQMRDLLVSSWGDFTPSLWDWTLFIGSFGVFLVPYSLFLRYVPMVSAFEVKQALHQERGDG
>NZ_CP005975.1|WP_033865883.1|5072545_5073070_-|DUF3341-domain-containing-protein
MAECLGLLARFPAPQPLVDAAVCAWDLGYRRLDAFAPFALEALEPVLAVDARRVGRMACLGAGLGIVLALVMQIGSVWAYPLNIGGRPLVALPSFAVVTFLFAVVFAAMAAVLTLLLCSRLPRLHHPLFGVEGFEGASDDGFFLFIDARDPLFDAHQTHAWLAERAQSVQQVAP
>NZ_CP005975.1|WP_027616403.1|5087291_5087843_+|Clp-protease
MPLHVINFTGPVTASTCSQLIEKASLAVQQEASGLVVNIATMGGECSYGFTMYNFLLALPIAVHTHNLGTVESMGNIIFLAGERRTACKHSKFLFHPFHWHVQGAVDHSRMSEYAMSLDYDLQLYARIVEERTRDAREKLETEKYLIAAPRILDPQQAMTAGLIHGIELPVIKAEFVSSFIHS
>NZ_CP005975.1|WP_027616402.1|5087872_5088112_+|DUF2934-domain-containing-protein
MDEETIRLTAYRIWEQQGKPDGQDFLHWLQARDELTPGQIDSSSGTIESSVTQPVPVQSKRQAAPSSTTRKARSKKLEA
>NZ_CP005975.1|WP_027616401.1|5088308_5088524_+|hypothetical-protein
MSGLQANGQCAQCKQPFEPTTDEPSYLVSTAAEMLCPQCRQQYLADLMMDALQRSALKLCMLQERRKNNKA
>NZ_CP005975.1|WP_045792173.1|5089291_5090125_+|DUF2892-domain-containing-protein
MTDQPLISTHTPPDAHRSGTMTKAERTLSLAAGAALLLHGCRKGGLSGALQVAAGAYGVIRGAAGHCALKRVLTPTPYETQFSREHQWPISEAITRSITILRPSDEVSAFIARPENIGPLLRWVDSVEQLTPDTALWKLRAPAGRRLQCALVQIDTQDRHVLHWKTPGDARWAHDITVSLSPAPAGRGTQVKAVVVCKPAMSKLGYGLARAISLFSDKALLNALQAVKQQLETGEVSNNRSRPEPDDDFFYVHAGADQVATDHPSAKTGVVIEGGPH
>NZ_CP005975.1|WP_027616399.1|5090124_5091294_+|glutathione-dependent-formaldehyde-dehydrogenase
MRALTWQAPNLLRVDHVADPAILNPRDAIIRVTLSSVCGSDLHLLGGYVPAMKPGDIIGHEFMGEVVEVGKGVTDLRKGDKVITISIIGCGNCEPCQRSDFSCCDNSNPNPSATDLMYGQPCCGIIGYSHAFGGYPGSHATYVRVPFADVNLFKVPEGVSDEQALFVSDAAPTGYFAADNADIQPGDTVAVWGCGGVGQMAICSAYLLGAERVIAIDRYPDRLRLAEERGKAIPINYEKTNVHEALLELTGGRGPDRCIDCVGMEAHGTEIDYAYDKAKQLLRLHTERGSVLRQAIRACRKGGTVSVVGVYGGLLDKFPMGAIVNKALTLRSGQQPGQRYAPTLFEHIRKGELDPAYLLTHPMSLEDGAQGYKLFKEKTDNCLRVVFKP
>NZ_CP005975.1|WP_080758260.1|5091384_5092647_-|amino-acid-permease
MLFLFILGDVLGAGVYALAGTIAGEVGGAIWVPLLVALFFAMLTAGSYAELVTKYPYAGAASVFAEKAFKSPLISFLVGFCMLAAAVTSAAGLSLAFAGDYLAAFVDVSPHLAALIFLMVIALLNARGIKESLGANMVMTCIELSGLLLVVVAAAWCIQSGEANLGRALEFKAGVNPMPAVLGAALLAFYSFVGFETSANLGEEIRGVRKVYPRALFAALVTAGIVYTAVGVAASVVLPMDKLTATSAPLLEVVRASGLSIPPQLFAFIALVAVANGALLTMVMASRLAYGMARMSLLPGPLSRVLPKRRTPWVAIIASTLVAISLTLTGTLAALAETVVLLLLFVFLSTNLAVLVLRRDLVAEHHFRVPTWVPVLAIVSCLILLSQQGLDTWLRGGALMLLGSALYACNRLATPVAEPG
>NZ_CP005975.1|WP_027616397.1|5092849_5093164_-|hypothetical-protein
MFIRGNTYKAWAQKALEEECFTQEVENGCHIEVRAREREDADIEVLVSVYTAMGQCVIERTSQLPGAEWTVHDALKRGIDQAERIAGGESGRLPCADAHLHEDD
>NZ_CP005975.1|WP_027616396.1|5093565_5094489_+|ubiquinol-oxidase-subunit-II
MKRAIGYCLAYLASVFLLSGCNLVVFNPKGQISTDERDLIILATGLMLLVVVPVIVLTFVFAYRYRATNKKARYSPRWASSHKIEAVVWGVPLLIIIALGWVTWKTTHALDPYRPLDSDTPPINVQVVAIDWKWLFIYPDLGIASVNELALPVHTPVSFTITSDAAMTSFFIPALGGQIYAMAGMQTKLHLIANETGEFKGIAANYNGPGFSDMHFTTLSLSPTDFQTWANKVKGASTVLDQTSYAHLAKPTIKHPVTYYSAVQERLFLDIVDKYEGMNKANKTRRAPLSGTEKRVDKHPSLLAEEQ
>NZ_CP005975.1|WP_034103402.1|5094491_5096465_+|cytochrome-o-ubiquinol-oxidase-subunit-I
MFGKLSWDAIPTTEPIVMYTLAFIGLIGAAMVGTITWKRKWGYLWREWFTSVDHKKIGCMYIIVALVMLLRGFSDAIMMRTQQAMAASGGPGYLPPEHYDQIFTAHGVIMIFFVAMPFVVGLMNVVVPLQIGARDVAYPFLNALSFWLFVAGAALVNVSLGIGEFARTGWVAYPPLSGLAYSPGVGVDYYIWSLQISGVGTLLTGLNFFVTILKMRTEGMTLFKMPVFTWNALCTSVLILASFPILTATLLMLSLDRYLGMHFFTNEAGGNPMMYVNLIWAWGHPEVYILILPAFGVFSEIAATFSSKRLFGYVSLVWATIAITVLSFIVWLHHFFTMGAGGNVNAFFGIMTMIIAVPTGVKIFTWLFTMYRGRVRFETPMLWTLGFIVTFSIGGMTGVLLAVPGADFMLHNSLFLIAHFHNVIIGGAVFGYMAGLTYWFPKAFGFRLNDKLGRIAFWCWLIGFYFAFMPSYVLGFMGMTRRLNHFDNPEWRPWLLLEVLGVLIILCGVISQALQLFVSIRNRHQYRDLTGDPWDGRTLEWATASPPPLYNFAEQPKVNDLDAYWGMKERGVSTLSHTDYRSIHMPRNTASGLVISLFALICSFALVWHIWWLAAFGLVASVVAFVVRSYDEDTDYFVSAQEVARIETARLKDLAEA
>NZ_CP005975.1|WP_027616394.1|5096468_5097083_+|cytochrome-o-ubiquinol-oxidase-subunit-III
MSNIVIEKDIAHTQEHGHEDAGSLSVFGFWIYLMTDCILFASLFAGYAVLRDSVAGGPSSVDIFELPYVLAETMLLLLSSITYGYAMLAMNRGQQSQVLRWLGLTFVLGAGFIAMEINEFRHLIAEGYGPDRSAFLTAFFTLVGTHGAHVLTGLIWMAVLMVQIRQKGLTNTTATRLSCLSLFWHFLDVVWICVFTVIYLLGVV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP005975_1	1.1\|5087055\|31\|NZ_CP005975\|CRISPRCasFinder	5087055-5087085	31	NZ_CP022661	Salmonella enterica subsp. enterica strain RM11065 plasmid pRM11065-1, complete sequence	108950-108980	7	0.774
NZ_CP005975_1	1.1\|5087055\|31\|NZ_CP005975\|CRISPRCasFinder	5087055-5087085	31	NZ_CP013526	Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence	316054-316084	8	0.742
NZ_CP005975_1	1.1\|5087055\|31\|NZ_CP005975\|CRISPRCasFinder	5087055-5087085	31	NZ_CP013556	Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence	328818-328848	8	0.742
NZ_CP005975_1	1.1\|5087055\|31\|NZ_CP005975\|CRISPRCasFinder	5087055-5087085	31	NZ_CP013589	Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence	318812-318842	8	0.742
NZ_CP005975_1	1.1\|5087055\|31\|NZ_CP005975\|CRISPRCasFinder	5087055-5087085	31	NZ_CP013562	Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence	361367-361397	8	0.742
NZ_CP005975_1	1.1\|5087055\|31\|NZ_CP005975\|CRISPRCasFinder	5087055-5087085	31	NZ_CP013579	Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence	315995-316025	8	0.742
NZ_CP005975_1	1.1\|5087055\|31\|NZ_CP005975\|CRISPRCasFinder	5087055-5087085	31	NZ_CP013531	Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence	335450-335480	8	0.742
NZ_CP005975_1	1.1\|5087055\|31\|NZ_CP005975\|CRISPRCasFinder	5087055-5087085	31	NZ_CP013541	Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence	322240-322270	8	0.742
NZ_CP005975_1	1.1\|5087055\|31\|NZ_CP005975\|CRISPRCasFinder	5087055-5087085	31	NZ_CP013546	Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence	330415-330445	8	0.742
NZ_CP005975_1	1.1\|5087055\|31\|NZ_CP005975\|CRISPRCasFinder	5087055-5087085	31	NZ_CP013567	Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence	328818-328848	8	0.742
NZ_CP005975_1	1.1\|5087055\|31\|NZ_CP005975\|CRISPRCasFinder	5087055-5087085	31	NZ_CP013584	Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence	335450-335480	8	0.742
NZ_CP005975_1	1.1\|5087055\|31\|NZ_CP005975\|CRISPRCasFinder	5087055-5087085	31	NZ_CP013573	Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence	315995-316025	8	0.742
NZ_CP005975_1	1.1\|5087055\|31\|NZ_CP005975\|CRISPRCasFinder	5087055-5087085	31	NC_010997	Rhizobium etli CIAT 652 plasmid pC, complete sequence	315558-315588	8	0.742
NZ_CP005975_1	1.1\|5087055\|31\|NZ_CP005975\|CRISPRCasFinder	5087055-5087085	31	NZ_CP020900	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence	91821-91851	8	0.742
NZ_CP005975_1	1.1\|5087055\|31\|NZ_CP005975\|CRISPRCasFinder	5087055-5087085	31	NC_020062	Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence	753643-753673	9	0.71
NZ_CP005975_1	1.1\|5087055\|31\|NZ_CP005975\|CRISPRCasFinder	5087055-5087085	31	NZ_CP022999	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-A, complete sequence	585879-585909	9	0.71

1. spacer 1.1|5087055|31|NZ_CP005975|CRISPRCasFinder matches to NZ_CP022661 (Salmonella enterica subsp. enterica strain RM11065 plasmid pRM11065-1, complete sequence) position: , mismatch: 7, identity: 0.774

ggccggtagcaaaggcggccagaacagcggg	CRISPR spacer
agagagcagaaaaggcggccagaacagcagg	Protospacer
.*  .*.** ******************.**

2. spacer 1.1|5087055|31|NZ_CP005975|CRISPRCasFinder matches to NZ_CP013526 (Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence) position: , mismatch: 8, identity: 0.742

ggccggtagcaaaggcggccagaacagcggg	CRISPR spacer
tgtggcgagcaaaggcggccggaacatcggc	Protospacer
 *. *  *************.***** ***

3. spacer 1.1|5087055|31|NZ_CP005975|CRISPRCasFinder matches to NZ_CP013556 (Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence) position: , mismatch: 8, identity: 0.742

ggccggtagcaaaggcggccagaacagcggg	CRISPR spacer
tgtggcgagcaaaggcggccggaacatcggc	Protospacer
 *. *  *************.***** ***

4. spacer 1.1|5087055|31|NZ_CP005975|CRISPRCasFinder matches to NZ_CP013589 (Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence) position: , mismatch: 8, identity: 0.742

ggccggtagcaaaggcggccagaacagcggg	CRISPR spacer
tgtggcgagcaaaggcggccggaacatcggc	Protospacer
 *. *  *************.***** ***

5. spacer 1.1|5087055|31|NZ_CP005975|CRISPRCasFinder matches to NZ_CP013562 (Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence) position: , mismatch: 8, identity: 0.742

ggccggtagcaaaggcggccagaacagcggg	CRISPR spacer
tgtggcgagcaaaggcggccggaacatcggc	Protospacer
 *. *  *************.***** ***

6. spacer 1.1|5087055|31|NZ_CP005975|CRISPRCasFinder matches to NZ_CP013579 (Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence) position: , mismatch: 8, identity: 0.742

ggccggtagcaaaggcggccagaacagcggg	CRISPR spacer
tgtggcgagcaaaggcggccggaacatcggc	Protospacer
 *. *  *************.***** ***

7. spacer 1.1|5087055|31|NZ_CP005975|CRISPRCasFinder matches to NZ_CP013531 (Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence) position: , mismatch: 8, identity: 0.742

ggccggtagcaaaggcggccagaacagcggg	CRISPR spacer
tgtggcgagcaaaggcggccggaacatcggc	Protospacer
 *. *  *************.***** ***

8. spacer 1.1|5087055|31|NZ_CP005975|CRISPRCasFinder matches to NZ_CP013541 (Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence) position: , mismatch: 8, identity: 0.742

ggccggtagcaaaggcggccagaacagcggg	CRISPR spacer
tgtggcgagcaaaggcggccggaacatcggc	Protospacer
 *. *  *************.***** ***

9. spacer 1.1|5087055|31|NZ_CP005975|CRISPRCasFinder matches to NZ_CP013546 (Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence) position: , mismatch: 8, identity: 0.742

ggccggtagcaaaggcggccagaacagcggg	CRISPR spacer
tgtggcgagcaaaggcggccggaacatcggc	Protospacer
 *. *  *************.***** ***

10. spacer 1.1|5087055|31|NZ_CP005975|CRISPRCasFinder matches to NZ_CP013567 (Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence) position: , mismatch: 8, identity: 0.742

ggccggtagcaaaggcggccagaacagcggg	CRISPR spacer
tgtggcgagcaaaggcggccggaacatcggc	Protospacer
 *. *  *************.***** ***

11. spacer 1.1|5087055|31|NZ_CP005975|CRISPRCasFinder matches to NZ_CP013584 (Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence) position: , mismatch: 8, identity: 0.742

ggccggtagcaaaggcggccagaacagcggg	CRISPR spacer
tgtggcgagcaaaggcggccggaacatcggc	Protospacer
 *. *  *************.***** ***

12. spacer 1.1|5087055|31|NZ_CP005975|CRISPRCasFinder matches to NZ_CP013573 (Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence) position: , mismatch: 8, identity: 0.742

ggccggtagcaaaggcggccagaacagcggg	CRISPR spacer
tgtggcgagcaaaggcggccggaacatcggc	Protospacer
 *. *  *************.***** ***

13. spacer 1.1|5087055|31|NZ_CP005975|CRISPRCasFinder matches to NC_010997 (Rhizobium etli CIAT 652 plasmid pC, complete sequence) position: , mismatch: 8, identity: 0.742

ggccggtagcaaaggcggccagaacagcggg	CRISPR spacer
tgtggcgagcaaaggcggccggaacatcggc	Protospacer
 *. *  *************.***** ***

14. spacer 1.1|5087055|31|NZ_CP005975|CRISPRCasFinder matches to NZ_CP020900 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence) position: , mismatch: 8, identity: 0.742

ggccggtagcaaaggcggccagaacagcggg	CRISPR spacer
tgtggcgagcaaaggcggccggaacatcggc	Protospacer
 *. *  *************.***** ***

15. spacer 1.1|5087055|31|NZ_CP005975|CRISPRCasFinder matches to NC_020062 (Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence) position: , mismatch: 9, identity: 0.71

ggccggtagcaaaggcggccagaacagcggg	CRISPR spacer
tgccgaaagcaaaggcggccagaaacaaagc	Protospacer
 ****. *****************  . .*

16. spacer 1.1|5087055|31|NZ_CP005975|CRISPRCasFinder matches to NZ_CP022999 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-A, complete sequence) position: , mismatch: 9, identity: 0.71

ggccggtagcaaaggcggccagaacagcggg	CRISPR spacer
tgccgaaagcaaaggcggccagaaacaaagc	Protospacer
 ****. *****************  . .*

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

397043 : 401998

uncultured_Mediterranean_phage(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010212421.1\|397043_397610_-	dCTP deaminase	S5VM63	Pseudomonas_phage	8.1e-74	73.3
WP_002554837.1\|397998_398208_+	cold-shock protein	Q9AZD3	Lactococcus_phage	2.2e-16	66.7
WP_042570670.1\|398414_399419_-	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	1.3e-34	36.2
WP_021492420.1\|399525_400362_-	peptidoglycan DD-metalloendopeptidase family protein	A0A0S2SXL7	Bacillus_phage	8.2e-06	33.3
WP_016976880.1\|400571_401249_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	6.8e-43	52.5
WP_021492421.1\|401248_401998_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.1e-62	50.2

DBSCAN-SWA_2

475203 : 534707

uncultured_Caudovirales_phage(26.92%)

holin,plate,tail,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044286716.1\|475203_476703_-\|tRNA	lysine--tRNA ligase	A0A2K9KZX5	Tupanvirus	1.3e-83	39.9
WP_100215725.1\|476786_477882_-	peptide chain release factor 2	A0A0S4KWG0	Pseudomonas_phage	2.0e-07	46.6
WP_010212639.1\|478121_479123_-	PleD family two-component system response regulator	A0A127AWB9	Bacillus_phage	1.1e-17	35.8
WP_010212641.1\|479174_480185_-	chemotaxis response regulator protein-glutamate methylesterase	NA	NA	NA	NA
WP_010212643.1\|480181_482446_-	hybrid sensor histidine kinase/response regulator	Q56AR1	Bacillus_thuringiensis_phage	9.7e-09	27.4
WP_010212644.1\|482442_483144_-	purine-binding chemotaxis protein CheW	NA	NA	NA	NA
WP_045791258.1\|483140_484400_-	chemotaxis protein CheR	NA	NA	NA	NA
WP_010212647.1\|484396_484909_-	purine-binding chemotaxis protein CheW	NA	NA	NA	NA
WP_010212648.1\|484908_486531_-	methyl-accepting chemotaxis protein	NA	NA	NA	NA
WP_010212650.1\|486679_487390_-	tellurite resistance TerB family protein	NA	NA	NA	NA
WP_010212651.1\|487558_488470_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_074900461.1\|488573_490061_+	gamma-aminobutyraldehyde dehydrogenase	NA	NA	NA	NA
WP_010212653.1\|490133_491285_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010212654.1\|491486_492521_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.2e-26	32.5
WP_010212656.1\|492522_493452_+	ABC transporter permease	NA	NA	NA	NA
WP_021492451.1\|493441_494251_+	ABC transporter permease	NA	NA	NA	NA
WP_010212660.1\|494428_495853_+	gamma-aminobutyraldehyde dehydrogenase	NA	NA	NA	NA
WP_010212662.1\|495916_497779_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_045791259.1\|498124_499750_+	glucan biosynthesis protein D	NA	NA	NA	NA
WP_010212665.1\|499850_500036_-	hypothetical protein	NA	NA	NA	NA
WP_021492454.1\|500291_500888_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_010212668.1\|500890_502060_+	DUF418 domain-containing protein	NA	NA	NA	NA
WP_010212669.1\|502107_503214_-	NADH:flavin oxidoreductase/NADH oxidase	NA	NA	NA	NA
WP_010212670.1\|503341_505243_-	potassium transporter Kup	M1HZV6	Acanthocystis_turfacea_Chlorella_virus	7.2e-74	33.4
WP_005785474.1\|505531_506872_+	30S ribosomal protein S12 methylthiotransferase RimO	NA	NA	NA	NA
WP_021492456.1\|506969_507440_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_042571732.1\|507565_508276_+	RNA-binding protein S4	NA	NA	NA	NA
WP_010212675.1\|508341_508803_+	DUF1456 family protein	Q9EYF4	Enterobacteria_phage	4.5e-38	51.3
WP_010212676.1\|508806_509502_+\|tRNA	tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO	NA	NA	NA	NA
WP_010212678.1\|510502_511429_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003172176.1\|511432_511795_-	diacylglycerol kinase	NA	NA	NA	NA
WP_010212680.1\|511870_512521_-	response regulator transcription factor	NA	NA	NA	NA
WP_042571731.1\|512659_513379_-	DTW domain-containing protein	NA	NA	NA	NA
WP_010212685.1\|513558_513999_+	hypothetical protein	NA	NA	NA	NA
WP_010212688.1\|514275_515388_+	TIGR00730 family Rossman fold protein	NA	NA	NA	NA
WP_021492459.1\|515450_515918_-	recombination regulator RecX	NA	NA	NA	NA
WP_003189042.1\|515926_516985_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	2.4e-111	62.4
WP_010212691.1\|517069_517570_-	CinA family protein	B5TK85	Pseudomonas_phage	8.8e-72	85.5
WP_029529227.1\|517651_518122_-	lysozyme	B5TK84	Pseudomonas_phage	6.0e-38	58.1
WP_010212696.1\|518109_518667_-	glycoside hydrolase family 19 protein	B5TK83	Pseudomonas_phage	5.0e-76	75.4
WP_010212698.1\|518673_519681_-	hypothetical protein	A0A2H4JH05	uncultured_Caudovirales_phage	5.8e-99	53.9
WP_010212700.1\|519690_519903_-\|tail	tail protein	A0A2H4JGD9	uncultured_Caudovirales_phage	1.2e-17	62.9
WP_010212701.1\|519895_520279_-\|tail	phage tail protein	A0A2H4JAC8	uncultured_Caudovirales_phage	1.8e-32	53.5
WP_045791260.1\|520278_521739_-	hypothetical protein	NA	NA	NA	NA
WP_010212706.1\|521866_522439_-\|tail	phage tail assembly protein	B0ZSH0	Halomonas_phage	2.3e-28	36.9
WP_010212707.1\|522491_522998_-\|tail	phage tail protein	Q6R4W3	Vibrio_virus	6.5e-22	34.5
WP_042571729.1\|522997_524164_-\|tail	tail protein	B0ZSG8	Halomonas_phage	5.5e-125	57.5
WP_021492465.1\|524425_524662_-	hypothetical protein	NA	NA	NA	NA
WP_021492466.1\|524671_525424_-	hypothetical protein	NA	NA	NA	NA
WP_021492467.1\|525492_526032_-	hypothetical protein	B0ZSG1	Halomonas_phage	1.5e-48	56.2
WP_021492468.1\|526028_526667_-\|tail	phage tail protein I	A0A2H4JDK0	uncultured_Caudovirales_phage	2.8e-38	51.9
WP_021492469.1\|526663_527659_-\|plate	baseplate J protein	A0A2H4JC04	uncultured_Caudovirales_phage	1.0e-111	63.5
WP_021492470.1\|527655_527988_-\|plate	phage baseplate protein	A0A2H4JI46	uncultured_Caudovirales_phage	3.9e-36	68.2
WP_010212718.1\|527997_528609_-\|plate	phage baseplate assembly protein V	A0A2H4JBW8	uncultured_Caudovirales_phage	6.6e-45	53.9
WP_021492471.1\|528612_529128_-	hypothetical protein	NA	NA	NA	NA
WP_021492472.1\|529149_529494_-\|holin	pyocin R2, holin	B5TK61	Pseudomonas_phage	1.5e-46	82.8
WP_021492473.1\|529744_529942_-	hypothetical protein	NA	NA	NA	NA
WP_010212723.1\|530091_530826_-	helix-turn-helix transcriptional regulator	B5TK58	Pseudomonas_phage	1.7e-119	88.1
WP_010212724.1\|531093_531582_+	DUF4065 domain-containing protein	D0UIM3	Aggregatibacter_phage	3.8e-27	44.5
WP_010212726.1\|531574_531946_+	hypothetical protein	NA	NA	NA	NA
WP_045791261.1\|532115_534707_+	DNA mismatch repair protein MutS	A0A1V0SJ67	Klosneuvirus	8.7e-30	22.5

DBSCAN-SWA_3

2274984 : 2296338

Klosneuvirus(33.33%)

holin,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044288002.1\|2274984_2276301_-\|protease	Zn-dependent protease	NA	NA	NA	NA
WP_042571442.1\|2276300_2277743_-	TldD/PmbA family protein	NA	NA	NA	NA
WP_010207131.1\|2277923_2279627_-\|holin	choline dehydrogenase	A0A1V0SI18	Klosneuvirus	1.7e-50	30.3
WP_010207130.1\|2279788_2281261_-	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_010207128.1\|2281371_2281965_-	transcriptional regulator BetI	NA	NA	NA	NA
WP_010207127.1\|2282299_2284291_+	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	6.9e-19	28.2
WP_010207126.1\|2284479_2285658_-\|holin	choline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.9e-26	37.1
WP_010207125.1\|2285654_2286500_-\|holin	choline ABC transporter permease subunit	NA	NA	NA	NA
WP_010207122.1\|2286568_2287516_-\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_045791547.1\|2287931_2289308_+	L-serine ammonia-lyase	NA	NA	NA	NA
WP_005792167.1\|2289811_2290915_+	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_010207120.1\|2291021_2291285_-	hypothetical protein	NA	NA	NA	NA
WP_010207118.1\|2291645_2292806_-	gamma-butyrobetaine dioxygenase	NA	NA	NA	NA
WP_010207115.1\|2292833_2293310_-	4-hydroxybenzoyl-CoA thioesterase	NA	NA	NA	NA
WP_044287998.1\|2293324_2294290_-	L-carnitine dehydrogenase	NA	NA	NA	NA
WP_010207113.1\|2294432_2295320_-	3-keto-5-aminohexanoate cleavage protein	NA	NA	NA	NA
WP_010207112.1\|2295393_2296338_-\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA

DBSCAN-SWA_4

4105421 : 4181212

Pseudomonas_phage(48.72%)

integrase,plate,portal,tail,holin,capsid,protease,terminase,coat,head

attL 4105359:4105378|attR 4140925:4140944

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4105359:4105378	attL	NA	NA	NA	NA
WP_045791876.1\|4105421_4106618_-\|integrase	site-specific integrase	J7HXC4	Pseudomonas_phage	1.1e-115	54.0
WP_045791877.1\|4106942_4107437_-	hypothetical protein	I2GUG5	Acinetobacter_phage	2.7e-09	30.8
WP_045791878.1\|4107613_4108291_+	hypothetical protein	NA	NA	NA	NA
WP_045791879.1\|4108633_4109233_+	hypothetical protein	NA	NA	NA	NA
WP_045791880.1\|4109945_4110329_-	helix-turn-helix transcriptional regulator	A0A2H4JA92	uncultured_Caudovirales_phage	3.1e-24	62.2
WP_052698813.1\|4111078_4111585_-	hypothetical protein	NA	NA	NA	NA
WP_080938513.1\|4111973_4112549_-	S24 family peptidase	A0A2H4J6Q0	uncultured_Caudovirales_phage	1.7e-82	78.8
WP_045791883.1\|4112862_4113072_+	regulatory protein	A0A0U4K5A6	Pseudomonas_phage	9.1e-15	67.8
WP_080938484.1\|4113421_4114129_+	helix-turn-helix domain-containing protein	A0A1B0YZZ0	Pseudomonas_phage	8.2e-31	63.3
WP_045791884.1\|4114121_4115489_+	replicative DNA helicase	A0A127KNK8	Pseudomonas_phage	1.0e-138	57.0
WP_045791885.1\|4115488_4115698_+	hypothetical protein	NA	NA	NA	NA
WP_045791886.1\|4115694_4117017_+\|integrase	site-specific integrase	A0A2D1GND4	Pseudomonas_phage	1.5e-126	54.9
WP_045791887.1\|4117165_4117555_+	antitermination protein Q	A0A1W6JTD2	Pseudomonas_phage	5.6e-42	61.7
WP_045791888.1\|4117731_4117953_+	DUF2158 domain-containing protein	NA	NA	NA	NA
WP_144410410.1\|4118069_4118372_+	hypothetical protein	NA	NA	NA	NA
WP_045791890.1\|4118564_4118894_+\|holin	phage holin, lambda family	A0A2H4J1U5	uncultured_Caudovirales_phage	1.9e-51	90.7
WP_045791891.1\|4118956_4119349_+	HNH endonuclease	A0A0U2C119	Paracoccus_phage	3.1e-16	52.4
WP_021492503.1\|4119484_4119958_+\|terminase	phage terminase small subunit P27 family	A0A2D1GNP3	Pseudomonas_phage	3.1e-34	47.7
WP_045791892.1\|4119967_4121701_+\|terminase	terminase large subunit	U5P0Q5	Shigella_phage	4.2e-161	50.3
WP_045791893.1\|4121851_4123078_+\|portal	phage portal protein	A0A1J0GUY8	Halomonas_phage	8.0e-151	67.2
WP_021492499.1\|4123082_4123706_+\|head,protease	HK97 family phage prohead protease	A0A1J0GUZ0	Halomonas_phage	5.3e-58	59.0
WP_045791894.1\|4123721_4124969_+\|capsid	phage major capsid protein	Q8SBH8	Shigella_phage	4.0e-113	53.8
WP_045791895.1\|4125007_4125391_+\|head,tail	phage gp6-like head-tail connector protein	A0A1J0GUX7	Halomonas_phage	6.2e-17	42.7
WP_045791896.1\|4125387_4125765_+\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_045791897.1\|4125757_4126258_+	hypothetical protein	U5P416	Shigella_phage	2.0e-07	27.0
WP_021492494.1\|4126315_4126882_+	hypothetical protein	B5TK65	Pseudomonas_phage	3.5e-32	40.4
WP_045792419.1\|4126911_4127121_+	DUF2635 domain-containing protein	NA	NA	NA	NA
WP_021492491.1\|4128586_4128934_+\|tail	phage tail protein	B5TK68	Pseudomonas_phage	1.3e-29	53.0
WP_021492490.1\|4128933_4129236_+\|tail	phage tail assembly protein	B5TK69	Pseudomonas_phage	1.1e-21	58.4
WP_045791898.1\|4129366_4131400_+\|tail	phage tail tape measure protein	U5P420	Shigella_phage	3.4e-106	49.6
WP_045791899.1\|4131403_4132639_+	hypothetical protein	B5TK71	Pseudomonas_phage	2.7e-74	40.5
WP_045791900.1\|4132645_4133752_+\|plate	baseplate protein	B5TK72	Pseudomonas_phage	1.5e-108	58.9
WP_045791901.1\|4133748_4134258_+\|plate	phage baseplate assembly protein	B5TK73	Pseudomonas_phage	1.1e-50	62.4
WP_045791902.1\|4134260_4134662_+	phage GP46	B5TK74	Pseudomonas_phage	1.4e-32	55.0
WP_021492484.1\|4134651_4135692_+\|plate	baseplate J/gp47 family protein	B5TK75	Pseudomonas_phage	8.4e-101	55.7
WP_021492483.1\|4135682_4136288_+	DUF2313 domain-containing protein	B5TK76	Pseudomonas_phage	1.0e-69	65.6
WP_052698822.1\|4137932_4138232_+	hypothetical protein	B5TK82	Pseudomonas_phage	2.5e-13	51.2
WP_045791903.1\|4138282_4138816_+	glycoside hydrolase family 19 protein	A0A059VA40	Pseudomonas_phage	7.2e-72	76.3
WP_021492479.1\|4138812_4139343_+	lysozyme	A0A2H4IZW4	uncultured_Caudovirales_phage	4.2e-56	73.3
WP_045791904.1\|4139329_4140016_-	hypothetical protein	A0A2H4J991	uncultured_Caudovirales_phage	5.9e-127	93.3
WP_045791905.1\|4140043_4140403_-	hypothetical protein	A0A2H4IZV2	uncultured_Caudovirales_phage	7.5e-33	63.1
WP_021492476.1\|4140500_4140707_-	hypothetical protein	A0A2D1GNR5	Pseudomonas_phage	3.5e-11	60.7
WP_010209410.1\|4141061_4141916_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	2.4e-29	33.9
4140925:4140944	attR	NA	NA	NA	NA
WP_010209411.1\|4143075_4144386_+	trigger factor	NA	NA	NA	NA
WP_021492827.1\|4144477_4145113_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	9.8e-60	60.1
WP_010209414.1\|4145225_4146509_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	2.1e-138	59.7
WP_010209415.1\|4146683_4149080_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	7.1e-220	51.6
WP_003174819.1\|4149228_4149501_+	HU family DNA-binding protein	A3E2K9	Sodalis_phage	1.8e-18	59.6
WP_042572097.1\|4149730_4151605_+	hypothetical protein	NA	NA	NA	NA
WP_074900423.1\|4151704_4152229_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_045791906.1\|4152175_4153381_-	MFS transporter	NA	NA	NA	NA
WP_045791907.1\|4153500_4154400_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010209420.1\|4154489_4155263_+	DUF2242 domain-containing protein	NA	NA	NA	NA
WP_042572099.1\|4155264_4157925_-	pyruvate dehydrogenase (acetyl-transferring), homodimeric type	NA	NA	NA	NA
WP_010209424.1\|4158071_4158542_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_021492823.1\|4158583_4159600_-	pyruvate dehydrogenase	NA	NA	NA	NA
WP_042572100.1\|4159933_4160962_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_021492821.1\|4160958_4162089_-	carbon-nitrogen hydrolase family protein	NA	NA	NA	NA
WP_021492820.1\|4162302_4164342_+	NADPH-dependent 2,4-dienoyl-CoA reductase	NA	NA	NA	NA
WP_042572102.1\|4164399_4165284_+	pyridoxal-phosphate dependent enzyme	NA	NA	NA	NA
WP_021492818.1\|4165273_4165831_-	cytochrome b	NA	NA	NA	NA
WP_042572103.1\|4165945_4166773_-	phosphonoacetaldehyde hydrolase	NA	NA	NA	NA
WP_044287389.1\|4166801_4167911_-	2-aminoethylphosphonate--pyruvate transaminase	NA	NA	NA	NA
WP_010209434.1\|4168024_4168885_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_045791908.1\|4168854_4169751_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010209437.1\|4170006_4171332_+	MFS transporter	NA	NA	NA	NA
WP_010209440.1\|4171441_4172149_+	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_045791909.1\|4172265_4173558_-	protein kinase	NA	NA	NA	NA
WP_045791910.1\|4173597_4174692_-	cell division protein ZapE	NA	NA	NA	NA
WP_021492813.1\|4174880_4175405_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_045791911.1\|4175398_4175941_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_010209446.1\|4175959_4176502_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_045791912.1\|4176504_4176993_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_021492811.1\|4177018_4177807_+	molecular chaperone	NA	NA	NA	NA
WP_045791913.1\|4177922_4180241_+	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_106119374.1\|4180291_4181212_+\|coat	spore coat U domain-containing protein	NA	NA	NA	NA

DBSCAN-SWA_5

4312717 : 4322692

uncultured_Caudovirales_phage(71.43%)

protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010209612.1\|4312717_4313998_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.6e-96	52.6
WP_010209614.1\|4313998_4315393_+	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_045791935.1\|4315498_4316494_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_045791936.1\|4316582_4317584_-	glycosyl transferase family protein	A0A2H4JBY5	uncultured_Caudovirales_phage	3.0e-164	85.7
WP_045791937.1\|4317580_4317916_-	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	9.8e-43	74.8
WP_010209618.1\|4317912_4318191_-	sulfurtransferase complex subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	9.9e-25	57.6
WP_042572148.1\|4318190_4318541_-	sulfurtransferase complex subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	4.4e-38	66.9
WP_021492753.1\|4318542_4318935_-	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	1.8e-56	84.5
WP_045791938.1\|4319092_4320274_+	CoA transferase	NA	NA	NA	NA
WP_010209629.1\|4320379_4320874_-\|protease	SprT family zinc-dependent metalloprotease	NA	NA	NA	NA
WP_010209630.1\|4321002_4321605_-	YIP1 family protein	NA	NA	NA	NA
WP_010209631.1\|4321867_4322692_+\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	3.4e-105	71.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage