CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP010018	Burkholderia thailandensis 34 chromosome 2, complete sequence	3 crisprs	csa3,cas3,DinG	13	17	4	0
NZ_CP010017	Burkholderia thailandensis 34 chromosome 1, complete sequence	2 crisprs	WYL,cas3,DEDDh,csa3,DinG	1	1	13	0
NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	1 crisprs	NA	2	2	2	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP010018_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP010018_1

949125-950108

Orphan

Consensus_repeat	Method
CTGGCCNGTNGCCGTGCT	CRT

23 spacers

The CRISPR arrays of NZ_CP010018_1

>merge|NZ_CP010018|1|949125-950108|CRT
CTGGCCGGTTGCTGCGCTATTGCTACCCGTCGCTTGTGAACCCTGGCCCGTCGCCGTGCTCGAATTGCCCGACGCGGTGGCGTTCTGGCCGGTTGCCGTGCTGTTGTCACTCGTCGCTTGCGAACCTTGGCCCATCGCCGTGCTCGAGTTGCCCGACGCCGTGGCGTTCTGGCCCGTCGCCGTGCTCGCATCGCCGGATGCGGTAGCGTTCTGGCCGGTTGCTGCGCTATTGCTACCCGTCGCTTGTGAACCCTGGCCCGTCGCCGTGCTCGATTCACCCGATGCAGCGGCGTTCTGGCCGGTTGCCGTACTGTTGTCGCCCGTCGCTTGCGAACCCTGGCCCGTCGCCGAGCTCGATTCACCCGATGCCGTGGCGTTCTGGCCGGTTGCCGTGCTGTTGTCGCCCGTCGCTTGCGAACCCTGGCCCGTCGCCGTGCTCGATTCACCCGATGCAGCGGCGTTCTGGCCGGTTGCCGTACTGTTGTCGCCCGTCGCTTGCGAACCCTGGCCCGTCGCCGAGCTCGATTCACCCGATGCCGTGGCGTTCTGGCCGGTTGCCGTGCTGTTGTCGCCCGTCGCTTGCGAACCCTGGCCCGTCGCCGTGCTCGATTCACCCGACGCCGTGGCGTTCTGGCCGGTTGCCGTACTGTTGTCGCCCGTCGCTTGCGAACCCTGCCCCGTCGCCGTGCTCGATTCACCCGATGCCGTGGCGTTCTGGCCGGTTGCCGTGCTGTTGTCGCCGATCGCTTGCGAACCCTGGCCCGTCGCCGTGCTCGAATCGCCCGACGCGGTGGCGTCCTGGCCAGTTGCCGTACTGTTGTCGCCCGCCGCTTGCGAACCCTGGCCCGTCGCCGTGCTCGATTCACCCGATGCCGTGGCGTTCTGGCCGGTTGCCGTGCTGTTGTCGCCGATCGCTTGCGAACCCTGGCCCGTCGCCGCGCTCGAATCGCCCGACGCCGTGGCGTTCTGGCCGGTTGCCGTACT

>NZ_CP010018|1|1|949125-950108|CRT
CTGGCCGGTTGCTGCGCT	ATTGCTACCCGTCGCTTGTGAACC
CTGGCCCGTCGCCGTGCT	CGAATTGCCCGACGCGGTGGCGTT
CTGGCCGGTTGCCGTGCT	GTTGTCACTCGTCGCTTGCGAACC
TTGGCCCATCGCCGTGCT	CGAGTTGCCCGACGCCGTGGCGTT
CTGGCCCGTCGCCGTGCT	CGCATCGCCGGATGCGGTAGCGTT
CTGGCCGGTTGCTGCGCT	ATTGCTACCCGTCGCTTGTGAACC
CTGGCCCGTCGCCGTGCT	CGATTCACCCGATGCAGCGGCGTT
CTGGCCGGTTGCCGTACT	GTTGTCGCCCGTCGCTTGCGAACC
CTGGCCCGTCGCCGAGCT	CGATTCACCCGATGCCGTGGCGTT
CTGGCCGGTTGCCGTGCT	GTTGTCGCCCGTCGCTTGCGAACC
CTGGCCCGTCGCCGTGCT	CGATTCACCCGATGCAGCGGCGTT
CTGGCCGGTTGCCGTACT	GTTGTCGCCCGTCGCTTGCGAACC
CTGGCCCGTCGCCGAGCT	CGATTCACCCGATGCCGTGGCGTT
CTGGCCGGTTGCCGTGCT	GTTGTCGCCCGTCGCTTGCGAACC
CTGGCCCGTCGCCGTGCT	CGATTCACCCGACGCCGTGGCGTT
CTGGCCGGTTGCCGTACT	GTTGTCGCCCGTCGCTTGCGAACC
CTGCCCCGTCGCCGTGCT	CGATTCACCCGATGCCGTGGCGTT
CTGGCCGGTTGCCGTGCT	GTTGTCGCCGATCGCTTGCGAACC
CTGGCCCGTCGCCGTGCT	CGAATCGCCCGACGCGGTGGCGTC
CTGGCCAGTTGCCGTACT	GTTGTCGCCCGCCGCTTGCGAACC
CTGGCCCGTCGCCGTGCT	CGATTCACCCGATGCCGTGGCGTT
CTGGCCGGTTGCCGTGCT	GTTGTCGCCGATCGCTTGCGAACC
CTGGCCCGTCGCCGCGCT	CGAATCGCCCGACGCCGTGGCGTT
CTGGCCGGTTGCCGTACT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP010018.1\|WP_045601551.1\|952043_953585_+\|membrane-protein	unknown	unknown	unknown
NZ_CP010018.1\|WP_045601554.1\|961395_961698_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010018.1\|WP_155275044.1\|960515_960749_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010018.1\|WP_009907089.1\|939888_940578_-\|DotU-family-type-IV/VI-secretion-system-protein	unknown	unknown	gnl\|CDD\|378275
NZ_CP010018.1\|WP_069255329.1\|959202_960402_+\|transcriptional-regulator-CynR	unknown	unknown	gnl\|CDD\|183051
NZ_CP010018.1\|WP_045601552.1\|957778_959203_+\|TolC-family-protein	unknown	unknown	gnl\|CDD\|273830
NZ_CP010018.1\|WP_162465482.1\|943822_943981_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010018.1\|WP_080558013.1\|946542_946749_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010018.1\|WP_038708432.1\|954596_956663_+\|FUSC-family-protein	unknown	unknown	gnl\|CDD\|377393
NZ_CP010018.1\|WP_009898306.1\|944836_945391_-\|type-1-fimbrial-protein	unknown	unknown	gnl\|CDD\|226069
NZ_CP010018.1\|WP_009894707.1\|956659_956884_+\|DUF1656-domain-containing-protein	unknown	unknown	gnl\|CDD\|377931
NZ_CP010018.1\|WP_045601546.1\|940608_941154_-\|type-1-fimbrial-protein	unknown	unknown	gnl\|CDD\|226069
NZ_CP010018.1\|WP_045601549.1\|946820_948272_+\|PhoPQ-regulated-protein	unknown	unknown	gnl\|CDD\|226737
NZ_CP010018.1\|WP_155275045.1\|951339_951696_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010018.1\|WP_045601547.1\|941173_943870_-\|fimbrial-biogenesis-outer-membrane-usher-protein	unknown	unknown	gnl\|CDD\|225729
NZ_CP010018.1\|WP_082256026.1\|945976_946570_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|284781
NZ_CP010018.1\|WP_045601545.1\|938209_939886_-\|OmpA-family-protein	unknown	unknown	gnl\|CDD\|143586
NZ_CP010018.1\|WP_009898271.1\|960770_961001_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010018.1\|WP_045601548.1\|944029_944755_-\|fimbria/pilus-periplasmic-chaperone	unknown	unknown	gnl\|CDD\|236634
NZ_CP010018.1\|WP_009898285.1\|956885_957785_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|182548

Protein	Function_ID	Function_description	E-value
NZ_CP010018.1\|WP_045601552.1\|957778_959203_+\|TolC-family-protein	gnl\|CDD\|273830	TIGR01845, Outer_membrane_protein_OprM, efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family. Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined. [Cellular processes, Detoxification, Transport and binding proteins, Porins].	8.10283e-59
NZ_CP010018.1\|WP_045601547.1\|941173_943870_-\|fimbrial-biogenesis-outer-membrane-usher-protein	gnl\|CDD\|225729	COG3188, FimD, P pilus assembly protein, porin PapC [Cell motility and secretion / Intracellular trafficking and secretion].	0
NZ_CP010018.1\|WP_069255329.1\|959202_960402_+\|transcriptional-regulator-CynR	gnl\|CDD\|183051	PRK11242, PRK11242, DNA-binding transcriptional regulator CynR; Provisional.	8.17779e-166
NZ_CP010018.1\|WP_045601546.1\|940608_941154_-\|type-1-fimbrial-protein	gnl\|CDD\|226069	COG3539, FimA, P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion].	2.26283e-20
NZ_CP010018.1\|WP_038708432.1\|954596_956663_+\|FUSC-family-protein	gnl\|CDD\|377393	pfam04632, FUSC, Fusaric acid resistance protein family. This family includes a conserved region found in two proteins associated with fusaric acid resistance, FusC from Burkholderia cepacia and fdt-2 from Klebsiella oxytoca. These proteins are likely to be membrane transporter proteins.	4.3239e-114
NZ_CP010018.1\|WP_009898306.1\|944836_945391_-\|type-1-fimbrial-protein	gnl\|CDD\|226069	COG3539, FimA, P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion].	1.26113e-17
NZ_CP010018.1\|WP_009894707.1\|956659_956884_+\|DUF1656-domain-containing-protein	gnl\|CDD\|377931	pfam07869, DUF1656, Protein of unknown function (DUF1656). This family contains bacterial proteins, many of which are hypothetical. Some proteins in this family are putative membrane proteins.	2.36543e-05
NZ_CP010018.1\|WP_045601549.1\|946820_948272_+\|PhoPQ-regulated-protein	gnl\|CDD\|226737	COG4287, PqaA, PhoPQ-activated pathogenicity-related protein [General function prediction only].	0
NZ_CP010018.1\|WP_009907089.1\|939888_940578_-\|DotU-family-type-IV/VI-secretion-system-protein	gnl\|CDD\|378275	pfam09850, DotU, Type VI secretion system protein DotU. DotU is a family of Gram-negative bacterial proteins that form part of the membrane-joining complex of the type VI secretion system. DotU binds tightly to IcmF and together they are tethered to the inner membrane at one end and the peptidoglycan layer at the other; they interact with Lip1 which then tethers the peptidoglycan layer to the outer membrane.	3.59581e-22
NZ_CP010018.1\|WP_082256026.1\|945976_946570_+\|hypothetical-protein	gnl\|CDD\|284781	pfam07437, YfaZ, YfaZ precursor. This family contains the precursor of the bacterial protein YfaZ (approximately 180 residues long). Many members of this family are hypothetical proteins.	4.64784e-16
NZ_CP010018.1\|WP_045601545.1\|938209_939886_-\|OmpA-family-protein	gnl\|CDD\|143586	cd07185, OmpA_C-like, Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA. OmpA-like domains (named after the C-terminal domain of Escherichia coli OmpA protein) have been shown to non-covalently associate with peptidoglycan, a network of glycan chains composed of disaccharides, which are crosslinked via short peptide bridges. Well-studied members of this family include the Escherichia coli outer membrane protein OmpA, the Escherichia coli lipoprotein PAL, Neisseria meningitdis RmpM, which interact with the outer membrane, as well as the Escherichia coli motor protein MotB, and the Vibrio flagellar motor proteins PomB and MotY, which interact with the inner membrane.	5.51471e-34
NZ_CP010018.1\|WP_045601548.1\|944029_944755_-\|fimbria/pilus-periplasmic-chaperone	gnl\|CDD\|236634	PRK09926, PRK09926, fimbrial chaperone.	4.4353e-95
NZ_CP010018.1\|WP_009898285.1\|956885_957785_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|182548	PRK10559, PRK10559, p-hydroxybenzoic acid efflux pump subunit AaeA.	9.19596e-71

>NZ_CP010018.1|WP_045601549.1|946820_948272_+|PhoPQ-regulated-protein
MLSITYPHAEAAPMDSPCQADAHRDLTDTLACYRQTVESQPLNYTMTSVVQLPGIEQRTYRLVSQSWSPDQLVRPDTWVHEVTLYIPQDALPHRALVIANDGTRHPSDGETPRSPNDFLPDTLTDIARNTRTAVISVSDVPNQLLTYAGDGKPKAEDDSVARSWTLFMQSPHTRATMPLHVPMAASVWRAMSLAERELTTLGIHRFVVSGISKRAWTTWLALIGDKRVDAIAPFAIDLLSTRAALDNMYRSYGGNWPLAFYPYYAEGIDRTLDSRAFGLLMRIEDPLSYLGTRHGSRLAVPKYIVNASGDDFFVPDNSQLYFDKLPGAKALRMVPNASHSDIRRATRDSLIPFVNRIQHGKALPQVEAMPADTNGQTILRLRTSEQPRQLLLWQATNPHARDFRYACGIRYTSTPVTMNGAPPRRLVLDRPASGWRAYFVEATFDDGFVATSQTYILGDGYPSTAPPPIGDICRTLPGRNTRS
>NZ_CP010018.1|WP_080558013.1|946542_946749_-|hypothetical-protein
MATADEILDELIDYPRQNRRLFEPTVTMPRAMRQDERRFLQDGAWRGMHRALASFDRRALQKEKPAAI
>NZ_CP010018.1|WP_082256026.1|945976_946570_+|hypothetical-protein
MSRTESLIFAKRPGWPRVLSKILRAASWIAVFSFMSSARSSDYSIVIGNGYQSVSRTPTGTGFGFLFDATRSGEDAYSIGPGLSFGVPIGAVSLTAAGKALYVRSADGRSGLTTPIGVIASLRAASRLSLVGRALYTPRSFFNAGLGAYTQAAAGVRSTYKPINLEAGWRYEELKGRNGTQNARLANGPYIAAGFSF
>NZ_CP010018.1|WP_009898306.1|944836_945391_-|type-1-fimbrial-protein
MKKNVVSFAAAALLGLGATQAAFAQTVGAAQGKVTFNGELITSTCTVDAGSKDQIVQLPKVSTNTLTTAGQTAGSRPFDIKVIDCPKEVKVAAHFEMDNMHPESRTLKNLDETDKGAKNVSVQLVEADGTPLDVGSTSKNFVEVSDNGAGKYGATLTYGGQYYALGKTDPGLVNTFTRFTLAYE
>NZ_CP010018.1|WP_045601548.1|944029_944755_-|fimbria/pilus-periplasmic-chaperone
MSAAVAAAACCLASALSQAAIVITGTRVVYPESSREVNVRLTNVEQSPVLVQAWIDDGNAGASPDEIKVPFVLMPPVFRVEPKKGQTLRVMYTGDDLPKDRESVYWLNVLEIPPKPTVEAEQNLLQLAFRTRIKLFFRPSALEDGNAAQARDQLTWKVVRNDKGVTVLRAENRSPYYISLSQVTAKSGEKSTQFDPGMVSPFGSRDFVSKRDTSTLSAHAEISYKLLNDYGAEVAGTATAE
>NZ_CP010018.1|WP_162465482.1|943822_943981_+|hypothetical-protein
MFVNPRAVEFRRIDRHAQRSNAACDGSSGDHDLAAAQQSRPAITILLRRLST
>NZ_CP010018.1|WP_045601547.1|941173_943870_-|fimbrial-biogenesis-outer-membrane-usher-protein
MPVDAAEFDGTRIDEHSRSDAMGAALLDAAPTQHDRKALLVASHASPSAPTTVSFNSRLLMSGGIDLSRFERGNPVVAGIYPVDVTVNGERRGRMDVEFRDVRGRDSAAPCFTRATLERLGVEDDLVVKRLDAARGVTGEQSGRPPAIAESACIGLHDALPDATYTLDTADLTLDLTIPQVDMRKTARGYVDPSRWDNGVNAGLLQYNLSGYASENKFFGSGTSSLFLGLQAGVNIGAWRVRQRSNLMWGNRSAGMSWRSLETYVQRDITALRSQITLGDSYTTGEIFESFGVRGVQLASDDRMLPVSLQSYAPTIRGIADTNARVAVRQRGNVIYEASVPPGPFEFDDLPPTGYGGDLDVTITESDGRTKQFTVPFASVRQLLRPGMQRFNFTVGQYRDALSNGKPWVAQLTYQRGLTNLLTGYAGLLSSTGYASGLIGVALNTPIGAFAFDVTSARTSLPGQGARNGFSSHVSYSKMVPSTGTNFSMAAYRYSTANYYSLADAVIARYGYNAEERAWRNDYRARTRLQLNVNQRIGDRSSAYVSSSLLNYWNGRGRDIQFQAGFSSVFKRVSYTVYAQRSRSSDDRTVTQVGVNLSIPLGGGAYTTRNAFSSLTTSLSRASNGDSSVQANLSGSTAHVVPIDYGINVSRSVSGDSNSASLGVYGTYRSPFGTYSGNASVDNRARQASFGANGAVVLHRGGVTLSPPLGPAAALVEAKGAKGGRLINGQGATIDRFGYAVIPSLMPYRANTVAIDPSELPDDVELANTSEEVVPRNNSIVFVKMETKRGRPVFAATETEDGKPLPMGSELFDVDGKSLGGVGQGGMAFLRGLEGSGNLVAKWGTGSSEQCTMPYAVPVDQADAKKSRAIVRIRLRCEPQLRAEASQTSDGDGETRND
>NZ_CP010018.1|WP_045601546.1|940608_941154_-|type-1-fimbrial-protein
MRGATRRWSAIAAAAMFASSAACGAPPSPTVTIKFKGSYNPVTCTVVEGNENKVVNLPTISTSSLTNAGQTAGATAFDISVLCDGYAGNVVTFFEHGPTANENGNLDVEDPNDGQSATGVQIQLVNGDGSPIKVGDLSTMKTVPVEASTPTPIPFFARYYATGKSGAGKVRTHVTFVIQML
>NZ_CP010018.1|WP_009907089.1|939888_940578_-|DotU-family-type-IV/VI-secretion-system-protein
MSIGMPAQSLRMLLQDTMLHVALLTEGARISRVHDWRARCIALVRQFEQAMQDGGYRGGIANELGLAQCVLLDEMTMRNLSPEQKEEWLRELLQFRFHSTRDGLGQVRARVDRLSSAHSANTELLEMYSLFYEFGLLEDRKGAALAGALASEAKPALGKKTAKAPEIWNESGPSDEAAHGRPWRIVGSLLAFAALMTMWLVIDARLSREVEQMGVTSTDEATIRPESGD
>NZ_CP010018.1|WP_045601545.1|938209_939886_-|OmpA-family-protein
MSRQIRFWLVWGAIPFVVLASLCLPLGMQPEWSHVLTIVLIIAAVVLAIEIFERLRETRQDRTVEAEIDDHELAVIIVAGPHASSLFNSKGDDAMLRREAGALWLRADNVEQFRETMARIKASRGRFPDAAVVPLVSESDDESDMRQAFSKWRTELRESLCYPDAAYVLPCYLAVYTCLGFKGGDSARPKWTGDAIEIGAGQMNAASKVGELLAAIRQQLLRPSRTGSSAQCALGLGAFDWLDATALLSSMSALANTPPFMLKGLTLADVGRQPVRPGAWTRWLTVRTGLHIRRPQSSTSPLPVPRVTKVAESGIREGWSSARNIVSARASFVPALVFSTVSTLGIAVAVSAWMNGRMIQRVATDMADYRSAPDEWIGKKRFAQARLEHERTTIVDTLLNGVPAGLGWGLYRGQELLVKLDMALASPRGESTAMQLDTVTLFATGQATFSPGAAQRELQHALRMILANPEQRVLIVGHSDSAGSDAVNLQLSKARARAIRDWFVDQGVLKTRFIVQGAGDTHPVADNASPLGRAQNRRVEILLIPDGASDRTAIETEL
>NZ_CP010018.1|WP_155275045.1|951339_951696_+|hypothetical-protein
MNTPLSTHSPNFKSLVRRLAARLHALVTTRNCRDLLAWKTRKELERLLPTGTPMTQVGWRLGPPHQAVEHPGGYVTWIFLSDGQWLREPGRLLMWSGQTRSLKLTFDREQILTQMQLD
>NZ_CP010018.1|WP_045601551.1|952043_953585_+|membrane-protein
MSISQTRIWMFGFVIAFMLAMSGPLTHTLQKTVDIDKQRNHAPEETATSDTKSAEQPIASEAHQAQTLPRIDPARSPADHFDELPMHLASIGGNERLPSGPLPPGPLPDTSFSPFPFQRGVDAAIHAGPPIPAPSSLTQASIDARTRADTSLDPGTPQPSEAAGMPLSFYADMVEQAMNRTAHDAITLAKLDPDATPLPDMQAEPHDRSAGTHAPIFYADMLAASIHVSIANDRMPSAPPLLTQRAIDIAWTKLFARELPAATMPPAPTPRVALVDATLQAEPFDLAQWNAPDDAHSDLPPFELDGQHDVAPPYSPADTLSSSTPPTNTDSPPDTRVARVEAMRATDFESADGHAAALCSRPLGADERPMEGHAIGLSGSGMEMLVMEQFASSARAASDYARECIHDRPTAFVNSLALPRPSDHFDSSEDASRITFLPRFANDPFQSAFSMPDDTLTHWESPYSGDFALTLKSEPSVHRERDADVRHRVRSCGREDRTGNRSCIATANSDRSD
>NZ_CP010018.1|WP_038708432.1|954596_956663_+|FUSC-family-protein
MPHASVAPLRSRDPLSIDHRKLFFSISTFIAAALVLLISFTVSFPRPWWALLTVYVTAQPMAGAFRPKVLYRLAGIAAGAMVAIVVAPNLQNSPLLLVLCLALWIGFCIYLAVLDRTPRAFLFQMAAFSSAVICLPYLDDPADIFITAISRVEEMTVAILCVTVAHMVLRPAGVRPVIHERALSFLDDACRWTAEAFGTHHARLEHEHRRKLAADVVELGMIAMNLPFDQRFALATRETVTALQHRLAALLSIASAAANRLDRLRSLNAVDAETAALIDSLIVDLRASQEVGDALDIDLASRCRALAAKRLRDPAWTSLLAASLFDRTADFIDTLHAARSLVRTFGDSDVELERHARLVDGAHRFRLARDHGLALLAGAATTTAIMIYCAVWILLAWPSGSATAAFAALVTCSFAAQDDPAPAIGRYLIATLTTFPLAALYLFVILPRVDGAGMLILTLAPAFLWMGYIQADPARSARALPMFSCFIVAMGFLDRFQADFATFVNTGLAQVGGIVTTLVVTKLFRSASTRWTAYRIVRQNWAELAQMADPREALDAQAWTARAVDRLGQVASRVALADPGDALHAVDGLSDLRIGRNIIQVRQRIGRGSARTRHAIERALGEVSNLYRARADASLPVPASAPLLRALDLAIHSAAHDPAGRDDATLLALVGMRCNLLPNVQPIEGGAR
>NZ_CP010018.1|WP_009894707.1|956659_956884_+|DUF1656-domain-containing-protein
MIEEIHIFGIYMPSALAWAIAALILTFLLRGMLLRLPLRLFLWQPALLELAAFFLLWLGIARLADAFLPRGILS
>NZ_CP010018.1|WP_009898285.1|956885_957785_+|efflux-RND-transporter-periplasmic-adaptor-subunit
MKRTIPLLRTCLTAAILVTILGAIYALWTRYQIEPLTRDGKVRADVVPIAPDVGGLVTDVRVHDNQKVTKGQVLLVIDPSRYRIALEHAQADLASQQAELDEAVREDRRNRALPDVVATESTEQGATRVEKLRAAVAQARAARDLAALNLERTRVRAPVDGTVTNVGLLPGVYLSAGKGAMALVNDRSLRVEGYFEETKLPAIHVGDPASVYLMGIASEIRGHVQSIAGGVEDRERAGGAAQLANVNPAFTWVRLAQRIPVRVAIDSVPPGLRLVPGQTASVEIHARAGDVTVRRSLPW
>NZ_CP010018.1|WP_045601552.1|957778_959203_+|TolC-family-protein
MVSAAAKAAAAVLCVALAACAEVGPDYRIPPGALVNTPAANRPFVAGASGAKVASGEPLPDRWWRLFDDPALDGLVEKALSGNVDLRVAEANLARSDALLAAARTAREPSIAADASTNYTQQSAQSVLSHVEPPRHEIYNIGFTASYDLDLFGGIRRGIEAASADREAVAAARDLARVNVAAEVTRAYSDLCNAGNQLDIARRSISVQERRLALTRLLVAHGRAPSFEQRRDEGAADSSRAQLAPLEARRLNAAFRLAALTGQPPENYDRALLACRTPLSLAAPIPTGDGRALLKRRPDVRAAERRLAAATARIGVETAALYPDIKLGASIGSTGGAASFFTPLTNRFAIGPMVTWDLHRNAIRARIEAARADSRASLAHFDATVLAALRETETALETYAGALERLRRLEASRDAARAVMERTDELRRGGKVGGLVALDAERGWLAAQAAVAAAQREVNDDQIATFLALGGSWQ
>NZ_CP010018.1|WP_069255329.1|959202_960402_+|transcriptional-regulator-CynR
MESDMMAARSATFYDHLCDDAATGVSDRSAAGAPADARRASDMPGDAAADGRRPPRTIPRSATAREAQDVAPPERHAQRLIRRNMKSMQRNPLLRNICYLLAVDEHRNFTRAAEALSISQSALSQKIRQLEDELGAQLFDRSGRVVQLTDFGGVYLEYARRAHSDLLTAQRALNDVHDLSRGQLRIGFTPTFTEYLIAPVIEHFHERYPGIVIEMTEMSLDAVETALGDDQVDLAFGFVDVRSDEIEAEALFPERLMLVAGDTHPLTAQRDPITPDQLAETPLALLTTSFVSRFYIDSYFQSYDMKPNVALQANSISAVLKIVRRGKIATILPGTIEFEHRDLQYVPLDPPFPVRTVALLRRKGAYRTVASTAFAESVRALLDNGSLSSLRTMTKRDDS
>NZ_CP010018.1|WP_155275044.1|960515_960749_-|hypothetical-protein
MTNSAHASDIVPARLKPLSRASVSTAESKCGSIEMSTRTLFLRAGAAGWAERIGAGADASPLAGSAVCAARIVAFRS
>NZ_CP010018.1|WP_009898271.1|960770_961001_+|hypothetical-protein
MTIEAGAKARGRQARSAAAPRAKCAIDGAIEQSSGCAMQRDLRTPRLCSDRALRAPISNRYRRIQRRPWTIAAFIA
>NZ_CP010018.1|WP_045601554.1|961395_961698_+|hypothetical-protein
MFKHTLVSLAVALTAFSGIPTNASAQQSQSAAHAESSVRAADAAYTTQLAARSAATGGGIDHVTGAKAAVPAGNAPAGRSIAPELQCVGPVSFCNPYFGS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP010018_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP010018_2

1247523-1248307

Orphan

Consensus_repeat	Method
GCTTGCGCGGCGAGCGCTTCGGCTGC	CRISPRCasFinder

13 spacers

The CRISPR arrays of NZ_CP010018_2

>merge|NZ_CP010018|2|1247523-1248307|CRISPRCasFinder
GCTTGCGCGGCGAGCGCTTCGGCCGCGGCCTTGTCTTTGGCCGCCTGGGCCGCTGCGGCGTCGGCCGCGCTGCGCTCCTCGGCCGCCTGTTCGGTCGCGCGCGCTTCGGCGGCCGCGCGCTCGGCACTGGCTTGCGCGGCGAGCAGCTCCGCTGCCGCGCGGTCGGCCGCGGCCTGAGCGGCAAGCGCTTCGGCTTTCGCCTTGTCGTCGGCCGCTTGCGCGGCAGCTTGTTCGGCGGCGGCGCGGTCGGCCGCCGCCTGTGCGCCGGCGCGCGTATCGGCCTCCGCCCGTTCGTTCGCCGCTTGCGCGGCGAGCGCTTCGGCTGCGGCCTTGTCGGTTGCGGCCTGGGCAGCGGCCTGCTCGGCGGCGGCGCGATCGGCCGCTGCTTGCGCGGCGAGCGCTTCGGCTGCCGATTTGTCGCTGGCTGCTTGCGCCGCTGCGGCATCGGCCGCGCTGCGCTCGGTCGATGCACGTTCCGCTGCCTCGCGATCGGTTGCGGCTCGAGCGGCTAGTGCTTCGGCGGCCGACTTGTCCGCCGCGGCGTGCGCGGCAGCCTGCTCCGCCGCTGCGCGCTCCGCCGCCGCTTGCGCGGCGAGCGCTTCGGCCGCGGTCTTGTCGGTGACCGCCTGCGCGGCGACTGCTTCGGCCGCCGCCTGGACGGCGACGGCCTGCTTGGCGAGCGCGTCGGCGGCTTCCTTGTCGGCGGCCGCTTGAGCGGCGAGTGCTTCGAGCGTTGCTTGCTCGACGGACATTTGAGCGGCTTGCGCGTGTTTCGCGGCGGCTTC

>NZ_CP010018|2|1|1247523-1248307|CRISPRCasFinder
GCTTGCGCGGCGAGCGCTTCGGCCGC	GGCCTTGTCTTTGGCCGCCTGGGCCGCTGCGGCGTCGGCCGCGCTGCGCTCCTCGGCCGCC
TGTTCGGTCGCGCGCGCTTCGGCGGC	CGCGCGCTCGGCACTG
GCTTGCGCGGCGAGCAGCTCCGCTGC	CGCGCGGTCGGCCGCG
GCCTGAGCGGCAAGCGCTTCGGCTTT	CGCCTTGTCGTCGGCC
GCTTGCGCGGCAGCTTGTTCGGCGGC	GGCGCGGTCGGCCGCCGCCTGTGCGCCGGCGCGCGTATCGGCCTCCGCCCGTTCGTTCGCC
GCTTGCGCGGCGAGCGCTTCGGCTGC	GGCCTTGTCGGTTGCGGCCTGGGCAGCGGCCTGCTCGGCGGCGGCGCGATCGGCCGCT
GCTTGCGCGGCGAGCGCTTCGGCTGC	CGATTTGTCGCTGGCT
GCTTGCGCCGCTGCGGCATCGGCCGC	GCTGCGCTCGGTCGATGCACGTTCCGCTGCCTCGCGATCGGTTGCG
GCTCGAGCGGCTAGTGCTTCGGCGGC	CGACTTGTCCGCCGCGGCGTGCGCGGCAGCCTGCTCCGCCGCTGCGCGCTCCGCCGCC
GCTTGCGCGGCGAGCGCTTCGGCCGC	GGTCTTGTCGGTGACC
GCCTGCGCGGCGACTGCTTCGGCCGC	CGCCTGGACGGCGACG
GCCTGCTTGGCGAGCGCGTCGGCGGC	TTCCTTGTCGGCGGCC
GCTTGAGCGGCGAGTGCTTCGAGCGT	TGCTTGCTCGACGGACATTTGAGCG
GCTTGCGCGTGTTTCGCGGCGGCTTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP010018.1\|WP_009901500.1\|1242163_1242517_-\|DOPA-4,5-dioxygenase-family-protein	unknown	unknown	gnl\|CDD\|378079
NZ_CP010018.1\|WP_009901488.1\|1251467_1252583_+\|OpgC-domain-containing-protein	unknown	unknown	gnl\|CDD\|378405
NZ_CP010018.1\|WP_019255813.1\|1250121_1251015_+\|EamA-family-transporter-RarD	unknown	unknown	gnl\|CDD\|225510
NZ_CP010018.1\|WP_045601735.1\|1237440_1238799_-\|aspartate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|235917
NZ_CP010018.1\|WP_009901456.1\|1260112_1261054_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176109
NZ_CP010018.1\|WP_025405913.1\|1245593_1246784_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|213815
NZ_CP010018.1\|WP_127446965.1\|1255229_1255424_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010018.1\|WP_009901505.1\|1239919_1240843_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176149
NZ_CP010018.1\|WP_009894248.1\|1243094_1244255_-\|adenosyl-hopene-transferase-HpnH	unknown	unknown	gnl\|CDD\|274595
NZ_CP010018.1\|WP_019255816.1\|1254157_1255237_-\|porin	unknown	unknown	gnl\|CDD\|238208
NZ_CP010018.1\|WP_009894247.1\|1244267_1245209_-\|4-hydroxy-3-methylbut-2-enyl-diphosphate-reductase	unknown	unknown	gnl\|CDD\|234893
NZ_CP010018.1\|WP_009894225.1\|1257491_1258769_+\|CoA-transferase	unknown	unknown	gnl\|CDD\|367110
NZ_CP010018.1\|WP_045601737.1\|1239080_1239527_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010018.1\|WP_009901510.1\|1236684_1237110_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|237361
NZ_CP010018.1\|WP_045601747.1\|1252650_1254114_-\|MmgE/PrpD-family-protein	unknown	unknown	gnl\|CDD\|377179
NZ_CP010018.1\|WP_009894263.1\|1236309_1236516_+\|YbdD/YjiX-family-protein	unknown	unknown	gnl\|CDD\|377308
NZ_CP010018.1\|WP_045601742.1\|1248660_1249668_-\|NAD-dependent-epimerase/dehydratase-family-protein	unknown	unknown	gnl\|CDD\|163279
NZ_CP010018.1\|WP_009894237.1\|1249828_1250125_+\|acylphosphatase	unknown	unknown	gnl\|CDD\|184674
NZ_CP010018.1\|WP_045601750.1\|1256668_1257418_+\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
NZ_CP010018.1\|WP_045601734.1\|1234218_1236297_+\|carbon-starvation-protein-A	unknown	unknown	gnl\|CDD\|184976

Protein	Function_ID	Function_description	E-value
NZ_CP010018.1\|WP_009901500.1\|1242163_1242517_-\|DOPA-4,5-dioxygenase-family-protein	gnl\|CDD\|378079	pfam08883, DOPA_dioxygen, Dopa 4,5-dioxygenase family. This family of proteins are related to a DOPA 4,5-dioxygenase that is involved in synthesis of betalain. DOPA-dioxygenase is the key enzyme involved in betalain biosynthesis. It converts 3,4-dihydroxyphenylalanine to betalamic acid, a yellow chromophore.	3.79813e-47
NZ_CP010018.1\|WP_009901488.1\|1251467_1252583_+\|OpgC-domain-containing-protein	gnl\|CDD\|378405	pfam10129, OpgC_C, OpgC protein. This domain, found in various hypothetical and OpgC prokaryotic proteins. It is likely to act as an acyltransferase enzyme.	4.20944e-103
NZ_CP010018.1\|WP_019255813.1\|1250121_1251015_+\|EamA-family-transporter-RarD	gnl\|CDD\|225510	COG2962, RarD, Predicted permeases [General function prediction only].	1.62193e-70
NZ_CP010018.1\|WP_045601735.1\|1237440_1238799_-\|aspartate-aminotransferase-family-protein	gnl\|CDD\|235917	PRK07046, PRK07046, aminotransferase; Validated.	0
NZ_CP010018.1\|WP_009901456.1\|1260112_1261054_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176109	cd08417, PBP2_Nitroaromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators that involved in the catabolism of nitroaromatic/naphthalene compounds and that of related regulators; contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of dinitrotoluene and similar compounds, such as DntR, NahR, and LinR. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. Also included are related LysR-type regulators clustered together in phylogenetic trees, including NodD, ToxR, LeuO, SyrM, TdcA, and PnbR. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.87835e-61
NZ_CP010018.1\|WP_025405913.1\|1245593_1246784_+\|glycosyltransferase	gnl\|CDD\|213815	TIGR03469, HpnB, hopene-associated glycosyltransferase HpnB. This family of genes include a glycosyl transferase, group 2 domain (pfam00535) which are responsible, generally for the transfer of nucleotide-diphosphate sugars to substrates such as polysaccharides and lipids. The genes of this family are often found in the same genetic locus with squalene-hopene cyclase genes, and are never associated with genes for the metabolism of phytoene. Indeed, the members of this family appear to never be found in a genome lacking squalene-hopene cyclase (SHC), although not all genomes encoding SHC have this glycosyl transferase. In the organism Zymomonas mobilis the linkage of this gene to hopanoid biosynthesis has been noted and the gene named HpnB. Hopanoids are known to feature polar glycosyl head groups in many organisms.	0
NZ_CP010018.1\|WP_009901505.1\|1239919_1240843_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176149	cd08460, PBP2_DntR_like_1, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold. This CD includes an uncharacterized LysR-type transcriptional regulator similar to DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	9.04348e-93
NZ_CP010018.1\|WP_009894248.1\|1243094_1244255_-\|adenosyl-hopene-transferase-HpnH	gnl\|CDD\|274595	TIGR03470, HpnH, hopanoid biosynthesis associated radical SAM protein HpnH. The sequences represented by this model are members of the radical SAM superfamily of enzymes (pfam04055). These enzymes utilize an iron-sulfur redox cluster and S-adenosylmethionine to carry out diverse radical mediated reactions. The members of this clade are frequently found in the same locus as squalene-hopene cyclase (SHC, TIGR01507) and other genes associated with the biosynthesis of hopanoid natural products. The linkage between SHC and this radical SAM enzyme is strong; one is nearly always observed in the same genome where the other is found. A hopanoid biosynthesis locus was described in Zymomonas mobilis consisting of the genes HpnA-E and SHC (HpnF). Continuing past SHC are found a phosphorylase enzyme (ZMO0873, i.e. HpnG, TIGR03468) and this radical SAM enzyme (ZMO0874) which we name here HpnH. Granted, in Z. mobilis, HpnH is in a convergent orientation with respect to HpnA-G, but one gene beyond HpnH and running in the same convergent direction is IspH (ZM0875, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase), an essential enzyme of IPP biosynthesis and therefore essential for the biosynthesis of hopanoids. One of the well-described hopanoid intermediates is bacteriohopanetetrol. In the conversion from hopene several reactions must occur in the side chain for which a radical mechanism might be reasonable. These include the four (presumably anaerobic) hydroxylations and a methyl shift.	0
NZ_CP010018.1\|WP_019255816.1\|1254157_1255237_-\|porin	gnl\|CDD\|238208	cd00342, gram_neg_porins, Porins form aqueous channels for the diffusion of small hydrophillic molecules across the outer membrane. Individual 16-strand anti-parallel beta-barrels form a central pore, and trimerizes thru mainly hydrophobic interactions at the interface. Trimers are stabilized by hytrophillic clamping of Loop L2. Loop 3 bends into the pore, creating an elliptical constriction of about 7 x 11A, large enough to allow passage of a glucose molecule without steric hindrance. Removal of the C-terminal residue (usuallly F) destabilizes the trimer and removal of the 16th beta-sheet abolishes trimerization. Unlike typical membrane proteins, porins lack long hydrophobic stretches. Short turns are found at the smooth, periplasmic end, longer irregular loops are found at the rough, extracellular end. C-terminal residue forms salt bridge with N-terminus.	3.2726e-65
NZ_CP010018.1\|WP_009894247.1\|1244267_1245209_-\|4-hydroxy-3-methylbut-2-enyl-diphosphate-reductase	gnl\|CDD\|234893	PRK01045, ispH, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase; Reviewed.	1.26694e-176
NZ_CP010018.1\|WP_009894225.1\|1257491_1258769_+\|CoA-transferase	gnl\|CDD\|367110	pfam02515, CoA_transf_3, CoA-transferase family III. CoA-transferases are found in organisms from all lines of descent. Most of these enzymes belong to two well-known enzyme families, but recent work on unusual biochemical pathways of anaerobic bacteria has revealed the existence of a third family of CoA-transferases. The members of this enzyme family differ in sequence and reaction mechanism from CoA-transferases of the other families. Currently known enzymes of the new family are a formyl-CoA: oxalate CoA-transferase, a succinyl-CoA: (R)-benzylsuccinate CoA-transferase, an (E)-cinnamoyl-CoA: (R)-phenyllactate CoA-transferase, and a butyrobetainyl-CoA: (R)-carnitine CoA-transferase. In addition, a large number of proteins of unknown or differently annotated function from Bacteria, Archaea and Eukarya apparently belong to this enzyme family. Properties and reaction mechanisms of the CoA-transferases of family III are described and compared to those of the previously known CoA-transferases.	4.46896e-127
NZ_CP010018.1\|WP_009901510.1\|1236684_1237110_-\|transcriptional-regulator	gnl\|CDD\|237361	PRK13355, PRK13355, bifunctional HTH-domain containing protein/aminotransferase; Provisional.	3.01391e-06
NZ_CP010018.1\|WP_045601747.1\|1252650_1254114_-\|MmgE/PrpD-family-protein	gnl\|CDD\|377179	pfam03972, MmgE_PrpD, MmgE/PrpD family. This family includes 2-methylcitrate dehydratase EC:4.2.1.79 (PrpD) that is required for propionate catabolism. It catalyzes the third step of the 2-methylcitric acid cycle.	1.02242e-135
NZ_CP010018.1\|WP_009894263.1\|1236309_1236516_+\|YbdD/YjiX-family-protein	gnl\|CDD\|377308	pfam04328, Sel_put, Selenoprotein, putative. This entry includes a group of putative selenoproteins from Proteobacteria, Actinobacteria and Firmicutes. The invariant cysteine at the C-terminus is encoded by a TGA Sec codon in some Epsilonproteobacteria, suggesting a redox activity for the protein.	1.11346e-29
NZ_CP010018.1\|WP_045601742.1\|1248660_1249668_-\|NAD-dependent-epimerase/dehydratase-family-protein	gnl\|CDD\|163279	TIGR03466, HpnA, hopanoid-associated sugar epimerase. The sequences in this family are members of the pfam01370 superfamily of NAD-dependent epimerases and dehydratases typically acting on nucleotide-sugar substrates. The genes of the family modeled here are generally in the same locus with genes involved in the biosynthesis and elaboration of hopene, the cyclization product of the polyisoprenoid squalene. This gene and its association with hopene biosynthesis in Zymomonas mobilis has been noted in the literature where the gene symbol hpnA was assigned. Hopanoids are known to be components of the plasma membrane and to have polar sugar head groups in Z. mobilis and other species.	0
NZ_CP010018.1\|WP_009894237.1\|1249828_1250125_+\|acylphosphatase	gnl\|CDD\|184674	PRK14424, PRK14424, acylphosphatase; Provisional.	3.12995e-58
NZ_CP010018.1\|WP_045601750.1\|1256668_1257418_+\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	2.89217e-51
NZ_CP010018.1\|WP_045601734.1\|1234218_1236297_+\|carbon-starvation-protein-A	gnl\|CDD\|184976	PRK15015, PRK15015, carbon starvation protein CstA.	0

>NZ_CP010018.1|WP_025405913.1|1245593_1246784_+|glycosyltransferase
MTLIVVFLLSCLSLVIWLVLLFGRGGFWRARPARRLPPDARGAAAAAGWPAVAAVVPARNEADVIGEAVQSLVGQAYEGAFHLIVVDDHSTDGTADAARAAAAAVGRADRLTVLAAQPLPAGWSGKVWAQSQGIAAVRSLGLPADYLLLTDADIGHPPDAVAQLVTRAQAEQRDLVSLMVRLRCDSFWEKALIPAFVFFFAKLYPFSWVNDPRNRTAGAAGGCMLVRRDALEEAGGIESIRGALIDDCSLAAQIKHRGAGRHPIRLDLADRSVSLRPYDSWRDIWNMIARTAFTQLRYSPALLLGTLVGMTIIYLVPPVAALAYGARAWPAWLAWASMCTAYAPMLSYYRRSPWWAPALPLVALFYVGATVASAVRYWRGKGGQWKARVQAPVQDR
>NZ_CP010018.1|WP_009894247.1|1244267_1245209_-|4-hydroxy-3-methylbut-2-enyl-diphosphate-reductase
MRVILAQPRGFCAGVVRAIEIVERALQQNGAPVYVRHEIVHNRHVVENLRNKGARFVEELDEVPHGAVAIFSAHGVAQTVEKDADARGLDVLDATCPLVTKVHVQGRQYVAAGRRLILIGHAGHPEVEGTIGQIPAEVILVQSEAEVDTLTLPADTPVAYVTQTTLSVDDTRGIIEALQRRFTDIVGPDTRDICYATQNRQAAVRELSEQVDVLLVVGATNSSNSNRLREIGTESGVPSYLVADGSEIRAEWFASARTVGLTAGASAPEEMVEDVIAALRALGPVEVATMSGREEKVEFKLPAKLTQAVAREV
>NZ_CP010018.1|WP_009894248.1|1243094_1244255_-|adenosyl-hopene-transferase-HpnH
MSIPLLQQVRVGAYIVRQHLSGNKRYPLALMLEPLFRCNLACNGCGKIDYPDPILNQRLSVEECLQAVDECGAPVVSIAGGEPLLHKEMPEIVRGIMKRKKFVYLCTNALLMEKKMDDYEPSPYFVWSVHLDGDKDMHDHSVSQDGVYDKAVAAIKEAKRRGFRVNINCTLFNDAIPERVAKFFDTLGPIGVDGITVSPGYAYERAPDQQHFLNRDKTKNLFREIFKRGEGGKRWSFSQSSLFLDFLAGNQTYKCTPWGNPARTVFGWQKPCYLVGEGYVKTFKELMESTDWDNYGVGNYEKCADCMVHCGFEATAVMDTIAHPLKALKVSMSGIRTDGAFAPDIPIDNQRPAEYVFSRHVEIKLEEIQRAGKGKLQKSPKPAATA
>NZ_CP010018.1|WP_009901500.1|1242163_1242517_-|DOPA-4,5-dioxygenase-family-protein
MTSSDVAAITGWHAHIYFDASSRDAAWAFRETVERRFGASVQLGRFHERLVGPHPAWSYQIAFEPAQFAEVVPWLILHHGALDVFLHPNTGDELRDHRDAAVWIGRSHALDLAALKP
>NZ_CP010018.1|WP_009901505.1|1239919_1240843_-|LysR-family-transcriptional-regulator
MAPDLNLLIALDALLEEGSVVGAARRMNLSPPAMSRTLARIRETVGDPIFVQAGRKMVPTPRALALRGAVRETVERASQLLAPSAEVDLRTLDKQFNVRANDIFVGTHGGRLLEEMERGMPRAMLRFTPEENDVDDDALRSGRIDLFISASRRLGPEIRVQPLFTTAFVGLARSDHPIFDDHITPERFARWPHIGVSRRGKSSGPIDAALGERGLKRRVALVVPTPYAAVFALQASDLILPLPEHLALGAMQAGLGVRTFELPVPLETVLITQAWHPRFQSDPAHQWLRRVVRGLCTGMAALQPAHA
>NZ_CP010018.1|WP_045601737.1|1239080_1239527_-|hypothetical-protein
MALDPQDFIVHDISRFPMCVFRERAATHGYAPQWEQEIDALMRRGAPFVVVYVSLDADEHHDDRRHRAMWLKRNKAALAAVCKALISVEPDAERRAAAVEQGRTAVSAFGIPHAAVASLGEAAALAARLAGADDQNGASGGGAAAPRT
>NZ_CP010018.1|WP_045601735.1|1237440_1238799_-|aspartate-aminotransferase-family-protein
MEIRHGVNLARARALAARERDAFARAMPKSRALSAEAAQHLLFGVPLHWMRDWSTPFSLYVDHARGAHFTDVDGHRYADFCLGDTGAMFGHAPEPVARALADQAARGYTTMLPSADAAWVGAELARRFRLPYWQFALSASDANRFVLRWARAATGRKHIVVFNGCYHGTVDDVFVDLVDGRPVQRDSLLGQAHDLLAYTRVVEFNDLGALEAALKDGDVACVLAEPALTNIGMVLPDPGFWREARALIRRYGTLLAIDETHTISSGPGGYAVAHGLEPDLLVVGKPIGGGVPCAVYGFSAPFAERAQRAKASAPPGHSGIGTTLTANMLAMRAIRATLADVMTDAAYAHMFDLAARLAAGLEQAIARRGLPWCVTRIGARTEFQFAPTPPRNGTIAGMQLDGELEHIVHLYLLNRGVLITPFHNMMLVCPETTAEDVDRLTAAFEACIGEMA
>NZ_CP010018.1|WP_009901510.1|1236684_1237110_-|transcriptional-regulator
MPTLEEKAAFAERLKFALQRSPEKISGATALALRFNLRHRGEHPISPQTAHKWLTGRTIPTPDKLRTLADWLRVDLHWLHYGPPPGAPGGKTPAPPRHDEKYAPTQETIELASKIEALSPHHRYLMQELIEHFYGDPSKRR
>NZ_CP010018.1|WP_009894263.1|1236309_1236516_+|YbdD/YjiX-family-protein
MFSDLGGELRTAGRYLGQALRLMVGLPDYDGYVAHMRATHPDRPVMTYEAFFRERQNARYGSGAGKCC
>NZ_CP010018.1|WP_045601734.1|1234218_1236297_+|carbon-starvation-protein-A
MNRASGYLIWIAVALLGAFAFGTIALAHGERVSALWIVIAAVCVYLIAYRFYSRFIASKVVQLDGLRMTPAVKYNDGLDYVPTNKYVLFGHHFAAIAGAGPLVGPVLAAQMGYTPGMLWILAGVVFAGAVQDFIVLFISTRRDGRSLGDLVKMELGTVPGVIALFGAFLIMVIILAVLALIVVKALTNSPWGTFTVAATIPIALFMGIYTRYIRPGRIGEVSIIGFVLLMASIAYGQHVHDSPALAAWFTFSGTQLTWILIGYGFVASVLPVWLLLAPRDYLSTFLKIGTIVGLAIGILIVAPELKMPALTKFVDGTGPVWSGNLFPFLFITIACGAVSGFHSLISSGTTPKLLDNETNARFIGYGAMLMESFVAIMALVAACVIEPGVYFAMNAPAAVLGTTPEAVAHTVTQWGFMLTPDMLTQTAKAVGETTIIARAGGAPTLAVGMAQILHQVIGGEAMMAFWYHFAILFEALFILTAVDAGTRAGRFMLQDLLGTFHPAFKRTESLPANLTATALCVAAWGYFLYQGVVDPLGGINTLWPLFGISNQMLAAIALVLGTVVLFKMKRERYAWVTIVPTAWLLICTLTAGWQKVFDSNPKVSFLAHAAKLQAAAADGKVLAPAKSIAQMQRIIFNDYVDAALSALFILVVVSIAVYGVIAVARARRAAQPTSRETPYEQMPAAQALGSGR
>NZ_CP010018.1|WP_045601742.1|1248660_1249668_-|NAD-dependent-epimerase/dehydratase-family-protein
MTDIQRDLVLVTGASGFVGSAVARAARQQGHRVRVLVRPTSPRTNVADLDAEIATGDMRDEASMRAALRGVRYLLHVAADYRLWAPDPLEIERANLEGAVATMRAALAEGVERIVYTSSVATLKVTPSGASADESSPLTAEQAIGVYKRSKVLAERAVERMIADDRLPAVIVNPSTPIGPRDVKPTPTGRIIVEAALGKIPAFVDTGLNLVHVDDVALGHLLALEHGRIGERYILGGENLPLQSMLADIAQLTGRKPPTIALPRWPLYPIALGAEAVAKLTKREPFVTVDGLKMSKNKMYFTSAKAERELGYRARPYREGIRDALDWFRQARYLR
>NZ_CP010018.1|WP_009894237.1|1249828_1250125_+|acylphosphatase
MSGDDLDERIETYYVRVRGVVQGVGFRHATVREAHALKLRGWVANLDDGSVEAMLQGPAPQIDRMLAWLRHGPSTAHVTEVTFEERPTDKRFERFQQH
>NZ_CP010018.1|WP_019255813.1|1250121_1251015_+|EamA-family-transporter-RarD
MSAAADYPRAGRGIALSVAASALFALLSAYAKLLAPLTGLDIFAWRIVWTAPGAIAIVVLRGRWPALRELLSRAFASARFALSLAASAGLLGLQLWLFLWAPLHGRMLEVSLGYFLLPLTMVLVGRFHYHERLSGLQWLALACAATGVAHELWATRAFAWPTLVVALGYPPYFVLRRRVNADSLALFAVEMLALLPVAAATLAAGGTSVADRPLLWALLLPGLGAISTLALASYLKASRMLPMALFGILGYVEPVLLVAVAVLVLDEALSWQQLATYAPIWAAVALTAWHGFLMARR
>NZ_CP010018.1|WP_009901488.1|1251467_1252583_+|OpgC-domain-containing-protein
MSGSAMSSPAPAARSIEVDFFRGLVLLTIVVDHIGASVLSRVTLHAFALCDAAEVFVFLGGFATASAFLAVSARHGPGAARRRFVRRAAQIYRAFLATSTLMLVVSAVLDHYGIDAPNMALDDISVLLASPLTGLVELLTFKRQPYLASVLPMYVLFALATPAIVPLARAKPWWLLFGSVLMWGCAPWLAAELLDTDSFRWSFNPFAWQLMFVLGALMRCWPLHRDVATRPGGAAITAIAFAIVLACAYYKLCAGLPLPEGELKRHLAWPRVMNFVAFAWLMAELVRHGWIARVARAAQPVVAVGQRGMPCFVAGAAISLTLDSVLHGVRGNARLPQLGMGLAADACALALMLTVAHSGPLFRRKRRSVAA
>NZ_CP010018.1|WP_045601747.1|1252650_1254114_-|MmgE/PrpD-family-protein
MNRRHFLAAAGGLPLAATLAPLDACARPNAAPTPPMLARQLAEYAAGLRYEDLDAATIDTVKSHLIDALGCTLAALDEPPVRIARDAARRIGGGPSTVIGTAERTSPDLATFATGTALRYFDFNDAYAGREIGHPSDNIAACVAVAEAQHASGRDLILSIALAYEIACRLMDAAAISPRGWDHTCYSLPAAALAAGKLMRMPVASLTQAVNLSLNSHLALNQTRVQELSNWKALADADAARNAVFSTLLARAGLTGPSPIFEGEAGFFRQVSGPFELDTHRFGGRGEPFGIARCFVKYYPAQGFTQTAIPAALDVASQAGDPSRIRRIDVHTTHVGYVTAGSEPEKWNPSTRETADHSLPYVVARAMLDGDIRTTSFSDAALHDPALRALIAKIRVEEDLALTAGYPARAANRVTAYCRDGAVYAKQVDDLPGSPTRPMRREDFEAKFVKNGGARLSARRMRAALDQIWRLDALSDVATLPPLFVAG
>NZ_CP010018.1|WP_019255816.1|1254157_1255237_-|porin
MDKRLSALCGLGLVSAGACAQTSVTLYGVADAYIEYATNQTSANGEPAALARMGSGGKSGSRWGIKGTEALGDGWRATFRLESGTNLNNGAGTGAGGFDRSAWIALEHPRWGALRFGRQYTTLFDIMEHYSPTGAYSTLYEPDGAIVGINFRENNVVKYLATAGPLTFEAHYAFSNAPGAFQASAAHGAGIEYTGGALSFAFAYDDVHTPQAGSFAHFRRYAAAAMLTVEATQLIAGVAHGQGGVATPSVVTRYTFWWIGVREAITPVVQLVGALYAQRVLAQNPASAPTARHASGTPQQATLQLNYFVSKTTTLYAAAGYARHAALDFDDYNYGFLHYSLAGGRCGSAGVAVGVRKLF
>NZ_CP010018.1|WP_127446965.1|1255229_1255424_+|hypothetical-protein
MSIVVSTYVPLFLRNRSSSCLLSLLLLLLLLSLLLLPLFRFAAHVVFALAAFGVAAAIDRVPHV
>NZ_CP010018.1|WP_045601750.1|1256668_1257418_+|IclR-family-transcriptional-regulator
MTNQTDGGVAAVNRALAALVAFGEAPGGLTLAQVSEASGVNMSTLLRMFESLERFRFIKRLNDGRYVLGPAVFQLGMMYRESFRLREHVVPVLDALGAETGETTAFYVREGDQRVCLFRVHPQRAVRTYLREGDRYPLDVGAAGRVLLAFSGARGGGFDKTAAQGYAVSRGERDPDSAAIACPVFGVGRALIGALSLGVPRFRFNKKVQADYLPRVQAAADALTHVLGGDLPPAAGVAQVVDLFGAAHE
>NZ_CP010018.1|WP_009894225.1|1257491_1258769_+|CoA-transferase
MDVRQTQVEERASPRRRANTGPIHAKRFDADARGPLAGVRVVDLSRLMAGNMLSLQLADFGADVVKVENERGDTLRAVGAGGVSTNWKVYGRNKRSVCVDLRSADGIDIVKRLVRDADVFVESFKPGVLEQMGLGPDVLLALRPSLVIARISGWGQTGPYRHKPGFGTLAEGYAGFASINGFADREPVLPPMFLGDMTAGLSGAIAVLVALHACRDGATGQVIDVSLFEPLFSILGPAAANYVLTGRVKERTGSRSSNTAPRNAYRTRDDKWLCLSSSTQGMAERLFRAIGRADLIDDPRYATNVQRVQHAGELDAIVGAFVAERDLADNLAFFEKSGVTVGPILDIAQIVQDRYVIEREALVELPDDDVGSLPMHGVVPRLSGTPGGFRRAAPRLGEHNREILLPLLGAHEYARLARNGVIRPE
>NZ_CP010018.1|WP_009901456.1|1260112_1261054_+|LysR-family-transcriptional-regulator
MNLRSIDLNLLVILDALLAERQVTRAGQRIGLTQPAVSNALGRLRYVFKDEILVRTPLGMELTPRAKALACPIRQILQQIEELFAPENQFDSITSDRRFTLRMSDLTELLLLPPLLRNIRGMAPHIRMNVMHLNADKTVEALDSGRLDMAVCAGLDHPGAISSQVLFQDRLVCVLSRRHPDANRPLTLERFAALDFLNVSINPVDSSLIDTMLADMRFTRRIAFNVPHWLVVPSMLDALPLAVIMSERHALSLGDPRLAIRELPLDLEPVTWSLYWHRRYDNSVAHEWLRSCIADVVDAIQQRGVLEEASAMG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP010018_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP010018_3

2367689-2367780

Orphan

Consensus_repeat	Method
CGCTTCCGCCTTGCGCGCGTCGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP010018_3

>merge|NZ_CP010018|3|2367689-2367780|CRISPRCasFinder
CGCTTCCGCCTTGCGCGCGTCGCCGTCGTGCTTGCGGTGCCTGTCGTCGTCGGCCGTGCGCTTCGCGCCCGCTTCGGCCTTGCGCGCGTCGC

>NZ_CP010018|3|2|2367689-2367780|CRISPRCasFinder
CGCTTCCGCCTTGCGCGCGTCGC	CGTCGTGCTTGCGGTGCCTGTCGTCGTCGGCCGTGCGCTTCGCGCC
CGCTTCGGCCTTGCGCGCGTCGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP010018.1\|WP_009899924.1\|2363231_2363957_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225099
NZ_CP010018.1\|WP_045602528.1\|2359234_2360713_-\|serine/threonine-protein-phosphatase	unknown	unknown	gnl\|CDD\|277318
NZ_CP010018.1\|WP_045602536.1\|2365774_2366395_+\|HAD-hydrolase-like-protein	unknown	unknown	gnl\|CDD\|319799
NZ_CP010018.1\|WP_045602520.1\|2355925_2356198_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010018.1\|WP_045602527.1\|2357552_2359238_-\|cytochrome-c-methylamine-utilization-protein	unknown	unknown	gnl\|CDD\|224771
NZ_CP010018.1\|WP_009896595.1\|2368626_2369136_-\|winged-helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|183009
NZ_CP010018.1\|WP_045602530.1\|2361874_2363182_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340929
NZ_CP010018.1\|WP_009896602.1\|2374083_2374425_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010018.1\|WP_045602529.1\|2360932_2361823_-\|amidohydrolase-family-protein	unknown	unknown	gnl\|CDD\|226145
NZ_CP010018.1\|WP_009899936.1\|2371436_2372078_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010018.1\|WP_045602525.1\|2356529_2357390_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|377216
NZ_CP010018.1\|WP_045602540.1\|2370998_2371352_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010018.1\|WP_127446982.1\|2373762_2374059_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010018.1\|WP_045602544.1\|2376046_2378077_-\|BCCT-family-transporter	unknown	unknown	gnl\|CDD\|376718
NZ_CP010018.1\|WP_045603218.1\|2372255_2373647_-\|alkaline-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|293737
NZ_CP010018.1\|WP_009899933.1\|2369328_2370345_+\|1-aminocyclopropane-1-carboxylate-deaminase	unknown	unknown	gnl\|CDD\|183494
NZ_CP010018.1\|WP_045602533.1\|2364157_2365420_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340877
NZ_CP010018.1\|WP_045602542.1\|2374599_2375790_+\|serine-hydrolase	unknown	unknown	gnl\|CDD\|365903
NZ_CP010018.1\|WP_045602546.1\|2378416_2379361_+\|MurR/RpiR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224651
NZ_CP010018.1\|WP_011401139.1\|2355397_2355610_-\|DUF3079-domain-containing-protein	unknown	unknown	gnl\|CDD\|337966

Protein	Function_ID	Function_description	E-value
NZ_CP010018.1\|WP_009899924.1\|2363231_2363957_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|225099	COG2188, PhnF, Transcriptional regulators [Transcription].	3.20406e-58
NZ_CP010018.1\|WP_045602528.1\|2359234_2360713_-\|serine/threonine-protein-phosphatase	gnl\|CDD\|277318	cd00839, MPP_PAPs, purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain. Purple acid phosphatases (PAPs) belong to a diverse family of binuclear metallohydrolases that have been identified and characterized in plants, animals, and fungi. PAPs contain a binuclear metal center and their characteristic pink or purple color derives from a charge-transfer transition between a tyrosine residue and a chromophoric ferric ion within the binuclear center. PAPs catalyze the hydrolysis of a wide range of activated phosphoric acid mono- and di-esters and anhydrides. PAPs are distinguished from the other phosphatases by their insensitivity to L-(+) tartrate inhibition and are therefore also known as tartrate resistant acid phosphatases (TRAPs). While only a few copies of PAP-like genes are present in mammalian and fungal genomes, multiple copies are present in plant genomes. PAPs belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	1.67697e-08
NZ_CP010018.1\|WP_045602536.1\|2365774_2366395_+\|HAD-hydrolase-like-protein	gnl\|CDD\|319799	cd04303, HAD_PGPase, phosphoglycolate phosphatase, similar to Synechococcus elongates phosphoglycolate phosphatase PGP/CbbZ. Phosphoglycolate phosphatase catalyzes the dephosphorylation of phosphoglycolate; its activity requires divalent cations, especially Mg++. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	2.63936e-66
NZ_CP010018.1\|WP_045602529.1\|2360932_2361823_-\|amidohydrolase-family-protein	gnl\|CDD\|226145	COG3618, COG3618, Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only].	3.36497e-69
NZ_CP010018.1\|WP_045602527.1\|2357552_2359238_-\|cytochrome-c-methylamine-utilization-protein	gnl\|CDD\|224771	COG1858, MauG, Cytochrome c peroxidase [Inorganic ion transport and metabolism].	1.91673e-82
NZ_CP010018.1\|WP_009896595.1\|2368626_2369136_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|183009	PRK11169, PRK11169, leucine-responsive transcriptional regulator Lrp.	6.18054e-47
NZ_CP010018.1\|WP_045602530.1\|2361874_2363182_-\|MFS-transporter	gnl\|CDD\|340929	cd17371, MFS_MucK, Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Acinetobacter sp. Cis,cis-muconate transport protein (MucK), Escherichia coli putative sialic acid transporter 1, and similar proteins. MucK functions in the uptake of muconate and allows Acinetobacter calcoaceticus ADP1 (BD413) to grow on exogenous cis,cis-muconate as the sole carbon source. The MucK subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	6.64572e-133
NZ_CP010018.1\|WP_045602525.1\|2356529_2357390_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|377216	pfam04072, LCM, Leucine carboxyl methyltransferase. Family of leucine carboxyl methyltransferases EC:2.1.1.-. This family may need divides a the full alignment contains a significantly shorter mouse sequence.	3.14694e-51
NZ_CP010018.1\|WP_045602542.1\|2374599_2375790_+\|serine-hydrolase	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	7.72702e-56
NZ_CP010018.1\|WP_045602544.1\|2376046_2378077_-\|BCCT-family-transporter	gnl\|CDD\|376718	pfam02028, BCCT, BCCT, betaine/carnitine/choline family transporter.	0
NZ_CP010018.1\|WP_045603218.1\|2372255_2373647_-\|alkaline-phosphatase-family-protein	gnl\|CDD\|293737	cd16013, AcpA, acid phosphatase A. Acid phosphatase A catalyzes the hydrolysis reaction via a phosphoseryl intermediate to produce inorganic phosphate and the corresponding alcohol, optimally at low pH. AcpA hydrolyzes a variety of substrates, including p-nitrophenylphosphate (pNPP), p-nitrophenylphosphorylcholine (pNPPC), peptides containing phosphotyrosine, inositol phosphates, AMP, ATP, fructose 1,6-bisphosphate, glucose and fructose 6-phosphates, NADP, and ribose 5-phosphate. AcpA is distinct from histidine ACPs and purple ACPs, as well as class A, B, and C bacterial nonspecific ACPs.	1.29447e-99
NZ_CP010018.1\|WP_009899933.1\|2369328_2370345_+\|1-aminocyclopropane-1-carboxylate-deaminase	gnl\|CDD\|183494	PRK12390, PRK12390, 1-aminocyclopropane-1-carboxylate deaminase; Provisional.	0
NZ_CP010018.1\|WP_045602533.1\|2364157_2365420_+\|MFS-transporter	gnl\|CDD\|340877	cd17319, MFS_ExuT_GudP_like, Hexuronate transporter, Glucarate transporter, and similar transporters of the Major Facilitator Superfamily. This family is composed of predominantly bacterial transporters for hexuronate (ExuT), glucarate (GudP), galactarate (GarP), and galactonate (DgoT). They mediate the uptake of these compounds into the cell. They belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.54832e-73
NZ_CP010018.1\|WP_045602546.1\|2378416_2379361_+\|MurR/RpiR-family-transcriptional-regulator	gnl\|CDD\|224651	COG1737, RpiR, Transcriptional regulators [Transcription].	5.08593e-56
NZ_CP010018.1\|WP_011401139.1\|2355397_2355610_-\|DUF3079-domain-containing-protein	gnl\|CDD\|337966	pfam11278, DUF3079, Protein of unknown function (DUF3079). This family of proteins with unknown function appears to be restricted to Proteobacteria.	1.88329e-34

>NZ_CP010018.1|WP_045602536.1|2365774_2366395_+|HAD-hydrolase-like-protein
MAYKLIAFDFDGTLADSLACFLLALSESARQHGFRAIDGALLPQVCGMSAHEIVKLLGVPPWKVPLIAADMRRRMHARASDVRLFAGIDATLRALAQRGTRVAIATSNSEAVVRAIAGPATCAHIRHFSCGISLFGKARRLRALAHASGFACADVLYVGDEVRDAQAADRAGIAFRGVAWGYTAPDALRAHCLMPLIERPEELLAL
>NZ_CP010018.1|WP_045602533.1|2364157_2365420_+|MFS-transporter
MTKIARRLMPLLVIMFLIAFIDRQNVGFAKLQMVHALGMTETSYGLGASLFFIGYLLFEVPSTLALHRFGARLWLARIMMTWGVITVLLGFTHSTSVFYVFRFLLGVAEAGFYPGVIYYLTLWFPQSHRTRVLGLFTLGSALANMLGSLAGGLLLSLDGRLGLAGWQWVFVATGLPAVAVAFVALRYLPESVERATFLADDEKRVVLAALKREASPEAVSESPWRALVDPRVLMFALAYMLMSTSLYGVTYWLPTLLKSSGVPASLNGLLNMIPWAIAALLLLWLPARLKRERLVLKAMAIVAGVGVAGFALSLALPGLPLRFAALVLGGACIPLLYPCFWSLPPRFSSGARAAASIAAINSIGNLGGFFAQNLMPYVGKAAGSTSAPMLVPVVCLAALGVGMLAAASVAGRRRAAGMAA
>NZ_CP010018.1|WP_009899924.1|2363231_2363957_-|GntR-family-transcriptional-regulator
MHATDDRLPRYQRLRDELAALIAARHWRPGEAIPTEQALAKRYDVAIGTVRKAVDLLVADGMLERFQGRGTFVRRASFDSSLFRFFRFQSKHGERRIPESRILRREVVEATSAVAAALQIPARAPVIEMTRVRLIDGAPMLAEEIWLPYDRFAAFSRLELDSIGDLLYPVYEAHCNQIVASATETLTVEAIGPVHARLLRIEPGTPAVVIERLAYGYDRRPLEWRRSRGPASEFIYQAEIR
>NZ_CP010018.1|WP_045602530.1|2361874_2363182_-|MFS-transporter
MFEWFATVSLRERRTFWACFGGWALDALDMQMFSLVIPAIVAEWSLSRTQAGFVGGATLVASAIGGWVAGMLSDRFGRVRTLQWTIACFAVGTFACAFATSYPQFVVLKALQGAGFGGEWAAGAVLMAETIRAEHRGKAMGAVQSAWALGWAAAVLLYALAFSLMPAALAWRAMFAIGLLPALLIVYVRRGIVEPSVSPSSPSNTPAAARASVPLVGIFSRDTRRMTLIGALLGVGAHGGYYALMTWLPTYLKVERHLSVLGTGGYLAVIIVAFFCGCIASAQLLDRIGRRGTILAFAACCIATVIAYLFLPLGNAAMLVLGFPFGFFAAGIPASMGALFNELYPRGTRGTGVGFCYNFGRVASAGFPVLVGHMSADMPLGTAIGIDAAIAYSIVVVAVLLLPETRARALDDLAGAHATADARADRIGAPDARHR
>NZ_CP010018.1|WP_045602529.1|2360932_2361823_-|amidohydrolase-family-protein
MSEQEWSTCAHAAEMRCAAGGITAIDAHAHVFETGLPLAGRRRYAPDYDAPLDAYLAQLDAHRVSHGVLVQPSFLGSDCRYLLRALAQQPRRLRGVAVIDAGCEPHVLDTLDRAGVVGIRLNLIGMPDPALDGPAWRATLERIAALRWHVELHAQAQRLGRLIAPLLAHRVNVVVDHFGRPNPACGIADAGFRDLLRTAATRRVWVKVSGVYRNWPLAPGEANARAQEAFDALAAEFGAERLVWGSDWPHTQFERTETFGRAFALARQWMRDDAMRRAIFVETPARLFRFGEIHGA
>NZ_CP010018.1|WP_045602528.1|2359234_2360713_-|serine/threonine-protein-phosphatase
MPRPILRRAAALLPTLASAALLQACTSSIDNQPDAASASANIQAAWVEIGDANQAIARVITSYAPPAAAPGEAAPAVCPQLNADGKIARMTLRAAAGTAAQRPTASDPADSKPSGFPVSVCEATVPANAKDVTVAGRALPLPKAEPQRVAIIADTGCRMKKADNAFQACSDATVWPFATIAASVAKLNPDLVLHVGDYHYRENACPPDIAGCKNSPWGYGWDAWRADLFEPAAPLLAKAPWVVVRGNHEECARAGQGWFRFLDPRPYSDARSCNDPANDGNANYSEPYAVPLGTGSQVIVFDTAKVGRAALKTTDVQFQIYQKQFQTVAALASKPGMSTTIFTNHHPILAFAPIPGSTPAPGNLALQSVMSSLYAQAYYPPGVQVALHGHVHDFQAINFASGHPATIVSGNGGDNLDVALPDPFPANLTPAPGVVIDKLSHNNSFGFLIMERRAAPARGWTFKAYTAAGKLLASCDQAGTTLTCDKTGFVAP
>NZ_CP010018.1|WP_045602527.1|2357552_2359238_-|cytochrome-c-methylamine-utilization-protein
MTGRRRSSAARRAVPAAALAVRASVTAFALGPAALGTARTRRAVLTLSTIARAACGALAACASAIALASGPAAPAATHSTHSTHSTHSTHSTHSTHSTHAARPASAASSTSPMNPTSTPGASGPALAKAALDAARAKAAPPSSPTTVLLPGAPPERVVDTIGRGTPQVASKVDPTAAVFRPDPTLAALGKRVFFDPALSEPRGTSCASCHDPGRAFAPTLSPAALAGPRVPQGSRPGHFSRRNAPSLLYVRYVPRRHFYQDDDALAPAPFGGLFSDGRADTLAEQLRGPLFDPDEMNNASAAALMRKIGRTGLGAALAGRFGPSVRRDPERMVRALGEAMQAYLQSDEMAPFSSRYDAYVTKRAPLTPQEMRGLALFRNPDKGNCMSCHTLSDTASRPERSLFTDFGYDAIAVPRNRALPANRDPRHFDNGLCDTAAKLRWPEPTQWCAYLRTPGLRNVAIKESFMHNGVFDTLRDAVAFYNTRSTDPARWYHGRDTFDDVPRAYRGNVNVNSTPMNRRPGTPPAMTDADVDDLVAFLRTLTDARYVGLMPAAPDGKAARP
>NZ_CP010018.1|WP_045602525.1|2356529_2357390_-|class-I-SAM-dependent-methyltransferase
MSNQSIAAPDSTAVRVALWRALHVEIDAPPHVLDDGIGLELAAPDDDWRSRPDMAPQATRGYRASIVGRARFVEDLIGEQAERGVAQYVVLGAGLDTFAQRRAKLAAHLRVFEIDQPGTQAWKRQRLIALGYGVPEWLRLVPVDFEASGAWRAQLSAAGFDDSRPAVVSSTGVSMYLTRDAIAGTLRQIATLAPGSTLAMTFLLPLELIDDPVERAQHAAVYERARAAGTPFVSFFSPAEMLALAREAGFREVRHVSTDDLVRRYFEGRPDGLRPSSGEAFLVAST
>NZ_CP010018.1|WP_045602520.1|2355925_2356198_-|hypothetical-protein
MEHLVRIVNDTDRQILAWLRNQVGDERVERAAQHMGRVRKPYLSAICRYLGVWPPISLRYQTRRAEVDHAVGDRYLTLIRQHLATHATSR
>NZ_CP010018.1|WP_011401139.1|2355397_2355610_-|DUF3079-domain-containing-protein
MAKKFPLHPKHPERNCWGCDRYCSVDALSCGNGSDRTQHPVELLGDDWYEWEQENEAAQKQMQQTQAAAR
>NZ_CP010018.1|WP_009896595.1|2368626_2369136_-|winged-helix-turn-helix-transcriptional-regulator
MCATKKSAPKAAAQPAGADIDRVDRAILRMLQRDASISNVALAAKVNLSAPACLRRVERLKEMGLIRGIVALLEPKALNAGMLVMIGVVLDRSTPDSFGAFEQAAQKVSGCMECHVVTGEFDYIMLIRTRDSDTFNRLHAEQLLYLPGVRQIRTFVVLKEILSTTSFPI
>NZ_CP010018.1|WP_009899933.1|2369328_2370345_+|1-aminocyclopropane-1-carboxylate-deaminase
MNLQKFPRYPLTFGPTPIQPLKRLSAHLGGKVELYAKRDDCNSGLAFGGNKTRKLEYLIPDALAQGCDTLVSIGGIQSNQTRQVAAVAAHLGMKCVLVQENWVNYHDAVYDRVGNIQMSRMMGADVRLVPDGFDIGFRKSWEDALADVRARGGKPYAIPAGCSDHPLGGLGFVGFAEEVRVQEAELGFKFDYVVVCSVTGSTQAGMVVGFAADGRADRVIGIDASAKPAQTREQILRIARNTADRVELGRDIASGDVVLDERFGGPEYGLPNEGTLEAIRLCAKLEGVLTDPVYEGKSMHGMIEKVRLGEFPAGSKVLYAHLGGVPALNAYSFLFRDG
>NZ_CP010018.1|WP_045602540.1|2370998_2371352_+|hypothetical-protein
MGFVGGERRRARIAESNEIDGATLITEVASEPLAALGGARSEATPPLTLYGAYRQGFADYLAGRPNPYRIGSRLAGVWHEGHAEAASNDALDFTARARTCGGARTAANPVAFFRRRR
>NZ_CP010018.1|WP_009899936.1|2371436_2372078_-|hypothetical-protein
MKIRSGLVAELTVNLLLPWAAYRAAVPHWGETGGLIASAVPPLAWSVIELARFRRIDALSAVVLFGIVLSIAAALAGGSPRMLLMRESLASGAIGVAFLGSLALRKPLVFHLARATIAREAHDGAARIDALWAERPAFVSAMRLMTLVWGSGLVAENLLRAWMVWNWPVERVLVVAPFVGYGIYGALMLWTLWYRKVMRAHALAGLPRGGALG
>NZ_CP010018.1|WP_045603218.1|2372255_2373647_-|alkaline-phosphatase-family-protein
MAKILENVEHIVVVMFENRSFDTMLGWLYPPGTQPAHVLPARGSPQFDGLKPDMSNPSRAGKTIAVTREATNNVIPDPQETFVNVTSQILGPGGAGNPWPPMQGFVVNYETTQTTDPGHVMQCHSVAQLPTLTALARAYAVSDAWFASVPSQTWPNRAFAHAGTSNGHVNNGAIPDPLEWDVPTIFDVLSSIGASWAVYRDTAVTPSLTHTMFPSLWNDKYADNFKRFPDFVAACKNDALPRYAFVEPSFLFEPNDQHPPHDVLAGDKFLHDIWTAISTSPGWPRTLLVVTYDEHGGCFDHVLPPANATPPDAASNPGDETFEFDRFGVRVPAVVVSPYIEAGTVFRSPTNVPYDHTSILATLRDWLAIAPDKMLKSARIANAPTLAQLFTRSVPRGDLPAIAAPSADFVQPPPSAPLNDLQKSLVTGTSRRDGNDPAASVAPIATRQHALDFFTRRATAKPT
>NZ_CP010018.1|WP_127446982.1|2373762_2374059_-|hypothetical-protein
MTTEPAHASGGARSFTHRADRAAIRRHDGRRHRQRHLRHQRGYRRNESVFMGRGANSAPGDKFAAMIETAPARAPPPARRVAGTPAAPPCFSRNIGYT
>NZ_CP010018.1|WP_009896602.1|2374083_2374425_-|hypothetical-protein
MIAPATPAALAAGATTFAEWAALGTLALLYLFGLGWSLRGALARSRGRAYWLACAALIAGGTACALLAKPSAPNSGEMPPGFGLGVLVVMLGIAGTTAGCAWQAIARLRHGQR
>NZ_CP010018.1|WP_045602542.1|2374599_2375790_+|serine-hydrolase
MNPESVTPATAAAAATDHAALAGRLDRVFATALAERRVVGAVALVARGGELVYRRAHGFAERETQRPMREDTLFRLSSITKPIVTVAVLRLVAAGRMALDAPITRWLPEFAPALPDGRAPALTVHQLLTHTAGLSYWLLEAPGSAYHTLGISDGIDLVDFDLAENLRRIAAAPLAFEPGSAWRYSLALDVLGAAIERETGLALPDAVAQLVTTPLGLRDTGFVAADPARFAAAYANAAPQPVRITDNLDVPLPEGHGVAVRFAPSRVFDARAFASGGAGMYGSADDVLRVLETIRTGGDGFLPAALAAAMRTDHTGPAAETRGPGWGFGYGGAVLSDPARAQSPQSAGTLQWGGVYGHSWFVDAARGLTVLLMTNTAYEGMSGPLTVEVRDAVYAV
>NZ_CP010018.1|WP_045602544.1|2376046_2378077_-|BCCT-family-transporter
MPSSRSAPRTTLKPQVVVPSLAVIGALLAVCALLPNEAGALFGAGQQWIVERFDWFYVLAITTFLIFIVLIAASRFGNIKLGPDDAEPEFSFVSWTAMLFAAGMGIGLMYFGVGEPIQHYLKPPTALGGTPAAAREAMLMSFFHWGLHAWATYGVMGLVLAYFGFRYNLPLTLRSGLYPVLREGVNGWIGHTVDAFALVGTVAGIAVTLGYGVLQLSAGLHTIAGWQTDSDAFRIGLVAVVVALAGLSAASGLDKGVRRLSELNLMLAFALLAFVVVAGPTSFLLRAFGDNVGEYLSKLVSLSFRTYAYEAPNDKGWFGGWTLLYWAWWVSWSPFVGMFIARISRGRTIREFVIGVLLVPTAFNLVWMTAFGNSAIWLDTHAAAGALAQTATNVDALLFRFFDYLPLTQLLSVAAIVLIAVFFVTSADSGAFVIDAIATRGAPHSPVWQRLFWAAVLGVTASVLLVAGGLKALQALTLVAALPVALVMLALCYGLWRGLKADHAHYSQEMAPATSFWTGQHWRQRLSQILRHTTGADARRFIAQTVEPALRKVADELKAGGVDAHVARDDDDAVRLTVPAPAQRDFVYGARVSRKSAPAFRIREAAEPEPQREHVCEVLTFFADGRLGYDIEYLRGDEIIADVLRQYERYVSLAADTRTHLLNRAPEHAGPDGLTQ
>NZ_CP010018.1|WP_045602546.1|2378416_2379361_+|MurR/RpiR-family-transcriptional-regulator
MSDSPDSPPDAEPSIAARIAAALPSLTPIHRRMGEYVLANPFRAATMRIDELANAVDASIATANRFARALGFDGYPALRAALVRGFEATLAPVERLRSAQEHEAGARGGELIDASFEQALANLERTRARLDRANVEAAVDSLLAARRIFIVGMGASAFLAGLMEHGLSVYRDNVQSLALLGGPTDAARRLFSARGDDLVVAIAFPRYVHDTIELTRRAAERGAPVLAITDGPDSPVAPFAARALFVHAERRLAATSEAAVLALVEALIDALAHRSQRSARAAAEVTEFMLPWLEARGACAAPPRPPRRSRKTDR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP010018_1	1.5\|949311\|24\|NZ_CP010018\|CRT	949311-949334	24	NZ_CP010018.1	949101-949124	0	1.0
NZ_CP010018_1	1.8\|949437\|24\|NZ_CP010018\|CRT	949437-949460	24	NZ_CP010018.1	949059-949082	0	1.0
NZ_CP010018_1	1.10\|949521\|24\|NZ_CP010018\|CRT	949521-949544	24	NZ_CP010018.1	949059-949082	0	1.0
NZ_CP010018_1	1.12\|949605\|24\|NZ_CP010018\|CRT	949605-949628	24	NZ_CP010018.1	949059-949082	0	1.0
NZ_CP010018_1	1.14\|949689\|24\|NZ_CP010018\|CRT	949689-949712	24	NZ_CP010018.1	949059-949082	0	1.0
NZ_CP010018_1	1.16\|949773\|24\|NZ_CP010018\|CRT	949773-949796	24	NZ_CP010018.1	949059-949082	0	1.0
NZ_CP010018_2	2.3\|1247678\|16\|NZ_CP010018\|CRISPRCasFinder	1247678-1247693	16	NZ_CP010018.1	89723-89738	0	1.0
NZ_CP010018_2	2.3\|1247678\|16\|NZ_CP010018\|CRISPRCasFinder	1247678-1247693	16	NZ_CP010017.1	1366147-1366162	0	1.0
NZ_CP010018_1	1.20\|949941\|24\|NZ_CP010018\|CRT	949941-949964	24	NZ_CP010018.1	949059-949082	1	0.958
NZ_CP010018_1	1.1\|949143\|24\|NZ_CP010018\|CRT	949143-949166	24	NZ_CP010018.1	950235-950258	2	0.917
NZ_CP010018_1	1.3\|949227\|24\|NZ_CP010018\|CRT	949227-949250	24	NZ_CP010018.1	949059-949082	2	0.917
NZ_CP010018_1	1.6\|949353\|24\|NZ_CP010018\|CRT	949353-949376	24	NZ_CP010018.1	950235-950258	2	0.917
NZ_CP010018_1	1.8\|949437\|24\|NZ_CP010018\|CRT	949437-949460	24	NZ_CP010018.1	950109-950132	2	0.917
NZ_CP010018_1	1.10\|949521\|24\|NZ_CP010018\|CRT	949521-949544	24	NZ_CP010018.1	950109-950132	2	0.917
NZ_CP010018_1	1.12\|949605\|24\|NZ_CP010018\|CRT	949605-949628	24	NZ_CP010018.1	950109-950132	2	0.917
NZ_CP010018_1	1.14\|949689\|24\|NZ_CP010018\|CRT	949689-949712	24	NZ_CP010018.1	950109-950132	2	0.917
NZ_CP010018_1	1.16\|949773\|24\|NZ_CP010018\|CRT	949773-949796	24	NZ_CP010018.1	950109-950132	2	0.917
NZ_CP010018_1	1.18\|949857\|24\|NZ_CP010018\|CRT	949857-949880	24	NZ_CP010018.1	949059-949082	2	0.917
NZ_CP010018_1	1.22\|950025\|24\|NZ_CP010018\|CRT	950025-950048	24	NZ_CP010018.1	949059-949082	2	0.917

1. spacer 1.5|949311|24|NZ_CP010018|CRT matches to position: 949101-949124, mismatch: 0, identity: 1.0

cgcatcgccggatgcggtagcgtt	CRISPR spacer
cgcatcgccggatgcggtagcgtt	Protospacer
************************

2. spacer 1.8|949437|24|NZ_CP010018|CRT matches to position: 949059-949082, mismatch: 0, identity: 1.0

gttgtcgcccgtcgcttgcgaacc	CRISPR spacer
gttgtcgcccgtcgcttgcgaacc	Protospacer
************************

3. spacer 1.10|949521|24|NZ_CP010018|CRT matches to position: 949059-949082, mismatch: 0, identity: 1.0

gttgtcgcccgtcgcttgcgaacc	CRISPR spacer
gttgtcgcccgtcgcttgcgaacc	Protospacer
************************

4. spacer 1.12|949605|24|NZ_CP010018|CRT matches to position: 949059-949082, mismatch: 0, identity: 1.0

gttgtcgcccgtcgcttgcgaacc	CRISPR spacer
gttgtcgcccgtcgcttgcgaacc	Protospacer
************************

5. spacer 1.14|949689|24|NZ_CP010018|CRT matches to position: 949059-949082, mismatch: 0, identity: 1.0

gttgtcgcccgtcgcttgcgaacc	CRISPR spacer
gttgtcgcccgtcgcttgcgaacc	Protospacer
************************

6. spacer 1.16|949773|24|NZ_CP010018|CRT matches to position: 949059-949082, mismatch: 0, identity: 1.0

gttgtcgcccgtcgcttgcgaacc	CRISPR spacer
gttgtcgcccgtcgcttgcgaacc	Protospacer
************************

7. spacer 2.3|1247678|16|NZ_CP010018|CRISPRCasFinder matches to position: 89723-89738, mismatch: 0, identity: 1.0

cgcgcggtcggccgcg	CRISPR spacer
cgcgcggtcggccgcg	Protospacer
****************

8. spacer 2.3|1247678|16|NZ_CP010018|CRISPRCasFinder matches to position: 1366147-1366162, mismatch: 0, identity: 1.0

cgcgcggtcggccgcg	CRISPR spacer
cgcgcggtcggccgcg	Protospacer
****************

9. spacer 1.20|949941|24|NZ_CP010018|CRT matches to position: 949059-949082, mismatch: 1, identity: 0.958

gttgtcgcccgccgcttgcgaacc	CRISPR spacer
gttgtcgcccgtcgcttgcgaacc	Protospacer
***********.************

10. spacer 1.1|949143|24|NZ_CP010018|CRT matches to position: 950235-950258, mismatch: 2, identity: 0.917

attgctacccgtcgcttgtgaacc	CRISPR spacer
attgccgcccgtcgcttgtgaacc	Protospacer
*****..*****************

11. spacer 1.3|949227|24|NZ_CP010018|CRT matches to position: 949059-949082, mismatch: 2, identity: 0.917

gttgtcactcgtcgcttgcgaacc	CRISPR spacer
gttgtcgcccgtcgcttgcgaacc	Protospacer
******.*.***************

12. spacer 1.6|949353|24|NZ_CP010018|CRT matches to position: 950235-950258, mismatch: 2, identity: 0.917

attgctacccgtcgcttgtgaacc	CRISPR spacer
attgccgcccgtcgcttgtgaacc	Protospacer
*****..*****************

13. spacer 1.8|949437|24|NZ_CP010018|CRT matches to position: 950109-950132, mismatch: 2, identity: 0.917

gttgtcgcccgtcgcttgcgaacc	CRISPR spacer
gttatcgcccgtcgcttgcgagcc	Protospacer
***.*****************.**

14. spacer 1.10|949521|24|NZ_CP010018|CRT matches to position: 950109-950132, mismatch: 2, identity: 0.917

gttgtcgcccgtcgcttgcgaacc	CRISPR spacer
gttatcgcccgtcgcttgcgagcc	Protospacer
***.*****************.**

15. spacer 1.12|949605|24|NZ_CP010018|CRT matches to position: 950109-950132, mismatch: 2, identity: 0.917

gttgtcgcccgtcgcttgcgaacc	CRISPR spacer
gttatcgcccgtcgcttgcgagcc	Protospacer
***.*****************.**

16. spacer 1.14|949689|24|NZ_CP010018|CRT matches to position: 950109-950132, mismatch: 2, identity: 0.917

gttgtcgcccgtcgcttgcgaacc	CRISPR spacer
gttatcgcccgtcgcttgcgagcc	Protospacer
***.*****************.**

17. spacer 1.16|949773|24|NZ_CP010018|CRT matches to position: 950109-950132, mismatch: 2, identity: 0.917

gttgtcgcccgtcgcttgcgaacc	CRISPR spacer
gttatcgcccgtcgcttgcgagcc	Protospacer
***.*****************.**

18. spacer 1.18|949857|24|NZ_CP010018|CRT matches to position: 949059-949082, mismatch: 2, identity: 0.917

gttgtcgccgatcgcttgcgaacc	CRISPR spacer
gttgtcgcccgtcgcttgcgaacc	Protospacer
********* .*************

19. spacer 1.22|950025|24|NZ_CP010018|CRT matches to position: 949059-949082, mismatch: 2, identity: 0.917

gttgtcgccgatcgcttgcgaacc	CRISPR spacer
gttgtcgcccgtcgcttgcgaacc	Protospacer
********* .*************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP010018_1	1.1\|949143\|24\|NZ_CP010018\|CRT	949143-949166	24	MK448743	Streptococcus phage Javan371, complete genome	20263-20286	3	0.875
NZ_CP010018_1	1.1\|949143\|24\|NZ_CP010018\|CRT	949143-949166	24	MK448919	Streptococcus phage Javan370, complete genome	19572-19595	3	0.875
NZ_CP010018_1	1.1\|949143\|24\|NZ_CP010018\|CRT	949143-949166	24	MK448903	Streptococcus phage Javan310, complete genome	19633-19656	3	0.875
NZ_CP010018_1	1.4\|949269\|24\|NZ_CP010018\|CRT	949269-949292	24	NZ_CP031166	Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence	65249-65272	3	0.875
NZ_CP010018_1	1.4\|949269\|24\|NZ_CP010018\|CRT	949269-949292	24	NZ_CP017563	Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence	860391-860414	3	0.875
NZ_CP010018_1	1.4\|949269\|24\|NZ_CP010018\|CRT	949269-949292	24	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2895441-2895464	3	0.875
NZ_CP010018_1	1.5\|949311\|24\|NZ_CP010018\|CRT	949311-949334	24	NC_008826	Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence	443246-443269	3	0.875
NZ_CP010018_1	1.6\|949353\|24\|NZ_CP010018\|CRT	949353-949376	24	MK448743	Streptococcus phage Javan371, complete genome	20263-20286	3	0.875
NZ_CP010018_1	1.6\|949353\|24\|NZ_CP010018\|CRT	949353-949376	24	MK448919	Streptococcus phage Javan370, complete genome	19572-19595	3	0.875
NZ_CP010018_1	1.6\|949353\|24\|NZ_CP010018\|CRT	949353-949376	24	MK448903	Streptococcus phage Javan310, complete genome	19633-19656	3	0.875
NZ_CP010018_1	1.9\|949479\|24\|NZ_CP010018\|CRT	949479-949502	24	LR746310	Klebsiella phage vB_KpnM_05F genome assembly, chromosome: 1	154291-154314	3	0.875
NZ_CP010018_1	1.9\|949479\|24\|NZ_CP010018\|CRT	949479-949502	24	MN101223	Klebsiella phage KOX10, complete genome	18054-18077	3	0.875
NZ_CP010018_1	1.9\|949479\|24\|NZ_CP010018\|CRT	949479-949502	24	MN101224	Klebsiella phage KOX11, complete genome	9126-9149	3	0.875
NZ_CP010018_1	1.9\|949479\|24\|NZ_CP010018\|CRT	949479-949502	24	MT157285	Klebsiella phage P-KP2, complete genome	5444-5467	3	0.875
NZ_CP010018_1	1.9\|949479\|24\|NZ_CP010018\|CRT	949479-949502	24	KT001919	Klebsiella phage Miro, complete genome	143087-143110	3	0.875
NZ_CP010018_1	1.9\|949479\|24\|NZ_CP010018\|CRT	949479-949502	24	HQ918180	Klebsiella phage KP27, complete genome	139865-139888	3	0.875
NZ_CP010018_1	1.9\|949479\|24\|NZ_CP010018\|CRT	949479-949502	24	KT001918	Klebsiella phage Matisse, complete genome	142885-142908	3	0.875
NZ_CP010018_1	1.9\|949479\|24\|NZ_CP010018\|CRT	949479-949502	24	LT607758	Klebsiella phage PMBT1 genome assembly, complete genome: monopartite	142028-142051	3	0.875
NZ_CP010018_1	1.9\|949479\|24\|NZ_CP010018\|CRT	949479-949502	24	KX130727	Escherichia phage phT4A, partial genome	136005-136028	3	0.875
NZ_CP010018_1	1.9\|949479\|24\|NZ_CP010018\|CRT	949479-949502	24	KT321315	Enterobacter phage phiEap-3, complete genome	141584-141607	3	0.875
NZ_CP010018_1	1.9\|949479\|24\|NZ_CP010018\|CRT	949479-949502	24	MN101221	Klebsiella phage KOX8, complete genome	18035-18058	3	0.875
NZ_CP010018_1	1.9\|949479\|24\|NZ_CP010018\|CRT	949479-949502	24	GU295964	Klebsiella phage KP15, complete genome	141266-141289	3	0.875
NZ_CP010018_1	1.13\|949647\|24\|NZ_CP010018\|CRT	949647-949670	24	LR746310	Klebsiella phage vB_KpnM_05F genome assembly, chromosome: 1	154291-154314	3	0.875
NZ_CP010018_1	1.13\|949647\|24\|NZ_CP010018\|CRT	949647-949670	24	MN101223	Klebsiella phage KOX10, complete genome	18054-18077	3	0.875
NZ_CP010018_1	1.13\|949647\|24\|NZ_CP010018\|CRT	949647-949670	24	MN101224	Klebsiella phage KOX11, complete genome	9126-9149	3	0.875
NZ_CP010018_1	1.13\|949647\|24\|NZ_CP010018\|CRT	949647-949670	24	MT157285	Klebsiella phage P-KP2, complete genome	5444-5467	3	0.875
NZ_CP010018_1	1.13\|949647\|24\|NZ_CP010018\|CRT	949647-949670	24	KT001919	Klebsiella phage Miro, complete genome	143087-143110	3	0.875
NZ_CP010018_1	1.13\|949647\|24\|NZ_CP010018\|CRT	949647-949670	24	HQ918180	Klebsiella phage KP27, complete genome	139865-139888	3	0.875
NZ_CP010018_1	1.13\|949647\|24\|NZ_CP010018\|CRT	949647-949670	24	KT001918	Klebsiella phage Matisse, complete genome	142885-142908	3	0.875
NZ_CP010018_1	1.13\|949647\|24\|NZ_CP010018\|CRT	949647-949670	24	LT607758	Klebsiella phage PMBT1 genome assembly, complete genome: monopartite	142028-142051	3	0.875
NZ_CP010018_1	1.13\|949647\|24\|NZ_CP010018\|CRT	949647-949670	24	KX130727	Escherichia phage phT4A, partial genome	136005-136028	3	0.875
NZ_CP010018_1	1.13\|949647\|24\|NZ_CP010018\|CRT	949647-949670	24	KT321315	Enterobacter phage phiEap-3, complete genome	141584-141607	3	0.875
NZ_CP010018_1	1.13\|949647\|24\|NZ_CP010018\|CRT	949647-949670	24	MN101221	Klebsiella phage KOX8, complete genome	18035-18058	3	0.875
NZ_CP010018_1	1.13\|949647\|24\|NZ_CP010018\|CRT	949647-949670	24	GU295964	Klebsiella phage KP15, complete genome	141266-141289	3	0.875
NZ_CP010018_1	1.17\|949815\|24\|NZ_CP010018\|CRT	949815-949838	24	LR746310	Klebsiella phage vB_KpnM_05F genome assembly, chromosome: 1	154291-154314	3	0.875
NZ_CP010018_1	1.17\|949815\|24\|NZ_CP010018\|CRT	949815-949838	24	MN101223	Klebsiella phage KOX10, complete genome	18054-18077	3	0.875
NZ_CP010018_1	1.17\|949815\|24\|NZ_CP010018\|CRT	949815-949838	24	MN101224	Klebsiella phage KOX11, complete genome	9126-9149	3	0.875
NZ_CP010018_1	1.17\|949815\|24\|NZ_CP010018\|CRT	949815-949838	24	MT157285	Klebsiella phage P-KP2, complete genome	5444-5467	3	0.875
NZ_CP010018_1	1.17\|949815\|24\|NZ_CP010018\|CRT	949815-949838	24	KT001919	Klebsiella phage Miro, complete genome	143087-143110	3	0.875
NZ_CP010018_1	1.17\|949815\|24\|NZ_CP010018\|CRT	949815-949838	24	HQ918180	Klebsiella phage KP27, complete genome	139865-139888	3	0.875
NZ_CP010018_1	1.17\|949815\|24\|NZ_CP010018\|CRT	949815-949838	24	KT001918	Klebsiella phage Matisse, complete genome	142885-142908	3	0.875
NZ_CP010018_1	1.17\|949815\|24\|NZ_CP010018\|CRT	949815-949838	24	LT607758	Klebsiella phage PMBT1 genome assembly, complete genome: monopartite	142028-142051	3	0.875
NZ_CP010018_1	1.17\|949815\|24\|NZ_CP010018\|CRT	949815-949838	24	KX130727	Escherichia phage phT4A, partial genome	136005-136028	3	0.875
NZ_CP010018_1	1.17\|949815\|24\|NZ_CP010018\|CRT	949815-949838	24	KT321315	Enterobacter phage phiEap-3, complete genome	141584-141607	3	0.875
NZ_CP010018_1	1.17\|949815\|24\|NZ_CP010018\|CRT	949815-949838	24	MN101221	Klebsiella phage KOX8, complete genome	18035-18058	3	0.875
NZ_CP010018_1	1.17\|949815\|24\|NZ_CP010018\|CRT	949815-949838	24	GU295964	Klebsiella phage KP15, complete genome	141266-141289	3	0.875
NZ_CP010018_1	1.19\|949899\|24\|NZ_CP010018\|CRT	949899-949922	24	NZ_LR134447	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 5, complete sequence	220929-220952	3	0.875
NZ_CP010018_1	1.20\|949941\|24\|NZ_CP010018\|CRT	949941-949964	24	NZ_CP021150	Vibrio campbellii strain LA16-V1 plasmid pLA16-4, complete sequence	51719-51742	3	0.875
NZ_CP010018_1	1.21\|949983\|24\|NZ_CP010018\|CRT	949983-950006	24	LR746310	Klebsiella phage vB_KpnM_05F genome assembly, chromosome: 1	154291-154314	3	0.875
NZ_CP010018_1	1.21\|949983\|24\|NZ_CP010018\|CRT	949983-950006	24	MN101223	Klebsiella phage KOX10, complete genome	18054-18077	3	0.875
NZ_CP010018_1	1.21\|949983\|24\|NZ_CP010018\|CRT	949983-950006	24	MN101224	Klebsiella phage KOX11, complete genome	9126-9149	3	0.875
NZ_CP010018_1	1.21\|949983\|24\|NZ_CP010018\|CRT	949983-950006	24	MT157285	Klebsiella phage P-KP2, complete genome	5444-5467	3	0.875
NZ_CP010018_1	1.21\|949983\|24\|NZ_CP010018\|CRT	949983-950006	24	KT001919	Klebsiella phage Miro, complete genome	143087-143110	3	0.875
NZ_CP010018_1	1.21\|949983\|24\|NZ_CP010018\|CRT	949983-950006	24	HQ918180	Klebsiella phage KP27, complete genome	139865-139888	3	0.875
NZ_CP010018_1	1.21\|949983\|24\|NZ_CP010018\|CRT	949983-950006	24	KT001918	Klebsiella phage Matisse, complete genome	142885-142908	3	0.875
NZ_CP010018_1	1.21\|949983\|24\|NZ_CP010018\|CRT	949983-950006	24	LT607758	Klebsiella phage PMBT1 genome assembly, complete genome: monopartite	142028-142051	3	0.875
NZ_CP010018_1	1.21\|949983\|24\|NZ_CP010018\|CRT	949983-950006	24	KX130727	Escherichia phage phT4A, partial genome	136005-136028	3	0.875
NZ_CP010018_1	1.21\|949983\|24\|NZ_CP010018\|CRT	949983-950006	24	KT321315	Enterobacter phage phiEap-3, complete genome	141584-141607	3	0.875
NZ_CP010018_1	1.21\|949983\|24\|NZ_CP010018\|CRT	949983-950006	24	MN101221	Klebsiella phage KOX8, complete genome	18035-18058	3	0.875
NZ_CP010018_1	1.21\|949983\|24\|NZ_CP010018\|CRT	949983-950006	24	GU295964	Klebsiella phage KP15, complete genome	141266-141289	3	0.875
NZ_CP010018_1	1.23\|950067\|24\|NZ_CP010018\|CRT	950067-950090	24	NZ_LT969519	Pseudomonas aeruginosa isolate RW109 genome assembly, plasmid: RW109 plasmid 1	531565-531588	3	0.875
NZ_CP010018_1	1.4\|949269\|24\|NZ_CP010018\|CRT	949269-949292	24	NZ_CP029358	Azospirillum sp. CFH 70021 plasmid unnamed3	86790-86813	4	0.833
NZ_CP010018_1	1.19\|949899\|24\|NZ_CP010018\|CRT	949899-949922	24	NZ_CP054617	Azospirillum oryzae strain KACC 14407 plasmid unnamed3, complete sequence	605491-605514	4	0.833
NZ_CP010018_1	1.2\|949185\|24\|NZ_CP010018\|CRT	949185-949208	24	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	712549-712572	5	0.792
NZ_CP010018_1	1.2\|949185\|24\|NZ_CP010018\|CRT	949185-949208	24	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	703765-703788	5	0.792
NZ_CP010018_1	1.2\|949185\|24\|NZ_CP010018\|CRT	949185-949208	24	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	607835-607858	5	0.792
NZ_CP010018_1	1.2\|949185\|24\|NZ_CP010018\|CRT	949185-949208	24	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	666722-666745	5	0.792
NZ_CP010018_1	1.2\|949185\|24\|NZ_CP010018\|CRT	949185-949208	24	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	606950-606973	5	0.792
NZ_CP010018_1	1.2\|949185\|24\|NZ_CP010018\|CRT	949185-949208	24	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	604427-604450	5	0.792
NZ_CP010018_1	1.2\|949185\|24\|NZ_CP010018\|CRT	949185-949208	24	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	604417-604440	5	0.792
NZ_CP010018_1	1.2\|949185\|24\|NZ_CP010018\|CRT	949185-949208	24	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	607823-607846	5	0.792
NZ_CP010018_1	1.2\|949185\|24\|NZ_CP010018\|CRT	949185-949208	24	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	607842-607865	5	0.792
NZ_CP010018_1	1.2\|949185\|24\|NZ_CP010018\|CRT	949185-949208	24	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	607820-607843	5	0.792
NZ_CP010018_1	1.2\|949185\|24\|NZ_CP010018\|CRT	949185-949208	24	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	712610-712633	5	0.792
NZ_CP010018_1	1.2\|949185\|24\|NZ_CP010018\|CRT	949185-949208	24	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	712610-712633	5	0.792
NZ_CP010018_1	1.2\|949185\|24\|NZ_CP010018\|CRT	949185-949208	24	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	712596-712619	5	0.792
NZ_CP010018_1	1.8\|949437\|24\|NZ_CP010018\|CRT	949437-949460	24	NC_021289	Burkholderia insecticola plasmid p1, complete sequence	213743-213766	5	0.792
NZ_CP010018_1	1.10\|949521\|24\|NZ_CP010018\|CRT	949521-949544	24	NC_021289	Burkholderia insecticola plasmid p1, complete sequence	213743-213766	5	0.792
NZ_CP010018_1	1.12\|949605\|24\|NZ_CP010018\|CRT	949605-949628	24	NC_021289	Burkholderia insecticola plasmid p1, complete sequence	213743-213766	5	0.792
NZ_CP010018_1	1.14\|949689\|24\|NZ_CP010018\|CRT	949689-949712	24	NC_021289	Burkholderia insecticola plasmid p1, complete sequence	213743-213766	5	0.792
NZ_CP010018_1	1.16\|949773\|24\|NZ_CP010018\|CRT	949773-949796	24	NC_021289	Burkholderia insecticola plasmid p1, complete sequence	213743-213766	5	0.792
NZ_CP010018_1	1.23\|950067\|24\|NZ_CP010018\|CRT	950067-950090	24	NZ_CP011515	Mitsuaria sp. 7 plasmid, complete sequence	42274-42297	5	0.792

1. spacer 1.1|949143|24|NZ_CP010018|CRT matches to MK448743 (Streptococcus phage Javan371, complete genome) position: , mismatch: 3, identity: 0.875

attgctacccgtcgcttgtgaacc	CRISPR spacer
attgctaccagtcgcttgtgaaga	Protospacer
********* ************

2. spacer 1.1|949143|24|NZ_CP010018|CRT matches to MK448919 (Streptococcus phage Javan370, complete genome) position: , mismatch: 3, identity: 0.875

attgctacccgtcgcttgtgaacc	CRISPR spacer
attgctaccagtcgcttgtgaaga	Protospacer
********* ************

3. spacer 1.1|949143|24|NZ_CP010018|CRT matches to MK448903 (Streptococcus phage Javan310, complete genome) position: , mismatch: 3, identity: 0.875

attgctacccgtcgcttgtgaacc	CRISPR spacer
attgctaccagtcgcttgtgaaaa	Protospacer
********* ************

4. spacer 1.4|949269|24|NZ_CP010018|CRT matches to NZ_CP031166 (Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence) position: , mismatch: 3, identity: 0.875

cgagttgcccgacgccgtggcgtt	CRISPR spacer
cgagttcgccgacgccgtggcgtg	Protospacer
******  ***************

5. spacer 1.4|949269|24|NZ_CP010018|CRT matches to NZ_CP017563 (Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence) position: , mismatch: 3, identity: 0.875

cgagttgcccgacgccgtggcgtt	CRISPR spacer
cgtgttgcccgacgccgtggcctg	Protospacer
** ****************** *

6. spacer 1.4|949269|24|NZ_CP010018|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 3, identity: 0.875

cgagttgcccgacgccgtggcgtt	CRISPR spacer
ctcggtgcccgacgccgtggcgtt	Protospacer
*  * *******************

7. spacer 1.5|949311|24|NZ_CP010018|CRT matches to NC_008826 (Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence) position: , mismatch: 3, identity: 0.875

cgcatcgccggatgcggtagcgtt	CRISPR spacer
tgcatcgccggatgctgtaccgtt	Protospacer
.************** *** ****

8. spacer 1.6|949353|24|NZ_CP010018|CRT matches to MK448743 (Streptococcus phage Javan371, complete genome) position: , mismatch: 3, identity: 0.875

attgctacccgtcgcttgtgaacc	CRISPR spacer
attgctaccagtcgcttgtgaaga	Protospacer
********* ************

9. spacer 1.6|949353|24|NZ_CP010018|CRT matches to MK448919 (Streptococcus phage Javan370, complete genome) position: , mismatch: 3, identity: 0.875

attgctacccgtcgcttgtgaacc	CRISPR spacer
attgctaccagtcgcttgtgaaga	Protospacer
********* ************

10. spacer 1.6|949353|24|NZ_CP010018|CRT matches to MK448903 (Streptococcus phage Javan310, complete genome) position: , mismatch: 3, identity: 0.875

attgctacccgtcgcttgtgaacc	CRISPR spacer
attgctaccagtcgcttgtgaaaa	Protospacer
********* ************

11. spacer 1.9|949479|24|NZ_CP010018|CRT matches to LR746310 (Klebsiella phage vB_KpnM_05F genome assembly, chromosome: 1) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

12. spacer 1.9|949479|24|NZ_CP010018|CRT matches to MN101223 (Klebsiella phage KOX10, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

13. spacer 1.9|949479|24|NZ_CP010018|CRT matches to MN101224 (Klebsiella phage KOX11, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

14. spacer 1.9|949479|24|NZ_CP010018|CRT matches to MT157285 (Klebsiella phage P-KP2, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

15. spacer 1.9|949479|24|NZ_CP010018|CRT matches to KT001919 (Klebsiella phage Miro, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

16. spacer 1.9|949479|24|NZ_CP010018|CRT matches to HQ918180 (Klebsiella phage KP27, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

17. spacer 1.9|949479|24|NZ_CP010018|CRT matches to KT001918 (Klebsiella phage Matisse, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

18. spacer 1.9|949479|24|NZ_CP010018|CRT matches to LT607758 (Klebsiella phage PMBT1 genome assembly, complete genome: monopartite) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

19. spacer 1.9|949479|24|NZ_CP010018|CRT matches to KX130727 (Escherichia phage phT4A, partial genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

20. spacer 1.9|949479|24|NZ_CP010018|CRT matches to KT321315 (Enterobacter phage phiEap-3, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

21. spacer 1.9|949479|24|NZ_CP010018|CRT matches to MN101221 (Klebsiella phage KOX8, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

22. spacer 1.9|949479|24|NZ_CP010018|CRT matches to GU295964 (Klebsiella phage KP15, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

23. spacer 1.13|949647|24|NZ_CP010018|CRT matches to LR746310 (Klebsiella phage vB_KpnM_05F genome assembly, chromosome: 1) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

24. spacer 1.13|949647|24|NZ_CP010018|CRT matches to MN101223 (Klebsiella phage KOX10, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

25. spacer 1.13|949647|24|NZ_CP010018|CRT matches to MN101224 (Klebsiella phage KOX11, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

26. spacer 1.13|949647|24|NZ_CP010018|CRT matches to MT157285 (Klebsiella phage P-KP2, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

27. spacer 1.13|949647|24|NZ_CP010018|CRT matches to KT001919 (Klebsiella phage Miro, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

28. spacer 1.13|949647|24|NZ_CP010018|CRT matches to HQ918180 (Klebsiella phage KP27, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

29. spacer 1.13|949647|24|NZ_CP010018|CRT matches to KT001918 (Klebsiella phage Matisse, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

30. spacer 1.13|949647|24|NZ_CP010018|CRT matches to LT607758 (Klebsiella phage PMBT1 genome assembly, complete genome: monopartite) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

31. spacer 1.13|949647|24|NZ_CP010018|CRT matches to KX130727 (Escherichia phage phT4A, partial genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

32. spacer 1.13|949647|24|NZ_CP010018|CRT matches to KT321315 (Enterobacter phage phiEap-3, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

33. spacer 1.13|949647|24|NZ_CP010018|CRT matches to MN101221 (Klebsiella phage KOX8, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

34. spacer 1.13|949647|24|NZ_CP010018|CRT matches to GU295964 (Klebsiella phage KP15, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

35. spacer 1.17|949815|24|NZ_CP010018|CRT matches to LR746310 (Klebsiella phage vB_KpnM_05F genome assembly, chromosome: 1) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

36. spacer 1.17|949815|24|NZ_CP010018|CRT matches to MN101223 (Klebsiella phage KOX10, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

37. spacer 1.17|949815|24|NZ_CP010018|CRT matches to MN101224 (Klebsiella phage KOX11, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

38. spacer 1.17|949815|24|NZ_CP010018|CRT matches to MT157285 (Klebsiella phage P-KP2, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

39. spacer 1.17|949815|24|NZ_CP010018|CRT matches to KT001919 (Klebsiella phage Miro, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

40. spacer 1.17|949815|24|NZ_CP010018|CRT matches to HQ918180 (Klebsiella phage KP27, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

41. spacer 1.17|949815|24|NZ_CP010018|CRT matches to KT001918 (Klebsiella phage Matisse, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

42. spacer 1.17|949815|24|NZ_CP010018|CRT matches to LT607758 (Klebsiella phage PMBT1 genome assembly, complete genome: monopartite) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

43. spacer 1.17|949815|24|NZ_CP010018|CRT matches to KX130727 (Escherichia phage phT4A, partial genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

44. spacer 1.17|949815|24|NZ_CP010018|CRT matches to KT321315 (Enterobacter phage phiEap-3, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

45. spacer 1.17|949815|24|NZ_CP010018|CRT matches to MN101221 (Klebsiella phage KOX8, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

46. spacer 1.17|949815|24|NZ_CP010018|CRT matches to GU295964 (Klebsiella phage KP15, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

47. spacer 1.19|949899|24|NZ_CP010018|CRT matches to NZ_LR134447 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 5, complete sequence) position: , mismatch: 3, identity: 0.875

cgaatcgcccgacgcggtggcgtc	CRISPR spacer
ggaatcgtcggacgcggtggcgtc	Protospacer
 ******.* **************

48. spacer 1.20|949941|24|NZ_CP010018|CRT matches to NZ_CP021150 (Vibrio campbellii strain LA16-V1 plasmid pLA16-4, complete sequence) position: , mismatch: 3, identity: 0.875

gttgtcgcccgccgcttgcgaacc	CRISPR spacer
gttgccgcccgccgcttgcaaaca	Protospacer
****.**************.***

49. spacer 1.21|949983|24|NZ_CP010018|CRT matches to LR746310 (Klebsiella phage vB_KpnM_05F genome assembly, chromosome: 1) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

50. spacer 1.21|949983|24|NZ_CP010018|CRT matches to MN101223 (Klebsiella phage KOX10, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

51. spacer 1.21|949983|24|NZ_CP010018|CRT matches to MN101224 (Klebsiella phage KOX11, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

52. spacer 1.21|949983|24|NZ_CP010018|CRT matches to MT157285 (Klebsiella phage P-KP2, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

53. spacer 1.21|949983|24|NZ_CP010018|CRT matches to KT001919 (Klebsiella phage Miro, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

54. spacer 1.21|949983|24|NZ_CP010018|CRT matches to HQ918180 (Klebsiella phage KP27, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

55. spacer 1.21|949983|24|NZ_CP010018|CRT matches to KT001918 (Klebsiella phage Matisse, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

56. spacer 1.21|949983|24|NZ_CP010018|CRT matches to LT607758 (Klebsiella phage PMBT1 genome assembly, complete genome: monopartite) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

57. spacer 1.21|949983|24|NZ_CP010018|CRT matches to KX130727 (Escherichia phage phT4A, partial genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

58. spacer 1.21|949983|24|NZ_CP010018|CRT matches to KT321315 (Enterobacter phage phiEap-3, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

59. spacer 1.21|949983|24|NZ_CP010018|CRT matches to MN101221 (Klebsiella phage KOX8, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

60. spacer 1.21|949983|24|NZ_CP010018|CRT matches to GU295964 (Klebsiella phage KP15, complete genome) position: , mismatch: 3, identity: 0.875

cgattcacccgatgccgtggcgtt	CRISPR spacer
cggttcacccgattccgtggcgtg	Protospacer
**.********** *********

61. spacer 1.23|950067|24|NZ_CP010018|CRT matches to NZ_LT969519 (Pseudomonas aeruginosa isolate RW109 genome assembly, plasmid: RW109 plasmid 1) position: , mismatch: 3, identity: 0.875

cgaatcgcccgacgccgtggcgtt	CRISPR spacer
ggaatcgcccgccgccgtggcgct	Protospacer
 ********** **********.*

62. spacer 1.4|949269|24|NZ_CP010018|CRT matches to NZ_CP029358 (Azospirillum sp. CFH 70021 plasmid unnamed3) position: , mismatch: 4, identity: 0.833

cgagttgcccgacgccgtggcgtt	CRISPR spacer
gccgctgcccgacgccgtggcgtt	Protospacer
   *.*******************

63. spacer 1.19|949899|24|NZ_CP010018|CRT matches to NZ_CP054617 (Azospirillum oryzae strain KACC 14407 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.833

cgaatcgcccgacgcggtggcgtc	CRISPR spacer
cgaatcgcccgacgcgctggcccg	Protospacer
**************** **** .

64. spacer 1.2|949185|24|NZ_CP010018|CRT matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.792

cgaattgcccgacgcggtggcgtt	CRISPR spacer
tgaattgcccgacgcggtgggtgg	Protospacer
.*******************

65. spacer 1.2|949185|24|NZ_CP010018|CRT matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 5, identity: 0.792

cgaattgcccgacgcggtggcgtt	CRISPR spacer
tgaattgcccgacgcggtgggtgg	Protospacer
.*******************

66. spacer 1.2|949185|24|NZ_CP010018|CRT matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.792

cgaattgcccgacgcggtggcgtt	CRISPR spacer
tgaattgcccgacgcggtgggtgg	Protospacer
.*******************

67. spacer 1.2|949185|24|NZ_CP010018|CRT matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.792

cgaattgcccgacgcggtggcgtt	CRISPR spacer
tgaattgcccgacgcggtgggtgg	Protospacer
.*******************

68. spacer 1.2|949185|24|NZ_CP010018|CRT matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 5, identity: 0.792

cgaattgcccgacgcggtggcgtt	CRISPR spacer
tgaattgcccgacgcggtgggtgg	Protospacer
.*******************

69. spacer 1.2|949185|24|NZ_CP010018|CRT matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.792

cgaattgcccgacgcggtggcgtt	CRISPR spacer
tgaattgcccgacgcggtgggtgg	Protospacer
.*******************

70. spacer 1.2|949185|24|NZ_CP010018|CRT matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.792

cgaattgcccgacgcggtggcgtt	CRISPR spacer
tgaattgcccgacgcggtgggtgg	Protospacer
.*******************

71. spacer 1.2|949185|24|NZ_CP010018|CRT matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.792

cgaattgcccgacgcggtggcgtt	CRISPR spacer
tgaattgcccgacgcggtgggtgg	Protospacer
.*******************

72. spacer 1.2|949185|24|NZ_CP010018|CRT matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.792

cgaattgcccgacgcggtggcgtt	CRISPR spacer
tgaattgcccgacgcggtgggtgg	Protospacer
.*******************

73. spacer 1.2|949185|24|NZ_CP010018|CRT matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.792

cgaattgcccgacgcggtggcgtt	CRISPR spacer
tgaattgcccgacgcggtgggtgg	Protospacer
.*******************

74. spacer 1.2|949185|24|NZ_CP010018|CRT matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.792

cgaattgcccgacgcggtggcgtt	CRISPR spacer
tgaattgcccgacgcggtgggtgg	Protospacer
.*******************

75. spacer 1.2|949185|24|NZ_CP010018|CRT matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.792

cgaattgcccgacgcggtggcgtt	CRISPR spacer
tgaattgcccgacgcggtgggtgg	Protospacer
.*******************

76. spacer 1.2|949185|24|NZ_CP010018|CRT matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.792

cgaattgcccgacgcggtggcgtt	CRISPR spacer
tgaattgcccgacgcggtgggtgg	Protospacer
.*******************

77. spacer 1.8|949437|24|NZ_CP010018|CRT matches to NC_021289 (Burkholderia insecticola plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.792

gttgtcgcccgtcgcttgcgaacc	CRISPR spacer
cttgtcgcccgtcgcttgcggcat	Protospacer
 *******************.  .

78. spacer 1.10|949521|24|NZ_CP010018|CRT matches to NC_021289 (Burkholderia insecticola plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.792

gttgtcgcccgtcgcttgcgaacc	CRISPR spacer
cttgtcgcccgtcgcttgcggcat	Protospacer
 *******************.  .

79. spacer 1.12|949605|24|NZ_CP010018|CRT matches to NC_021289 (Burkholderia insecticola plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.792

gttgtcgcccgtcgcttgcgaacc	CRISPR spacer
cttgtcgcccgtcgcttgcggcat	Protospacer
 *******************.  .

80. spacer 1.14|949689|24|NZ_CP010018|CRT matches to NC_021289 (Burkholderia insecticola plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.792

gttgtcgcccgtcgcttgcgaacc	CRISPR spacer
cttgtcgcccgtcgcttgcggcat	Protospacer
 *******************.  .

81. spacer 1.16|949773|24|NZ_CP010018|CRT matches to NC_021289 (Burkholderia insecticola plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.792

gttgtcgcccgtcgcttgcgaacc	CRISPR spacer
cttgtcgcccgtcgcttgcggcat	Protospacer
 *******************.  .

82. spacer 1.23|950067|24|NZ_CP010018|CRT matches to NZ_CP011515 (Mitsuaria sp. 7 plasmid, complete sequence) position: , mismatch: 5, identity: 0.792

cgaatcgcccgacgccgtggcgtt	CRISPR spacer
gcaatcgcccgacgccgtggcacg	Protospacer
  *******************..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

264571 : 374814

106

Burkholderia_phage(37.21%)

tail,plate,integrase,transposase,tRNA

attL 323472:323491|attR 355381:355400

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009899358.1\|264571_265384_-\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
WP_045601189.1\|265383_267954_-	membrane protein	NA	NA	NA	NA
WP_009895845.1\|268089_269211_-	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_009899338.1\|269582_270650_-	3-isopropylmalate dehydrogenase	NA	NA	NA	NA
WP_009895841.1\|270763_271414_-	3-isopropylmalate dehydratase small subunit	NA	NA	NA	NA
WP_009895839.1\|271491_271641_-	entericidin A/B family lipoprotein	NA	NA	NA	NA
WP_009895837.1\|271637_273047_-	3-isopropylmalate dehydratase large subunit	NA	NA	NA	NA
WP_009895836.1\|273240_273768_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_045601191.1\|273928_276661_+	alpha-ketoglutarate dehydrogenase	NA	NA	NA	NA
WP_045601193.1\|277264_278509_-	DUF1479 domain-containing protein	NA	NA	NA	NA
WP_009899333.1\|279339_279729_-	VOC family protein	NA	NA	NA	NA
WP_045601195.1\|279804_280773_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_009895831.1\|280883_282185_-	citrate (Si)-synthase	NA	NA	NA	NA
WP_004528990.1\|282237_282510_-	succinate dehydrogenase assembly factor 2	NA	NA	NA	NA
WP_009895822.1\|282511_283213_-	succinate dehydrogenase iron-sulfur subunit	NA	NA	NA	NA
WP_009895820.1\|283234_285010_-	succinate dehydrogenase flavoprotein subunit	NA	NA	NA	NA
WP_009895819.1\|285013_285382_-	succinate dehydrogenase, hydrophobic membrane anchor protein	NA	NA	NA	NA
WP_009895818.1\|285386_285803_-	succinate dehydrogenase, cytochrome b556 subunit	NA	NA	NA	NA
WP_038708254.1\|286002_286812_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_009895814.1\|287101_288085_+	malate dehydrogenase	NA	NA	NA	NA
WP_045601197.1\|288282_289302_+	aldolase	NA	NA	NA	NA
WP_009895811.1\|289458_289968_+	hypothetical protein	NA	NA	NA	NA
WP_045601198.1\|290046_291498_+	bifunctional 2-methylcitrate dehydratase/aconitate hydratase	NA	NA	NA	NA
WP_009895807.1\|291545_294263_+	aconitate hydratase AcnA	NA	NA	NA	NA
WP_025987288.1\|294621_296715_-	c-type cytochrome	NA	NA	NA	NA
WP_045601201.1\|297143_297518_-	DUF2784 domain-containing protein	NA	NA	NA	NA
WP_011400975.1\|297716_298151_-	hypothetical protein	NA	NA	NA	NA
WP_025987287.1\|298266_299874_-	tyrosinase family protein	NA	NA	NA	NA
WP_082256058.1\|299925_300168_-	hypothetical protein	NA	NA	NA	NA
WP_025405423.1\|300154_300787_-	hypothetical protein	NA	NA	NA	NA
WP_162486616.1\|301608_301884_+	hypothetical protein	NA	NA	NA	NA
WP_045601204.1\|302243_303992_+	S8 family serine peptidase	NA	NA	NA	NA
WP_009899295.1\|304074_304914_-	ABC transporter permease	NA	NA	NA	NA
WP_009895785.1\|304945_306205_-	ABC transporter permease	NA	NA	NA	NA
WP_009895783.1\|306305_307352_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_009899293.1\|307426_308539_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.1e-25	31.5
WP_045601207.1\|308647_310177_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_045601208.1\|310258_311293_-	lipase secretion chaperone	NA	NA	NA	NA
WP_011400969.1\|311296_312391_-	triacylglycerol lipase	NA	NA	NA	NA
WP_019255060.1\|312717_314979_-	TonB-dependent copper receptor	NA	NA	NA	NA
WP_045601210.1\|315065_315461_-	DUF2946 domain-containing protein	NA	NA	NA	NA
WP_009899277.1\|315621_316158_-	cytochrome b	NA	NA	NA	NA
WP_009895772.1\|316412_317048_+	hypothetical protein	NA	NA	NA	NA
WP_045602985.1\|317163_317925_-	peptidoglycan DD-metalloendopeptidase family protein	NA	NA	NA	NA
WP_019255065.1\|318193_318505_-	cupin	NA	NA	NA	NA
WP_009895765.1\|318949_319282_-	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_045601211.1\|319480_320896_-	NADP-dependent phosphogluconate dehydrogenase	M4QQM4	Ostreococcus_lucimarinus_virus	9.2e-42	30.5
WP_009899263.1\|320884_321028_+	hypothetical protein	NA	NA	NA	NA
WP_045601213.1\|321350_322028_-	DUF938 domain-containing protein	NA	NA	NA	NA
WP_045601215.1\|321990_322908_-	NAD-dependent protein deacetylase	S5M4R0	Bacillus_phage	5.3e-14	25.3
WP_009899260.1\|322904_324329_-	cytosine permease	NA	NA	NA	NA
323472:323491	attL	NA	NA	NA	NA
WP_102889782.1\|325076_326311_-\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	3.4e-101	65.2
WP_045601221.1\|326716_327934_+	acyltransferase	A0A2H4IZR3	uncultured_Caudovirales_phage	7.2e-27	26.5
WP_045601222.1\|328216_328918_-\|tail	tail fiber assembly protein	E5E3Q6	Burkholderia_phage	7.5e-61	60.8
WP_045601223.1\|328933_330901_-\|tail	tail fiber protein	Q45YG3	Burkholderia_virus	8.7e-131	58.8
WP_009907013.1\|330900_331482_-\|tail	phage tail protein I	A4JWL7	Burkholderia_virus	1.5e-91	86.5
WP_009907014.1\|331474_332626_-\|plate	baseplate protein	A4JWL6	Burkholderia_virus	2.3e-168	79.9
WP_009907015.1\|332622_332976_-\|plate	baseplate protein	Q6QIA0	Burkholderia_phage	4.2e-52	82.9
WP_045601225.1\|333421_333862_-\|tail	phage tail protein	A0A291LAV4	Bordetella_phage	3.4e-19	41.7
WP_144411832.1\|335108_335411_+	hypothetical protein	NA	NA	NA	NA
WP_045601229.1\|335424_336027_-\|plate	phage baseplate assembly protein V	A4JWL4	Burkholderia_virus	5.6e-65	69.0
WP_045601230.1\|336023_337229_-	bacteriophage regulatory protein	A4JWL3	Burkholderia_virus	5.0e-137	70.6
WP_009906886.1\|337216_337423_-	membrane protein	A4JWL2	Burkholderia_virus	1.5e-25	78.3
WP_009906887.1\|337422_338325_-\|tail	phage tail protein	Q6QIA4	Burkholderia_phage	3.5e-71	72.1
WP_082256159.1\|338326_340420_-\|tail	phage tail tape measure protein	A4JWL0	Burkholderia_virus	2.4e-155	49.8
WP_009906947.1\|341035_341194_-	hypothetical protein	Q6QIA7	Burkholderia_phage	2.5e-17	80.8
WP_009906946.1\|341165_341495_-\|tail	phage tail assembly protein	Q6QIA8	Burkholderia_phage	1.8e-25	65.7
WP_045599843.1\|341652_342873_+\|transposase	ISL3 family transposase	A9YX10	Burkholderia_phage	2.2e-225	92.4
WP_025405412.1\|343161_343686_-\|tail	phage major tail tube protein	A4JWK6	Burkholderia_virus	1.0e-86	90.8
WP_045601234.1\|343687_345121_-\|tail	tail protein	A4JWK5	Burkholderia_virus	6.1e-243	87.2
WP_009906943.1\|345124_345370_-	hypothetical protein	Q6QIB1	Burkholderia_phage	1.7e-20	62.5
WP_009906942.1\|345366_345831_-	hypothetical protein	Q6QIB2	Burkholderia_phage	3.9e-42	60.1
WP_045601238.1\|346001_346316_+	hypothetical protein	NA	NA	NA	NA
WP_045601240.1\|346648_346981_-	hypothetical protein	Q6QIC3	Burkholderia_phage	5.0e-47	78.7
WP_009906940.1\|346977_347316_-	hypothetical protein	A4JWP6	Burkholderia_virus	4.0e-44	82.7
WP_155275021.1\|347312_347747_-	hypothetical protein	A4JWP5	Burkholderia_virus	4.4e-43	69.3
WP_025405408.1\|347911_348520_-	transglycosylase SLT domain-containing protein	Q6QIC7	Burkholderia_phage	3.9e-90	79.8
WP_045601243.1\|348522_348870_-	membrane protein	Q6QIC8	Burkholderia_phage	9.2e-44	79.1
WP_060970118.1\|349345_350290_-	hypothetical protein	A4JWN9	Burkholderia_virus	3.4e-24	29.2
WP_052712508.1\|350286_350706_-	helix-turn-helix transcriptional regulator	A4JWR8	Burkholderia_virus	6.7e-25	51.4
WP_009906820.1\|350836_351079_+	DNA-binding protein	Q6QID3	Burkholderia_phage	7.3e-32	90.0
WP_155722056.1\|351153_351597_+	hypothetical protein	NA	NA	NA	NA
WP_009899245.1\|351593_351905_+	helix-turn-helix domain-containing protein	A4JWN4	Burkholderia_virus	1.7e-33	80.0
WP_045601248.1\|351918_352884_+	DUF3102 domain-containing protein	A4JWN3	Burkholderia_virus	3.2e-102	70.3
WP_009899242.1\|352898_354695_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	Q6QIE0	Burkholderia_phage	4.3e-278	80.2
WP_082256055.1\|354691_355945_+	AAA family ATPase	Q6QIE1	Burkholderia_phage	7.2e-155	69.1
355381:355400	attR	NA	NA	NA	NA
WP_009899237.1\|355976_356309_+	hypothetical protein	Q6QIE2	Burkholderia_phage	2.5e-22	58.2
WP_009899234.1\|356405_357020_+	DUF3164 family protein	A4JWM8	Burkholderia_virus	2.2e-93	83.4
WP_009899233.1\|357110_357467_+	DNA-binding protein	Q6QIE8	Burkholderia_phage	1.1e-44	76.8
WP_045601250.1\|357800_358301_+	hypothetical protein	A0A2H4N7D9	Pectobacterium_phage	1.8e-32	55.0
WP_127446954.1\|358392_358791_-	hypothetical protein	NA	NA	NA	NA
WP_019256110.1\|358771_359062_+	hypothetical protein	NA	NA	NA	NA
WP_045601251.1\|359155_359341_+	hypothetical protein	NA	NA	NA	NA
WP_009899229.1\|359709_361752_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	4.2e-35	32.0
WP_009895748.1\|361810_362149_+	hypothetical protein	NA	NA	NA	NA
WP_045601252.1\|362195_364073_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	2.5e-66	35.8
WP_045601253.1\|364169_364616_-	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	5.1e-23	49.3
WP_009895742.1\|364782_364995_-	30S ribosomal protein S21	NA	NA	NA	NA
WP_045601255.1\|365074_366298_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_025405402.1\|366428_367469_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.7e-93	54.0
WP_009895738.1\|367883_368693_-	GTP cyclohydrolase I FolE2	NA	NA	NA	NA
WP_009899218.1\|368843_370748_-	1-deoxy-D-xylulose-5-phosphate synthase	NA	NA	NA	NA
WP_045601256.1\|370832_371717_-	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_045601257.1\|371713_372007_-	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
WP_009899213.1\|372276_373383_+	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
WP_045600741.1\|373485_374814_-\|transposase	IS4 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

913613 : 990456

Ralstonia_phage(40.0%)

holin,plate,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009894757.1\|913613_914132_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_009894755.1\|914133_916014_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_009898345.1\|916010_917060_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_009898344.1\|917078_918149_+	type VI secretion protein ImpA	NA	NA	NA	NA
WP_045601534.1\|918204_919233_+	fimbrial protein	NA	NA	NA	NA
WP_045601536.1\|919265_920624_+	hypothetical protein	A0A292GJ55	Xanthomonas_phage	3.4e-110	49.5
WP_045601537.1\|920516_923969_-	RHS repeat protein	NA	NA	NA	NA
WP_004523693.1\|923981_924251_-	PAAR motif protein	NA	NA	NA	NA
WP_045601538.1\|924325_927004_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	1.9e-35	26.0
WP_045601539.1\|927104_927674_-	hypothetical protein	NA	NA	NA	NA
WP_045601540.1\|927864_931773_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_045601541.1\|931787_933089_-	type VI secretion system protein TssL	NA	NA	NA	NA
WP_045603054.1\|933085_934435_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_019255186.1\|934440_934983_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_009894730.1\|935110_935593_-	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_009894729.1\|935793_937293_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_045601543.1\|937326_937866_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_045601545.1\|938209_939886_-	OmpA family protein	NA	NA	NA	NA
WP_009907089.1\|939888_940578_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_045601546.1\|940608_941154_-	type 1 fimbrial protein	NA	NA	NA	NA
WP_045601547.1\|941173_943870_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_162465482.1\|943822_943981_+	hypothetical protein	NA	NA	NA	NA
WP_045601548.1\|944029_944755_-	fimbria/pilus periplasmic chaperone	NA	NA	NA	NA
WP_009898306.1\|944836_945391_-	type 1 fimbrial protein	NA	NA	NA	NA
WP_082256026.1\|945976_946570_+	hypothetical protein	NA	NA	NA	NA
WP_080558013.1\|946542_946749_-	hypothetical protein	NA	NA	NA	NA
WP_045601549.1\|946820_948272_+	PhoPQ-regulated protein	NA	NA	NA	NA
WP_045601550.1\|948347_950495_-	hypothetical protein	K4F7R4	Cronobacter_phage	7.8e-08	46.1
WP_155275045.1\|951339_951696_+	hypothetical protein	NA	NA	NA	NA
WP_045601551.1\|952043_953585_+	membrane protein	NA	NA	NA	NA
WP_038708432.1\|954596_956663_+	FUSC family protein	NA	NA	NA	NA
WP_009894707.1\|956659_956884_+	DUF1656 domain-containing protein	NA	NA	NA	NA
WP_009898285.1\|956885_957785_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_045601552.1\|957778_959203_+	TolC family protein	NA	NA	NA	NA
WP_069255329.1\|959202_960402_+	transcriptional regulator CynR	NA	NA	NA	NA
WP_155275044.1\|960515_960749_-	hypothetical protein	NA	NA	NA	NA
WP_009898271.1\|960770_961001_+	hypothetical protein	NA	NA	NA	NA
WP_045601554.1\|961395_961698_+	hypothetical protein	NA	NA	NA	NA
WP_082256023.1\|962315_963239_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_045601557.1\|963910_965053_+	porin	NA	NA	NA	NA
WP_082256021.1\|965529_965886_+	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_019255408.1\|966708_967401_-	hypothetical protein	NA	NA	NA	NA
WP_004523720.1\|967873_968200_+	thioredoxin family protein	NA	NA	NA	NA
WP_004523721.1\|968219_968639_+	YjbQ family protein	NA	NA	NA	NA
WP_045601559.1\|969053_969317_-	PAAR domain-containing protein	NA	NA	NA	NA
WP_045601560.1\|969326_970985_-	DUF2875 family protein	NA	NA	NA	NA
WP_082256020.1\|971003_972494_-	DUF3274 domain-containing protein	A0A077K801	Ralstonia_phage	1.0e-06	28.4
WP_009894667.1\|973329_973593_-	PAAR domain-containing protein	NA	NA	NA	NA
WP_045601561.1\|973602_975261_-	DUF2875 family protein	NA	NA	NA	NA
WP_045601562.1\|977532_980313_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	6.2e-90	34.3
WP_045601564.1\|980633_980939_-	H-NS histone family protein	NA	NA	NA	NA
WP_045601565.1\|981581_982613_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_045601567.1\|982609_983464_-	ABC transporter permease	NA	NA	NA	NA
WP_009894659.1\|983450_984296_-	ABC transporter permease	NA	NA	NA	NA
WP_009894657.1\|984831_985284_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_045601570.1\|985302_986319_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_102889796.1\|986343_987155_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_045601576.1\|988260_990456_-\|holin	phospholipase C, phosphocholine-specific	NA	NA	NA	NA

DBSCAN-SWA_3

1492499 : 1527897

Burkholderia_virus(27.27%)

integrase,transposase

attL 1494244:1494260|attR 1520519:1520535

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082255786.1\|1492499_1493963_-\|transposase	IS1182-like element ISBma2 family transposase	A0A1X9I5T2	Streptococcus_phage	8.8e-80	38.6
WP_009893969.1\|1494102_1495302_-	aspartate/tyrosine/aromatic aminotransferase	NA	NA	NA	NA
1494244:1494260	attL	NA	NA	NA	NA
WP_009901217.1\|1495590_1497681_+	excinuclease ABC subunit UvrB	NA	NA	NA	NA
WP_011401484.1\|1497903_1498455_+	membrane protein	NA	NA	NA	NA
WP_045601911.1\|1498514_1498844_+	cupredoxin domain-containing protein	NA	NA	NA	NA
WP_011401483.1\|1498903_1499746_+	DUF2029 domain-containing protein	NA	NA	NA	NA
WP_009901215.1\|1499742_1501143_+	4Fe-4S binding protein	NA	NA	NA	NA
WP_011401482.1\|1501202_1501613_+	heme-binding protein	NA	NA	NA	NA
WP_011401481.1\|1501918_1502185_-	hemin uptake protein HemP	NA	NA	NA	NA
WP_009901213.1\|1502328_1502814_-	DUF1857 family protein	NA	NA	NA	NA
WP_009901212.1\|1502932_1503805_-	pirin family protein	NA	NA	NA	NA
WP_009893955.1\|1503928_1504894_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_009901209.1\|1505259_1505688_-	biopolymer transporter ExbD	NA	NA	NA	NA
WP_009901208.1\|1505701_1506430_-	MotA/TolQ/ExbB proton channel family protein	NA	NA	NA	NA
WP_045601912.1\|1506466_1507201_-	energy transducer TonB	NA	NA	NA	NA
WP_009893950.1\|1507428_1507668_-	(2Fe-2S)-binding protein	NA	NA	NA	NA
WP_045601913.1\|1507802_1508675_-	glutamate racemase	NA	NA	NA	NA
WP_009893946.1\|1508720_1509197_-	bacterioferritin	NA	NA	NA	NA
WP_009893945.1\|1509352_1510888_-	fumarate hydratase	NA	NA	NA	NA
WP_009893943.1\|1510927_1511536_-	TIGR00645 family protein	K4K6D8	Caulobacter_phage	9.2e-23	33.2
WP_009901203.1\|1511766_1512666_-	DMT family transporter	NA	NA	NA	NA
WP_045601914.1\|1512955_1514938_+	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	8.9e-83	44.3
WP_045143316.1\|1515035_1515416_+	DUF4212 domain-containing protein	NA	NA	NA	NA
WP_045601915.1\|1515409_1517425_+	VC_2705 family sodium/solute symporter	NA	NA	NA	NA
WP_082256127.1\|1517627_1518200_-\|integrase	site-specific integrase	A0A1W6JTA0	Pseudomonas_phage	2.7e-56	66.5
WP_045601917.1\|1518507_1518723_-	hypothetical protein	Q6JIH9	Burkholderia_virus	4.3e-28	77.5
WP_045601918.1\|1518767_1519043_-	hypothetical protein	A1YZS4	Burkholderia_virus	1.2e-30	69.8
WP_082256201.1\|1519070_1519253_-	hypothetical protein	NA	NA	NA	NA
WP_045598699.1\|1519816_1521382_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	9.8e-69	34.0
1520519:1520535	attR	NA	NA	NA	NA
WP_045601925.1\|1521413_1521764_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_045598892.1\|1521739_1522213_-\|transposase	transposase	NA	NA	NA	NA
WP_045598824.1\|1522418_1523249_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	1.6e-14	29.9
WP_045603127.1\|1524040_1524379_+	hypothetical protein	A4JX41	Burkholderia_virus	1.9e-49	90.2
WP_045601927.1\|1524426_1524627_+	hypothetical protein	NA	NA	NA	NA
WP_045603129.1\|1524661_1525051_-	type II toxin-antitoxin system death-on-curing family toxin	A0A222YZ88	Escherichia_phage	2.4e-16	39.8
WP_052712499.1\|1525928_1526366_-	hypothetical protein	NA	NA	NA	NA
WP_102889803.1\|1526761_1527897_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.2e-14	29.9

DBSCAN-SWA_4

1635131 : 1729403

Burkholderia_phage(87.76%)

terminase,tail,plate,holin,integrase,transposase

attL 1627536:1627555|attR 1696769:1696788

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1627536:1627555	attL	NA	NA	NA	NA
WP_102889787.1\|1635131_1635942_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_025405836.1\|1635973_1636345_+	membrane protein	NA	NA	NA	NA
WP_045601994.1\|1636625_1638233_-	alkyl hydroperoxide reductase subunit F	A0A2I2L5E1	Orpheovirus	3.0e-36	32.8
WP_009901055.1\|1638373_1638937_-	peroxiredoxin	NA	NA	NA	NA
WP_045601996.1\|1639192_1640290_-	chitin-binding protein	C3TWS8	Euproctis_pseudoconspersa_nucleopolyhedrovirus	8.0e-25	32.1
WP_045601997.1\|1640642_1641128_-	hypothetical protein	NA	NA	NA	NA
WP_045601999.1\|1641192_1641816_-	nitroreductase	NA	NA	NA	NA
WP_045602000.1\|1642040_1642532_-	DUF1804 family protein	B5TA69	Burkholderia_phage	4.3e-31	44.9
WP_045602001.1\|1644625_1644886_-	hypothetical protein	B5TA66	Burkholderia_phage	7.4e-22	69.8
WP_045602002.1\|1644930_1646463_-	DUF935 family protein	B5TA67	Burkholderia_phage	8.5e-251	89.3
WP_045602004.1\|1646452_1648069_-\|terminase	phage terminase large subunit	B5TA68	Burkholderia_phage	2.4e-304	92.4
WP_038755846.1\|1648075_1648573_-	DUF1804 family protein	B5TA69	Burkholderia_phage	3.5e-81	93.9
WP_009927781.1\|1648576_1648867_-	hypothetical protein	B5TA70	Burkholderia_phage	1.3e-40	89.6
WP_038724579.1\|1648863_1649085_-	hypothetical protein	B5TA71	Burkholderia_phage	4.3e-31	89.0
WP_082256119.1\|1649192_1649657_-	hypothetical protein	NA	NA	NA	NA
WP_009927784.1\|1649653_1650328_-	lytic transglycosylase domain-containing protein	B5TA73	Burkholderia_phage	6.3e-89	71.4
WP_052712509.1\|1650324_1650636_-	hypothetical protein	B5TA74	Burkholderia_phage	7.4e-37	72.6
WP_045602008.1\|1650752_1651025_-	hypothetical protein	NA	NA	NA	NA
WP_045602010.1\|1651021_1651504_-	DUF2778 domain-containing protein	NA	NA	NA	NA
WP_127446971.1\|1651545_1652244_-	hypothetical protein	NA	NA	NA	NA
WP_045602012.1\|1652268_1652805_-	hypothetical protein	B5TA76	Burkholderia_phage	2.8e-60	67.4
WP_045602013.1\|1652848_1653349_-	helix-turn-helix transcriptional regulator	K4NXA8	Burkholderia_phage	1.3e-11	35.3
WP_045602015.1\|1653413_1653605_+	DNA-binding protein	B5TA78	Burkholderia_phage	6.0e-21	76.3
WP_045602017.1\|1653601_1654651_+	hypothetical protein	B5TA79	Burkholderia_phage	2.7e-139	77.8
WP_045602019.1\|1654688_1656314_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	B5TA80	Burkholderia_phage	4.6e-303	95.0
WP_045602021.1\|1656323_1657316_+	AAA family ATPase	B5TA81	Burkholderia_phage	2.4e-174	93.9
WP_045603147.1\|1657323_1657512_+	hypothetical protein	B5TA82	Burkholderia_phage	5.7e-16	71.0
WP_045602024.1\|1657508_1657814_+	hypothetical protein	B5TA83	Burkholderia_phage	3.5e-39	86.1
WP_045602025.1\|1657800_1658388_+	hypothetical protein	B5TA84	Burkholderia_phage	3.4e-83	92.9
WP_045602027.1\|1658384_1659011_+	DUF3164 family protein	B5TA85	Burkholderia_phage	4.6e-102	91.8
WP_045602029.1\|1659021_1659414_+	hypothetical protein	B5TA86	Burkholderia_phage	1.8e-67	94.6
WP_045602031.1\|1659477_1659750_+	HU family DNA-binding protein	B5TA87	Burkholderia_phage	1.1e-36	93.3
WP_082256118.1\|1659825_1660110_+	hypothetical protein	B5TA88	Burkholderia_phage	1.6e-14	66.1
WP_045602033.1\|1660273_1660597_+	hypothetical protein	B5TA89	Burkholderia_phage	1.5e-48	87.6
WP_045602036.1\|1660598_1661039_+	regulatory protein GemA	B5TA90	Burkholderia_phage	9.4e-70	92.5
WP_006484119.1\|1661035_1661434_+	hypothetical protein	B5TA91	Burkholderia_phage	1.1e-69	100.0
WP_045602041.1\|1661647_1662796_+	hypothetical protein	B5TA92	Burkholderia_phage	1.5e-188	87.9
WP_009927839.1\|1662840_1663197_+	DUF2190 family protein	B5TA94	Burkholderia_phage	3.3e-41	77.1
WP_045602043.1\|1663252_1664200_+	hypothetical protein	B5TA95	Burkholderia_phage	4.4e-165	92.7
WP_045603149.1\|1664273_1664675_+	hypothetical protein	B5TA96	Burkholderia_phage	1.2e-10	69.8
WP_045602045.1\|1664671_1665175_+	DUF1320 family protein	B5TA97	Burkholderia_phage	1.0e-88	92.8
WP_045602047.1\|1665171_1665606_+	virion morphogenesis protein	B5TA98	Burkholderia_phage	5.0e-55	75.7
WP_045603151.1\|1665620_1666223_+	hypothetical protein	B5TA99	Burkholderia_phage	2.7e-51	51.8
WP_045602049.1\|1666191_1666458_+	hypothetical protein	B5TAA0	Burkholderia_phage	1.3e-13	55.8
WP_045602051.1\|1666508_1667987_+\|tail	tail sheath protein	B5TAA1	Burkholderia_phage	7.5e-220	79.9
WP_045602053.1\|1668033_1668405_+	hypothetical protein	B5TAA2	Burkholderia_phage	2.4e-50	75.6
WP_045602055.1\|1668437_1668662_+	hypothetical protein	E5EYD6	Acinetobacter_phage	7.5e-23	66.2
WP_045602057.1\|1668753_1669302_+	hypothetical protein	B5TAA3	Burkholderia_phage	1.1e-64	70.1
WP_045602059.1\|1669350_1672014_+\|tail	tail protein	B5TAA4	Burkholderia_phage	3.3e-218	65.4
WP_045602060.1\|1672017_1673406_+	multidrug DMT transporter	B5TAA5	Burkholderia_phage	4.0e-191	73.4
WP_045602062.1\|1673408_1674575_+	hypothetical protein	B5TAA6	Burkholderia_phage	1.7e-182	79.3
WP_045602064.1\|1674571_1675087_+\|plate	baseplate assembly protein	B5TAA7	Burkholderia_phage	1.0e-54	63.2
WP_045602066.1\|1675173_1675761_+\|tail	tail protein	B5TAA8	Burkholderia_phage	2.5e-81	73.4
WP_045602069.1\|1675757_1676879_+\|plate	baseplate J/gp47 family protein	B5TAA9	Burkholderia_phage	6.6e-152	72.7
WP_045602071.1\|1676878_1677475_+	DUF2313 domain-containing protein	B5TAB0	Burkholderia_phage	9.8e-62	62.8
WP_045602073.1\|1677486_1678773_+	hypothetical protein	A4JWL8	Burkholderia_virus	5.0e-127	61.9
WP_045602075.1\|1678786_1679221_+\|tail	tail assembly chaperone	A4JWL9	Burkholderia_virus	2.0e-43	75.7
WP_011401430.1\|1679971_1681387_+	circularly permuted type 2 ATP-grasp protein	NA	NA	NA	NA
WP_045602078.1\|1681481_1682423_+	alpha-E domain-containing protein	NA	NA	NA	NA
WP_045602080.1\|1682431_1683388_+	transglutaminase family protein	NA	NA	NA	NA
WP_045602082.1\|1683512_1686950_+	transglutaminase family protein	NA	NA	NA	NA
WP_045603152.1\|1687153_1689802_+	circularly permuted type 2 ATP-grasp protein	NA	NA	NA	NA
WP_045602085.1\|1689792_1690830_+	transglutaminase family protein	NA	NA	NA	NA
WP_045602087.1\|1690963_1692466_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_045602088.1\|1692571_1693807_+	multidrug effflux MFS transporter	NA	NA	NA	NA
WP_025405833.1\|1693994_1694726_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_045602089.1\|1695080_1696154_-	FUSC family protein	NA	NA	NA	NA
WP_045603157.1\|1696949_1697540_+	glutamine amidotransferase	NA	NA	NA	NA
1696769:1696788	attR	NA	NA	NA	NA
WP_009901031.1\|1697680_1698748_-	2-aminoethylphosphonate aminotransferase	NA	NA	NA	NA
WP_045602091.1\|1698762_1699944_-	phosphonopyruvate decarboxylase	NA	NA	NA	NA
WP_019256483.1\|1699940_1701629_-	phosphoenolpyruvate mutase	NA	NA	NA	NA
WP_009901024.1\|1701625_1702393_-\|holin	phosphocholine cytidylyltransferase family protein	NA	NA	NA	NA
WP_045602093.1\|1702431_1703433_-	HpnL family protein	NA	NA	NA	NA
WP_009893782.1\|1703429_1704203_-	2OG-Fe(II) oxygenase	NA	NA	NA	NA
WP_009901017.1\|1704199_1704895_-	CDP-alcohol phosphatidyltransferase family protein	NA	NA	NA	NA
WP_045602095.1\|1705260_1706775_+	acetyl-CoA hydrolase/transferase family protein	NA	NA	NA	NA
WP_045602097.1\|1708396_1709341_+	hypothetical protein	NA	NA	NA	NA
WP_009901015.1\|1709374_1709926_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_009901014.1\|1709928_1711434_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_045598712.1\|1711577_1712105_+	type VI secretion protein	NA	NA	NA	NA
WP_009901012.1\|1712183_1712615_+	GPW/gp25 family protein	NA	NA	NA	NA
WP_045598709.1\|1712628_1714491_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_009893772.1\|1714487_1715477_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_045598707.1\|1715479_1718323_+	type VI secretion system ATPase TssH	A0A2I7REQ1	Vibrio_phage	1.2e-61	27.0
WP_045602102.1\|1718313_1720605_+	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_045602104.1\|1720719_1723008_+	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_045602106.1\|1723011_1725228_+	DUF2169 domain-containing protein	NA	NA	NA	NA
WP_009900995.1\|1725227_1726298_+	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_045598706.1\|1726300_1727017_+	DUF3540 domain-containing protein	NA	NA	NA	NA
WP_009893761.1\|1727056_1727446_+	DUF4150 domain-containing protein	NA	NA	NA	NA
WP_009900994.1\|1727451_1728045_+	hypothetical protein	NA	NA	NA	NA
WP_045598705.1\|1728041_1729403_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP010016

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP010016_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP010016_1

229918-230137

Orphan

Consensus_repeat	Method
TGCCGTTGCGCCATTACCAATCGCACTAGCATTCAATCCGGATGCCGTCGCG	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP010016_1

>merge|NZ_CP010016|1|229918-230137|PILER-CR
TGCCGTTGCGCCATTACCAATCGCACTAGCATTCAATCCGGATGCCGTCGCGCCAGAACCCAGAGCGCTTGAATTCGCTCCGCTCGCCACTGCTTGATTGCCAATCGCACTAGCATTCGTGTTGTTAGCGACCGCACCAGTACCCAGCGCATTTGAAGTCGCACCGCTTGCCGTTGCGCCATTACCAATCGCACTAGCATTCAATCCGGATGCCGTCGCG

>NZ_CP010016|1|1|229918-230137|PILER-CR
TGCCGTTGCGCCATTACCAATCGCACTAGCATTCAATCCGGATGCCGTCGCG	CCAGAACCCAGAGCGCTTGAATTCGCTCCGCTCGCCACTGCTTG
ATTGCCAATCGCACTAGCATTCGTGTTGTTAGCGACCGCACCAGTACCCAGC	GCATTTGAAGTCGCACCGCTTGCCGTTGCGCCATTACCAATCGCACTAG
CATTCAATCCGGATGCCGTCGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP010016.1\|WP_045598866.1\|234624_234927_-\|transposase	unknown	unknown	gnl\|CDD\|366690
NZ_CP010016.1\|WP_045598869.1\|236298_238131_-\|glutamine--fructose-6-phosphate-transaminase-(isomerizing)	unknown	unknown	gnl\|CDD\|234729
NZ_CP010016.1\|WP_045598846.1\|221121_221610_-\|DUF2844-domain-containing-protein	unknown	unknown	gnl\|CDD\|314047
NZ_CP010016.1\|WP_045598844.1\|219911_221111_-\|DUF3443-domain-containing-protein	unknown	unknown	gnl\|CDD\|314750
NZ_CP010016.1\|WP_082256008.1\|233187_233766_+\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NZ_CP010016.1\|WP_102889859.1\|227828_228500_-\|OmpA-family-protein	unknown	unknown	gnl\|CDD\|143586
NZ_CP010016.1\|WP_045598851.1\|227152_227476_-\|H-NS-histone-family-protein	unknown	unknown	gnl\|CDD\|376390
NZ_CP010016.1\|WP_045598840.1\|215722_217876_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010016.1\|WP_009905747.1\|218452_219220_-\|FkbM-family-methyltransferase	unknown	unknown	gnl\|CDD\|273628
NZ_CP010016.1\|WP_158351383.1\|234257_234494_-\|transposase	unknown	unknown	gnl\|CDD\|372671
NZ_CP010016.1\|WP_082255993.1\|233842_234235_+\|MAPEG-family-protein	unknown	unknown	gnl\|CDD\|376462
NZ_CP010016.1\|WP_009905744.1\|223235_224441_+\|outer-membrane-protein-assembly-factor-BamC	unknown	unknown	gnl\|CDD\|225854
NZ_CP010016.1\|WP_025405302.1\|221700_222921_-\|ISL3-family-transposase	unknown	unknown	gnl\|CDD\|225995
NZ_CP010016.1\|WP_082256009.1\|238722_239580_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226386
NZ_CP010016.1\|WP_045598873.1\|241068_242712_-\|DUF3492-domain-containing-protein	unknown	unknown	gnl\|CDD\|340841
NZ_CP010016.1\|WP_158351381.1\|231570_232629_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|376350
NZ_CP010016.1\|WP_082255990.1\|226103_226871_-\|DUF937-domain-containing-protein	unknown	unknown	gnl\|CDD\|368733
NZ_CP010016.1\|WP_045598867.1\|235096_236119_-\|UDP-glucose-4-epimerase-GalE	unknown	unknown	gnl\|CDD\|187558
NZ_CP010016.1\|WP_045598871.1\|239692_241069_-\|exopolysaccharide-Pel-transporter-PelG	unknown	unknown	gnl\|CDD\|379904
NZ_CP010016.1\|WP_045598850.1\|225745_225931_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP010016.1\|WP_045598866.1\|234624_234927_-\|transposase	gnl\|CDD\|366690	pfam01527, HTH_Tnp_1, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family consists of various E. coli insertion elements and other bacterial transposases some of which are members of the IS3 family.	1.57148e-07
NZ_CP010016.1\|WP_045598869.1\|236298_238131_-\|glutamine--fructose-6-phosphate-transaminase-(isomerizing)	gnl\|CDD\|234729	PRK00331, PRK00331, isomerizing glutamine--fructose-6-phosphate transaminase.	0
NZ_CP010016.1\|WP_045598846.1\|221121_221610_-\|DUF2844-domain-containing-protein	gnl\|CDD\|314047	pfam11005, DUF2844, Protein of unknown function (DUF2844). This bacterial family of proteins has no known function.	1.45144e-41
NZ_CP010016.1\|WP_045598844.1\|219911_221111_-\|DUF3443-domain-containing-protein	gnl\|CDD\|314750	pfam11925, DUF3443, Protein of unknown function (DUF3443). This family of proteins are functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 400 to 434 amino acids in length. This protein has two conserved sequence motifs: NPV and DNNG.	1.25488e-154
NZ_CP010016.1\|WP_082256008.1\|233187_233766_+\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	8.13569e-56
NZ_CP010016.1\|WP_102889859.1\|227828_228500_-\|OmpA-family-protein	gnl\|CDD\|143586	cd07185, OmpA_C-like, Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA. OmpA-like domains (named after the C-terminal domain of Escherichia coli OmpA protein) have been shown to non-covalently associate with peptidoglycan, a network of glycan chains composed of disaccharides, which are crosslinked via short peptide bridges. Well-studied members of this family include the Escherichia coli outer membrane protein OmpA, the Escherichia coli lipoprotein PAL, Neisseria meningitdis RmpM, which interact with the outer membrane, as well as the Escherichia coli motor protein MotB, and the Vibrio flagellar motor proteins PomB and MotY, which interact with the inner membrane.	2.57905e-40
NZ_CP010016.1\|WP_045598851.1\|227152_227476_-\|H-NS-histone-family-protein	gnl\|CDD\|376390	pfam00816, Histone_HNS, H-NS histone family.	8.67934e-14
NZ_CP010016.1\|WP_009905747.1\|218452_219220_-\|FkbM-family-methyltransferase	gnl\|CDD\|273628	TIGR01444, 2-O-methyltransferase_NoeI, methyltransferase, FkbM family. Members of this family are characterized by two well-conserved short regions separated by a variable in both sequence and length. The first of the two regions is found in a large number of proteins outside this subfamily, a number of which have been characterized as methyltransferases. One member of the present family, FkbM, was shown to be required for a specific methylation in the biosynthesis of the immunosuppressant FK506 in Streptomyces strain MA6548.	3.03847e-24
NZ_CP010016.1\|WP_158351383.1\|234257_234494_-\|transposase	gnl\|CDD\|372671	pfam13683, rve_3, Integrase core domain.	3.3003e-25
NZ_CP010016.1\|WP_082255993.1\|233842_234235_+\|MAPEG-family-protein	gnl\|CDD\|376462	pfam01124, MAPEG, MAPEG family. This family is has been called MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism). It includes proteins such as Prostaglandin E synthase. This enzyme catalyzes the synthesis of PGE2 from PGH2 (produced by cyclooxygenase from arachidonic acid). Because of structural similarities in the active sites of FLAP, LTC4 synthase and PGE synthase, substrates for each enzyme can compete with one another and modulate synthetic activity.	1.05147e-06
NZ_CP010016.1\|WP_009905744.1\|223235_224441_+\|outer-membrane-protein-assembly-factor-BamC	gnl\|CDD\|225854	COG3317, NlpB, Uncharacterized lipoprotein [Cell envelope biogenesis, outer membrane].	9.98738e-46
NZ_CP010016.1\|WP_025405302.1\|221700_222921_-\|ISL3-family-transposase	gnl\|CDD\|225995	COG3464, COG3464, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	3.79594e-91
NZ_CP010016.1\|WP_082256009.1\|238722_239580_-\|hypothetical-protein	gnl\|CDD\|226386	COG3868, COG3868, Uncharacterized conserved protein [Function unknown].	2.28083e-51
NZ_CP010016.1\|WP_045598873.1\|241068_242712_-\|DUF3492-domain-containing-protein	gnl\|CDD\|340841	cd03813, GT4-like, glycosyltransferase family 4 proteins. This family is most closely related to the GT4 family of glycosyltransferases. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in bacteria, while some of them are also found in Archaea and eukaryotes.	0
NZ_CP010016.1\|WP_158351381.1\|231570_232629_-\|EAL-domain-containing-protein	gnl\|CDD\|376350	pfam00563, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues. The EAL domain is a good candidate for a diguanylate phosphodiesterase function. The domain contains many conserved acidic residues that could participate in metal binding and might form the phosphodiesterase active site.	6.75942e-20
NZ_CP010016.1\|WP_082255990.1\|226103_226871_-\|DUF937-domain-containing-protein	gnl\|CDD\|368733	pfam06078, DUF937, Bacterial protein of unknown function (DUF937). This family consists of several hypothetical bacterial proteins of unknown function.	2.89218e-07
NZ_CP010016.1\|WP_045598867.1\|235096_236119_-\|UDP-glucose-4-epimerase-GalE	gnl\|CDD\|187558	cd05247, UDP_G4E_1_SDR_e, UDP-glucose 4 epimerase, subgroup 1, extended (e) SDRs. UDP-glucose 4 epimerase (aka UDP-galactose-4-epimerase), is a homodimeric extended SDR. It catalyzes the NAD-dependent conversion of UDP-galactose to UDP-glucose, the final step in Leloir galactose synthesis. This subgroup has the characteristic active site tetrad and NAD-binding motif of the extended SDRs. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	0
NZ_CP010016.1\|WP_045598871.1\|239692_241069_-\|exopolysaccharide-Pel-transporter-PelG	gnl\|CDD\|379904	pfam16933, PelG, Putative exopolysaccharide Exporter (EPS-E). PelG is a family of putative exopolysaccharide transporters like PelG. Most members carry twelve transmembrane regions. The family also contains fusion proteins with glycosyl transferase group 1, which are putative flippase transporters.	2.59584e-156

>NZ_CP010016.1|WP_102889859.1|227828_228500_-|OmpA-family-protein
MKNIYLPLILSAVSLVGCSATSGPTFSARELQARDGVRTYQVDCHGLFSSSKMCMRVATRVCGDQPVHVIDSAQPLRNAPDPDSLTFQCRAKDVAQSTPVPAPVVMPIPQHITLSTDANFDFDQATLTPTAHDRLNKLIADATGLKFGTVEVNGYTDGVGPNAYNLHLSELRAQAVAGYLQSHGLEATGFDVKGYGKDNPVATNSTAEGRAKNRRVEITLPQQ
>NZ_CP010016.1|WP_045598851.1|227152_227476_-|H-NS-histone-family-protein
MSRYQMLFDQYEKLKQQIDRERKEEMDSFVCAIANRIREILDEYGLDIEVVPRGIGPEKTRKKIEPKYWNKKTGQTWSGRGRTPLWLVGQDREKFRIPIENEDQDLK
>NZ_CP010016.1|WP_082255990.1|226103_226871_-|DUF937-domain-containing-protein
MKIGQIPVCDSVNILESLHFLTTDPICLQISVLLDESRIGVKAAIQLLLANLLGVIVCRGSTKKGGGSLLGVLSSSEMFPGLLSTDLNELFSGNKSTQDLMMRGETLLMRLLGRKAGDLCDAIACLSGLRDESVMSLLAMMTPIILTMVKRVANANCAFHHAGIWPLMIAQKEYLFDRVSGRVLMAVGMEEFSVFSDSSENYGIGAVDGIGNFQVGAMKFNKIVSTYGFSSKILRSSWILVMIIALVILVYKKIP
>NZ_CP010016.1|WP_045598850.1|225745_225931_-|hypothetical-protein
MKSKRTSGGRKLDHATLQATRQQAVKAVREGQGVASVAAAYGVNERSAYPSHLKPDSAGHT
>NZ_CP010016.1|WP_009905744.1|223235_224441_+|outer-membrane-protein-assembly-factor-BamC
MTDLRLTKRFAALLATGAFVAGCSSPSPTKIDYKSDSKSKEVSLAVPPNMLDETPDQRSLPPQGGATSLSSLQQVQQAAPPTDSVAPAVPGMRIQRDGTESWLVIDDKSPAQIWPQVRRFWQEQGFLLVVEQRDKGVMETDWNETHPQINDGLIRGVISKAMGNSYVTAERNKYRTRLDAAPNGGTYVFISQKGMREALTGANNDSSKWEPKPNDPGLETEYLKRLMAVIAQNDARVKAGGVPITDDAAPSRAKASTSKSKDAAAAIAAKNVASASTSSAPSGAAVPDVPPEVTLAEPYDRSWLHVGLALDRANFTVDDRDRTKGLYYVRYVDPKDLSVEEQGFWSQLFHGKKEKKAKQYLVNVKAVTEGETRVAVVDDKGNVDASAPARQIMSLLVNQLR
>NZ_CP010016.1|WP_025405302.1|221700_222921_-|ISL3-family-transposase
MLDRKALQALGCWTGYRLERVEWPEGEGRTLSLHVKPVSKVMYCEQCGARCHQIHETTVRRVRDLPLFEYRVVLHVPRRRVWCERCGGPRLEKLAWLGRYQRVTERFAKACEKLLQAASVQAVAAFYDLGWHTVKSIDKMRLQARVAEPDWSTIRYLAMDEFALHKGHRYATVVVDPIGRQVLWIGSGRSRETARAFFEQLPEGVAERIEAVAIDMTTAYELEIKAQCPQAEVVYDLFHVVAKYGREVIDRVRVDQANQLRHDRPARKVLKSSRWLLLRNRHNLKPEQSVHLKELLAANQPLLCVYVLRDELKRLWFYRKPAWAEKAWEHWIEQARQSGIAALQLFAQRLQGYWHGILARCRHPLNTSVVEGINNTIKVIKRRAYGYRDEEYFFLKIRAAFPGNPR
>NZ_CP010016.1|WP_045598846.1|221121_221610_-|DUF2844-domain-containing-protein
MNNKNSFPPVRRRPACALLVAAALTFVPVSAQSQLGGTVTDSSARAFAQTSTPLLGGAVTMRSHVDAGGTTIREYATRAGLVFAYTWDGPTSPNLRQLLGERISTYQSHAVSTDARARVSLHAGRVAQSDFVVEAGGRMRTYVGRAWLPGAVPSGVSIDDLP
>NZ_CP010016.1|WP_045598844.1|219911_221111_-|DUF3443-domain-containing-protein
MTLKITWRAAALTVTLAACGGGGGGGSTTPNSSGSGVTPSNAANVQPVTVSEGITGAANMLMTTVTVCAPNTNQCQTIDNVQVDTGSDGLRILAAALPSSVALPVVPAANAPITGACAIFGTGFTWGAVRRADVRVAGEVAANIPIQVIADPSTPNAPADCTQSAGPMQTQGALRANGILGIGLFVTDCGTACANSAPPGWYYGCTASGACASTSQPIAQQIANPVGAFSSDNNGSVIVLPAIPATGSATVNGSLIFGIGTQANNGLGAATPLATTASGAYVTSVLNGNTNARTFFDSGSNGIFFADTSLPQCGSWFCPASTQTFDITLSSGNGASKATTFQVASSQVLFSTFNFAFNDLAGPIGNVVDLGLPLFYGRNIYTAIEGRATPAGPGPYYAY
>NZ_CP010016.1|WP_009905747.1|218452_219220_-|FkbM-family-methyltransferase
MGSPYIQARLSQIGDLMSFGIIQLDYEEVLAKHYRRWIQPGDTVIDVGAHLGLHLSRFIELAGPTGQVIGFEPLPFAFDILSTQHACPTLTLNNVALAHEPGHAEFTFAQGSPGESGLRKRLYISPETVTPTLIPVKVDTLDMHTENLRSVDYIKIDIEGGEIGCLEGATRTIDKFRPLISTEYGYPSYSVYGLTKDSLFNFASSKNYVLFDIFLNRIDTRDEWHIVCDSICWDYFLVPAEKLDVFTERVARRAF
>NZ_CP010016.1|WP_045598840.1|215722_217876_-|hypothetical-protein
MRTAISASRWFLRSCAGTAVTLAVLSAGCAESTPKSGNGVTASTTIERTKADRLAREQQIARTVPALASIKIDQPRPLTLRDSGQSGTLAFLRDVDFRIVGDLGFLVHELSATLVPTHPGSPAVFDDPTSFDIAVHHGTVTLDNTKLNALFGGYIFGYRNAPLRNVRVTAGDGVLDIRGEMQRDGWVPFSLRGRLEIRDGSTLVFRPTDVHVSGIDAGPVMRAAKVQVSDLLKIDTPIVRLNGNDLVLNVDKLLPPPHLKINIVALKLTSAGLDLVLDDGTKAGFAMPENAPKHAMYLRGGDVKFMRTMPMNADIVIYPPRESPPNAPFVFDMYHYRDQLVAGYFNFEPSGALSILMPSYQQVARPVTPGVGNASAHMNDSLIDAQQSSLNDARRQWEAFAIMPNGSAPQPSFRKVTAKRGGDVSTFGPRHISNGTTTIHLHNADFYIAGNIGFRVDDLVVQLVSKRAGDPVDLDDPNQYDIRILSGSVLASWDAMSDLFNRHLLDYSPRSLNDLKLSADGNALRVQGGIKLWNQVPPGVWLPADMKGSLTLLDDRHLAFTPTQVSVLGIPQAKLLHALGIELSSLAPLKRRGAELRGNSLVLDQHTVFPPPMLVGHMSQATVEPDGLRLTFRPAPNAPVLRPPANLPNSYLWLEGGDTKMFNVLVLNMRILVQDTAKQRVRFDLYDYRDVVSRGSVRMVHDGTLYVDVGRKDPLAR
>NZ_CP010016.1|WP_158351381.1|231570_232629_-|EAL-domain-containing-protein
MLIEVTNRSVLIDNFGRALVEEIDIELSERARHLCGPSVGVRAIRGGRLVISGSVAEVPHDGRRVACVGTEEWLLKLSGKSAPHSRVGWLAELRARWICGNAETLIDAGRSKAPLGAATRADFAIASAVLRAIDTDAISLEVSPVHNPSDHCDVLYFDCSMLIGSLGGFQCSLDAYSSCFARMGLVPYIECHMFSLVLDLLEHSTNLYVGVNFSGQTIADEFWSEEVINRLCGSPDLAKRLIVEVAENIDFDSENARKFLKQLKALGCRIAIDEYGLAYGCDVNTTIPEPDIVKIAPAFVAEACRDSAALGKFRRLLKLGASIAREVVVMGVKGDDEMSVVRVVSANWVQRF
>NZ_CP010016.1|WP_082256008.1|233187_233766_+|recombinase-family-protein
MNIGYARVSTDEQNIELQIDALERAGCDIILSDRGVSGAEFHRPGLDAALEKAMKGDTFVVWRLDRLGRSLGKLIDLINFLARRGVDFVSLNESINTASSGGRLVFHMMGALAEFERSLISERTRAGLAAARARGKQIGRRRQLTPDQCERARILLETHPMTEVAMRFNVHPRTIKRALGSNVNTYPSDNLK
>NZ_CP010016.1|WP_082255993.1|233842_234235_+|MAPEG-family-protein
MNFVAAFCTFALGCLVFGLGFWVSLMRKSARIAHGATADPGDFLYRLIRAHGNTTEYAPFLALLILYLGAHHPANWAIGTMIVSVLCRYILVVGFLMYPTLAKPNGLRFLGAAGTYVTGFMLCLAMVLPT
>NZ_CP010016.1|WP_158351383.1|234257_234494_-|transposase
MENAYIESFNGRLREECLNQHAFVNLDDARKRIETWRTDYNSVRPHSALGQLAPDQFRQLHQSKTGKPANLRMVYSAG
>NZ_CP010016.1|WP_045598866.1|234624_234927_-|transposase
MNRIPRAVYTKELRDEAVKLALAEGVGISEASRRLSIPIETLANWVRAAKAGKLKDVGRPQKPLTEVEAELAQVKCELAEVKMERDLLKMFATYFAKESR
>NZ_CP010016.1|WP_045598867.1|235096_236119_-|UDP-glucose-4-epimerase-GalE
MSTKGTILVTGGAGYIGSHTAVELLEHGYDVVIADNLVNSKREAIARIEQITGKTPAFHEADVSDERALARIFDAHPITAAIHFAALKAVGESVAKPVEYYRNNLDSLLSLLRVMRERDVKRIVFSSSATVYGVPERSPIDETFPLSATNPYGQTKLMAEQILRDVEAADPSWRVATLRYFNPVGAHESGLIGEDPAGIPNNLMPYVAQVAVGKLEKLRVFGSDYATPDGTGVRDYIHVVDLARGHIAALDALERRDASLTVNLGTGRGYSVLEVVRAFEKASGRPVPYELVARRPGDVAECYANPAAAAEVIGWKAERDLERMCADHWRWQENNPRGFA
>NZ_CP010016.1|WP_045598869.1|236298_238131_-|glutamine--fructose-6-phosphate-transaminase-(isomerizing)
MCGIVGAVAQRNIVPVLIEGLRRLEYRGYDSCGVAVLGAGAPAPGAPRRARSVARVADLDAQVRESHLGGVTGIAHTRWATHGAPVTHNAHPIFSSNALALVHNGIIENFEPLREGLRAKGYAFVSQTDTEVIAHLIHSLYRGNLFAAVQEAVKQLHGAYAIAVIHEDEPHTVVGARQGSPLVVGFGEQENFLASDALALAGSTDRFTFLEEGDVCELTLAGVTIVDRDGARAVREVRVVAAYGGAVELGPYRHFMQKEIFEQPRAIADTIAQADAFDPSLFGERAGSVFAGIDSLLILACGTSYYSGLTAKYWLESIAKIPTQVEIASEYRYRESVPNPRALVVVISQSGETADTLAALKHAQALGHAHTLAICNVATSAMVRQTELQFLTHAGTEIGVASTKAFTTQLVALFVLAATLGKLRGHVDAAREADYLKQLRHLPAALNSVLALEPQIIAWSEEFAHMENTLFLGRGLHYPISLEGALKLKEISYIHAEAYPAGELKHGPLALVTEAMPVVTVAPNDTLLEKLKSNMQEVRARGGELYVFADADTHIVNDEGLHVIRMPEHYGPLSPILHVVPLQLLAYHTACARGTDVDKPRNLAKSVTVE
>NZ_CP010016.1|WP_082256009.1|238722_239580_-|hypothetical-protein
MGEWLMRMCATGVIASVAYAQDVVGRTPVPAPTIALFYGESVPVGQLNGFDVVVVEPDATFDPRAYPDKKPAWFAYASVGEVNGERRYAVRMPRKWLIGANQAWAAAVIDQAAPGWPDFFVDHVIAPLWERGYRGFFLDTLDSYQLVAKTGAARVGQEAGIVRVIRKLKARYPSARLILNRGFEVLPQVHGLVDMVAFESLYRGWDPVKQQYTEVSPPDRDWLLAQARSIRTQYGLPVLAIDYCPERDEQCRKDTASRIVAAGLTPYVTDGGLMTVGYGKAVRLK
>NZ_CP010016.1|WP_045598871.1|239692_241069_-|exopolysaccharide-Pel-transporter-PelG
MAGIGFELRNILRRDSLNSVARAYVYAGLIGSGPQILSIFGILIIGQLSLASVIPANAVVQFQMSVTYLIAVSLVLTGPFQLTLTRFVSDRLFEANDNLVLWNYNGVVLVVTALAGVFATAAVLAGFGGTSAIYRGLMIAGFVVLSQIWIAVIFLSGVKQYRQILVVFFVGYGCSIGFALCLTRFGLVGLLSGFVAGQIVLLAGLTAFVYCDYHSERLVSYEVFNRRYTYPSLAMVGLLFNVGVWLDKFMFWYAPGTGSRVIGPLYASVIYDIPVFLAYVCVMPGMAAFLVRIEADFVEYYDAFYEGVRNGATLHHINGMRDMMVRCVRTGLYEIVKVQAVVLLLIAAFGERLLNVFGISPLYYPLLVIHVMSASLQVLLLGILNVFFYLDRRRNVLRLTCEFALLNGVLTAVTLKLGPDYYGYGFAIALLIVVVAAMSRLDRTFQSLEYETYMLRRG
>NZ_CP010016.1|WP_045598873.1|241068_242712_-|DUF3492-domain-containing-protein
MNAIPNRRADNADVCLLLEGTFPFVRGGVSSWVNDMIRSFPALRFAIVFIGSRAQDYTGHAYPLPDNVVDLEVHYLYGDEPADLPPQRAIDGDTHAFARSRLLHETLRKRDGKNEMRMLLAKIVPMLGADGALSEQAFLSSRQAWETIVDEYRQRCSDPSFTDYFWTVRTMHKPLWLLARIAEQAPKARVYHTVSTGYAGFLGALMHYRTGRPLLLSEHGIYTKERKIDLLQSQWIRDNRGMFERDISRVSYFQELWVRFFEALGRVAYEAAEDIIGLYEANRARQVADGAPEARTQCIPNGIDIEHFSHALAQRKPGEGHRVVALIGRVVPIKDIKTFIRMIFIALRTMPDIEGWIVGPEEEDPGYAEECRALVESLGLAENVRFLGFRRVNETLPQVDLVALTSVSEGLPLVLLEGFAAGVPAVTTDVGSCRQLIEGGDDEDRALGAAGAVVPIANPAAFAQAAVSLLTDHARWQAAQRAGLARVRSYYTKARMIERYRALYDKLAALPDQTRYGDATHCPFSHGGMRWHGRVDATRRDVTEGAR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP010016_1	1.1\|229970\|44\|NZ_CP010016\|PILER-CR	229970-230013	44	NZ_CP010016.1	230138-230181	0	1.0
NZ_CP010016_1	1.2\|230066\|49\|NZ_CP010016\|PILER-CR	230066-230114	49	NZ_CP010016.1	229869-229917	1	0.98
NZ_CP010016_1	1.2\|230066\|49\|NZ_CP010016\|PILER-CR	230066-230114	49	NZ_CP010016.1	230205-230253	1	0.98
NZ_CP010016_1	1.2\|230066\|49\|NZ_CP010016\|PILER-CR	230066-230114	49	NZ_CP010016.1	230373-230421	2	0.959

1. spacer 1.1|229970|44|NZ_CP010016|PILER-CR matches to position: 230138-230181, mismatch: 0, identity: 1.0

ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	CRISPR spacer
ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	Protospacer
********************************************

2. spacer 1.2|230066|49|NZ_CP010016|PILER-CR matches to position: 229869-229917, mismatch: 1, identity: 0.98

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagaacccagcgcatttgaagtcgcaccgct	Protospacer
********************* ***************************

3. spacer 1.2|230066|49|NZ_CP010016|PILER-CR matches to position: 230205-230253, mismatch: 1, identity: 0.98

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagaacccagcgcatttgaagtcgcaccgct	Protospacer
********************* ***************************

4. spacer 1.2|230066|49|NZ_CP010016|PILER-CR matches to position: 230373-230421, mismatch: 2, identity: 0.959

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagtacccagcgcatttgaattcgctccgct	Protospacer
************************************** **** *****

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP010016_1	1.1\|229970\|44\|NZ_CP010016\|PILER-CR	229970-230013	44	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	12460-12503	0	1.0
NZ_CP010016_1	1.1\|229970\|44\|NZ_CP010016\|PILER-CR	229970-230013	44	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	12628-12671	0	1.0
NZ_CP010016_1	1.1\|229970\|44\|NZ_CP010016\|PILER-CR	229970-230013	44	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	229970-230013	0	1.0
NZ_CP010016_1	1.1\|229970\|44\|NZ_CP010016\|PILER-CR	229970-230013	44	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	230138-230181	0	1.0
NZ_CP010016_1	1.2\|230066\|49\|NZ_CP010016\|PILER-CR	230066-230114	49	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	12527-12575	0	1.0
NZ_CP010016_1	1.2\|230066\|49\|NZ_CP010016\|PILER-CR	230066-230114	49	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	230037-230085	0	1.0
NZ_CP010016_1	1.1\|229970\|44\|NZ_CP010016\|PILER-CR	229970-230013	44	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	12796-12839	1	0.977
NZ_CP010016_1	1.1\|229970\|44\|NZ_CP010016\|PILER-CR	229970-230013	44	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	230306-230349	1	0.977
NZ_CP010016_1	1.2\|230066\|49\|NZ_CP010016\|PILER-CR	230066-230114	49	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	12359-12407	1	0.98
NZ_CP010016_1	1.2\|230066\|49\|NZ_CP010016\|PILER-CR	230066-230114	49	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	12695-12743	1	0.98
NZ_CP010016_1	1.2\|230066\|49\|NZ_CP010016\|PILER-CR	230066-230114	49	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	229869-229917	1	0.98
NZ_CP010016_1	1.2\|230066\|49\|NZ_CP010016\|PILER-CR	230066-230114	49	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	230205-230253	1	0.98
NZ_CP010016_1	1.2\|230066\|49\|NZ_CP010016\|PILER-CR	230066-230114	49	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	12863-12911	2	0.959
NZ_CP010016_1	1.2\|230066\|49\|NZ_CP010016\|PILER-CR	230066-230114	49	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	230373-230421	2	0.959
NZ_CP010016_1	1.1\|229970\|44\|NZ_CP010016\|PILER-CR	229970-230013	44	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	119717-119760	10	0.773
NZ_CP010016_1	1.1\|229970\|44\|NZ_CP010016\|PILER-CR	229970-230013	44	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	10839-10882	10	0.773

1. spacer 1.1|229970|44|NZ_CP010016|PILER-CR matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 0, identity: 1.0

ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	CRISPR spacer
ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	Protospacer
********************************************

2. spacer 1.1|229970|44|NZ_CP010016|PILER-CR matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 0, identity: 1.0

ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	CRISPR spacer
ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	Protospacer
********************************************

3. spacer 1.1|229970|44|NZ_CP010016|PILER-CR matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	CRISPR spacer
ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	Protospacer
********************************************

4. spacer 1.1|229970|44|NZ_CP010016|PILER-CR matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	CRISPR spacer
ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	Protospacer
********************************************

5. spacer 1.2|230066|49|NZ_CP010016|PILER-CR matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 0, identity: 1.0

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	Protospacer
*************************************************

6. spacer 1.2|230066|49|NZ_CP010016|PILER-CR matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	Protospacer
*************************************************

7. spacer 1.1|229970|44|NZ_CP010016|PILER-CR matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 1, identity: 0.977

ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	CRISPR spacer
ctagaacccagagcgcttgaattcgctccgctcgccactgcttg	Protospacer
*.******************************************

8. spacer 1.1|229970|44|NZ_CP010016|PILER-CR matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.977

ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	CRISPR spacer
ctagaacccagagcgcttgaattcgctccgctcgccactgcttg	Protospacer
*.******************************************

9. spacer 1.2|230066|49|NZ_CP010016|PILER-CR matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 1, identity: 0.98

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagaacccagcgcatttgaagtcgcaccgct	Protospacer
********************* ***************************

10. spacer 1.2|230066|49|NZ_CP010016|PILER-CR matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 1, identity: 0.98

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagaacccagcgcatttgaagtcgcaccgct	Protospacer
********************* ***************************

11. spacer 1.2|230066|49|NZ_CP010016|PILER-CR matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.98

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagaacccagcgcatttgaagtcgcaccgct	Protospacer
********************* ***************************

12. spacer 1.2|230066|49|NZ_CP010016|PILER-CR matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.98

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagaacccagcgcatttgaagtcgcaccgct	Protospacer
********************* ***************************

13. spacer 1.2|230066|49|NZ_CP010016|PILER-CR matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 2, identity: 0.959

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagtacccagcgcatttgaattcgctccgct	Protospacer
************************************** **** *****

14. spacer 1.2|230066|49|NZ_CP010016|PILER-CR matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.959

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagtacccagcgcatttgaattcgctccgct	Protospacer
************************************** **** *****

15. spacer 1.1|229970|44|NZ_CP010016|PILER-CR matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 10, identity: 0.773

ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	CRISPR spacer
cgaaaacccagcgcgcttgaactcgctccgctcgccaacgaggc	Protospacer
* *.******* *********.*************** .*

16. spacer 1.1|229970|44|NZ_CP010016|PILER-CR matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.773

ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	CRISPR spacer
cgaaaacccagcgcgcttgaactcgctccgctcgccaacgaggc	Protospacer
* *.******* *********.*************** .*

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

15211 : 70246

Leptospira_phage(38.46%)

transposase,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045598689.1\|15211_16318_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_082256005.1\|16759_17653_+	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	1.3e-38	56.3
WP_045598690.1\|17887_19114_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_045598692.1\|19453_19807_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	8.2e-16	40.4
WP_082256006.1\|20214_20988_-	FkbM family methyltransferase	A0A218MM68	uncultured_virus	3.1e-15	30.3
WP_127447004.1\|21606_21948_-	hypothetical protein	NA	NA	NA	NA
WP_045598892.1\|22145_22619_+\|transposase	transposase	NA	NA	NA	NA
WP_045598698.1\|22594_22945_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.1e-17	39.4
WP_045598699.1\|22976_24542_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	9.8e-69	34.0
WP_045598980.1\|24670_24946_-	hypothetical protein	NA	NA	NA	NA
WP_045598702.1\|25157_25595_-	hypothetical protein	NA	NA	NA	NA
WP_009893756.1\|25617_25977_-	hypothetical protein	NA	NA	NA	NA
WP_045598703.1\|26035_29530_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_045598705.1\|31337_32699_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_009900994.1\|32695_33289_-	hypothetical protein	NA	NA	NA	NA
WP_009893761.1\|33294_33684_-	DUF4150 domain-containing protein	NA	NA	NA	NA
WP_045598706.1\|33723_34440_-	DUF3540 domain-containing protein	NA	NA	NA	NA
WP_009900995.1\|34442_35513_-	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_045598707.1\|42434_45278_-	type VI secretion system ATPase TssH	A0A2I7SAX5	Vibrio_phage	2.5e-78	28.8
WP_009893772.1\|45280_46270_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_045598709.1\|46266_48129_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_009901012.1\|48142_48574_-	GPW/gp25 family protein	NA	NA	NA	NA
WP_045598712.1\|48652_49180_-	type VI secretion protein	NA	NA	NA	NA
WP_009901014.1\|49323_50829_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_009901015.1\|50831_51383_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_045598715.1\|51416_52352_-	hypothetical protein	NA	NA	NA	NA
WP_045598716.1\|52812_54039_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_102889827.1\|54792_56027_-\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	9.1e-102	65.5
WP_082265638.1\|56425_56860_+\|transposase	transposase	B6DZU5	Stx2-converting_phage	2.1e-13	36.4
WP_045598721.1\|56856_57204_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	5.9e-35	62.6
WP_045598724.1\|57604_58072_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_045598725.1\|58071_58425_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.3e-16	38.5
WP_045598726.1\|58524_60147_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	2.1e-66	33.7
WP_045598729.1\|60156_60417_-	hypothetical protein	NA	NA	NA	NA
WP_045598730.1\|61806_62403_+	plasmid pRiA4b ORF-3 family protein	A0A2H4PDG5	Mycobacterium_phage	1.2e-22	34.5
WP_045598987.1\|62429_63047_-\|transposase	IS3 family transposase	A0A1B3AZE5	Gordonia_phage	3.9e-05	27.5
WP_045598732.1\|63043_63352_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_127447005.1\|65924_66611_+	hypothetical protein	NA	NA	NA	NA
WP_009910381.1\|66685_66904_-	hypothetical protein	NA	NA	NA	NA
WP_009905942.1\|68395_70246_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA

DBSCAN-SWA_2

191336 : 309400

112

Leptospira_phage(20.0%)

transposase,integrase,tRNA

attL 257345:257360|attR 301833:301848

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_102889803.1\|191336_192471_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.0e-11	26.5
WP_045598827.1\|193217_194750_-	cellulase family glycosylhydrolase	NA	NA	NA	NA
WP_127447007.1\|194742_194958_-	hypothetical protein	NA	NA	NA	NA
WP_004191840.1\|195320_195866_-	PAS domain-containing protein	NA	NA	NA	NA
WP_009891596.1\|196120_196825_+	CoA transferase subunit A	NA	NA	NA	NA
WP_009891594.1\|196826_197468_+	CoA transferase subunit B	NA	NA	NA	NA
WP_009891589.1\|197864_198587_-	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	7.1e-06	31.6
WP_045598830.1\|198634_199735_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_009891586.1\|199748_200309_-	ester cyclase	NA	NA	NA	NA
WP_045598831.1\|200495_201401_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_045598833.1\|201454_201886_-	DUF1641 domain-containing protein	NA	NA	NA	NA
WP_009905763.1\|201917_203108_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_019255973.1\|204608_204962_+	RidA family protein	NA	NA	NA	NA
WP_009905759.1\|205007_207251_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	NA	NA	NA	NA
WP_009905758.1\|207703_209611_+\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	2.2e-123	37.5
WP_071810680.1\|209660_210185_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	4.1e-11	28.7
WP_004191477.1\|210378_210576_+	50S ribosomal protein L35	NA	NA	NA	NA
WP_004192938.1\|210606_210966_+	50S ribosomal protein L20	NA	NA	NA	NA
WP_019255972.1\|211114_212128_+\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2K9L3A8	Tupanvirus	1.3e-29	36.2
WP_045598836.1\|212215_214648_+\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_009891557.1\|214720_215125_+	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	1.1e-11	38.9
WP_009905754.1\|215183_215588_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_045598840.1\|215722_217876_-	hypothetical protein	NA	NA	NA	NA
WP_009905747.1\|218452_219220_-	FkbM family methyltransferase	A0A291AUV0	Sinorhizobium_phage	3.9e-10	26.2
WP_045598844.1\|219911_221111_-	DUF3443 domain-containing protein	NA	NA	NA	NA
WP_045598846.1\|221121_221610_-	DUF2844 domain-containing protein	NA	NA	NA	NA
WP_025405302.1\|221700_222921_-\|transposase	ISL3 family transposase	A9YX10	Burkholderia_phage	4.4e-226	92.6
WP_009905744.1\|223235_224441_+	outer membrane protein assembly factor BamC	NA	NA	NA	NA
WP_045598850.1\|225745_225931_-	hypothetical protein	NA	NA	NA	NA
WP_082255990.1\|226103_226871_-	DUF937 domain-containing protein	NA	NA	NA	NA
WP_045598851.1\|227152_227476_-	H-NS histone family protein	NA	NA	NA	NA
WP_102889859.1\|227828_228500_-	OmpA family protein	NA	NA	NA	NA
WP_082255991.1\|228666_231072_-	hypothetical protein	NA	NA	NA	NA
WP_158351381.1\|231570_232629_-	EAL domain-containing protein	NA	NA	NA	NA
WP_082256008.1\|233187_233766_+	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	1.6e-40	53.4
WP_082255993.1\|233842_234235_+	MAPEG family protein	NA	NA	NA	NA
WP_158351383.1\|234257_234494_-\|transposase	transposase	S5WIU1	Leptospira_phage	4.8e-12	53.6
WP_045598866.1\|234624_234927_-\|transposase	transposase	NA	NA	NA	NA
WP_045598867.1\|235096_236119_-	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	1.9e-84	47.5
WP_045598869.1\|236298_238131_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	1.3e-141	47.2
WP_082256009.1\|238722_239580_-	hypothetical protein	NA	NA	NA	NA
WP_045598871.1\|239692_241069_-	exopolysaccharide Pel transporter PelG	NA	NA	NA	NA
WP_045598873.1\|241068_242712_-	DUF3492 domain-containing protein	NA	NA	NA	NA
WP_045598875.1\|242708_243722_-	hypothetical protein	NA	NA	NA	NA
WP_045598877.1\|243714_245115_-	membrane protein	NA	NA	NA	NA
WP_052712455.1\|245150_245702_-	hypothetical protein	NA	NA	NA	NA
WP_082256010.1\|245739_249606_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_127447000.1\|249676_252424_-	sugar ABC transporter	NA	NA	NA	NA
WP_158351385.1\|253184_253346_-	hypothetical protein	NA	NA	NA	NA
WP_045598690.1\|254045_255272_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_082256011.1\|255459_257013_+	S8 family peptidase	A0A2K9L199	Tupanvirus	2.8e-15	34.2
WP_045598690.1\|257086_258313_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
257345:257360	attL	NA	NA	NA	NA
WP_127447001.1\|258802_259057_+	hypothetical protein	NA	NA	NA	NA
WP_045598883.1\|259128_259455_-	HigA family addiction module antidote protein	I6ZVM3	Aeromonas_phage	9.0e-09	39.4
WP_045598886.1\|259464_259743_-	hypothetical protein	A0A2L1IV28	Escherichia_phage	1.9e-20	47.8
WP_060970101.1\|259814_260060_-	hypothetical protein	NA	NA	NA	NA
WP_082255996.1\|260303_260519_-	hypothetical protein	NA	NA	NA	NA
WP_045598888.1\|260515_261289_-	ATP-binding protein	U5N3V8	Enterobacteria_phage	1.4e-36	37.7
WP_045598890.1\|261275_262775_-\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	6.0e-31	32.8
WP_158351387.1\|263396_263768_+\|transposase	transposase	NA	NA	NA	NA
WP_052712457.1\|264911_266138_+	replication initiation protein	NA	NA	NA	NA
WP_045598892.1\|267293_267767_+\|transposase	transposase	NA	NA	NA	NA
WP_045598698.1\|267742_268093_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.1e-17	39.4
WP_045598699.1\|268124_269690_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	9.8e-69	34.0
WP_082255997.1\|269782_270055_+	hypothetical protein	NA	NA	NA	NA
WP_102889787.1\|270454_271265_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_045598894.1\|271313_272345_-	ParB/RepB/Spo0J family partition protein	NA	NA	NA	NA
WP_045598899.1\|272341_273001_-	AAA family ATPase	A2I303	Vibrio_virus	4.8e-17	32.9
WP_127447002.1\|273868_274096_-	hypothetical protein	NA	NA	NA	NA
WP_045598732.1\|274092_274401_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_102889860.1\|274488_275293_+\|transposase	IS5 family transposase	A0A0M5M147	Mycobacterium_phage	1.3e-21	32.4
WP_052712458.1\|275371_276886_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_045598690.1\|278229_279456_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_082255998.1\|279461_279677_-\|transposase	transposase	NA	NA	NA	NA
WP_045599009.1\|280117_280591_+\|transposase	transposase	NA	NA	NA	NA
WP_045598698.1\|280566_280917_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.1e-17	39.4
WP_155722043.1\|280948_281119_+	hypothetical protein	NA	NA	NA	NA
WP_060970100.1\|281189_281438_-	hypothetical protein	NA	NA	NA	NA
WP_045598909.1\|281772_282276_-	peptidoglycan-associated lipoprotein Pal	NA	NA	NA	NA
WP_045598911.1\|282399_284097_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_045598915.1\|284281_285967_-	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	4.8e-37	29.0
WP_045598918.1\|285993_286416_-	organomercurial transporter MerC	NA	NA	NA	NA
WP_045598921.1\|286433_286709_-	mercury resistance system periplasmic binding protein MerP	NA	NA	NA	NA
WP_045598923.1\|286723_287074_-	mercuric ion transporter MerT	NA	NA	NA	NA
WP_045598924.1\|287142_287550_+	Hg(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_082255999.1\|288744_289029_+	hypothetical protein	NA	NA	NA	NA
WP_045599010.1\|289132_289606_-	DoxX family protein	NA	NA	NA	NA
WP_102889797.1\|289702_290459_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_045598928.1\|290437_291232_-	DUF2063 domain-containing protein	NA	NA	NA	NA
WP_045598929.1\|291215_292109_-	DUF692 domain-containing protein	NA	NA	NA	NA
WP_045598930.1\|292124_292445_-	DUF2282 domain-containing protein	NA	NA	NA	NA
WP_052712460.1\|292557_293214_-	DUF1109 domain-containing protein	NA	NA	NA	NA
WP_045598931.1\|293215_293785_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_045599015.1\|294174_294630_+	hypothetical protein	NA	NA	NA	NA
WP_045598932.1\|294733_295450_+	TVP38/TMEM64 family protein	NA	NA	NA	NA
WP_045598933.1\|295547_296210_+	hypothetical protein	NA	NA	NA	NA
WP_045598935.1\|296271_296853_-	alkylhydroperoxidase	NA	NA	NA	NA
WP_082256013.1\|296943_297516_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_045599019.1\|297613_298306_-	haloacid dehalogenase type II	NA	NA	NA	NA
WP_045598936.1\|298573_298825_+	DUF2282 domain-containing protein	NA	NA	NA	NA
WP_045598937.1\|298832_299735_+	DUF692 domain-containing protein	NA	NA	NA	NA
WP_045598939.1\|299718_300495_+	hypothetical protein	NA	NA	NA	NA
WP_045598941.1\|300520_300988_+	DoxX family protein	NA	NA	NA	NA
WP_082256000.1\|300989_303203_+	FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	2.2e-37	26.9
301833:301848	attR	NA	NA	NA	NA
WP_045598942.1\|303250_303481_+	zf-HC2 domain-containing protein	NA	NA	NA	NA
WP_127447003.1\|303556_303916_+	hypothetical protein	NA	NA	NA	NA
WP_045598944.1\|303916_305008_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_045598945.1\|305004_305661_-	glycosyltransferase	NA	NA	NA	NA
WP_082256001.1\|305669_306461_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_045598946.1\|306478_307360_-	S-methyl-5'-thioadenosine phosphorylase	NA	NA	NA	NA
WP_082256002.1\|307356_308067_-	hypothetical protein	NA	NA	NA	NA
WP_102889801.1\|308583_309400_+\|transposase	IS5 family transposase	A0A0M5M147	Mycobacterium_phage	2.3e-21	32.4

Anti-CRISPR protein detection

Acr_ID: NZ_CP010016.1|WP_127447001.1|258802_259057_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: NZ_CP010016.1|WP_158351385.1|253184_253346_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP010016.1|WP_127447001.1|258802_259057_+|hypothetical-protein

258802_259057_+

84 aa aa

191336-309400

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP010016_1	Orphan	1.1\|229970\|44\|NZ_CP010016\|PILER-CR	229970-230013	44	230138-230181	0
NZ_CP010016_1	Orphan	1.2\|230066\|49\|NZ_CP010016\|PILER-CR	230066-230114	49	229869-229917	1
NZ_CP010016_1	Orphan	1.2\|230066\|49\|NZ_CP010016\|PILER-CR	230066-230114	49	230205-230253	1
NZ_CP010016_1	Orphan	1.2\|230066\|49\|NZ_CP010016\|PILER-CR	230066-230114	49	230373-230421	2
NZ_CP010017_1	Orphan	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	197762-197741	0
NZ_CP010017_1	Orphan	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	197769-197748	0
NZ_CP010017_1	Orphan	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	197776-197755	0
NZ_CP010017_1	Orphan	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	197783-197762	0
NZ_CP010017_1	Orphan	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	197790-197769	0
NZ_CP010017_1	Orphan	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	197797-197776	0
NZ_CP010017_1	Orphan	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	197804-197783	0
NZ_CP010017_1	Orphan	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	197811-197790	0
NZ_CP010017_1	Orphan	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	197818-197797	0

1. spacer 1.1|229970|44|NZ_CP010016|PILER-CR matches to NZ_CP010016 position: 230138-230181, mismatch: 0

ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	CRISPR spacer
ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	Protospacer
********************************************

2. spacer 1.2|230066|49|NZ_CP010016|PILER-CR matches to NZ_CP010016 position: 229869-229917, mismatch: 1

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagaacccagcgcatttgaagtcgcaccgct	Protospacer
********************* ***************************

3. spacer 1.2|230066|49|NZ_CP010016|PILER-CR matches to NZ_CP010016 position: 230205-230253, mismatch: 1

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagaacccagcgcatttgaagtcgcaccgct	Protospacer
********************* ***************************

4. spacer 1.2|230066|49|NZ_CP010016|PILER-CR matches to NZ_CP010016 position: 230373-230421, mismatch: 2

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagtacccagcgcatttgaattcgctccgct	Protospacer
************************************** **** *****

5. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to NZ_CP010016 position: 197762-197741, mismatch: 0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

6. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to NZ_CP010016 position: 197769-197748, mismatch: 0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

7. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to NZ_CP010016 position: 197776-197755, mismatch: 0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

8. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to NZ_CP010016 position: 197783-197762, mismatch: 0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

9. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to NZ_CP010016 position: 197790-197769, mismatch: 0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

10. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to NZ_CP010016 position: 197797-197776, mismatch: 0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

11. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to NZ_CP010016 position: 197804-197783, mismatch: 0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

12. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to NZ_CP010016 position: 197811-197790, mismatch: 0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

13. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to NZ_CP010016 position: 197818-197797, mismatch: 0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

NZ_CP010016.1|WP_158351385.1|253184_253346_-|hypothetical-protein

253184_253346_-

53 aa aa

191336-309400

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP010016_1	Orphan	1.1\|229970\|44\|NZ_CP010016\|PILER-CR	229970-230013	44	230138-230181	0
NZ_CP010016_1	Orphan	1.2\|230066\|49\|NZ_CP010016\|PILER-CR	230066-230114	49	229869-229917	1
NZ_CP010016_1	Orphan	1.2\|230066\|49\|NZ_CP010016\|PILER-CR	230066-230114	49	230205-230253	1
NZ_CP010016_1	Orphan	1.2\|230066\|49\|NZ_CP010016\|PILER-CR	230066-230114	49	230373-230421	2
NZ_CP010017_1	Orphan	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	197762-197741	0
NZ_CP010017_1	Orphan	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	197769-197748	0
NZ_CP010017_1	Orphan	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	197776-197755	0
NZ_CP010017_1	Orphan	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	197783-197762	0
NZ_CP010017_1	Orphan	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	197790-197769	0
NZ_CP010017_1	Orphan	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	197797-197776	0
NZ_CP010017_1	Orphan	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	197804-197783	0
NZ_CP010017_1	Orphan	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	197811-197790	0
NZ_CP010017_1	Orphan	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	197818-197797	0

1. spacer 1.1|229970|44|NZ_CP010016|PILER-CR matches to NZ_CP010016 position: 230138-230181, mismatch: 0

ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	CRISPR spacer
ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	Protospacer
********************************************

2. spacer 1.2|230066|49|NZ_CP010016|PILER-CR matches to NZ_CP010016 position: 229869-229917, mismatch: 1

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagaacccagcgcatttgaagtcgcaccgct	Protospacer
********************* ***************************

3. spacer 1.2|230066|49|NZ_CP010016|PILER-CR matches to NZ_CP010016 position: 230205-230253, mismatch: 1

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagaacccagcgcatttgaagtcgcaccgct	Protospacer
********************* ***************************

4. spacer 1.2|230066|49|NZ_CP010016|PILER-CR matches to NZ_CP010016 position: 230373-230421, mismatch: 2

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagtacccagcgcatttgaattcgctccgct	Protospacer
************************************** **** *****

5. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to NZ_CP010016 position: 197762-197741, mismatch: 0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

6. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to NZ_CP010016 position: 197769-197748, mismatch: 0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

7. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to NZ_CP010016 position: 197776-197755, mismatch: 0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

8. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to NZ_CP010016 position: 197783-197762, mismatch: 0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

9. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to NZ_CP010016 position: 197790-197769, mismatch: 0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

10. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to NZ_CP010016 position: 197797-197776, mismatch: 0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

11. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to NZ_CP010016 position: 197804-197783, mismatch: 0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

12. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to NZ_CP010016 position: 197811-197790, mismatch: 0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

13. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to NZ_CP010016 position: 197818-197797, mismatch: 0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

3. NZ_CP010017

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP010017_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP010017_1

789561-789729

Orphan

Consensus_repeat	Method
CGCGGTTCGCGGTTCGCGGTTCGCGGTTCGCGGT	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP010017_1

>merge|NZ_CP010017|1|789561-789729|CRISPRCasFinder
GCCGTTTGGCGTTTGGCGTTTGGCGTTTGGCGTTTGGCATGTTGGGAGCATCGTCGGCATCGGGCGGCTGGCATTTGATCGCCGCGTGCCCTTTGCGGTACGCAGCACGCGGTTCGCGGTTCGCGGTTCGCGGTTCGCGGTTCGCGGTTCGCGGTTCGCGGTTCGCGGT

>NZ_CP010017|1|1|789561-789729|CRISPRCasFinder
GCCGTTTGGCGTTTGGCGTTTGGCGTTTGGCGTT	TGGCATGTTGGGAGCATCGTCGGCATCGGGCGGCTGGCATTTGAT
CGCCGCGTGCCCTTTGCGGTACGCAGCACGCGGT	TCGCGGTTCGCGGTTCGCGGTT
CGCGGTTCGCGGTTCGCGGTTCGCGGTTCGCGGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP010017.1\|WP_009903745.1\|798332_798890_+\|FUSC-family-protein	unknown	unknown	gnl\|CDD\|226614
NZ_CP010017.1\|WP_155722033.1\|788574_789030_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010017.1\|WP_009903769.1\|784532_785921_+\|purine-permease	unknown	unknown	gnl\|CDD\|274468
NZ_CP010017.1\|WP_045599353.1\|782852_784319_+\|ribonuclease-G	unknown	unknown	gnl\|CDD\|183285
NZ_CP010017.1\|WP_045599359.1\|790019_790337_+\|cold-shock-protein	unknown	unknown	gnl\|CDD\|377438
NZ_CP010017.1\|WP_009903813.1\|780400_781153_+\|nicotinate-nucleotide-adenylyltransferase	unknown	unknown	gnl\|CDD\|180781
NZ_CP010017.1\|WP_045600755.1\|789201_789495_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010017.1\|WP_009892289.1\|781680_782151_+\|23S-rRNA-(pseudouridine(1915)-N(3))-methyltransferase-RlmH	unknown	unknown	gnl\|CDD\|234634
NZ_CP010017.1\|WP_009903746.1\|796810_798073_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340883
NZ_CP010017.1\|WP_045599362.1\|800984_802160_-\|putative-lipopolysaccharide-heptosyltransferase-III	unknown	unknown	gnl\|CDD\|223928
NZ_CP010017.1\|WP_009903765.1\|790428_790893_+\|lipocalin-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|372819
NZ_CP010017.1\|WP_045599360.1\|793446_794340_+\|RNA-polymerase-sigma-70-factor	unknown	unknown	gnl\|CDD\|132002
NZ_CP010017.1\|WP_009892315.1\|799130_799514_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227742
NZ_CP010017.1\|WP_045599355.1\|787554_788268_-\|phospholipase-C-accessory-protein-PlcR	unknown	unknown	gnl\|CDD\|132439
NZ_CP010017.1\|WP_009903812.1\|781157_781622_+\|ribosome-silencing-factor	unknown	unknown	gnl\|CDD\|272901
NZ_CP010017.1\|WP_045600753.1\|786106_787483_-\|pectin-acetylesterase	unknown	unknown	gnl\|CDD\|367434
NZ_CP010017.1\|WP_025405189.1\|795824_796814_+\|photosystem-reaction-center-subunit-H	unknown	unknown	gnl\|CDD\|236090
NZ_CP010017.1\|WP_009903809.1\|782203_782836_+\|septum-formation-inhibitor-Maf	unknown	unknown	gnl\|CDD\|179341
NZ_CP010017.1\|WP_009903749.1\|794807_795260_+\|carboxymuconolactone-decarboxylase-family-protein	unknown	unknown	gnl\|CDD\|225039
NZ_CP010017.1\|WP_009892318.1\|799947_800712_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133005

Protein	Function_ID	Function_description	E-value
NZ_CP010017.1\|WP_009903745.1\|798332_798890_+\|FUSC-family-protein	gnl\|CDD\|226614	COG4129, COG4129, Predicted membrane protein [Function unknown].	1.01203e-10
NZ_CP010017.1\|WP_009892289.1\|781680_782151_+\|23S-rRNA-(pseudouridine(1915)-N(3))-methyltransferase-RlmH	gnl\|CDD\|234634	PRK00103, PRK00103, rRNA large subunit methyltransferase; Provisional.	1.82029e-89
NZ_CP010017.1\|WP_009903769.1\|784532_785921_+\|purine-permease	gnl\|CDD\|274468	TIGR03173, pbuX, xanthine permease. All the seed members of this model are observed adjacent to genes for either xanthine phosphoribosyltransferase (for the conversion of xanthine to guanine, GenProp0696) or genes for the conversion of xanthine to urate and its concomitant catabolism (GenProp0640, GenProp0688, GenProp0686 and GenProp0687). A number of sequences scoring higher than trusted to this model are found in different genomic contexts, and the possibility exist that these transport related compounds in addition to or instead of xanthine itself. The outgroup to this family are sequences which are characterized as uracil permeases or are adjacent to established uracil phosphoribosyltransferases.	2.08627e-132
NZ_CP010017.1\|WP_009903809.1\|782203_782836_+\|septum-formation-inhibitor-Maf	gnl\|CDD\|179341	PRK01839, PRK01839, septum formation inhibitor Maf.	3.32481e-117
NZ_CP010017.1\|WP_009903813.1\|780400_781153_+\|nicotinate-nucleotide-adenylyltransferase	gnl\|CDD\|180781	PRK06973, PRK06973, nicotinate-nucleotide adenylyltransferase.	4.91775e-135
NZ_CP010017.1\|WP_045599360.1\|793446_794340_+\|RNA-polymerase-sigma-70-factor	gnl\|CDD\|132002	TIGR02957, putative_sigma_factor, RNA polymerase sigma-70 factor, TIGR02957 family. This group of sigma factors are members of the sigma-70 family (TIGR02937). They and appear by homology, tree building and bidirectional best hits, to represent a conserved family. This family is found in a limited number of bacterial lineages. This family includes apparent paralogous expansion in Streptomyces coelicolor A3(2), and multiple copies in Mycobacterium smegmatis MC2, Streptomyces avermitilis MA-4680 and Nocardia farcinica IFM10152.	6.29612e-109
NZ_CP010017.1\|WP_009903746.1\|796810_798073_+\|MFS-transporter	gnl\|CDD\|340883	cd17325, MFS_MdtG_SLC18_like, bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters. This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	5.14927e-27
NZ_CP010017.1\|WP_045599362.1\|800984_802160_-\|putative-lipopolysaccharide-heptosyltransferase-III	gnl\|CDD\|223928	COG0859, RfaF, ADP-heptose:LPS heptosyltransferase [Cell envelope biogenesis, outer membrane].	1.72477e-58
NZ_CP010017.1\|WP_009903765.1\|790428_790893_+\|lipocalin-like-domain-containing-protein	gnl\|CDD\|372819	pfam13924, Lipocalin_5, Lipocalin-like domain. This family includes domains distantly related to lipocalins. However, they do contain the important GXW motif in the first strand. The protein in this family include aln5, which is involved in biosynthesis of alnumycin. The family also includes the ZFK protein from Trypanosoma brucei which is a protein kinase. This domain is at the C-terminus of that protein. The domain is also found as the C-terminal domain in StiJ a protein involved in producing stigmatellin. This domain has been assumed to catalyze a final cyclisation reaction.	7.80531e-45
NZ_CP010017.1\|WP_009892315.1\|799130_799514_-\|hypothetical-protein	gnl\|CDD\|227742	COG5455, COG5455, Predicted integral membrane protein [Function unknown].	6.46057e-22
NZ_CP010017.1\|WP_045599355.1\|787554_788268_-\|phospholipase-C-accessory-protein-PlcR	gnl\|CDD\|132439	TIGR03398, plc_access_R, phospholipase C accessory protein PlcR. The class of microbial phosphocholine-preferring phospholipase C enzymes described by model TIGR03396 has two members in Pseudomonas aeruginosa, one of which (PlcH) is hemolytic and can hydrolyzes sphingomyelin as well as phosphatidylcholine. This model describes PlcR, an accessory protein for PlcH with which it forms a heterodimer. The member of the family from P. aeruginosa, although not the members from various Burkholderia species, is encoded immediately downstream of phospholipase C.	2.80324e-46
NZ_CP010017.1\|WP_009903812.1\|781157_781622_+\|ribosome-silencing-factor	gnl\|CDD\|272901	TIGR00090, rsfS_iojap_ybeB, ribosome silencing factor RsfS/YbeB/iojap. This model describes a widely distributed family of bacterial proteins related to iojap from plants. It includes RsfS(YbeB) from E. coli. The gene iojap is a pattern-striping gene in maize, reflecting a chloroplast development defect in some cells. The conserved function of this protein is to silence ribosomes by binding the ribosomal large subunit and impairing joining with the small subunit in response to nutrient stress. Note that RsfS (starvation) is an author-endorsed change from the published symbol RsfA, which conflicted with previously published gene symbols. [Protein synthesis, Translation factors].	3.90562e-45
NZ_CP010017.1\|WP_045600753.1\|786106_787483_-\|pectin-acetylesterase	gnl\|CDD\|367434	pfam03283, PAE, Pectinacetylesterase.	4.58544e-05
NZ_CP010017.1\|WP_045599353.1\|782852_784319_+\|ribonuclease-G	gnl\|CDD\|183285	PRK11712, PRK11712, ribonuclease G; Provisional.	0
NZ_CP010017.1\|WP_025405189.1\|795824_796814_+\|photosystem-reaction-center-subunit-H	gnl\|CDD\|236090	PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated.	0.000106169
NZ_CP010017.1\|WP_045599359.1\|790019_790337_+\|cold-shock-protein	gnl\|CDD\|377438	pfam04993, TfoX_N, TfoX N-terminal domain. TfoX may play a key role in the development of genetic competence by regulating the expression of late competence-specific genes. This family corresponds to the N-terminal presumed domain of TfoX. The domain is found as an isolated domain in some proteins suggesting this is an autonomous domain.	2.88059e-06
NZ_CP010017.1\|WP_009903749.1\|794807_795260_+\|carboxymuconolactone-decarboxylase-family-protein	gnl\|CDD\|225039	COG2128, COG2128, Uncharacterized conserved protein [Function unknown].	1.90773e-33
NZ_CP010017.1\|WP_009892318.1\|799947_800712_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133005	cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.	3.21587e-88

>NZ_CP010017.1|WP_045600755.1|789201_789495_+|hypothetical-protein
MSEPPLPSRQVDYEGFEIHVSPTPTQTDANRYTYAGYVCHPGADPALPGHTVPFHADGEERFRSADEAFHEAVSIGRSIVDGTHPDLSVLSLVTHGY
>NZ_CP010017.1|WP_155722033.1|788574_789030_-|hypothetical-protein
MDRDRRRRHGRAAGRARRLPFDHRAAGWPPASRPPVTRRPAAAASRGHVACCAADSFAAGDAMRPEFSRSVAWGDLSPPDDDGRIGGDDGVPLEAERIEHRIELGGPRDGTRDRRRATGGVQPAPMARFGSSGAAPGGASGGGRSIGRIVT
>NZ_CP010017.1|WP_045599355.1|787554_788268_-|phospholipase-C-accessory-protein-PlcR
MKKSKALWRIALLLAMIGVAVAGWRYVSPSQTAVARPVRSDAVSDARGGALADAADETRADAGPSERRLDLAALRKSLAGRDDAQVQLQRIVAFARFRDRIAAYGEGRNSMPAAERARLARQILAELPEHVARNEIVPVQAEALSAALLADATADSDTRGAAIQSMRQQWDAYARQTVGPSPASDPRYLAYARQSRDIVRQVQASGTDADQQQAVIAQRLQALRVQLFDQTSRSDTR
>NZ_CP010017.1|WP_045600753.1|786106_787483_-|pectin-acetylesterase
MSVRECLECLCVAGLLSVAAVDADAAAAATQDPSIPYYSWYEVTLPESSGASCGNGTPMRFYINRAQSDNLLYMMEPGGACWDHGTCTETATGAEAGLGAFNPDGIPHNYVNGTVQQSLKSSFLSPLMTRMDLAHILVGEPKVETQEWTQVFVPYCTGDIHMGSAVRSYVSPSGDWRIQHYSGLKNVRVIAQWLVDHGFGKPSRLLVYGTSAGGYGTLGNYATLRATLQPQRHSSLLDDAGTVFNTRFGADPAAYPSVGLYDKVRDEWGMTAPDGMITINSQLTRNFDPGNMGSAYAALSATYPHDRFGYTTYRRDRIIAAYHYRPFVPAVIAAPDDATKDALSLAMFDRELSDLKQMLNPLPNFGYFIPWARDDFMGNHQVTAISFTGSGIHENGIDADVGTFVADLLNQQDPADAPVMKAYRTEQWSDFTFSTFLAWIDSIFNLTGEAGPVSGHRS
>NZ_CP010017.1|WP_009903769.1|784532_785921_+|purine-permease
MQPAPLAPPASHGADHAESAHDLVYGPDDRPAPTVAFVAALQHLLAILVPIVTPGLLICQALGVASRDTTLIVSMSLVISGIATFVQCKRFGPLGAGLLIVQGTSFNFVGPLIAGGSLMVKQGTPVETVMAAIFGVVIAGSFVEMAVSRILPFVKRLITPLVTGIVVLLIGLTLIKVGLVSMGGGYGAIAKGNFGSAENLTLSGLVLGTIIVLNRVPVVWVRSTALVIALAIGYLAAAAMGRLDFTGAREAALFQIPTPLHFGLGFSWSLFVPMLIIYLVTSLEAIGDVTATSKISRQPVEGPLWMRRIKGGVLVNGANSLLAGVFNTFPSSVFAQNNGVIQLTGIASRHVGIWIAGMLVLLGLFPVVAGVLQAVPEPVLGGAAMVMFGAVAASGINILAGIRLDRRALLIIAVSLALGLGVSQVPEILANLPHALKNVLESGVATGGICALVMNWFLPEKK
>NZ_CP010017.1|WP_045599353.1|782852_784319_+|ribonuclease-G
MNEEILINITPQETRVALVQQGAVQELHVERTLSRGRVGNIYLGKVVRVLPGMQSAFIDIGLERAAFLHVADIWQPRAGDAPATAAHQPIEKIVFEGQTLMVQVIKDPIGTKGARLSTQISIAGRTLVYLPQEPHIGISQKIESEAEREAVRARLTAVIPADEKGGYIVRTIAEDATSDELAADVAYLRKTWATIVAQGQRVPPTSLLYQDLDLAQRVLRDFANDDTTRIQVDSRETHQRLVDFAAEFTPAVSPKLHHYTGERPLFDLYNIEAEIQRALSRRVDLKSGGYLMIDQTEAMTTIDVNTGGYVGARNFDDTIFKTNLEAAHTIARQLRLRNLGGIIIIDFIDMENAEHRDAVLAELKKALSRDRTRVTVNTFSQLGLVEMTRKRTRESLAHVLCEPCPTCQGKGQVKTSRTVCYDILREILRESRQFNPREFRVIASQQVIDLFLDEESQHLAMLIDFIGKPVSLQVESNLSQEQYDIVLM
>NZ_CP010017.1|WP_009903809.1|782203_782836_+|septum-formation-inhibitor-Maf
MPDRAAAPSYPFVYLASQSPRRRELLDQLGVRYALLAPTPDEDAEALEAELPGEAPDHYVLRVCVAKAEAARARLVASGKPAAPVLVADTTVTLDGAILGKPADAADALAMLARLAGRTHDVLTALAVIDATGELMPPALSRSAVRFAPATRDALARYVETGEPFGKAGAYAIQGRAAEFVERIDGSHSGIMGLPLFEAAALLRAAHVAF
>NZ_CP010017.1|WP_009892289.1|781680_782151_+|23S-rRNA-(pseudouridine(1915)-N(3))-methyltransferase-RlmH
MKLHIVAVGHKMPGWIATGFDEYAKRMPPELRIELREVKPELRSGSRTADSVMAAERQRIEAALPKNARVVALDERGRDWTTMQLAQALPAWQQDGRDVAFVIGGADGLDPQLKSRAELLLRVSSLTLPHGMVRVLLAEQLYRAWSITQNHPYHRA
>NZ_CP010017.1|WP_009903812.1|781157_781622_+|ribosome-silencing-factor
MDIRKLQRVIVDALEDVKAQDIKVFNTSHLTELFDRVIVASGTSNRQTKALASNVRDKVKEAGGDVVSSEGEDTGEWVLVDCGDAVVHILQPALRQYYNLEEIWGDKPVRMKLGGPAANARGARAAEGADDDEPDEDEAPAARPARKTTAARRR
>NZ_CP010017.1|WP_009903813.1|780400_781153_+|nicotinate-nucleotide-adenylyltransferase
MSRSATGRAAAPQGFAPNAEPAGLPALPRRIGILGGTFDPIHDGHLALARRFADVLRLTELVLMPAGQPYQKQAVSAAEHRLAMTRAAAGSLVLPGVAVSVATDEIEHAGPTYTVETLARWRERLGADASLSLLIGADQLVRLDTWRDWRRLFDFAHVCAATRPGFDFAAASPAVAAEIASRQASADVLRATPAGRLLIDTTLALDVAATDIRAHLRACIARHAQVPDASAEHVPAAVWAYILQHRLYHP
>NZ_CP010017.1|WP_045599359.1|790019_790337_+|cold-shock-protein
MARDPGLEDELKYEHNVVAKAMFGGRAWLLGGHLLCCARGDGLLVRLGKDNDGWALQRPGIVRMTSRGRPMQGWVRAAPAAYGNDALRRSLIAAALEFVRSLPPQ
>NZ_CP010017.1|WP_009903765.1|790428_790893_+|lipocalin-like-domain-containing-protein
MNEARNLRQRLLGAWTLESYVEIDAETGVRDAPFGDAPLGFIVYTADGYMSAQLQARTRAPFSGDDPYRGTPAEYARAGRTYLAYAGRFFVDEATCALSHEMAVSLFPNWLGRIQTRIVELTGDALHLGTPTPLRLNGALKHARLVWRRAAPNG
>NZ_CP010017.1|WP_045599360.1|793446_794340_+|RNA-polymerase-sigma-70-factor
MTETSRPTPSDEPFAALRPRLFSIAYRMLGMRADAEDVLQDAWLRWHQADRDALDSPEAWLVTVVTRLSIDRLRAAKAQRDAYVGWWLPEPLVDVDERTPETAAEFADDLSVALLWVLERLSPEERAAFLLRQAFERDYAEIAQLLDKSEAACRQLVHRASTRVQQEHRRFDVSRDRHRQLVERFAQASASGERSAIQALLADDVELVGDGGGKVPSFFKVLRGALRIANLYWVVGRRHAGRIEYRLAQINGEPGLLRFIDGQIESAQAFVTDGARIVAIYAVRNPDKLAHIPARHA
>NZ_CP010017.1|WP_009903749.1|794807_795260_+|carboxymuconolactone-decarboxylase-family-protein
MSHAPRLPYPKLASKPFNALLHLSETVWSGSLGKRLVDLVFLRVSQINGCAYCIDMHWRDLVKLGVDERHLNAVAGWREAPFFDARERAALQWAESVARIPHADPSDEAFAQLQAHFSDTEIAELGFAIATINAWNLLNVSFRNPIPETV
>NZ_CP010017.1|WP_025405189.1|795824_796814_+|photosystem-reaction-center-subunit-H
MSGGFPRSAFRLPRPVATAAPVVLAMFALSGCALLRAPQAPAPIVEAAAVPVEPASEPVAAPEPASAPEPVETTAPKKPHREAAPRRKPARVAPPVPRPAPPPAPLVTTRAIERSQVHALLDSEVRRSGKVIGRAVDMTADAAGAPREMLVNLQGFMGVGDRKVSFPWKLFRFTPGGKQEPIVLDMPATAGLAPADRPKTVPLSGSAQAGAEPGQMRIIDADVERPNGAKVGRVVDVLIGRDAQPQAVVLDVGGLVDPDRHTIAANWSALRFAPRDKSLRALLDLSDAQLRASPPYAGDKPILAVSPAAPAAPAAPAAAPAAARAGAKR
>NZ_CP010017.1|WP_009903746.1|796810_798073_+|MFS-transporter
MTVRHAVSARSLRALDWLNFFVANVQTGFGPFIASYLASHKWTQGEIGMALSIGTISAMVSQVPGGAAVDALKNKKGAAAWAIAAIILSAVLLAASPTVVPVIAAEVFHGFASCMLVPAMAAISFALVGRESLGDRLGRNARWASLGSAVAAGLMGLTGEYFSARAVFWLTAALALPALVALAMIEPTHHHHHAAPRASAPRDGTDEDEERETLRELLRDKRMLIFAACVVLFHLSNAAMLNLAAGEVTAGMGENVQLVIAACIIVPQAIVAMLSPWVGRSSQRWGRRPILLLGFAALPLRALLFAGVSSPYLLVPVQMLDGISAAVFGVMLPLIAADVAGGKGRYNLCIGLFGLAAGVGATLSTALAGFAADHFGNAMSFFGLAAAGALATLLVWFAMPETRDATLAEDAQRPSAEPAQ
>NZ_CP010017.1|WP_009903745.1|798332_798890_+|FUSC-family-protein
METIKAFNDARRQIQESVLDLFKGLSLKERLLQGVLMAVQAASGACLAYGIGRALHTEQAVWAAITAIAVTQHNYVDTINLSRDQFIGAMVGGLIGFAGAATGAGHFVAYAVTIVAAIICCWCLNVGSAARLGAITATIVLLFPGEGPLWDIPLVRLGEVTLGTACAMAVGWTMSRIERRWFAKH
>NZ_CP010017.1|WP_009892315.1|799130_799514_-|hypothetical-protein
MKAHRTLWISMLAAGALVSSLAAAQPHGRGGPGDERHGPPPGRHVGGDHGKRGEYGGPRPGEHRGDENAAWHRGDRLPDEYRDRQYVIDDWRGYHLSPPPRGYHWVGIGGDYLLVRISTGVILQIGP
>NZ_CP010017.1|WP_009892318.1|799947_800712_+|glycosyltransferase-family-2-protein
MAEPTLGVALIAHNAAARLAECLDALAFADDIVVVDGGSTDATVDIAKAHGARVMVAADWPGFGPQKNRAVAALDTDWVLSIDTDEIVTPELAASIQAAIRAPRAPVYALDRLSSFCGSWVRHSGWYPDWLPRLFKRGAARFSDDLVHERLVFDEPSAKLDGKLLHYSYEDFETVLRKLDAYSSAGAAQRRAAGKRGGLAKAIGRGAWAFVRTYLLRRGFLDGRAGFMIAMFNAETVYYRFLKLGFSQRQETRD
>NZ_CP010017.1|WP_045599362.1|800984_802160_-|putative-lipopolysaccharide-heptosyltransferase-III
MTLLRPPRTILVSCTRRLGDVLLTTPLVRSLKARWPDAQIDMIVFQGTESVLEHNPDIRRVITVAQRARPKERIADALRIWRKYDLACAAISSDRARFYAFFAGRRRIGLVDPERVTRLTRFILNGVVLDEHRDVHTVTSNLSLAGALGVTPCADVVAPGIGDDPAAHARFDAKLYGTSALLRDEPYVVLHPYPMFRYKRWREDGWVDLVRWARSRGLAVALSGGPAQAECDYAARIAQAAGEPVLNMAGKLSFGESAEMFRRARLFIGPDTGATHVAAACGVPTIALFGPSNPTRWGPWPAHWPAGSEPWPLRGSQRCGNVYLLQGEGDCVPCKLEGCDRHLDSWSRCLTELPSARVIGAAAAMLGLDAASAQTTGIAMSVDVSRLKAGK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP010017_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP010017_2

2910327-2910412

Orphan

Consensus_repeat	Method
AGCACGCTGCAAAACGCAGCGGCGAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP010017_2

>merge|NZ_CP010017|2|2910327-2910412|CRISPRCasFinder
AGCACGCTGCAAAACGCAGCGGCGAATAACCCGCTGTCGGGCGCGCTGAGCAATGCGGTGAGCACGCTGCAAAACGCGGCGGCGAA

>NZ_CP010017|2|2|2910327-2910412|CRISPRCasFinder
AGCACGCTGCAAAACGCAGCGGCGAA	TAACCCGCTGTCGGGCGCGCTGAGCAATGCGGTG
AGCACGCTGCAAAACGCGGCGGCGAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP010017.1\|WP_045600265.1\|2908218_2908644_+\|winged-helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|334619
NZ_CP010017.1\|WP_009904192.1\|2912575_2914216_+\|chaperonin-GroEL	unknown	unknown	gnl\|CDD\|234573
NZ_CP010017.1\|WP_045600263.1\|2905870_2906890_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010017.1\|WP_009889573.1\|2917381_2917960_+\|YqgE/AlgH-family-protein	unknown	unknown	gnl\|CDD\|234694
NZ_CP010017.1\|WP_009904202.1\|2918981_2920013_+\|aspartate-carbamoyltransferase-catalytic-subunit	unknown	unknown	gnl\|CDD\|234849
NZ_CP010017.1\|WP_045600269.1\|2918383_2918902_+\|bifunctional-pyr-operon-transcriptional-regulator/uracil-phosphoribosyltransferase-PyrR	unknown	unknown	gnl\|CDD\|235365
NZ_CP010017.1\|WP_045600261.1\|2898240_2899455_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293825
NZ_CP010017.1\|WP_009889485.1\|2903929_2904754_+\|OmpW-family-protein	unknown	unknown	gnl\|CDD\|225589
NZ_CP010017.1\|WP_004186397.1\|2914516_2915365_-\|hydroxymethylpyrimidine/phosphomethylpyrimidine-kinase	unknown	unknown	gnl\|CDD\|369938
NZ_CP010017.1\|WP_009904189.1\|2906945_2907953_-\|NAD(P)-dependent-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176237
NZ_CP010017.1\|WP_045600262.1\|2899758_2900205_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP010017.1\|WP_162486607.1\|2915934_2917185_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010017.1\|WP_009904186.1\|2904870_2905386_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010017.1\|WP_004186709.1\|2915584_2915755_+\|rubredoxin	unknown	unknown	gnl\|CDD\|224687
NZ_CP010017.1\|WP_009889537.1\|2912234_2912528_+\|co-chaperone-GroES	unknown	unknown	gnl\|CDD\|178988
NZ_CP010017.1\|WP_009904203.1\|2920097_2921375_+\|dihydroorotase	unknown	unknown	gnl\|CDD\|181059
NZ_CP010017.1\|WP_009889482.1\|2900939_2902538_+\|DUF2957-domain-containing-protein	unknown	unknown	gnl\|CDD\|371404
NZ_CP010017.1\|WP_155722029.1\|2908860_2909307_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010017.1\|WP_009889574.1\|2917956_2918397_+\|Holliday-junction-resolvase-RuvX	unknown	unknown	gnl\|CDD\|234639
NZ_CP010017.1\|WP_025404799.1\|2902597_2903851_+\|DUF2957-domain-containing-protein	unknown	unknown	gnl\|CDD\|371404

Protein	Function_ID	Function_description	E-value
NZ_CP010017.1\|WP_045600265.1\|2908218_2908644_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|334619	pfam01638, HxlR, HxlR-like helix-turn-helix. HxlR, a member of this family, is a DNA-binding protein that acts as a positive regulator of the formaldehyde-inducible hxlAB operon in Bacillus subtilis.	2.68728e-41
NZ_CP010017.1\|WP_009904192.1\|2912575_2914216_+\|chaperonin-GroEL	gnl\|CDD\|234573	PRK00013, groEL, chaperonin GroEL; Reviewed.	0
NZ_CP010017.1\|WP_009889573.1\|2917381_2917960_+\|YqgE/AlgH-family-protein	gnl\|CDD\|234694	PRK00228, PRK00228, YqgE/AlgH family protein.	2.64152e-96
NZ_CP010017.1\|WP_009904202.1\|2918981_2920013_+\|aspartate-carbamoyltransferase-catalytic-subunit	gnl\|CDD\|234849	PRK00856, pyrB, aspartate carbamoyltransferase catalytic subunit.	0
NZ_CP010017.1\|WP_045600269.1\|2918383_2918902_+\|bifunctional-pyr-operon-transcriptional-regulator/uracil-phosphoribosyltransferase-PyrR	gnl\|CDD\|235365	PRK05205, PRK05205, bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR.	2.4586e-77
NZ_CP010017.1\|WP_045600261.1\|2898240_2899455_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293825	cd07739, metallo-hydrolase-like_MBL-fold, uncharacterized subgroup of the MBL-fold_metallo-hydrolase superfamily; MBL-fold metallo hydrolase domain. Members of the MBL-fold metallohydrolase superfamily are mainly hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) from which this fold was named are only a small fraction of the activities which are included in this superfamily. Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	2.63145e-102
NZ_CP010017.1\|WP_009889485.1\|2903929_2904754_+\|OmpW-family-protein	gnl\|CDD\|225589	COG3047, OmpW, Outer membrane protein W [Cell envelope biogenesis, outer membrane].	2.95014e-32
NZ_CP010017.1\|WP_004186397.1\|2914516_2915365_-\|hydroxymethylpyrimidine/phosphomethylpyrimidine-kinase	gnl\|CDD\|369938	pfam08543, Phos_pyr_kin, Phosphomethylpyrimidine kinase. This enzyme EC:2.7.4.7 is part of the Thiamine pyrophosphate (TPP) synthesis pathway, TPP is an essential cofactor for many enzymes.	1.13902e-70
NZ_CP010017.1\|WP_009904189.1\|2906945_2907953_-\|NAD(P)-dependent-alcohol-dehydrogenase	gnl\|CDD\|176237	cd08276, MDR7, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	2.55349e-173
NZ_CP010017.1\|WP_045600262.1\|2899758_2900205_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.59607e-38
NZ_CP010017.1\|WP_009889537.1\|2912234_2912528_+\|co-chaperone-GroES	gnl\|CDD\|178988	PRK00364, groES, co-chaperonin GroES; Reviewed.	7.18843e-55
NZ_CP010017.1\|WP_009904203.1\|2920097_2921375_+\|dihydroorotase	gnl\|CDD\|181059	PRK07627, PRK07627, dihydroorotase; Provisional.	0
NZ_CP010017.1\|WP_009889482.1\|2900939_2902538_+\|DUF2957-domain-containing-protein	gnl\|CDD\|371404	pfam11170, DUF2957, Protein of unknown function (DUF2957). Some members annotate the proteins to be putative lipoproteins however this cannot be confirmed. Currently no function is known for this family of proteins.	3.59636e-131
NZ_CP010017.1\|WP_025404799.1\|2902597_2903851_+\|DUF2957-domain-containing-protein	gnl\|CDD\|371404	pfam11170, DUF2957, Protein of unknown function (DUF2957). Some members annotate the proteins to be putative lipoproteins however this cannot be confirmed. Currently no function is known for this family of proteins.	1.45002e-156
NZ_CP010017.1\|WP_009889574.1\|2917956_2918397_+\|Holliday-junction-resolvase-RuvX	gnl\|CDD\|234639	PRK00109, PRK00109, Holliday junction resolvase RuvX.	8.37996e-62
NZ_CP010017.1\|WP_004186709.1\|2915584_2915755_+\|rubredoxin	gnl\|CDD\|224687	COG1773, COG1773, Rubredoxin [Energy production and conversion].	1.12689e-20

>NZ_CP010017.1|WP_155722029.1|2908860_2909307_-|hypothetical-protein
MANAPSKPTLFQPRSARIDSFSSDLNPYPGAHATTTSDVDAHRQVRGAANAIARHALRDPMHRSFPFIYEYQYIAHNIHFFINFKKSPSEMNNALRAKDSLDRARAQKIRMNSWPFMKRTSSSGRHRAPSAWPRSGGIAANDETGSPR
>NZ_CP010017.1|WP_045600265.1|2908218_2908644_+|winged-helix-turn-helix-transcriptional-regulator
MRPKRSGSKSGCSVEVTLSVIGGLWKPVILFHLLKEKKRFMELTRLMPNTTQRMLTLQLRELEADGIVARHVYPQVPPKVEYELTPFGTTLAPVLISLREWGDAYRTHQSGAGSAESARDAATCDAPTQSGKRTAGAMKAA
>NZ_CP010017.1|WP_009904189.1|2906945_2907953_-|NAD(P)-dependent-alcohol-dehydrogenase
MKAIMLRQPAGLEHLERVTLADPGAPAAGEIRVRIHASSLNYHDLGVVTGRLSTADKRIPMSDGAGVVEAIGEGVTEFAVGDAVVSTFFPQWLDGGPSTADFATVPGDGVDGYARETVVRPAHWFTHAPKGYTHEEAATLTTAGLTGWRALVVDGRLKAGDSVLVLGTGGVSIFALQFAKRMGATVIATSSSDEKLERARQLGADHVVNYRRDANWAAKVLEQTNGRGVDHVIEVGGPDTLPQSIQACRIGGHIALIGVLTGIAGPVPTVALMARQQNLQGLIVGSRRHQIDMVRAIDATGIKPVIDRTFALDDIADAFSHQAAGKHFGKICLSI
>NZ_CP010017.1|WP_045600263.1|2905870_2906890_+|hypothetical-protein
MPDNHNHRVDAEGLSLGSLRTAAWLRHLLDHAERFASAAAESREARVATAARNMLARAGVHARRGPPADAGLLNELLAALRGDGPPADTALAAEYEALARTPTKRLLVAVERYLPGSKAVFDSAHGAADALGYGDPGVGWAALDSIELGIGRAFAMDGDAADDAMRGIVGFEGPAAARVIDRAIGRMWGAHERPIEALAALAAFSAALATNAPITIDAYGGEHNGVAAAILCKRRDLASTEGLLAALAVCRLDRLTGAGSFWAYYLLAGVMIAAPEAVASICARFHRDALSAWLDMLLASPARSGIGDAEEAALGRLGASMSFTSRHNPIVHTRRRPMR
>NZ_CP010017.1|WP_009904186.1|2904870_2905386_+|hypothetical-protein
MRNRKFVPFVVALAFAAAAATPALAVTVSRVDGQPMNPNGEPFSATSAPYETLLSKGSISANCVATFNGTITPAGIVNITSTTFTGTNSLCSLIKGSASGMNPWTGQADSATQLTINNAQVNVSLLGQCGPSKIVTAWSDANSSLTFSNAVLTPDCKVTGTVVTSPKFHVQ
>NZ_CP010017.1|WP_009889485.1|2903929_2904754_+|OmpW-family-protein
MKKLIAACVVAGASTGAFAQQAGDVVATLGWLHVMPQDSTNGLTTNVVNSPINGPLRLPGSFTSPGTSLTVNNADTVGLTFTYFFTDHIAVTSVLGIPPEFALTGHGVIKPPGPSGSLGSVDLGNPANQPAVKNARQWSPTIILNYYFNSPTAKFRPFVGIGVAYSWFSNIELNGNFAKDINDNLGSVLAAGAGKPGPTSVEGKASSSFTPVYNVGASYAFAKNWALTATLSYMPLKTYSSLVIKAADGTTLATTRTKLKADPLITFVGISYKF
>NZ_CP010017.1|WP_025404799.1|2902597_2903851_+|DUF2957-domain-containing-protein
MYWRKSLAAAVLAPVLTACGGGDDPPPAPVVRLCPKTIDYSTVFTGGSGSGELVRVQLDTTKMTFQITYLASPVPAATGTVQPTRDAPPNNIVTGTLTDETGLPTEKLNQCTFRLNDASLDPNRPARVFLGEGVLGGAIPGATIQFGGVIGVGQIPKTTFPYYPFISFSDQETDLSKIAGNYNQLGYHQVPSQNFAPAAVDAKVTINADGTYVETDNFGRKNGGQPLASSATVNQKLTLRADAPVFQSLNYQPQVPPTLASLDPAKAGKGILIVGKLRNQLVPIFIRTGAANADLTQGAPVADDESGISILSPQTTIASGSQDGEYTGVDSLLDYRATALVGAQATLLDPFHASQVALTRALNLDYTQAVPGVVTTVQTNAASGPPTGKFIFTGGVFGFLDMSDANNPYFTVGAFVQ
>NZ_CP010017.1|WP_009889482.1|2900939_2902538_+|DUF2957-domain-containing-protein
MLCIPNLRAALLSCVVAAMPFVAGCGGGDDPGPIQVGQCSGGSCPPSGPSTTPPTVTKLCPDALDYSTTYTGGSGSGEYVKVKFDTAKKTYQMQFIASSVPTSAGQINNTRAGLTISGTFHNATGLPTAEQNRCAFVLDNGVTSDGAYSVTINRADPPMLFVGMGVVGGGIPGATIAFPGLELFPGLTIGTVPSRTFDFYPFIGFTDTETDFTKVAGVYNEVGVHLQPTGTSFQTAAPQGWQPDVVNWTQTLNADGSCTITPGSDYSCRTTGTPWTLRQNADGTSDNVFVSHPQPNQPYPSAGQGQPLVILTPSQAQGVMIVGKLNGQLVPVVIRVGYANVDSANPLGSVADAEIGISVLAPVTPIAANSLQGGYIGATSAVACGVVSFGGNSTAPANSGSAFDNTVPHPELPGAYRNGFFYPSAGNCTDGSAVSTLAANYTSTLFQGATAAFLDPMTSAVSSQFSLDYTQATPGKIKVTATRDFNAQGSAGSVAIFRKGDYGWLIKVGNVYGMVVNNSQYNPFFTVGAFVQ
>NZ_CP010017.1|WP_045600262.1|2899758_2900205_+|helix-turn-helix-transcriptional-regulator
MATMRKNAPHGEQITDRKPSLLDAPLKGNVYASECPTRLVLDRIADKWTVLILALLSHAPLRFNALLRHIEGLSQKVLSQTLKRLERDGLVARTVYATVPVSVEYALTPLGHTLARSISPIIVWAETHIDAVLDARTAYDARRACVGA
>NZ_CP010017.1|WP_045600261.1|2898240_2899455_-|MBL-fold-metallo-hydrolase
MALAAAAASMLGAAPAHATSASAPLQIDVYNPGEKSLFPVSSEIVTGKTGTILIDAQFQRNDAEALVNKIKATGKPLKLVYVSHSDPDYYFGLDTIRAAFPDAKIVATPQTVAAIKANKDDKLAYWGPILKDNAPRALVVPQPLDGDRLTLDGHELRIVGLDGPSPDRTFVSIPSAHAVVGGIPVAANIHVWIADTQTPESRRNWIKTLDRIAALRPSRVVPGHYLANPDGSEPNTLASVKFTRDYLVAFETEAAKARNSGELIAAMKARYPNLADVSSLEMSAKVIKGEMQWPVVGTASAFPAAGKKALVQFGDIGFRLDFKDDHTMTFVGTSGQYQGATDTVEYKATQIRPQVFMVYWHEPKSGDNVVHVEDFENGVVYTNIAHRNGEFQHLKGTIRIEDAK
>NZ_CP010017.1|WP_009889537.1|2912234_2912528_+|co-chaperone-GroES
MNLRPLHDRVIVKRLDQETKTASGIVIPDAAAEKPDQGEVLAIGPGKRDDKGAPIALDVKVGDRVLFGKYAGQTVKVDGQELLVMREEDIMAVVNAQ
>NZ_CP010017.1|WP_009904192.1|2912575_2914216_+|chaperonin-GroEL
MAAKDVVFGDSARAKMVEGVNILANAVKVTLGPKGRNVVLERSFGGPTVTKDGVSVAKEIELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGMKYVASGMNPMDLKRGIDKAVAAAVEELKKISKPCTTNKEIAQVGSISANSDSSIGDRIAEAMDKVGKEGVITVEDGKSLADELDVVEGMQFDRGYLSPYFINNPDKQVAVLENPFVLLHDKKVSNIRDLLPVLEQVAKAGRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKAMLEDIAILTGGQVIAEETGLTLEKATLAELGQAKRIEVGKENTTIIDGAGEAVNIEARVKQIRTQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALIRARTAIAALTGVNADQNAGIKIVLRAMEEPLRQIVTNGGEEASVVVAAVAAGKGNYGYNAATGEYVDMVEAGVVDPTKVTRTALQNAASVAGLLLTTDAAVAELPKEDAPMPGGMPGGMGGMGMDM
>NZ_CP010017.1|WP_004186397.1|2914516_2915365_-|hydroxymethylpyrimidine/phosphomethylpyrimidine-kinase
MSSNTPPIVLTFGLSDPTGGSGLQADLMTLASMGCHGVSVLTGYTVRDSAACDEVTGLDPDTVAAQARMLLEDMPVAAFKIGAATRAEVVSAIAEVVADYDGVPLVLAPDFTLDDEHVLAADDLRESIADLLAPQTTLLVADHATLIALAQPDGDAEAPNLDAALSHLLGQGCEYILATETGSHRLVNTLYGEEGQIRQDLWERTPHRLMGITDTLGAAIAALLANGQEPPEAVREAQEYLYQAARDAFRPGMGAYLPDRFFWARSNEDESPAPAGIAKRTN
>NZ_CP010017.1|WP_004186709.1|2915584_2915755_+|rubredoxin
MEYKSWMCLICGWIYDEEAGLPEEGIAPGTRWEDVPINWTCPECGARKEDFEMVQI
>NZ_CP010017.1|WP_162486607.1|2915934_2917185_+|hypothetical-protein
MPAAEAALRAAQQAFERRADPAGSLAAAAAALREAGWLAAQRFVVALAHAAPIAAIELQPIAFEAALRDFRAALERHNLRELACSPLLFEHYRALRAQAASDLRMDTPHGVLALAGRPVPPATLYALSPHALAHLRARYEQALLGALRASETATDKALDGLADCAAELAGPSPYDFWRLAGACMRVLRVRGGVELKRFLARCNLLLGEQARGLRIAPAALVDEALALFWRDYALYGAAAEDVADVELLHDYGLTVAWHVAGTQASEALWEADAARAEADAVRAAATRELGVVTVNAQAYDDFLQTADASMSELALDPRAADAGAALRAAQAAYRVGSAACALGLGHTALLADALGLAWRRHAHLGAMGDACAAACRQAAEALRAALHRIAAGMAPHDLSDACASLAGALSGAARGA
>NZ_CP010017.1|WP_009889573.1|2917381_2917960_+|YqgE/AlgH-family-protein
MSKSSDRINLTNQFLIAMPNMADPTFSGTVVYLCDHSERGALGLVINRPTDIDLESLFNRIDLKLEIEPLLHIPVYFGGPVQTERGFVLHEPVEGSSYNSSMTVEGGLEMTTSKDVLEAVATGTGPKRFLLTLGHAGWGAGQLEEEISKNGWLTVAADPRIVFDTPAEERFEAALGLLGVSSSMLSGEAGHA
>NZ_CP010017.1|WP_009889574.1|2917956_2918397_+|Holliday-junction-resolvase-RuvX
MSAALSRDATLLAFDYGEKRIGVAIGNLLTRTARALVIVPNLNREHRFKAVGELIAEWKPDALVVGLPLHPDGAPHEMTQRALRFGNQLNGRFNLPVSWVDERYSSVEARAGLRARGDAANRVDAEAARVILQQFLDGLPDQHEFN
>NZ_CP010017.1|WP_045600269.1|2918383_2918902_+|bifunctional-pyr-operon-transcriptional-regulator/uracil-phosphoribosyltransferase-PyrR
MSSIDAEALYRVLLDQIRGAYGGTAFADAGGPVLAGIHSGGAWLAERLARDLGAPEFGVVNVALHRDDYAKKGLHSQASPTSLPFEVEGRRIVLVDDVLYTGRTVRAALNELYDYGRPAVVELAVLADRGGRELPVAARFVGGTLAVDADATLVLERADAGRFTLRTEARAG
>NZ_CP010017.1|WP_009904202.1|2918981_2920013_+|aspartate-carbamoyltransferase-catalytic-subunit
MTTDTSGRTGTPAAAAPAERFRYGFLKGNPQLTKNGELKHLLTIEGLPRAILNQILDTAEQFVSVTDREVKKVPLLRGKSVFNLFFENSTRTRTTFEIAAKRLSADVINLNINASSTSKGESLLDTINNLSAMHADLFVVRHASSGAPYLIAEHCAPHVHVINAGDGRHAHPTQGLLDMYTIRHYKRDFTKLRVAIVGDILHSRVARSDIHALTTLGVPEVRAIGPRTLLPGGLEQMGVRVFHNLDEGLKDVDVIIMLRLQNERMSGALLPSAQEYFKSWGLTPERLALAAPDAIVMHPGPMNRGVEIDSQVADGPQSVILNQVTFGIAVRMAVMGIVAGTND
>NZ_CP010017.1|WP_009904203.1|2920097_2921375_+|dihydroorotase
MKIHIKGGTLIDPAAGTQRQADVFVAAGKVAAIGAAPADFNAAKTIDATGMIVAPGFVDLSARLREPGYEHKATLESEMAAAVAGGVTSLVCPPDTDPVLDEPGLVEMLKFRARNRNQAHVYPLGALTVGLKGQVITEMVELTEAGCIGFTQANVPVTDTQVLLRALQYASTYGYTVWLRPLDAFLAKGGVAASGPVASRLGLSGVPVAAETIALHTLFELMRVTGARVHVARLSSAAGVALVRAAKAEGLPVTCDVGANHLHLIDVDIGYFDAQFRLDPPLRAERDREAIRAALADGTIDAICSDHTPVDDDEKLLPFAEATPGATGLELLLSLTVKWAQEAGVPLARALATITSAPADVLKLPAGRVGEGAPADLCVFDPNAHWRVEPRALKSQGHNTPFLGYELPAQVRATLVAGQVAFERR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Identity
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010017.1	379360-379381	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010017.1	379367-379388	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010017.1	379374-379395	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010017.1	379381-379402	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010017.1	379388-379409	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010017.1	379395-379416	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010017.1	379402-379423	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010017.1	379409-379430	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010017.1	379416-379437	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010017.1	789709-789730	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010017.1	789716-789737	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010017.1	789723-789744	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010017.1	789730-789751	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010017.1	789737-789758	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010016.1	197741-197762	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010016.1	197748-197769	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010016.1	197755-197776	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010016.1	197762-197783	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010016.1	197769-197790	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010016.1	197776-197797	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010016.1	197783-197804	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010016.1	197790-197811	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010016.1	197797-197818	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010018.1	465017-465038	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010018.1	465024-465045	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010018.1	465031-465052	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010018.1	465038-465059	1.0

1. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to position: 379360-379381, mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

2. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to position: 379367-379388, mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

3. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to position: 379374-379395, mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

4. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to position: 379381-379402, mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

5. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to position: 379388-379409, mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

6. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to position: 379395-379416, mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

7. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to position: 379402-379423, mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

8. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to position: 379409-379430, mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

9. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to position: 379416-379437, mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

10. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to position: 789709-789730, mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

11. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to position: 789716-789737, mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

12. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to position: 789723-789744, mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

13. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to position: 789730-789751, mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

14. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to position: 789737-789758, mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

15. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to position: 197741-197762, mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

16. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to position: 197748-197769, mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

17. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to position: 197755-197776, mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

18. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to position: 197762-197783, mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

19. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to position: 197769-197790, mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

20. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to position: 197776-197797, mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

21. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to position: 197783-197804, mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

22. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to position: 197790-197811, mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

23. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to position: 197797-197818, mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

24. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to position: 465017-465038, mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

25. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to position: 465024-465045, mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

26. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to position: 465031-465052, mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

27. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to position: 465038-465059, mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	197741-197762	0	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	197748-197769	0	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	197755-197776	0	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	197762-197783	0	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	197769-197790	0	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	197776-197797	0	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	197783-197804	0	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	197790-197811	0	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	197797-197818	0	1.0
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	197734-197755	1	0.955
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	197804-197825	1	0.955
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	MN693095	Marine virus AFVG_25M68, complete genome	236-257	1	0.955
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	MN693522	Marine virus AFVG_25M153, complete genome	90-111	1	0.955
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	MN693522	Marine virus AFVG_25M153, complete genome	59783-59804	1	0.955
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	MN693582	Marine virus AFVG_25M154, complete genome	91-112	2	0.909
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	MN693582	Marine virus AFVG_25M154, complete genome	59060-59081	2	0.909
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP038449	Aeromonas media strain R50-22 plasmid pAeme5, complete sequence	69234-69255	3	0.864
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	MF668280	Mycobacterium phage Phabba, complete genome	134559-134580	3	0.864
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP029358	Azospirillum sp. CFH 70021 plasmid unnamed3	297111-297132	3	0.864
NZ_CP010017_1	1.2\|789674\|22\|NZ_CP010017\|CRISPRCasFinder	789674-789695	22	NZ_CP038446	Aeromonas media strain R25-3 plasmid pAeme3, complete sequence	1592-1613	3	0.864

1. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

2. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

3. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

4. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

5. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

6. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

7. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

8. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

9. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtt	Protospacer
**********************

10. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.955

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggta	Protospacer
*********************

11. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.955

tcgcggttcgcggttcgcggtt	CRISPR spacer
gcgcggttcgcggttcgcggtt	Protospacer
 *********************

12. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to MN693095 (Marine virus AFVG_25M68, complete genome) position: , mismatch: 1, identity: 0.955

tcgcggttcgcggttcgcggtt	CRISPR spacer
acgcggttcgcggttcgcggtt	Protospacer
 *********************

13. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to MN693522 (Marine virus AFVG_25M153, complete genome) position: , mismatch: 1, identity: 0.955

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtc	Protospacer
*********************.

14. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to MN693522 (Marine virus AFVG_25M153, complete genome) position: , mismatch: 1, identity: 0.955

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcgcggttcgcggttcgcggtc	Protospacer
*********************.

15. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to MN693582 (Marine virus AFVG_25M154, complete genome) position: , mismatch: 2, identity: 0.909

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcacggttcgcggttcgcggtc	Protospacer
**.******************.

16. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to MN693582 (Marine virus AFVG_25M154, complete genome) position: , mismatch: 2, identity: 0.909

tcgcggttcgcggttcgcggtt	CRISPR spacer
tcacggttcgcggttcgcggtc	Protospacer
**.******************.

17. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to NZ_CP038449 (Aeromonas media strain R50-22 plasmid pAeme5, complete sequence) position: , mismatch: 3, identity: 0.864

tcgcggttcgcggttcgcggtt	CRISPR spacer
gatcggttcgcggttcgcggtt	Protospacer
   *******************

18. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to MF668280 (Mycobacterium phage Phabba, complete genome) position: , mismatch: 3, identity: 0.864

tcgcggttcgcggttcgcggtt	CRISPR spacer
atgcggttcgcggttcgcggtc	Protospacer
 .*******************.

19. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to NZ_CP029358 (Azospirillum sp. CFH 70021 plasmid unnamed3) position: , mismatch: 3, identity: 0.864

tcgcggttcgcggttcgcggtt	CRISPR spacer
ggacggttcgcggttcgcggtt	Protospacer
  .*******************

20. spacer 1.2|789674|22|NZ_CP010017|CRISPRCasFinder matches to NZ_CP038446 (Aeromonas media strain R25-3 plasmid pAeme3, complete sequence) position: , mismatch: 3, identity: 0.864

tcgcggttcgcggttcgcggtt	CRISPR spacer
gatcggttcgcggttcgcggtt	Protospacer
   *******************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

82397 : 93077

Burkholderia_virus(58.33%)

transposase,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_102860124.1\|82397_83597_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	9.2e-43	42.7
WP_045599085.1\|83868_84960_+	DUF3396 domain-containing protein	Q8W6S0	Burkholderia_virus	1.2e-209	97.5
WP_102889828.1\|85077_85834_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_009897078.1\|86084_86207_+	CopG family transcriptional regulator	A4JWV6	Burkholderia_virus	5.9e-14	100.0
WP_009897076.1\|86309_86843_+	bacteriophage gp29 protein	A4JWV5	Burkholderia_virus	2.4e-96	99.4
WP_045599088.1\|86839_87577_+	VRR-NUC domain-containing protein	A4JWV4	Burkholderia_virus	4.2e-131	98.4
WP_082255833.1\|87585_88707_+	DUF3396 domain-containing protein	A4JWV3	Burkholderia_virus	6.3e-219	99.5
WP_006027262.1\|89297_89594_+	type II toxin-antitoxin system RelE/ParE family toxin	A4JWV2	Burkholderia_virus	5.6e-50	99.0
WP_004202809.1\|89596_89953_+	putative addiction module antidote protein	A4JWV1	Burkholderia_virus	3.9e-42	100.0
WP_045599090.1\|89996_90974_-\|portal	phage portal protein	K4NZV0	Burkholderia_phage	2.7e-189	98.8
WP_045599091.1\|91024_91420_-	helix-turn-helix transcriptional regulator	S6B268	Ralstonia_phage	1.5e-26	55.1
WP_045599092.1\|91951_92251_+	hypothetical protein	W6CMZ9	Ralstonia_phage	4.2e-13	40.4
WP_102889801.1\|92259_93077_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	8.6e-08	37.6

DBSCAN-SWA_2

449012 : 514547

uncultured_Caudovirales_phage(33.33%)

transposase,coat,plate,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045598778.1\|449012_451637_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	7.1e-80	39.2
WP_045598774.1\|452080_453301_+	CoA transferase	NA	NA	NA	NA
WP_009905865.1\|453386_454193_+	hypothetical protein	NA	NA	NA	NA
WP_038709125.1\|454723_454933_-	ornithine acetyltransferase	NA	NA	NA	NA
WP_009891706.1\|455213_456923_+\|tRNA	glutamine--tRNA ligase/YqeY domain fusion protein	A0A222YZ70	Escherichia_phage	2.8e-186	56.9
WP_009891707.1\|457208_457685_-	NUDIX hydrolase	A0A2I6PFL2	Proteus_phage	2.0e-20	41.3
WP_009891709.1\|457703_458090_-	hypothetical protein	NA	NA	NA	NA
WP_045598772.1\|458376_460476_-	glycoside hydrolase family 3 protein	NA	NA	NA	NA
WP_009905872.1\|460401_460581_+	hypothetical protein	NA	NA	NA	NA
WP_009891712.1\|460577_461438_+	M15 family metallopeptidase	NA	NA	NA	NA
WP_045598769.1\|461483_462887_-	cytochrome-c peroxidase	NA	NA	NA	NA
WP_045598767.1\|463120_464704_+	acid phosphatase	NA	NA	NA	NA
WP_045598765.1\|464928_466122_+	trans-2-enoyl-CoA reductase family protein	NA	NA	NA	NA
WP_045598763.1\|466139_466982_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_009891722.1\|467719_468352_-	response regulator transcription factor	NA	NA	NA	NA
WP_045598762.1\|468352_470425_-	response regulator	Q8QKV7	Ectocarpus_siliculosus_virus	1.6e-29	27.8
WP_045598760.1\|470835_471801_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_045598757.1\|471816_474228_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_009905896.1\|474272_475112_-	molecular chaperone	NA	NA	NA	NA
WP_038708375.1\|475129_475654_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_009905900.1\|475736_476297_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_045598752.1\|476349_476895_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_009891734.1\|477703_478597_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_045598748.1\|479012_480302_+	MFS transporter	NA	NA	NA	NA
WP_025405114.1\|480346_481273_+	amidohydrolase family protein	NA	NA	NA	NA
WP_009891740.1\|481758_482040_+	H-NS histone family protein	NA	NA	NA	NA
WP_009927991.1\|482302_482575_-	hypothetical protein	NA	NA	NA	NA
WP_082255944.1\|483451_484144_-	hypothetical protein	NA	NA	NA	NA
WP_045598747.1\|484173_487197_-	hypothetical protein	NA	NA	NA	NA
WP_045598745.1\|487199_488216_-	hypothetical protein	NA	NA	NA	NA
WP_045598742.1\|488219_491042_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	1.2e-29	24.6
WP_009909765.1\|491054_491360_-	hypothetical protein	NA	NA	NA	NA
WP_045599247.1\|491377_491710_-	hypothetical protein	NA	NA	NA	NA
WP_038708366.1\|492170_492662_-	hypothetical protein	NA	NA	NA	NA
WP_082255818.1\|493420_493915_-	hypothetical protein	NA	NA	NA	NA
WP_025405119.1\|493892_497228_-	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_045598740.1\|497336_499739_-	DUF2235 domain-containing protein	NA	NA	NA	NA
WP_082255817.1\|499735_500335_-	DUF3304 domain-containing protein	NA	NA	NA	NA
WP_045598989.1\|500331_500889_-	DUF3304 domain-containing protein	NA	NA	NA	NA
WP_009905935.1\|501025_501859_-	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_045598738.1\|501861_504660_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	2.0e-27	24.1
WP_009891791.1\|505185_505452_+	PAAR domain-containing protein	NA	NA	NA	NA
WP_045598735.1\|505475_506903_+	hypothetical protein	NA	NA	NA	NA
WP_009905942.1\|506931_508782_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_009910381.1\|510273_510492_+	hypothetical protein	NA	NA	NA	NA
WP_127447005.1\|510566_511253_-	hypothetical protein	NA	NA	NA	NA
WP_025405125.1\|512096_513575_+	PHB depolymerase family esterase	NA	NA	NA	NA
WP_102889787.1\|513735_514547_-\|transposase	IS5 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

874697 : 930258

uncultured_Caudovirales_phage(28.95%)

terminase,head,transposase,plate,tail,capsid,portal,integrase

attL 885742:885759|attR 921588:921605

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045599388.1\|874697_875369_-	DUF159 family protein	Q8W6R8	Burkholderia_virus	6.6e-115	83.8
WP_045600761.1\|875448_875913_+	hypothetical protein	C7BGE3	Burkholderia_phage	3.3e-49	61.7
WP_045599391.1\|875912_876194_+	hypothetical protein	NA	NA	NA	NA
WP_045599392.1\|876253_876679_+	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	1.7e-15	50.6
WP_082255805.1\|876675_877185_+	DUF4123 domain-containing protein	A4PE24	Ralstonia_virus	8.8e-19	37.3
WP_082255804.1\|877526_878129_+	hypothetical protein	NA	NA	NA	NA
WP_045599395.1\|878135_878858_+	LysR family transcriptional regulator	A4PE26	Ralstonia_virus	4.1e-30	39.5
WP_045599396.1\|878893_879682_-	DNA adenine methylase	Q8W6S4	Burkholderia_virus	9.4e-153	96.9
WP_045599398.1\|879825_880371_-	lysozyme	Q8W6S5	Burkholderia_virus	7.6e-77	91.7
WP_045599399.1\|880370_880868_-	lysozyme	A4JX20	Burkholderia_virus	3.1e-69	81.2
WP_004533694.1\|880860_881055_-	hypothetical protein	NA	NA	NA	NA
WP_045599400.1\|881130_882183_-	phage late control D protein	A0A2H4JBF6	uncultured_Caudovirales_phage	1.6e-78	44.8
WP_004538529.1\|882192_882399_-\|tail	phage tail protein	A0A2H4J9Z9	uncultured_Caudovirales_phage	5.3e-15	59.7
WP_045599401.1\|882373_883255_-\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	2.4e-32	38.5
WP_045599402.1\|883263_885678_-\|tail	phage tail tape measure protein	A0A2H4JG00	uncultured_Caudovirales_phage	1.8e-69	34.7
885742:885759	attL	NA	NA	NA	NA
WP_045599403.1\|885765_886068_-\|tail	phage tail assembly protein	V5YST8	Pseudomonas_phage	1.1e-05	37.2
WP_045599404.1\|886139_886643_-\|tail	phage major tail tube protein	A0A2H4JBU0	uncultured_Caudovirales_phage	7.3e-42	49.1
WP_045599406.1\|886653_887823_-\|tail	phage tail sheath family protein	A0A2H4J869	uncultured_Caudovirales_phage	6.2e-161	74.6
WP_045599408.1\|887897_888332_-\|tail	tail assembly chaperone	A4JWL9	Burkholderia_virus	2.4e-41	74.6
WP_045599411.1\|888347_889748_-	hypothetical protein	A4JWL8	Burkholderia_virus	1.8e-159	60.2
WP_045599413.1\|889744_890314_-\|tail	phage tail protein I	A4JWL7	Burkholderia_virus	8.0e-37	48.1
WP_045599415.1\|890303_891197_-\|plate	baseplate J protein	D5LGZ3	Escherichia_phage	2.2e-49	41.6
WP_045599417.1\|891193_891538_-\|plate	phage baseplate protein	A0A2H4JA09	uncultured_Caudovirales_phage	1.9e-25	50.9
WP_045599418.1\|891534_891741_-	hypothetical protein	NA	NA	NA	NA
WP_045600764.1\|891805_892486_-\|plate	phage baseplate assembly protein V	Q9JML8	Wolbachia_phage	6.9e-19	33.8
WP_045599419.1\|892488_893022_-	hypothetical protein	Q9JML9	Wolbachia_phage	1.6e-23	40.3
WP_045599420.1\|893011_893542_-\|tail	phage tail protein	A0A2H4JBV1	uncultured_Caudovirales_phage	2.4e-11	29.6
WP_045599421.1\|893543_893834_-	hypothetical protein	NA	NA	NA	NA
WP_045599422.1\|893837_894833_-\|capsid	major capsid protein	A0A2H4J890	uncultured_Caudovirales_phage	2.1e-109	59.1
WP_045599423.1\|894897_895242_-\|head	head decoration protein	NA	NA	NA	NA
WP_045599425.1\|895268_896369_-	peptidase S14	A0A2H4JDI2	uncultured_Caudovirales_phage	5.3e-45	34.8
WP_045599426.1\|896365_897859_-\|portal	phage portal protein	A0A2H4JFL5	uncultured_Caudovirales_phage	4.1e-133	50.8
WP_009964508.1\|897855_898062_-	hypothetical protein	NA	NA	NA	NA
WP_082255803.1\|898072_900061_-\|terminase	phage terminase large subunit family protein	A0A2D1GMT1	Marinobacter_phage	8.6e-179	53.1
WP_009964504.1\|900023_900593_-	hypothetical protein	NA	NA	NA	NA
WP_082255802.1\|900798_901065_+	DUF1883 domain-containing protein	NA	NA	NA	NA
WP_045599429.1\|901624_902398_-	hypothetical protein	NA	NA	NA	NA
WP_045599430.1\|902615_905108_-	virulence protein E	A0A2D1GN57	Marinobacter_phage	2.9e-99	42.2
WP_045600765.1\|905228_905699_-	hypothetical protein	NA	NA	NA	NA
WP_045599432.1\|906072_906531_-	hypothetical protein	NA	NA	NA	NA
WP_082255931.1\|907237_907570_-	hypothetical protein	NA	NA	NA	NA
WP_045599434.1\|907583_908111_-	hypothetical protein	C7BGG0	Burkholderia_phage	4.4e-29	46.8
WP_082255930.1\|908486_909050_+	helix-turn-helix transcriptional regulator	G9L6A6	Escherichia_phage	6.7e-12	41.1
WP_045600767.1\|909601_909820_+	hypothetical protein	NA	NA	NA	NA
WP_045599438.1\|909871_910207_+	hypothetical protein	NA	NA	NA	NA
WP_045599439.1\|910203_910809_+	hypothetical protein	NA	NA	NA	NA
WP_045599440.1\|910805_911255_+	hypothetical protein	NA	NA	NA	NA
WP_045599442.1\|911254_912592_+	ParB N-terminal domain-containing protein	NA	NA	NA	NA
WP_045599443.1\|912693_913065_+	hypothetical protein	NA	NA	NA	NA
WP_102889801.1\|913190_914007_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	8.6e-08	37.6
WP_045599445.1\|914004_914439_+	hypothetical protein	NA	NA	NA	NA
WP_052712467.1\|914451_914925_+	hypothetical protein	NA	NA	NA	NA
WP_045599447.1\|914921_915161_+	hypothetical protein	NA	NA	NA	NA
WP_045599449.1\|915230_917420_-	S8 family peptidase	NA	NA	NA	NA
WP_045599450.1\|917409_918642_-	AAA family ATPase	R4TQL5	Phaeocystis_globosa_virus	2.2e-15	32.7
WP_045600769.1\|918736_919852_-\|integrase	site-specific integrase	A0A248XD46	Klebsiella_phage	6.0e-44	32.7
WP_045599452.1\|920306_921521_+\|integrase	tyrosine-type recombinase/integrase	Q7M297	Enterobacteria_phage	2.6e-85	40.9
WP_045598699.1\|921977_923543_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	9.8e-69	34.0
921588:921605	attR	NA	NA	NA	NA
WP_045598698.1\|923574_923925_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.1e-17	39.4
WP_045598892.1\|923900_924374_-\|transposase	transposase	NA	NA	NA	NA
WP_045599454.1\|925132_927985_-	DUF927 domain-containing protein	A0A1B0VP75	Pseudomonas_phage	1.0e-71	35.7
WP_045599455.1\|928129_928471_-	hypothetical protein	NA	NA	NA	NA
WP_045600770.1\|928467_928725_-	hypothetical protein	NA	NA	NA	NA
WP_102889853.1\|929123_930258_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.2e-14	29.9

DBSCAN-SWA_4

1110595 : 1121476

Agrobacterium_phage(16.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045599533.1\|1110595_1112896_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	3.9e-167	41.8
WP_009892611.1\|1112892_1113207_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A218MMY6	uncultured_virus	2.6e-13	44.6
WP_004196460.1\|1113737_1113941_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	6.8e-23	81.8
WP_045599534.1\|1114052_1115648_-	multicopper oxidase family protein	NA	NA	NA	NA
WP_045599535.1\|1115812_1117072_-	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	6.8e-12	63.0
WP_009892615.1\|1117336_1117915_+	pseudouridine synthase	NA	NA	NA	NA
WP_080511442.1\|1118175_1118391_+	hypothetical protein	NA	NA	NA	NA
WP_019256450.1\|1118586_1119096_+	DUF192 domain-containing protein	A0A1B1IUW8	uncultured_Mediterranean_phage	5.0e-14	42.2
WP_009903323.1\|1119361_1121476_+	elongation factor G	E4ZFJ7	Streptococcus_phage	2.3e-57	27.0

DBSCAN-SWA_5

1652123 : 1658838

Burkholderia_virus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045598699.1\|1652123_1653689_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	9.8e-69	34.0
WP_045598698.1\|1653720_1654071_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.1e-17	39.4
WP_045598892.1\|1654046_1654520_-\|transposase	transposase	NA	NA	NA	NA
WP_010113596.1\|1654848_1655397_+	hypothetical protein	A4JWV5	Burkholderia_virus	8.4e-76	80.7
WP_045599756.1\|1655393_1656155_+	nuclease	A4JWV4	Burkholderia_virus	7.1e-57	54.6
WP_045599758.1\|1656160_1657270_+	DUF3396 domain-containing protein	A4JWV3	Burkholderia_virus	8.9e-125	58.9
WP_052712469.1\|1657842_1658838_+	AAA family ATPase	Q7M293	Enterobacteria_phage	2.8e-29	29.4

DBSCAN-SWA_6

1704949 : 1756817

Leptospira_phage(28.57%)

transposase,plate,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009906304.1\|1704949_1706248_+\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_045599769.1\|1706316_1707399_+	peptide chain release factor 1	A0A0S4KWG0	Pseudomonas_phage	6.7e-08	46.6
WP_009906305.1\|1707424_1708282_+	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_004186955.1\|1708361_1708670_+	Grx4 family monothiol glutaredoxin	NA	NA	NA	NA
WP_009906309.1\|1708683_1709280_+	UbiX family flavin prenyltransferase	NA	NA	NA	NA
WP_045599770.1\|1709535_1710324_+	dioxygenase	NA	NA	NA	NA
WP_009888654.1\|1710480_1712082_-	APC family permease	NA	NA	NA	NA
WP_004196837.1\|1712516_1712720_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	6.3e-21	73.1
WP_009906314.1\|1712811_1714074_-	Hsp70 family protein	NA	NA	NA	NA
WP_009888637.1\|1714290_1714896_-	nitroreductase family protein	NA	NA	NA	NA
WP_045599771.1\|1715219_1716503_-	MFS transporter	NA	NA	NA	NA
WP_045599772.1\|1716661_1717297_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_045599773.1\|1717617_1718223_+	DUF1415 domain-containing protein	NA	NA	NA	NA
WP_045599774.1\|1718283_1719180_-	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_045600830.1\|1719311_1720448_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_009906322.1\|1721137_1721644_-	hypothetical protein	NA	NA	NA	NA
WP_045599776.1\|1722246_1724397_+	peptidase M1	A0A0P0IY26	Acinetobacter_phage	2.2e-47	25.7
WP_009906327.1\|1725440_1725689_+	hypothetical protein	NA	NA	NA	NA
WP_009888621.1\|1725790_1726012_+	hypothetical protein	NA	NA	NA	NA
WP_009888619.1\|1726663_1727932_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_045599777.1\|1727946_1730160_+	peptidase domain-containing ABC transporter	W8CYL7	Bacillus_phage	5.7e-38	28.3
WP_045599778.1\|1730156_1731605_+	TolC family protein	NA	NA	NA	NA
WP_045599779.1\|1731801_1732767_-	hypothetical protein	NA	NA	NA	NA
WP_025369750.1\|1732892_1733744_+	M15 family metallopeptidase	NA	NA	NA	NA
WP_045599780.1\|1734029_1737950_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_009888606.1\|1737946_1738936_+	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_045599781.1\|1738940_1739909_+	OmpA family protein	NA	NA	NA	NA
WP_009906864.1\|1740098_1741229_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_045599782.1\|1741314_1743978_-	type VI secretion system ATPase TssH	A0A223W0B1	Agrobacterium_phage	1.8e-91	31.0
WP_019255984.1\|1744011_1745112_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_045599783.1\|1745075_1746914_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_009888597.1\|1746994_1747477_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_009906860.1\|1747534_1748038_-	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_009888594.1\|1748110_1749601_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_009888592.1\|1749617_1750136_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_045599785.1\|1750172_1750862_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_025404121.1\|1751235_1751850_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_009906858.1\|1751958_1753305_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_009888580.1\|1753301_1754087_+	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_127447041.1\|1754120_1754378_-	hypothetical protein	NA	NA	NA	NA
WP_045598699.1\|1754420_1755986_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	9.8e-69	34.0
WP_045598698.1\|1756017_1756368_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.1e-17	39.4
WP_045598892.1\|1756343_1756817_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_7

1780202 : 1819051

Leptospira_phage(42.86%)

transposase,protease,integrase

attL 1807435:1807480|attR 1818443:1818488

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045598726.1\|1780202_1781825_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	2.1e-66	33.7
WP_045598729.1\|1781834_1782095_-	hypothetical protein	NA	NA	NA	NA
WP_045599797.1\|1782894_1783884_+	hypothetical protein	NA	NA	NA	NA
WP_045600835.1\|1784280_1785090_+	DUF4942 domain-containing protein	NA	NA	NA	NA
WP_045599798.1\|1785192_1785495_+	hypothetical protein	NA	NA	NA	NA
WP_045599799.1\|1785496_1785850_+	hypothetical protein	NA	NA	NA	NA
WP_045599800.1\|1785843_1786212_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_045599801.1\|1786450_1788226_+	hypothetical protein	A0A1L7N0M1	Ralstonia_phage	1.8e-55	32.1
WP_045599802.1\|1788386_1789451_+	hypothetical protein	NA	NA	NA	NA
WP_045599803.1\|1789885_1790752_+	hypothetical protein	NA	NA	NA	NA
WP_158351394.1\|1790847_1791873_+	DUF2806 domain-containing protein	NA	NA	NA	NA
WP_127447040.1\|1792026_1792761_+	hypothetical protein	NA	NA	NA	NA
WP_127447039.1\|1792997_1793963_+	hypothetical protein	NA	NA	NA	NA
WP_045599807.1\|1793972_1795004_-	DUF4935 domain-containing protein	NA	NA	NA	NA
WP_045598724.1\|1795317_1795785_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_045598725.1\|1795784_1796138_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.3e-16	38.5
WP_045598726.1\|1796237_1797860_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	2.1e-66	33.7
WP_045598729.1\|1797869_1798130_-	hypothetical protein	NA	NA	NA	NA
WP_045599808.1\|1799533_1799953_-	hypothetical protein	NA	NA	NA	NA
WP_102889787.1\|1799919_1800731_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_127447038.1\|1801691_1801982_+	hypothetical protein	NA	NA	NA	NA
WP_082255761.1\|1802029_1803625_+	DUF3987 domain-containing protein	NA	NA	NA	NA
WP_045599810.1\|1804032_1805196_+	inovirus-type Gp2 protein	NA	NA	NA	NA
WP_127447037.1\|1805179_1806040_-	hypothetical protein	NA	NA	NA	NA
WP_045599811.1\|1806036_1807239_-\|integrase	integrase arm-type DNA-binding domain-containing protein	B7SYF8	Stenotrophomonas_phage	1.0e-105	49.5
1807435:1807480	attL	NA	NA	NA	NA
WP_127447036.1\|1807864_1808704_-	hypothetical protein	NA	NA	NA	NA
WP_127447035.1\|1808950_1809508_-	hypothetical protein	NA	NA	NA	NA
WP_052712471.1\|1810034_1810436_-	hypothetical protein	NA	NA	NA	NA
WP_045599812.1\|1810684_1811152_-	DUF4411 family protein	NA	NA	NA	NA
WP_045599813.1\|1811151_1812309_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_127447034.1\|1812311_1812584_-	hypothetical protein	NA	NA	NA	NA
WP_144411827.1\|1813736_1813991_-	hypothetical protein	NA	NA	NA	NA
WP_045599815.1\|1813989_1814187_+	hypothetical protein	NA	NA	NA	NA
WP_127447033.1\|1814375_1814648_-	hypothetical protein	NA	NA	NA	NA
WP_045599817.1\|1814681_1815653_-	type IV secretion system protein	NA	NA	NA	NA
WP_052712472.1\|1816153_1816813_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_045599819.1\|1817292_1818345_-\|integrase	tyrosine-type recombinase/integrase	W6MYA3	Pseudomonas_phage	2.4e-50	38.2
WP_045600839.1\|1818538_1819051_-\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	1.5e-21	52.5
1818443:1818488	attR	NA	NA	NA	NA

DBSCAN-SWA_8

2030957 : 2068250

Leptospira_phage(30.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_102889787.1\|2030957_2031769_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_045599880.1\|2031895_2032519_+	LysE family translocator	NA	NA	NA	NA
WP_009906604.1\|2032783_2034445_-	acid phosphatase	NA	NA	NA	NA
WP_009906606.1\|2034998_2035673_-	DUF799 domain-containing protein	NA	NA	NA	NA
WP_009906607.1\|2035681_2036119_-	DUF4810 domain-containing protein	NA	NA	NA	NA
WP_009906608.1\|2036178_2036856_-	CsgG/HfaB family protein	NA	NA	NA	NA
WP_155275006.1\|2036870_2037455_+	hypothetical protein	NA	NA	NA	NA
WP_009906613.1\|2037731_2038547_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_009906614.1\|2038682_2039159_-	hypothetical protein	NA	NA	NA	NA
WP_011402617.1\|2039619_2041425_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	7.0e-10	55.6
WP_082255753.1\|2041781_2044127_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_009906618.1\|2044162_2045293_+	DegT/DnrJ/EryC1/StrS family aminotransferase	NA	NA	NA	NA
WP_011402619.1\|2045282_2045993_+	WbqC family protein	NA	NA	NA	NA
WP_009906620.1\|2045989_2046622_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_009906621.1\|2046621_2047281_+	acetyltransferase	NA	NA	NA	NA
WP_045599881.1\|2047291_2048251_+	hypothetical protein	NA	NA	NA	NA
WP_019255924.1\|2048399_2049143_-	streptogramin acetyl transferase	M1I2A5	Paramecium_bursaria_Chlorella_virus	2.2e-10	33.3
WP_009910161.1\|2049675_2050320_-	lytic polysaccharide monooxygenase	A0A0K1Y848	Apis_mellifera_filamentous_virus	2.3e-08	31.9
WP_127447030.1\|2050851_2052516_-\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	3.6e-61	51.9
WP_162486614.1\|2052573_2053347_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_045599882.1\|2053934_2054240_+	H-NS histone family protein	NA	NA	NA	NA
WP_045599883.1\|2054560_2057341_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	8.0e-90	34.2
WP_045598892.1\|2057469_2057943_+\|transposase	transposase	NA	NA	NA	NA
WP_045598698.1\|2057918_2058269_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.1e-17	39.4
WP_045598699.1\|2058300_2059866_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	9.8e-69	34.0
WP_045599884.1\|2059926_2062113_+	DUF3274 domain-containing protein	A0A077K801	Ralstonia_phage	3.0e-23	28.9
WP_045599886.1\|2062131_2063790_+	DUF2875 family protein	NA	NA	NA	NA
WP_045599887.1\|2063799_2064063_+	PAAR domain-containing protein	NA	NA	NA	NA
WP_144411828.1\|2064193_2065009_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	3.3e-07	36.8
WP_045598729.1\|2066357_2066618_+	hypothetical protein	NA	NA	NA	NA
WP_045598726.1\|2066627_2068250_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	2.1e-66	33.7

DBSCAN-SWA_9

2077371 : 2087491

Burkholderia_phage(25.0%)

transposase,integrase

attL 2080117:2080168|attR 2092450:2092501

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025405302.1\|2077371_2078592_+\|transposase	ISL3 family transposase	A9YX10	Burkholderia_phage	4.4e-226	92.6
WP_045599893.1\|2079028_2079226_+	hypothetical protein	K4NZY3	Burkholderia_phage	7.5e-27	93.8
2080117:2080168	attL	NA	NA	NA	NA
WP_045599894.1\|2080362_2081871_-	hypothetical protein	P79669	Escherichia_phage	1.9e-13	21.0
WP_082255747.1\|2082018_2082351_-	helix-turn-helix transcriptional regulator	A0A088CD40	Shigella_phage	6.5e-15	51.1
WP_045599895.1\|2082343_2082676_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A088CBP5	Shigella_phage	1.7e-18	51.9
WP_045600852.1\|2082717_2083305_-\|integrase	site-specific integrase	A0A0S2SYQ7	Pseudomonas_phage	3.1e-44	48.9
WP_045599896.1\|2083652_2084432_-	hypothetical protein	A0A1W5LU59	Ralstonia_phage	8.4e-37	42.2
WP_045599897.1\|2084956_2085190_+	hypothetical protein	NA	NA	NA	NA
WP_045599900.1\|2085203_2086568_-	type II secretory pathway protein	NA	NA	NA	NA
WP_045599095.1\|2086564_2087491_-	AAA family ATPase	Q6UAZ2	Ralstonia_phage	4.2e-27	36.7
2092450:2092501	attR	NA	NA	NA	NA

DBSCAN-SWA_10

2488124 : 2530975

Escherichia_phage(22.22%)

transposase,holin,integrase,tRNA

attL 2488605:2488624|attR 2536290:2536309

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009893359.1\|2488124_2489120_-\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	2.6e-107	71.0
2488605:2488624	attL	NA	NA	NA	NA
WP_004199336.1\|2489116_2489521_-	dihydroneopterin aldolase	NA	NA	NA	NA
WP_045600063.1\|2489602_2490538_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_009902404.1\|2490551_2491742_+	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_009893351.1\|2491760_2491955_+	DUF2905 domain-containing protein	NA	NA	NA	NA
WP_009893349.1\|2492043_2492268_-	hypothetical protein	NA	NA	NA	NA
WP_009902405.1\|2492451_2493360_-	carbohydrate kinase	NA	NA	NA	NA
WP_009893347.1\|2493356_2494769_-	AGE family epimerase/isomerase	NA	NA	NA	NA
WP_009902407.1\|2494765_2495785_-	LacI family transcriptional regulator	NA	NA	NA	NA
WP_045600065.1\|2495956_2497516_-	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	6.9e-14	38.7
WP_025404568.1\|2497971_2499018_-	bile acid:sodium symporter	NA	NA	NA	NA
WP_025404567.1\|2499405_2499897_+	hypothetical protein	NA	NA	NA	NA
WP_009902428.1\|2500301_2501378_+	porin	NA	NA	NA	NA
WP_009902430.1\|2501537_2502500_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_009893335.1\|2502685_2503645_-	nitronate monooxygenase	NA	NA	NA	NA
WP_009902431.1\|2503941_2504835_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_045600067.1\|2504925_2505414_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_025404565.1\|2505525_2506440_+	DMT family transporter	NA	NA	NA	NA
WP_045600068.1\|2506666_2506999_-	DUF1289 domain-containing protein	NA	NA	NA	NA
WP_009902438.1\|2506995_2507502_-	YbaK/EbsC family protein	NA	NA	NA	NA
WP_009902439.1\|2507551_2508484_-	hydroxymethylglutaryl-CoA lyase	A0A1V0SKU2	Klosneuvirus	9.1e-38	32.7
WP_045600069.1\|2508569_2509511_-	glyoxylate/hydroxypyruvate reductase A	NA	NA	NA	NA
WP_009893323.1\|2509515_2509953_-	VOC family protein	NA	NA	NA	NA
WP_045600071.1\|2510102_2510741_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_045600073.1\|2511121_2513239_-\|holin	phospholipase C, phosphocholine-specific	NA	NA	NA	NA
WP_025404562.1\|2513285_2513597_-	hypothetical protein	NA	NA	NA	NA
WP_009902447.1\|2514038_2514497_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_019256199.1\|2514621_2515350_+	AzlC family ABC transporter permease	NA	NA	NA	NA
WP_009893313.1\|2515346_2515649_+	AzlD family protein	NA	NA	NA	NA
WP_025404561.1\|2515645_2516479_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_045600076.1\|2516767_2517661_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_082255903.1\|2517870_2519220_+\|integrase	integrase family protein	NA	NA	NA	NA
WP_025404559.1\|2519216_2520035_+	hypothetical protein	NA	NA	NA	NA
WP_004545945.1\|2520236_2520431_+	hypothetical protein	NA	NA	NA	NA
WP_082255902.1\|2520452_2521175_+	hypothetical protein	NA	NA	NA	NA
WP_102889803.1\|2521117_2522253_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.2e-14	29.9
WP_045600080.1\|2522397_2524473_+	molybdopterin oxidoreductase family protein	A0A077SK27	Escherichia_phage	8.2e-55	26.7
WP_009888736.1\|2524612_2526286_+	long-chain fatty acid--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	9.9e-35	26.6
WP_045599821.1\|2526510_2527107_-	plasmid pRiA4b ORF-3 family protein	A0A2H4PDG5	Mycobacterium_phage	8.4e-29	39.7
WP_045599822.1\|2527146_2528709_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	9.3e-144	52.3
WP_025404693.1\|2528738_2529086_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	1.2e-40	71.0
WP_082255759.1\|2529085_2529448_-\|transposase	transposase	NA	NA	NA	NA
WP_045600741.1\|2529646_2530975_+\|transposase	IS4 family transposase	NA	NA	NA	NA
2536290:2536309	attR	NA	NA	NA	NA

DBSCAN-SWA_11

2750949 : 2760180

Hokovirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009904051.1\|2750949_2752902_+	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	6.6e-147	50.3
WP_009889258.1\|2753165_2754296_+	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	1.8e-24	38.0
WP_025404755.1\|2754327_2756337_+	bifunctional anthranilate synthase component I family protein/class IV aminotransferase	S4VT78	Pandoravirus	8.2e-52	34.7
WP_009904054.1\|2756512_2757328_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	3.3e-36	32.9
WP_045600868.1\|2757392_2758076_-	deoxynucleoside kinase	A0A249XZR7	Enterococcus_phage	2.6e-05	26.0
WP_045600187.1\|2758072_2758600_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_009904055.1\|2758635_2760180_-	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	2.5e-24	31.2

DBSCAN-SWA_12

3125921 : 3134631

Bacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009904402.1\|3125921_3127322_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	1.4e-79	38.7
WP_052712481.1\|3127290_3128277_+	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	1.4e-15	27.4
WP_009904403.1\|3128334_3129327_+	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	9.1e-28	30.9
WP_009889858.1\|3129398_3129716_+	competence protein ComE	NA	NA	NA	NA
WP_009904404.1\|3130050_3130953_+	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	4.3e-53	39.9
WP_045600363.1\|3131047_3132289_-	lytic murein transglycosylase B	NA	NA	NA	NA
WP_009889864.1\|3132467_3133391_+	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	3.2e-43	36.2
WP_009904406.1\|3133719_3134631_-	alpha/beta hydrolase	A7XCB7	Tanapox_virus	9.2e-19	26.8

DBSCAN-SWA_13

3419732 : 3523069

106

uncultured_Caudovirales_phage(22.45%)

tRNA,terminase,head,transposase,plate,tail,protease,capsid,portal,integrase

attL 3439190:3439209|attR 3529465:3529484

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045600498.1\|3419732_3421259_-\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	7.3e-85	36.2
WP_080554852.1\|3421331_3422360_-	peptide chain release factor 2	A0A0S4KWG0	Pseudomonas_phage	2.0e-06	37.1
WP_009909025.1\|3422663_3424358_-	single-stranded-DNA-specific exonuclease RecJ	A0A0K2FM92	Brevibacillus_phage	1.4e-28	27.5
WP_082255967.1\|3424373_3425459_-	regulator	NA	NA	NA	NA
WP_009890181.1\|3425808_3427062_+	lipoprotein-releasing ABC transporter permease subunit	NA	NA	NA	NA
WP_011402197.1\|3427054_3427804_+	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	4.9e-34	38.4
WP_009904677.1\|3427808_3428597_+	TatD family hydrolase	NA	NA	NA	NA
WP_045600502.1\|3428650_3431188_+	DNA internalization-related competence protein ComEC/Rec2	NA	NA	NA	NA
WP_009890187.1\|3431224_3432052_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_009904686.1\|3432294_3433956_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.4e-150	52.0
WP_009890191.1\|3433952_3434807_+	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	1.0e-48	41.3
WP_009890193.1\|3434911_3436195_+	phosphopyruvate hydratase	W6LP63	Streptococcus_phage	9.3e-150	62.1
WP_009890195.1\|3436286_3436718_+	cell division protein FtsB	NA	NA	NA	NA
WP_045600503.1\|3436879_3437224_-	hypothetical protein	NA	NA	NA	NA
WP_009904690.1\|3437312_3438263_-	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_009890200.1\|3438301_3438826_-	gamma carbonic anhydrase family protein	NA	NA	NA	NA
WP_045600504.1\|3439004_3439823_+	ferritin-like domain-containing protein	NA	NA	NA	NA
3439190:3439209	attL	NA	NA	NA	NA
WP_009904693.1\|3440109_3441000_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_045600900.1\|3441211_3442042_+	PHP domain-containing protein	NA	NA	NA	NA
WP_009904695.1\|3442105_3442735_+	threonylcarbamoyl-AMP synthase	NA	NA	NA	NA
WP_009890209.1\|3442833_3443499_+\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_009890211.1\|3443507_3444710_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_045600506.1\|3444706_3445324_+	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_045600508.1\|3445368_3446271_+	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_025404919.1\|3446381_3447524_+	outer membrane protein assembly factor BamC	NA	NA	NA	NA
WP_009904699.1\|3447530_3448307_+	MBL fold metallo-hydrolase	U5PVD0	Bacillus_phage	4.3e-09	27.1
WP_009904703.1\|3448972_3450160_-	cupin domain-containing protein	NA	NA	NA	NA
WP_045600509.1\|3450228_3450774_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_045600510.1\|3450753_3452052_-	hypothetical protein	NA	NA	NA	NA
WP_045600512.1\|3452038_3454720_-	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	2.2e-28	24.0
WP_004547867.1\|3454879_3456181_+\|integrase	integrase family protein	C7BGE7	Burkholderia_phage	2.3e-148	58.9
WP_009890227.1\|3456131_3456374_-	AlpA family phage regulatory protein	C7BGF0	Burkholderia_phage	9.3e-19	59.2
WP_045600901.1\|3456382_3456856_-	hypothetical protein	B5TA88	Burkholderia_phage	2.3e-05	71.4
WP_025405240.1\|3456864_3457194_-	hypothetical protein	NA	NA	NA	NA
WP_009964483.1\|3457307_3458624_-	ParB N-terminal domain-containing protein	NA	NA	NA	NA
WP_045600513.1\|3458623_3459073_-	hypothetical protein	NA	NA	NA	NA
WP_004534172.1\|3459069_3459675_-	hypothetical protein	NA	NA	NA	NA
WP_045600515.1\|3459671_3460007_-	hypothetical protein	NA	NA	NA	NA
WP_004550209.1\|3460058_3460277_-	hypothetical protein	NA	NA	NA	NA
WP_123850154.1\|3460405_3460861_-	hypothetical protein	NA	NA	NA	NA
WP_009909040.1\|3460808_3461294_-	helix-turn-helix transcriptional regulator	A0A193GYL7	Enterobacter_phage	4.4e-12	41.2
WP_076853252.1\|3461442_3461670_+	hypothetical protein	NA	NA	NA	NA
WP_045599434.1\|3461758_3462286_+	hypothetical protein	C7BGG0	Burkholderia_phage	4.4e-29	46.8
WP_082255966.1\|3462299_3462632_+	hypothetical protein	NA	NA	NA	NA
WP_045600516.1\|3463338_3463797_+	hypothetical protein	NA	NA	NA	NA
WP_045600903.1\|3464170_3464641_+	hypothetical protein	NA	NA	NA	NA
WP_045600517.1\|3464762_3467255_+	virulence protein E	A0A2D1GN57	Marinobacter_phage	2.5e-98	41.5
WP_017844234.1\|3467472_3468246_+	hypothetical protein	NA	NA	NA	NA
WP_009944039.1\|3468808_3469075_-	DUF1883 domain-containing protein	NA	NA	NA	NA
WP_082255861.1\|3469273_3469843_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_082255860.1\|3469805_3471794_+\|terminase	phage terminase large subunit family protein	A0A2D1GMT1	Marinobacter_phage	6.0e-180	53.4
WP_004533700.1\|3471804_3472011_+	hypothetical protein	NA	NA	NA	NA
WP_045600519.1\|3472007_3473501_+\|portal	phage portal protein	A0A2H4JFL5	uncultured_Caudovirales_phage	1.2e-135	51.4
WP_045600520.1\|3473497_3474565_+\|protease	Clp protease ClpP	A0A2H4JDI2	uncultured_Caudovirales_phage	1.1e-50	37.8
WP_004539732.1\|3474591_3474936_+\|head	head decoration protein	NA	NA	NA	NA
WP_082255859.1\|3474970_3475996_+\|capsid	major capsid protein	A0A2H4J890	uncultured_Caudovirales_phage	1.7e-109	59.1
WP_045599421.1\|3475999_3476290_+	hypothetical protein	NA	NA	NA	NA
WP_045599420.1\|3476291_3476822_+\|tail	phage tail protein	A0A2H4JBV1	uncultured_Caudovirales_phage	2.4e-11	29.6
WP_045600523.1\|3476811_3477345_+	hypothetical protein	Q9JML9	Wolbachia_phage	1.8e-22	38.8
WP_025405226.1\|3477347_3478028_+\|plate	phage baseplate assembly protein V	A0A1B2LRU5	Wolbachia_phage	1.5e-18	34.4
WP_025405225.1\|3478091_3478298_+	hypothetical protein	NA	NA	NA	NA
WP_045600525.1\|3478294_3478639_+\|plate	phage baseplate protein	A0A2H4JA09	uncultured_Caudovirales_phage	3.2e-25	50.9
WP_045600526.1\|3478635_3479529_+\|plate	baseplate J protein	D5LGZ3	Escherichia_phage	2.4e-51	41.9
WP_045600528.1\|3479518_3480088_+\|tail	phage tail protein I	A4JWL7	Burkholderia_virus	1.8e-36	47.6
WP_045600530.1\|3480084_3481485_+	hypothetical protein	A4JWL8	Burkholderia_virus	2.8e-160	61.0
WP_045600532.1\|3481500_3481935_+\|tail	tail assembly chaperone	A4JWL9	Burkholderia_virus	2.4e-41	74.6
WP_045600533.1\|3482009_3483179_+\|tail	phage tail sheath family protein	A0A2H4J869	uncultured_Caudovirales_phage	1.1e-160	74.3
WP_045599404.1\|3483189_3483693_+\|tail	phage major tail tube protein	A0A2H4JBU0	uncultured_Caudovirales_phage	7.3e-42	49.1
WP_045600534.1\|3483764_3484067_+\|tail	phage tail assembly protein	V5YST8	Pseudomonas_phage	1.1e-05	37.2
WP_045600536.1\|3484154_3486569_+\|tail	phage tail tape measure protein	A0A2H4JG00	uncultured_Caudovirales_phage	4.7e-70	33.2
WP_045600537.1\|3486577_3487459_+\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	1.9e-32	38.5
WP_045600906.1\|3487433_3487640_+\|tail	phage tail protein	A0A2H4J9Z9	uncultured_Caudovirales_phage	1.2e-14	59.7
WP_045600538.1\|3487649_3488702_+	phage late control D protein	A0A2H4JBF6	uncultured_Caudovirales_phage	2.7e-78	44.5
WP_004533694.1\|3488777_3488972_+	hypothetical protein	NA	NA	NA	NA
WP_045600540.1\|3488964_3489462_+	lysozyme	A4JX20	Burkholderia_virus	3.6e-65	75.4
WP_045600542.1\|3489461_3490007_+	lysozyme	Q8W6S5	Burkholderia_virus	9.2e-83	95.6
WP_045600543.1\|3490150_3490939_+	DNA adenine methylase	Q8W6S4	Burkholderia_virus	1.6e-152	97.3
WP_024430649.1\|3490979_3491690_-	hypothetical protein	A4PE26	Ralstonia_virus	2.6e-37	41.0
WP_045600908.1\|3491701_3492217_-	hypothetical protein	NA	NA	NA	NA
WP_045600544.1\|3492188_3492662_-	hypothetical protein	NA	NA	NA	NA
WP_045600910.1\|3492654_3493161_-	DUF4123 domain-containing protein	A4PE24	Ralstonia_virus	4.3e-18	39.4
WP_025404957.1\|3493160_3493586_-	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	2.4e-14	48.3
WP_025405797.1\|3493647_3493929_-	hypothetical protein	NA	NA	NA	NA
WP_009904707.1\|3493928_3494393_-	hypothetical protein	C7BGE3	Burkholderia_phage	8.8e-50	61.0
WP_045600545.1\|3494472_3495144_+	DUF159 family protein	Q8W6R8	Burkholderia_virus	4.9e-110	81.9
WP_082255857.1\|3495263_3495749_+	DUF3304 domain-containing protein	NA	NA	NA	NA
WP_052712484.1\|3495774_3497367_+	DUF2235 domain-containing protein	NA	NA	NA	NA
WP_102860126.1\|3498002_3499202_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	9.2e-43	42.7
WP_080403979.1\|3499877_3500900_-	ParA family protein	H2BD62	Pseudomonas_phage	1.8e-50	35.5
WP_019254661.1\|3502536_3502809_+	hypothetical protein	NA	NA	NA	NA
WP_009890278.1\|3503073_3503877_-	inositol monophosphatase	NA	NA	NA	NA
WP_025404921.1\|3504188_3505100_+	RNA methyltransferase	NA	NA	NA	NA
WP_009890280.1\|3505301_3506084_+	serine O-acetyltransferase	NA	NA	NA	NA
WP_009890284.1\|3506457_3507258_-	UDP-2,3-diacylglucosamine diphosphatase	NA	NA	NA	NA
WP_009890286.1\|3507281_3507773_-	peptidyl-prolyl cis-trans isomerase	A0A2H4UTF4	Bodo_saltans_virus	8.2e-06	29.8
WP_009890287.1\|3507853_3508429_-	peptidyl-prolyl cis-trans isomerase	A0A1V0SCU1	Indivirus	2.4e-12	40.0
WP_019254658.1\|3508484_3509207_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_009890291.1\|3509437_3510835_+\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	2.4e-42	33.8
WP_045600549.1\|3510882_3511821_+	DNA-3-methyladenine glycosylase 2 family protein	NA	NA	NA	NA
WP_009904725.1\|3511923_3512895_+	acetyl-CoA carboxylase carboxyltransferase subunit alpha	NA	NA	NA	NA
WP_045600551.1\|3512938_3514411_+\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_009890299.1\|3514751_3516002_+	aspartate kinase	NA	NA	NA	NA
WP_127447014.1\|3516700_3518440_+	AAA family ATPase	NA	NA	NA	NA
WP_102889803.1\|3521181_3522317_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.2e-14	29.9
WP_045600558.1\|3522350_3522707_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	6.5e-37	70.3
WP_082255759.1\|3522706_3523069_-\|transposase	transposase	NA	NA	NA	NA
3529465:3529484	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP010018

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP010016

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

3. NZ_CP010017

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection