CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_LM655252	Candidatus Evansia muelleri genome assembly CEM1.1, chromosome : I	1 crisprs	NA	3	1	3	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_LM655252_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LM655252_1

251649-251927

Orphan

Consensus_repeat	Method
AATATTAAAAAAAATATT	CRT

6 spacers

The CRISPR arrays of NZ_LM655252_1

>merge|NZ_LM655252|1|251649-251927|CRT
AATATTGAAAATAATATTAAAAAAAATATAAAAAAAAATATTAAAAAAAATATTAAAAAAAATATTGAAAATAATATGGAAAATATTAAAAAAAATATTGAAAAGAATATTAAAAAAAATATTAAAAAAAATCTTGAAAATAATATTAAAAAAAATATTGAAAATAATATTGAAAATAATATTGAAAATCATATTAAAAAAAATATTAAAAAAAATATTAAAAAAAATATTAAAAAAAATCTTGAAAATAATATTGAAAACAATATTAATGAAAAACCC

>NZ_LM655252|1|1|251649-251927|CRT
AATATTGAAAATAATATT	AAAAAAAATATAAAAAAA
AATATTAAAAAAAATATT	AAAAAAAATATTGAAAATAATATGGAAAATATTAAAAAAAATATTGAAAAG
AATATTAAAAAAAATATT	AAAAAAAATCTTGAAAAT
AATATTAAAAAAAATATT	GAAAATAATATTGAAAATAATATTGAAAAT
CATATTAAAAAAAATATT	AAAAAAAATATTAAAAAA
AATATTAAAAAAAATCTT	GAAAATAATATTGAAAAC
AATATTAATGAAAAACCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LM655252.1\|WP_045086273.1\|242679_243099_+\|F0F1-ATP-synthase-subunit-epsilon	unknown	unknown	gnl\|CDD\|234796
NZ_LM655252.1\|WP_045086280.1\|254062_254332_+\|30S-ribosomal-protein-S15	unknown	unknown	gnl\|CDD\|180170
NZ_LM655252.1\|WP_082041952.1\|249600_251313_+\|ATP-dependent-zinc-metalloprotease-FtsH	unknown	unknown	gnl\|CDD\|273520
NZ_LM655252.1\|WP_045086276.1\|246777_247665_-\|glycine--tRNA-ligase-subunit-alpha	unknown	unknown	gnl\|CDD\|236473
NZ_LM655252.1\|WP_045086278.1\|249040_249514_+\|Holliday-junction-resolvase-RuvX	unknown	unknown	gnl\|CDD\|340815
NZ_LM655252.1\|WP_045086283.1\|256019_256394_+\|NADH-quinone-oxidoreductase-subunit-A	unknown	unknown	gnl\|CDD\|180638
NZ_LM655252.1\|WP_045086275.1\|244680_246756_-\|glycine--tRNA-ligase-subunit-beta	unknown	unknown	gnl\|CDD\|234925
NZ_LM655252.1\|WP_045086277.1\|248377_248974_+\|RlmE-family-RNA-methyltransferase	unknown	unknown	gnl\|CDD\|223370
NZ_LM655252.1\|WP_082041947.1\|259289_260618_+\|NADH-quinone-oxidoreductase-subunit-NuoF	unknown	unknown	gnl\|CDD\|236891
NZ_LM655252.1\|WP_045086287.1\|260647_263386_+\|NADH-quinone-oxidoreductase-subunit-NuoG	unknown	unknown	gnl\|CDD\|236170
NZ_LM655252.1\|WP_045086286.1\|258801_259293_+\|NADH-quinone-oxidoreductase-subunit-NuoE	unknown	unknown	gnl\|CDD\|181024
NZ_LM655252.1\|WP_102029576.1\|256412_257027_+\|NADH-quinone-oxidoreductase-subunit-B	unknown	unknown	gnl\|CDD\|235797
NZ_LM655252.1\|WP_045086279.1\|253659_253944_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376719
NZ_LM655252.1\|WP_045086274.1\|243102_244104_+\|ornithine-carbamoyltransferase	unknown	unknown	gnl\|CDD\|179366
NZ_LM655252.1\|WP_045086281.1\|254550_255306_+\|ferredoxin--NADP-reductase	unknown	unknown	gnl\|CDD\|99792
NZ_LM655252.1\|WP_045086382.1\|247669_248338_-\|ribose-5-phosphate-isomerase-RpiA	unknown	unknown	gnl\|CDD\|234816
NZ_LM655252.1\|WP_045086285.1\|257045_258782_+\|NADH-quinone-oxidoreductase-subunit-C/D	unknown	unknown	gnl\|CDD\|236965
NZ_LM655252.1\|WP_045086272.1\|241288_242683_+\|F0F1-ATP-synthase-subunit-beta	unknown	unknown	gnl\|CDD\|236447
NZ_LM655252.1\|WP_052661168.1\|244312_244615_-\|DNA-directed-RNA-polymerase-subunit-omega	unknown	unknown	gnl\|CDD\|234744
NZ_LM655252.1\|WP_045086282.1\|255309_255975_+\|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB	unknown	unknown	gnl\|CDD\|234649

Protein	Function_ID	Function_description	E-value
NZ_LM655252.1\|WP_045086273.1\|242679_243099_+\|F0F1-ATP-synthase-subunit-epsilon	gnl\|CDD\|234796	PRK00571, atpC, F0F1 ATP synthase subunit epsilon; Validated.	5.32725e-49
NZ_LM655252.1\|WP_045086280.1\|254062_254332_+\|30S-ribosomal-protein-S15	gnl\|CDD\|180170	PRK05626, rpsO, 30S ribosomal protein S15; Reviewed.	5.88423e-38
NZ_LM655252.1\|WP_082041952.1\|249600_251313_+\|ATP-dependent-zinc-metalloprotease-FtsH	gnl\|CDD\|273520	TIGR01241, ATP-dependent_zinc_metalloprotease_FtsH, ATP-dependent metalloprotease FtsH. HflB(FtsH) is a pleiotropic protein required for correct cell division in bacteria. It has ATP-dependent zinc metalloprotease activity. It was formerly designated cell division protein FtsH. [Cellular processes, Cell division, Protein fate, Degradation of proteins, peptides, and glycopeptides].	0
NZ_LM655252.1\|WP_045086276.1\|246777_247665_-\|glycine--tRNA-ligase-subunit-alpha	gnl\|CDD\|236473	PRK09348, glyQ, glycyl-tRNA synthetase subunit alpha; Validated.	0
NZ_LM655252.1\|WP_045086278.1\|249040_249514_+\|Holliday-junction-resolvase-RuvX	gnl\|CDD\|340815	cd16964, YqgF, putative pre-16S rRNA nuclease YqgF and RuvX family. Escherichia coli YqgF has been shown to act as a pre-16S rRNA nuclease, presumably as a monomer. It is involved in the processing of pre-16S rRNA during ribosome maturation. The RuvX gene product from Mycobacterium tuberculosis was shown to act, in a dimeric form, as a Holliday junction resolvase (HJR). HJRs endonucleases specifically resolve Holliday junction DNA intermediates during homologous recombination. Holliday junctions are formed by the reciprocal exchange of strands between two DNA duplexes. HJRs occur in archaea, bacteria, and in the mitochondria of certain fungi; they may form homodimers and display structural similarity to RNase H and Hsp70.	9.8994e-25
NZ_LM655252.1\|WP_045086283.1\|256019_256394_+\|NADH-quinone-oxidoreductase-subunit-A	gnl\|CDD\|180638	PRK06602, PRK06602, NADH:ubiquinone oxidoreductase subunit A; Validated.	6.8104e-34
NZ_LM655252.1\|WP_045086275.1\|244680_246756_-\|glycine--tRNA-ligase-subunit-beta	gnl\|CDD\|234925	PRK01233, glyS, glycyl-tRNA synthetase subunit beta; Validated.	0
NZ_LM655252.1\|WP_045086277.1\|248377_248974_+\|RlmE-family-RNA-methyltransferase	gnl\|CDD\|223370	COG0293, FtsJ, 23S rRNA methylase [Translation, ribosomal structure and biogenesis].	6.04921e-72
NZ_LM655252.1\|WP_082041947.1\|259289_260618_+\|NADH-quinone-oxidoreductase-subunit-NuoF	gnl\|CDD\|236891	PRK11278, PRK11278, NADH-quinone oxidoreductase subunit NuoF.	0
NZ_LM655252.1\|WP_045086287.1\|260647_263386_+\|NADH-quinone-oxidoreductase-subunit-NuoG	gnl\|CDD\|236170	PRK08166, PRK08166, NADH-quinone oxidoreductase subunit NuoG.	0
NZ_LM655252.1\|WP_045086286.1\|258801_259293_+\|NADH-quinone-oxidoreductase-subunit-NuoE	gnl\|CDD\|181024	PRK07539, PRK07539, NADH-quinone oxidoreductase subunit NuoE.	3.16135e-73
NZ_LM655252.1\|WP_102029576.1\|256412_257027_+\|NADH-quinone-oxidoreductase-subunit-B	gnl\|CDD\|235797	PRK06411, PRK06411, NADH-quinone oxidoreductase subunit NuoB.	3.43848e-100
NZ_LM655252.1\|WP_045086279.1\|253659_253944_+\|hypothetical-protein	gnl\|CDD\|376719	pfam02033, RBFA, Ribosome-binding factor A.	4.01799e-19
NZ_LM655252.1\|WP_045086274.1\|243102_244104_+\|ornithine-carbamoyltransferase	gnl\|CDD\|179366	PRK02102, PRK02102, ornithine carbamoyltransferase; Validated.	1.73294e-177
NZ_LM655252.1\|WP_045086281.1\|254550_255306_+\|ferredoxin--NADP-reductase	gnl\|CDD\|99792	cd06195, FNR1, Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.	2.83688e-87
NZ_LM655252.1\|WP_045086382.1\|247669_248338_-\|ribose-5-phosphate-isomerase-RpiA	gnl\|CDD\|234816	PRK00702, PRK00702, ribose-5-phosphate isomerase RpiA.	1.34067e-90
NZ_LM655252.1\|WP_045086285.1\|257045_258782_+\|NADH-quinone-oxidoreductase-subunit-C/D	gnl\|CDD\|236965	PRK11742, PRK11742, bifunctional NADH:ubiquinone oxidoreductase subunit C/D; Provisional.	0
NZ_LM655252.1\|WP_045086272.1\|241288_242683_+\|F0F1-ATP-synthase-subunit-beta	gnl\|CDD\|236447	PRK09280, PRK09280, F0F1 ATP synthase subunit beta; Validated.	0
NZ_LM655252.1\|WP_052661168.1\|244312_244615_-\|DNA-directed-RNA-polymerase-subunit-omega	gnl\|CDD\|234744	PRK00392, rpoZ, DNA-directed RNA polymerase subunit omega; Reviewed.	1.60416e-09
NZ_LM655252.1\|WP_045086282.1\|255309_255975_+\|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB	gnl\|CDD\|234649	PRK00121, trmB, tRNA (guanine-N(7)-)-methyltransferase; Reviewed.	2.87224e-49

>NZ_LM655252.1|WP_082041952.1|249600_251313_+|ATP-dependent-zinc-metalloprotease-FtsH
MKKNIIKILFLLFLSYKFYIKKKIKIIIYSDFLNELYKKNVKKILIDGDYIYGITTNNLEFKTIFNKIYLSKLIKILIKNNINIEFFRQFQFFNFIYCKYFYIIIFILFIIYQIFFNKSNIKKKKNKNKIKFNDIVGCNEAKLEVKEIIDFLRKPVKFLKLGCKIPKGVLLIGPPGTGKTLLAKSISGEANVPFLYISGSDFIEMFVGIGAARVRDIFNKAKKIFPCIIFIDEIDAIGRKRNLNINNEEREQTLNQLLVEMDGFESNNKIIILAATNRPEILDLALLRPGRFDRKIFMNLPDINNRKKIIELYFSKIPLFYNVYSKMLSKTTYGFSGAEIYNIINEAAINSTNKNLRLISMYEIEEAKDKNLIGLKNQSYIIDKCNTAYHESGHTIIALLVYKHNPVYKVTIIPRGKTLGVTMFFSIKDNYNLSLINLKNHICTLLAGRIAEEITSGLNYITIGASNDIKQATELAYNMLAKWGFSSKLGPIMYIPDNDNLNIKYGKFSSSKTYNKFDLEIQKIINNCYLDTKIVLKTKRNLLNIMSKALILYETIYYNQIINIMKCIFI
>NZ_LM655252.1|WP_045086278.1|249040_249514_+|Holliday-junction-resolvase-RuvX
MENKIKQFRLLNFNKLIGKRRIMSFDFGMSKIGIAIGNEVSKNITSIKTIIAKKGKPDINNITYLILKWKPDMFLIGIPKYKKNYKSKLIRIIKEFANFMKYYFSRPCKIINEFGSTLEAKSIAKERSNFFKCKYNKMDINSISAEVICYMFFEKIF
>NZ_LM655252.1|WP_045086277.1|248377_248974_+|RlmE-family-RNA-methyltransferase
MDLKNHLKDIFVLRSKIDNYRSRASYKLLEICKKYKILKNVMLIIDLGSYPGGWSQILKKYLGSNSTIIALDIKQMESLPGVKFIKGDINNFKIHKKIFLYLNGKKVDLIISDMSPNISGHNIIDQSLMINLFNSALKLNKKILKINGNFIIKVFQGYNFKNYINNLKNYFKLVKIFKPYASKTFSKEIYLICLGFYK
>NZ_LM655252.1|WP_045086382.1|247669_248338_-|ribose-5-phosphate-isomerase-RpiA
MNNLKFAAANAAIEEIRSYLQKETIIGIGTGTTINFFIDLLKKLKGKFLGAVASSQSSAIRLKKYGILLFELNDIKYLPFYIDSADEIDINLSMIKGGGAALTREKIIAKYANRFICIADETKLVKNLGKFPIPIEFIPIAKNYIINKMYLIGANPIYRKGLLTDNGNHIIDLYNLINYINPVYIEKLLNNISGIVSNGIFAQRSADLLLLSKFNGVDYINR
>NZ_LM655252.1|WP_045086276.1|246777_247665_-|glycine--tRNA-ligase-subunit-alpha
MFLYKKLITFQQIILNLKKYWSEQGCIIIEPLDLEVGAGTFHPATFLKAIDPKSKIWNAAYLQSCRRPSDSRYAKTPNRIQHYYQFQVIMKPSPENLQELYINSLYNLGINPNIHDIRFVKDNWKSPVLGAWGLGWEIWINGMEVTQFTYLQQVGGIECNPIIGELTYGIERLAMYLQNVNDIYEIIWYFTLDGNQITYGNIYLQNEIDQSNYNLKYTNSKFLYNNFDYHENMCLQLIKFNLIYPAYEQIIKASHIFNIIDAKKSISITERQRYILRIRTMSCNLAKKYYNLRLK
>NZ_LM655252.1|WP_045086275.1|244680_246756_-|glycine--tRNA-ligase-subunit-beta
MSVKITLLIELGCEELPQYDSYNLSYNLEKNIINYFNLYKIIFDKSYVYNTPRRLSIIINNIEYNILDNYIEIIGPDIKIAIKNNQLTKKGIGFIKSKNINLKNLIIINTNKGKKIGYKYIKKSVSIKNILPKIIKISIEKISINNCMRWNIYNNKFCRPIRWLVILYGYDIIRIKLFGLLSNRITYGHRIHCFSPIILNNAKEYIYKLATLGNVIVDYNHRRKIIYNLIRQQALKINANIIIDNNLLNEVTGLVEWPIALIGNFNKYYLNIPYECIISTMKLNQKYFHIFDNKNKLLPKFLTIANIKSIDYKKIISDNERVINSRLCDAFFFFNSDIKIKLDYYRLNLKDIIFHPKLGSIAEKSNRLEIISANIANLIGGIKINAIRAAQLSKCDLVTKMVYEFPELQGIMGAHYAQKYGEKNDVVIAIYNQYLPKFSNDKIPQNKTSIAIALADKIDTIIGIFSIGLQPTGTKDPFALRRYTIGILNILIKSKYNLDLKNLLNLSINQYNILNKKKILIKVINYFYDKLCYWAINHGISKKFFFAIKALNVTNIFDFVKRMYILKQFNKNKYFLILVTSIKRILNILKKNNFFYKKYKLKINNNFFINNDEYYLFKIIIRIQSEIKILINNKNYYQALYILLSLITPIYNYFNNNIIIKKNKYVKYNIFALLNNLILLFFKVADISIFD
>NZ_LM655252.1|WP_052661168.1|244312_244615_-|DNA-directed-RNA-polymerase-subunit-omega
MIINLENCFKRIKNRFQLIYISCNRSRELSKGSSYSKLPNENNKPIIVALKEISRGYIHGSIPKNYKFNLKSEFGQNIKVQKLKLLEIQFQHLMSFNLIK
>NZ_LM655252.1|WP_045086274.1|243102_244104_+|ornithine-carbamoyltransferase
MFWCLRNKNILSFLNHTRKEIIHLLDLTCELKHAKKLGIEKTCLIGKNIALIFEKTSTRTRCSFEIAAYNQGAHITYINKTSQIGEKESIEDTAKVLSRIFDAIVYRGFSHLNIELLSKYANIPVFNALTNEFHPTQILADIFTMIENSEKKINNISYAYLGDARSNVGRSLIIIGAKLGMDVRIASPKLLWPSLDFIIACEKIAWFSGANLNFMEDPFLAVKGVDFIYTDVWVSIGESIQCWSDRIKLLMPYQVNNNLIKNSNNPIVKLMHCLPSFHNIETILSKQIINKYNYLDKGIEISEEVFKSSANIAFEQSENRMHTIKSILISSLI
>NZ_LM655252.1|WP_045086273.1|242679_243099_+|F0F1-ATP-synthase-subunit-epsilon
MINIVKCDIVSAESTIFSGNIIKIIVTGIEGELCIMPGHAPLLTTLLPAPVKIFCEGGEKEIFYISSGFLEIQPNLISILSDVALRAIDLDEYDSKKAYEQAKQLINNVYSNLEFKNALIEIAKALARLRTIKMLKNNH
>NZ_LM655252.1|WP_045086272.1|241288_242683_+|F0F1-ATP-synthase-subunit-beta
MIRGRIIQIIGAVIDVEFSHDSIPKIYDALNIKNCNIVLEVQQQLGDGIVRTIAMGPTEKLKRNMIVYNTNSPIKVPVGIKTLGRIINVLGQPIDDGISLSEEEHMSIHRNPPKYSDQSIYNEILETGIKVIDLLCPFSKGGKIGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFTGVGERTREGNDFYYEMKESNVLDKVALVYGQMNEPPGNRLRVALTGLTIAEKFRDEGNDVLLFIDNIYRFTLAGTEVSALLGRMPSAVGYQPTLAEEMGMFQERITSTNTGSITSVQAIYVPADDLTDPSPATTFAHLDATVVLSRQIAELGIYPAIDPLDSTSRQLDPLIIGEEHYNVARKVQKTLQRYKELKDIIAILGMDELSEEDKRLVARARKIQKFLSQPFFVAEIFNGIPGKYVSIKETISAFSLILNGDYDHIPEQFFYMVGNINEVIIKYNNSLKLNKL
>NZ_LM655252.1|WP_045086279.1|253659_253944_+|hypothetical-protein
MILFNKSLKIAKKIKKEIILIFKYKIKDPRLTNINISFININNDLKYIDIYFFKNFNFIKNFKKISGFLKYQLSCRLKISYIPELRFFYDNSII
>NZ_LM655252.1|WP_045086280.1|254062_254332_+|30S-ribosomal-protein-S15
MTISFTHKIKIIKNFGLSINNTGATEVQIALLTANIIKLQYHFKTNKNDFHSRRGLMGMVNKRRKLLIYLKNKDKDNYLSLIKNLKIRR
>NZ_LM655252.1|WP_045086281.1|254550_255306_+|ferredoxin--NADP-reductase
MKGFYPEKILNIYHWNKTLFSFKTTRERTLHFKNGQFLMIGIFINKNLIIRAYSIVSPNYINYFEFLSIKVINGKLTSILQNIKIGDIIFISNKPTGTIVIDNLHNGRYLYMFSTGTGIAPFISLIQDHELYYRFDKIILIHGTRYINDLVYNYFIKKELPQNKYIGKKLIKNLIYYTTVTREKYLNIGRITEHINSGKLFQDIAIPIINPKYDIAMICGSPNMIKEITNILNYKGFKSSIGDYVIERAFI
>NZ_LM655252.1|WP_045086282.1|255309_255975_+|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB
MYKKKIISIKSYVLRCGKNITLLHKYIIKKKFNKFKLNINKYINFKQLFGFKKIVIDIGFGMGDSLINQAINNPNIIYIGIEVYLPGIIRIINILNKNNIKNVKIIIGDAVLILKKFFNNSIDNIQIFFPDPWPKIKHNKRRIIFLSGFIINIIRCLKKEGILHIVTDNKNYALKIINFLENTKLYYIKKKNISRPITKYEQISKKLGNKIWEMIFYKYIY
>NZ_LM655252.1|WP_045086283.1|256019_256394_+|NADH-quinone-oxidoreductase-subunit-A
MILQYYGIFFFILVTIILLILIISISSLLGGISVGYQKNIPFESGILETGNARIRFPIKYYLVGIIFVIFDIETIYLLNWSISVRELGWQGFWCATIYIIILLIGLYYDINLGILNWNSEKKFK
>NZ_LM655252.1|WP_102029576.1|256412_257027_+|NADH-quinone-oxidoreductase-subunit-B
MFNLSEDIIKQQLCRNILMAKLEDFIRLIVNWGRKNSLWPYNFGLSCCYVEMTTAFTSPHDIARFGSEVIRASPRQADFMVIAGTCFIKMAPVIKQLYDQMLEPKWVISMGSCANSGGMYDIYSVVQGVDKFLPVDIYIPGCPPRPEAFLEGLQLLQNSIKEERRPLSWIIGNQGIYRSELYKNKLSLHNNSLKKKYFRKTNEI
>NZ_LM655252.1|WP_045086285.1|257045_258782_+|NADH-quinone-oxidoreductase-subunit-C/D
MNSKILKVIYKKFGDCFIYQKTLMNIPVIWINRNMLLNIMKFLRKGKYSFDMLFDLHAIDERFRNNRDGLPKSAFTVFYHILSFNYNDLMIKVSLLDESDIWLPSITNIWKNANWYEREVFDMFGINFKGHPDLRRILMPFTWKGHPLRKDYYSRATECDPFNMTNEKQYIEQEALRFYPEKWGMKLENNNQDYMFLNFGPNHPSAHGAFRIFLQLYGEEIVDCVPDIGYHHRGAEKIGERQTWHSYIPYTDRIDYTGGVINNLPYILAVEKLANIEIPERAKIIRVMMSEISRINSHLLFLGTYLQDLGAMTPVFFTFTDRQKAYEIIESITGSRMHPAWFRIGGVAQDLPKGWDRLIKSFIKYMPKRLNEYKLAMMDNAIIKKRTRFIAIYNTKEALEWGITGPNLRSTGFSFDVRKHRPYSGYENFDFEIPIGNNGDVYDRGIIRIEEMYQSLIIIEQCIKNMPEGNYKSDNLFTIPPLRKKMMYNIEDLINHFLQVSWGTIFKPNESFQMIEATKGINSYYLISDGNNTSYRTRIRTPSYPNLQHIREVIKGACFQDMIAHIASIDFVMSDVDR
>NZ_LM655252.1|WP_045086286.1|258801_259293_+|NADH-quinone-oxidoreductase-subunit-NuoE
MDNKNYLYNNVKSKERDEIISIIKNYEHPRAAIIEALKIVQKYRGWVPDNLIFFIAKLLNITTIDVEEVATFYSHIFRQKVGRNIILICDSITCYINGYKEIYNKLKLELKIVFGQTSPDKRFTLLPVCCLGNCDKSPTMMINKDTYNNINIKNIMNIIEMYK
>NZ_LM655252.1|WP_082041947.1|259289_260618_+|NADH-quinone-oxidoreductase-subunit-NuoF
MNYKLINKMPSFGKINLIEKNQEKNPLTWRLNNDGQPVYLKEYKFKNGYIGAQYALIKLKPNQIIEKIIKSGLKGRGGAGFPTGIKWNLTVKCDGIQRGYLICNADEMEPNTYKDRMLIEQQPHLLIEGMIIAGYANNSKIGYIFLRGEYIIAYKNIKFALEEARSVGLLGENILDSGYNFDIFIHVGAGRYICGEETALMNSLEGRRANPRAKPPFPGQSGVWGKPTVINNVETLCNIPSILALGVKWYHSLCRPCSEDHGTKLMGFTGKVKNPGLWELPLGITARELLENFAGGMQDGYTLKAWQPGGASTGFLLPKHLDIEMYSNGISKLGTRIGTALALAIDNTINIVSLICNIEEFFSRESCGFCTPCRDGLPWIVKLLQSLEEKKGKKEYIDILLDLTNKLSSGNTFCAHAPGAMEPLKSAIYYFYKDFENGIKKI
>NZ_LM655252.1|WP_045086287.1|260647_263386_+|NADH-quinone-oxidoreductase-subunit-NuoG
MNIINIDGKNYKVNSKNNLLHSCLSIGINIPYFCWHPSLGSIGACRQCAVKLYKNKYDINGKIIMSCMTGITNNMYISINDIDVITFRKNVIEWMMINHPHDCPVCEEGGNCHLQDMTIITEHKNRRYNFNKRTHENQNLGPFISHEMNRCISCYRCIRYYKDYAGGKDLGVFGMNNNIYFGRINDGMLESEFSGNITDICPTGVFTDKTYSYHYTRKWDLQYAPSICNACSVGCNISPGERYGKIRKIENRYNGLINKYFICDRGRFGYNYLNNNRPYYPKYKKNNNNLKIEDIFFSFDTAIKRGAFLLRNASRIIGIGSTRASIESNFALLMLVGLENFSTGIKEEELQRLKLMIKINQEFYSPSVRDIEEHDVIIILGEDVTQTAARIALAIRQSANNYRINKISNETNIPKWNINAINNCLQDYKSPIYIASVYETKLDDIARGTFYGTPEDITNLGYTLANAIDKKAPKVIDEFYYNIIDDIVESLKYSTRPLIITGESLNSISILHAAANLTKALKVIGKSVSLTFISKAANSTGLAILDGKSIDWALKNIVNKNADTVIILENDLYLHNKPLLVDKALNTANTIIVIDHQKTKTWEKAHLVLPTANFVESNGTLVNYEGRAQRFFKVYDPIYYNPNCLIKESWQWLHTLNVTIKNSLIEWKNFDNVVNACSKFKQELYNIKKAAPLSSFRIKGKKLSRSPSRYSGRTSMLSNININEPGQTKDKDTAFAFSMEGYFGHNEFYSQIPFTWSPGLNSSQACNKFHNVVGGNLRFGDPGIILFNKKKKIKNLKLNYFKYSHNIFKKQINNWQIIPIYHLFGSEETSSISKPIQKCIPEPYVLFNYKDIIKLGLNKYSKIYINVNTYKLNLSIRISNVLPHGIIGIPILSSIPSDIFGSWATITTEIII

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_LM655252_1	1.1\|251667\|18\|NZ_LM655252\|CRT	251667-251684	18	NZ_LM655252.1	227176-227193	1	0.944
NZ_LM655252_1	1.1\|251667\|18\|NZ_LM655252\|CRT	251667-251684	18	NZ_LM655252.1	292639-292656	1	0.944
NZ_LM655252_1	1.1\|251667\|18\|NZ_LM655252\|CRT	251667-251684	18	NZ_LM655252.1	294376-294393	1	0.944
NZ_LM655252_1	1.3\|251772\|18\|NZ_LM655252\|CRT	251772-251789	18	NZ_LM655252.1	297380-297397	1	0.944
NZ_LM655252_1	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	NZ_LM655252.1	245192-245209	1	0.944
NZ_LM655252_1	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	NZ_LM655252.1	271868-271885	1	0.944
NZ_LM655252_1	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	NZ_LM655252.1	211203-211220	1	0.944
NZ_LM655252_1	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	NZ_LM655252.1	249604-249621	1	0.944
NZ_LM655252_1	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	NZ_LM655252.1	316562-316579	1	0.944
NZ_LM655252_1	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	NZ_LM655252.1	352083-352100	1	0.944
NZ_LM655252_1	1.1\|251667\|18\|NZ_LM655252\|CRT	251667-251684	18	NZ_LM655252.1	58354-58371	2	0.889
NZ_LM655252_1	1.1\|251667\|18\|NZ_LM655252\|CRT	251667-251684	18	NZ_LM655252.1	102537-102554	2	0.889
NZ_LM655252_1	1.1\|251667\|18\|NZ_LM655252\|CRT	251667-251684	18	NZ_LM655252.1	208595-208612	2	0.889
NZ_LM655252_1	1.1\|251667\|18\|NZ_LM655252\|CRT	251667-251684	18	NZ_LM655252.1	211203-211220	2	0.889
NZ_LM655252_1	1.1\|251667\|18\|NZ_LM655252\|CRT	251667-251684	18	NZ_LM655252.1	215301-215318	2	0.889
NZ_LM655252_1	1.1\|251667\|18\|NZ_LM655252\|CRT	251667-251684	18	NZ_LM655252.1	249604-249621	2	0.889
NZ_LM655252_1	1.1\|251667\|18\|NZ_LM655252\|CRT	251667-251684	18	NZ_LM655252.1	249952-249969	2	0.889
NZ_LM655252_1	1.1\|251667\|18\|NZ_LM655252\|CRT	251667-251684	18	NZ_LM655252.1	249970-249987	2	0.889
NZ_LM655252_1	1.1\|251667\|18\|NZ_LM655252\|CRT	251667-251684	18	NZ_LM655252.1	253533-253550	2	0.889
NZ_LM655252_1	1.1\|251667\|18\|NZ_LM655252\|CRT	251667-251684	18	NZ_LM655252.1	313702-313719	2	0.889
NZ_LM655252_1	1.1\|251667\|18\|NZ_LM655252\|CRT	251667-251684	18	NZ_LM655252.1	313742-313759	2	0.889
NZ_LM655252_1	1.1\|251667\|18\|NZ_LM655252\|CRT	251667-251684	18	NZ_LM655252.1	352083-352100	2	0.889
NZ_LM655252_1	1.1\|251667\|18\|NZ_LM655252\|CRT	251667-251684	18	NZ_LM655252.1	76392-76409	2	0.889
NZ_LM655252_1	1.1\|251667\|18\|NZ_LM655252\|CRT	251667-251684	18	NZ_LM655252.1	132226-132243	2	0.889
NZ_LM655252_1	1.1\|251667\|18\|NZ_LM655252\|CRT	251667-251684	18	NZ_LM655252.1	202375-202392	2	0.889
NZ_LM655252_1	1.1\|251667\|18\|NZ_LM655252\|CRT	251667-251684	18	NZ_LM655252.1	209961-209978	2	0.889
NZ_LM655252_1	1.1\|251667\|18\|NZ_LM655252\|CRT	251667-251684	18	NZ_LM655252.1	210615-210632	2	0.889
NZ_LM655252_1	1.1\|251667\|18\|NZ_LM655252\|CRT	251667-251684	18	NZ_LM655252.1	222665-222682	2	0.889
NZ_LM655252_1	1.1\|251667\|18\|NZ_LM655252\|CRT	251667-251684	18	NZ_LM655252.1	245192-245209	2	0.889
NZ_LM655252_1	1.1\|251667\|18\|NZ_LM655252\|CRT	251667-251684	18	NZ_LM655252.1	271022-271039	2	0.889
NZ_LM655252_1	1.1\|251667\|18\|NZ_LM655252\|CRT	251667-251684	18	NZ_LM655252.1	271868-271885	2	0.889
NZ_LM655252_1	1.1\|251667\|18\|NZ_LM655252\|CRT	251667-251684	18	NZ_LM655252.1	325922-325939	2	0.889
NZ_LM655252_1	1.3\|251772\|18\|NZ_LM655252\|CRT	251772-251789	18	NZ_LM655252.1	43020-43037	2	0.889
NZ_LM655252_1	1.3\|251772\|18\|NZ_LM655252\|CRT	251772-251789	18	NZ_LM655252.1	124352-124369	2	0.889
NZ_LM655252_1	1.3\|251772\|18\|NZ_LM655252\|CRT	251772-251789	18	NZ_LM655252.1	131908-131925	2	0.889
NZ_LM655252_1	1.3\|251772\|18\|NZ_LM655252\|CRT	251772-251789	18	NZ_LM655252.1	232294-232311	2	0.889
NZ_LM655252_1	1.3\|251772\|18\|NZ_LM655252\|CRT	251772-251789	18	NZ_LM655252.1	269825-269842	2	0.889
NZ_LM655252_1	1.3\|251772\|18\|NZ_LM655252\|CRT	251772-251789	18	NZ_LM655252.1	296891-296908	2	0.889
NZ_LM655252_1	1.3\|251772\|18\|NZ_LM655252\|CRT	251772-251789	18	NZ_LM655252.1	323768-323785	2	0.889
NZ_LM655252_1	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	NZ_LM655252.1	165563-165580	2	0.889
NZ_LM655252_1	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	NZ_LM655252.1	202176-202193	2	0.889
NZ_LM655252_1	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	NZ_LM655252.1	210615-210632	2	0.889
NZ_LM655252_1	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	NZ_LM655252.1	231427-231444	2	0.889
NZ_LM655252_1	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	NZ_LM655252.1	271409-271426	2	0.889
NZ_LM655252_1	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	NZ_LM655252.1	292639-292656	2	0.889
NZ_LM655252_1	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	NZ_LM655252.1	292640-292657	2	0.889
NZ_LM655252_1	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	NZ_LM655252.1	292641-292658	2	0.889
NZ_LM655252_1	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	NZ_LM655252.1	294376-294393	2	0.889
NZ_LM655252_1	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	NZ_LM655252.1	20949-20966	2	0.889
NZ_LM655252_1	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	NZ_LM655252.1	21789-21806	2	0.889
NZ_LM655252_1	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	NZ_LM655252.1	59415-59432	2	0.889
NZ_LM655252_1	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	NZ_LM655252.1	104116-104133	2	0.889
NZ_LM655252_1	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	NZ_LM655252.1	110188-110205	2	0.889
NZ_LM655252_1	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	NZ_LM655252.1	187200-187217	2	0.889
NZ_LM655252_1	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	NZ_LM655252.1	205349-205366	2	0.889
NZ_LM655252_1	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	NZ_LM655252.1	227176-227193	2	0.889
NZ_LM655252_1	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	NZ_LM655252.1	229163-229180	2	0.889
NZ_LM655252_1	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	NZ_LM655252.1	233586-233603	2	0.889
NZ_LM655252_1	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	NZ_LM655252.1	237630-237647	2	0.889
NZ_LM655252_1	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	NZ_LM655252.1	243072-243089	2	0.889
NZ_LM655252_1	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	NZ_LM655252.1	299051-299068	2	0.889
NZ_LM655252_1	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	NZ_LM655252.1	299053-299070	2	0.889
NZ_LM655252_1	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	NZ_LM655252.1	307880-307897	2	0.889
NZ_LM655252_1	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	NZ_LM655252.1	314378-314395	2	0.889
NZ_LM655252_1	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	NZ_LM655252.1	340387-340404	2	0.889

1. spacer 1.1|251667|18|NZ_LM655252|CRT matches to position: 227176-227193, mismatch: 1, identity: 0.944

aaaaaaaatataaaaaaa	CRISPR spacer
aaaaaaaaaataaaaaaa	Protospacer
******** *********

2. spacer 1.1|251667|18|NZ_LM655252|CRT matches to position: 292639-292656, mismatch: 1, identity: 0.944

aaaaaaaatataaaaaaa	CRISPR spacer
aaaaaaaatttaaaaaaa	Protospacer
********* ********

3. spacer 1.1|251667|18|NZ_LM655252|CRT matches to position: 294376-294393, mismatch: 1, identity: 0.944

aaaaaaaatataaaaaaa	CRISPR spacer
aaaaaaaatatacaaaaa	Protospacer
************ *****

4. spacer 1.3|251772|18|NZ_LM655252|CRT matches to position: 297380-297397, mismatch: 1, identity: 0.944

aaaaaaaatcttgaaaat	CRISPR spacer
aaaaaaaatcttgataat	Protospacer
************** ***

5. spacer 1.5|251856|18|NZ_LM655252|CRT matches to position: 245192-245209, mismatch: 1, identity: 0.944

aaaaaaaatattaaaaaa	CRISPR spacer
aaaaaaaatattaataaa	Protospacer
************** ***

6. spacer 1.5|251856|18|NZ_LM655252|CRT matches to position: 271868-271885, mismatch: 1, identity: 0.944

aaaaaaaatattaaaaaa	CRISPR spacer
aaaaaaaatattaaataa	Protospacer
*************** **

7. spacer 1.5|251856|18|NZ_LM655252|CRT matches to position: 211203-211220, mismatch: 1, identity: 0.944

aaaaaaaatattaaaaaa	CRISPR spacer
aaaaaaaattttaaaaaa	Protospacer
********* ********

8. spacer 1.5|251856|18|NZ_LM655252|CRT matches to position: 249604-249621, mismatch: 1, identity: 0.944

aaaaaaaatattaaaaaa	CRISPR spacer
aaaaaaaatattataaaa	Protospacer
************* ****

9. spacer 1.5|251856|18|NZ_LM655252|CRT matches to position: 316562-316579, mismatch: 1, identity: 0.944

aaaaaaaatattaaaaaa	CRISPR spacer
aaaacaaatattaaaaaa	Protospacer
**** *************

10. spacer 1.5|251856|18|NZ_LM655252|CRT matches to position: 352083-352100, mismatch: 1, identity: 0.944

aaaaaaaatattaaaaaa	CRISPR spacer
aaaaaaaatattaaacaa	Protospacer
*************** **

11. spacer 1.1|251667|18|NZ_LM655252|CRT matches to position: 58354-58371, mismatch: 2, identity: 0.889

aaaaaaaatataaaaaaa	CRISPR spacer
aaaaaaggtataaaaaaa	Protospacer
******..**********

12. spacer 1.1|251667|18|NZ_LM655252|CRT matches to position: 102537-102554, mismatch: 2, identity: 0.889

aaaaaaaatataaaaaaa	CRISPR spacer
aaaaaaaataaaaaataa	Protospacer
********** **** **

13. spacer 1.1|251667|18|NZ_LM655252|CRT matches to position: 208595-208612, mismatch: 2, identity: 0.889

aaaaaaaatataaaaaaa	CRISPR spacer
aaatataatataaaaaaa	Protospacer
*** * ************

14. spacer 1.1|251667|18|NZ_LM655252|CRT matches to position: 211203-211220, mismatch: 2, identity: 0.889

aaaaaaaatataaaaaaa	CRISPR spacer
aaaaaaaattttaaaaaa	Protospacer
********* * ******

15. spacer 1.1|251667|18|NZ_LM655252|CRT matches to position: 215301-215318, mismatch: 2, identity: 0.889

aaaaaaaatataaaaaaa	CRISPR spacer
aaaaaaaatataattaaa	Protospacer
*************  ***

16. spacer 1.1|251667|18|NZ_LM655252|CRT matches to position: 249604-249621, mismatch: 2, identity: 0.889

aaaaaaaatataaaaaaa	CRISPR spacer
aaaaaaaatattataaaa	Protospacer
*********** * ****

17. spacer 1.1|251667|18|NZ_LM655252|CRT matches to position: 249952-249969, mismatch: 2, identity: 0.889

aaaaaaaatataaaaaaa	CRISPR spacer
aaatcaaatataaaaaaa	Protospacer
***  *************

18. spacer 1.1|251667|18|NZ_LM655252|CRT matches to position: 249970-249987, mismatch: 2, identity: 0.889

aaaaaaaatataaaaaaa	CRISPR spacer
aaaaaaaataaaaacaaa	Protospacer
********** *** ***

19. spacer 1.1|251667|18|NZ_LM655252|CRT matches to position: 253533-253550, mismatch: 2, identity: 0.889

aaaaaaaatataaaaaaa	CRISPR spacer
aaagaaaatataaaagaa	Protospacer
***.***********.**

20. spacer 1.1|251667|18|NZ_LM655252|CRT matches to position: 313702-313719, mismatch: 2, identity: 0.889

aaaaaaaatataaaaaaa	CRISPR spacer
aaaaaaaatatataataa	Protospacer
************ ** **

21. spacer 1.1|251667|18|NZ_LM655252|CRT matches to position: 313742-313759, mismatch: 2, identity: 0.889

aaaaaaaatataaaaaaa	CRISPR spacer
aaaacaaatataaataaa	Protospacer
**** ********* ***

22. spacer 1.1|251667|18|NZ_LM655252|CRT matches to position: 352083-352100, mismatch: 2, identity: 0.889

aaaaaaaatataaaaaaa	CRISPR spacer
aaaaaaaatattaaacaa	Protospacer
*********** *** **

23. spacer 1.1|251667|18|NZ_LM655252|CRT matches to position: 76392-76409, mismatch: 2, identity: 0.889

aaaaaaaatataaaaaaa	CRISPR spacer
aaaaaaattataaaataa	Protospacer
******* ******* **

24. spacer 1.1|251667|18|NZ_LM655252|CRT matches to position: 132226-132243, mismatch: 2, identity: 0.889

aaaaaaaatataaaaaaa	CRISPR spacer
aaagaaaatataaataaa	Protospacer
***.********** ***

25. spacer 1.1|251667|18|NZ_LM655252|CRT matches to position: 202375-202392, mismatch: 2, identity: 0.889

aaaaaaaatataaaaaaa	CRISPR spacer
aaaataaatataataaaa	Protospacer
**** ******** ****

26. spacer 1.1|251667|18|NZ_LM655252|CRT matches to position: 209961-209978, mismatch: 2, identity: 0.889

aaaaaaaatataaaaaaa	CRISPR spacer
aagaaaaatataataaaa	Protospacer
**.********** ****

27. spacer 1.1|251667|18|NZ_LM655252|CRT matches to position: 210615-210632, mismatch: 2, identity: 0.889

aaaaaaaatataaaaaaa	CRISPR spacer
aaaaaaaatatcaaataa	Protospacer
*********** *** **

28. spacer 1.1|251667|18|NZ_LM655252|CRT matches to position: 222665-222682, mismatch: 2, identity: 0.889

aaaaaaaatataaaaaaa	CRISPR spacer
aaaaataaaataaaaaaa	Protospacer
***** ** *********

29. spacer 1.1|251667|18|NZ_LM655252|CRT matches to position: 245192-245209, mismatch: 2, identity: 0.889

aaaaaaaatataaaaaaa	CRISPR spacer
aaaaaaaatattaataaa	Protospacer
*********** ** ***

30. spacer 1.1|251667|18|NZ_LM655252|CRT matches to position: 271022-271039, mismatch: 2, identity: 0.889

aaaaaaaatataaaaaaa	CRISPR spacer
aaaaaaaaaaaaaaaaaa	Protospacer
******** * *******

31. spacer 1.1|251667|18|NZ_LM655252|CRT matches to position: 271868-271885, mismatch: 2, identity: 0.889

aaaaaaaatataaaaaaa	CRISPR spacer
aaaaaaaatattaaataa	Protospacer
*********** *** **

32. spacer 1.1|251667|18|NZ_LM655252|CRT matches to position: 325922-325939, mismatch: 2, identity: 0.889

aaaaaaaatataaaaaaa	CRISPR spacer
aaaaaaaatatattaaaa	Protospacer
************  ****

33. spacer 1.3|251772|18|NZ_LM655252|CRT matches to position: 43020-43037, mismatch: 2, identity: 0.889

aaaaaaaatcttgaaaat	CRISPR spacer
aaaaaaaatattaaaaat	Protospacer
********* **.*****

34. spacer 1.3|251772|18|NZ_LM655252|CRT matches to position: 124352-124369, mismatch: 2, identity: 0.889

aaaaaaaatcttgaaaat	CRISPR spacer
aaaataaatctttaaaat	Protospacer
**** ******* *****

35. spacer 1.3|251772|18|NZ_LM655252|CRT matches to position: 131908-131925, mismatch: 2, identity: 0.889

aaaaaaaatcttgaaaat	CRISPR spacer
aaaaaaaattttaaaaat	Protospacer
*********.**.*****

36. spacer 1.3|251772|18|NZ_LM655252|CRT matches to position: 232294-232311, mismatch: 2, identity: 0.889

aaaaaaaatcttgaaaat	CRISPR spacer
aaaaaaaatatttaaaat	Protospacer
********* ** *****

37. spacer 1.3|251772|18|NZ_LM655252|CRT matches to position: 269825-269842, mismatch: 2, identity: 0.889

aaaaaaaatcttgaaaat	CRISPR spacer
aaaaaaaatcttaataat	Protospacer
************.* ***

38. spacer 1.3|251772|18|NZ_LM655252|CRT matches to position: 296891-296908, mismatch: 2, identity: 0.889

aaaaaaaatcttgaaaat	CRISPR spacer
aaaaaaaaaattgaaaat	Protospacer
********  ********

39. spacer 1.3|251772|18|NZ_LM655252|CRT matches to position: 323768-323785, mismatch: 2, identity: 0.889

aaaaaaaatcttgaaaat	CRISPR spacer
aaaaaatatattgaaaat	Protospacer
****** ** ********

40. spacer 1.5|251856|18|NZ_LM655252|CRT matches to position: 165563-165580, mismatch: 2, identity: 0.889

aaaaaaaatattaaaaaa	CRISPR spacer
aataaaattattaaaaaa	Protospacer
** **** **********

41. spacer 1.5|251856|18|NZ_LM655252|CRT matches to position: 202176-202193, mismatch: 2, identity: 0.889

aaaaaaaatattaaaaaa	CRISPR spacer
aaaattaatattaaaaaa	Protospacer
****  ************

42. spacer 1.5|251856|18|NZ_LM655252|CRT matches to position: 210615-210632, mismatch: 2, identity: 0.889

aaaaaaaatattaaaaaa	CRISPR spacer
aaaaaaaatatcaaataa	Protospacer
***********.*** **

43. spacer 1.5|251856|18|NZ_LM655252|CRT matches to position: 231427-231444, mismatch: 2, identity: 0.889

aaaaaaaatattaaaaaa	CRISPR spacer
aaaaaaaatacttaaaaa	Protospacer
**********.* *****

44. spacer 1.5|251856|18|NZ_LM655252|CRT matches to position: 271409-271426, mismatch: 2, identity: 0.889

aaaaaaaatattaaaaaa	CRISPR spacer
aaaagaattattaaaaaa	Protospacer
****.** **********

45. spacer 1.5|251856|18|NZ_LM655252|CRT matches to position: 292639-292656, mismatch: 2, identity: 0.889

aaaaaaaatattaaaaaa	CRISPR spacer
aaaaaaaatttaaaaaaa	Protospacer
********* * ******

46. spacer 1.5|251856|18|NZ_LM655252|CRT matches to position: 292640-292657, mismatch: 2, identity: 0.889

aaaaaaaatattaaaaaa	CRISPR spacer
aaaaaaaaatttaaaaaa	Protospacer
********  ********

47. spacer 1.5|251856|18|NZ_LM655252|CRT matches to position: 292641-292658, mismatch: 2, identity: 0.889

aaaaaaaatattaaaaaa	CRISPR spacer
aaaaaaaaaatttaaaaa	Protospacer
******** *** *****

48. spacer 1.5|251856|18|NZ_LM655252|CRT matches to position: 294376-294393, mismatch: 2, identity: 0.889

aaaaaaaatattaaaaaa	CRISPR spacer
aaaaaaaatatacaaaaa	Protospacer
***********  *****

49. spacer 1.5|251856|18|NZ_LM655252|CRT matches to position: 20949-20966, mismatch: 2, identity: 0.889

aaaaaaaatattaaaaaa	CRISPR spacer
aaaaaaagtattgaaaaa	Protospacer
*******.****.*****

50. spacer 1.5|251856|18|NZ_LM655252|CRT matches to position: 21789-21806, mismatch: 2, identity: 0.889

aaaaaaaatattaaaaaa	CRISPR spacer
aaataaaaaattaaaaaa	Protospacer
*** **** *********

51. spacer 1.5|251856|18|NZ_LM655252|CRT matches to position: 59415-59432, mismatch: 2, identity: 0.889

aaaaaaaatattaaaaaa	CRISPR spacer
aataaaaatattaaataa	Protospacer
** ************ **

52. spacer 1.5|251856|18|NZ_LM655252|CRT matches to position: 104116-104133, mismatch: 2, identity: 0.889

aaaaaaaatattaaaaaa	CRISPR spacer
aaaaaaaatattggaaaa	Protospacer
************..****

53. spacer 1.5|251856|18|NZ_LM655252|CRT matches to position: 110188-110205, mismatch: 2, identity: 0.889

aaaaaaaatattaaaaaa	CRISPR spacer
aaaataaatattataaaa	Protospacer
**** ******** ****

54. spacer 1.5|251856|18|NZ_LM655252|CRT matches to position: 187200-187217, mismatch: 2, identity: 0.889

aaaaaaaatattaaaaaa	CRISPR spacer
aaaagaattattaaaaaa	Protospacer
****.** **********

55. spacer 1.5|251856|18|NZ_LM655252|CRT matches to position: 205349-205366, mismatch: 2, identity: 0.889

aaaaaaaatattaaaaaa	CRISPR spacer
aaaaaaattattaataaa	Protospacer
******* ****** ***

56. spacer 1.5|251856|18|NZ_LM655252|CRT matches to position: 227176-227193, mismatch: 2, identity: 0.889

aaaaaaaatattaaaaaa	CRISPR spacer
aaaaaaaaaataaaaaaa	Protospacer
******** ** ******

57. spacer 1.5|251856|18|NZ_LM655252|CRT matches to position: 229163-229180, mismatch: 2, identity: 0.889

aaaaaaaatattaaaaaa	CRISPR spacer
aaaaaaaatgttaataaa	Protospacer
*********.**** ***

58. spacer 1.5|251856|18|NZ_LM655252|CRT matches to position: 233586-233603, mismatch: 2, identity: 0.889

aaaaaaaatattaaaaaa	CRISPR spacer
aaaaataaaattaaaaaa	Protospacer
***** ** *********

59. spacer 1.5|251856|18|NZ_LM655252|CRT matches to position: 237630-237647, mismatch: 2, identity: 0.889

aaaaaaaatattaaaaaa	CRISPR spacer
aaaaaaactattaataaa	Protospacer
******* ****** ***

60. spacer 1.5|251856|18|NZ_LM655252|CRT matches to position: 243072-243089, mismatch: 2, identity: 0.889

aaaaaaaatattaaaaaa	CRISPR spacer
aataaaaatgttaaaaaa	Protospacer
** ******.********

61. spacer 1.5|251856|18|NZ_LM655252|CRT matches to position: 299051-299068, mismatch: 2, identity: 0.889

aaaaaaaatattaaaaaa	CRISPR spacer
aaaaaaaaaattataaaa	Protospacer
******** **** ****

62. spacer 1.5|251856|18|NZ_LM655252|CRT matches to position: 299053-299070, mismatch: 2, identity: 0.889

aaaaaaaatattaaaaaa	CRISPR spacer
aaaaaaaattataaaaaa	Protospacer
*********  *******

63. spacer 1.5|251856|18|NZ_LM655252|CRT matches to position: 307880-307897, mismatch: 2, identity: 0.889

aaaaaaaatattaaaaaa	CRISPR spacer
aaaaataatattaataaa	Protospacer
***** ******** ***

64. spacer 1.5|251856|18|NZ_LM655252|CRT matches to position: 314378-314395, mismatch: 2, identity: 0.889

aaaaaaaatattaaaaaa	CRISPR spacer
aaaaaatatattaataaa	Protospacer
****** ******* ***

65. spacer 1.5|251856|18|NZ_LM655252|CRT matches to position: 340387-340404, mismatch: 2, identity: 0.889

aaaaaaaatattaaaaaa	CRISPR spacer
aaaaaaaatattatataa	Protospacer
************* * **

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP039041	Piscirickettsia salmonis strain Psal-072 plasmid unnamed1, complete sequence	70358-70387	4	0.867
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	111404-111433	4	0.867
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MT774393	CrAssphage cr127_1, complete genome	82675-82704	4	0.867
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_LR214986	Mycoplasma cynos strain NCTC10142 plasmid 13	733249-733278	4	0.867
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP013238	Clostridium butyricum strain CDC_51208 plasmid pNPD4_2, complete sequence	117084-117113	4	0.867
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_LR214976	Mycoplasma cynos strain NCTC10142 plasmid 3	1667-1696	4	0.867
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP021873	Borrelia miyamotoi strain CA17-2241 plasmid lp72, complete sequence	62242-62271	5	0.833
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP017255	Clostridium taeniosporum strain 1/k plasmid pCt2, complete sequence	6675-6704	5	0.833
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP020558	Paenibacillus larvae subsp. pulvifaciens strain SAG 10367 plasmid pPLP3, complete sequence	101109-101138	5	0.833
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_LR214976	Mycoplasma cynos strain NCTC10142 plasmid 3	2466-2495	5	0.833
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MK250021	Prevotella phage Lak-B2, complete genome	290937-290966	5	0.833
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MK250023	Prevotella phage Lak-B4, complete genome	291480-291509	5	0.833
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MK250027	Prevotella phage Lak-B8, complete genome	290173-290202	5	0.833
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MK250026	Prevotella phage Lak-B7, complete genome	289231-289260	5	0.833
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	CP002510	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB28, complete sequence	1636-1665	6	0.8
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NC_015427	Clostridium botulinum BKT015925 plasmid p4BKT015925, complete sequence	32744-32773	6	0.8
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP041075	Bacillus tropicus strain LM1212-W3 plasmid p2, complete sequence	119924-119953	6	0.8
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP024773	Bacillus thuringiensis LM1212 plasmid pLM2, complete sequence	51420-51449	6	0.8
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP021437	Bacillus thuringiensis strain C15 plasmid pBMB240, complete sequence	134740-134769	6	0.8
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MN698242	Pelagibacter phage HTVC103P, complete genome	47240-47269	6	0.8
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	LT960552	Yersinia phage fHe-Yen9-03 genome assembly, complete genome: monopartite	104861-104890	6	0.8
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MF360958	Salicola phage SCTP-2, complete genome	24653-24682	6	0.8
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP035412	Bacillus subtilis strain SRCM103622 plasmid unnamed1, complete sequence	27140-27169	6	0.8
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP028216	Bacillus subtilis strain SRCM102750 plasmid unnamed1, complete sequence	51664-51693	6	0.8
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NC_014633	Ilyobacter polytropus DSM 2926 plasmid pILYOP01, complete sequence	210833-210862	6	0.8
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP035398	Bacillus subtilis strain SRCM103773 plasmid unnamed1, complete sequence	34631-34660	6	0.8
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP030938	Bacillus sp. DM2 plasmid unnamed, complete sequence	4502-4531	6	0.8
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NC_015419	Clostridium botulinum BKT015925 plasmid p5BKT015925, complete sequence	7561-7590	6	0.8
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_AP019715	Bacillus subtilis subsp. subtilis strain NBRC 13719 plasmid pBSU1, complete sequence	7842-7871	6	0.8
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MN693288	Marine virus AFVG_25M432, complete genome	44223-44252	6	0.8
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP045822	Bacillus subtilis strain MB8_B7 plasmid pBs001, complete sequence	75274-75303	6	0.8
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP045813	Bacillus subtilis strain P8_B3 plasmid pBs005, complete sequence	68293-68322	6	0.8
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP041758	Bacillus sp. KBS0812 plasmid unnamed, complete sequence	16356-16385	6	0.8
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP010015	Bacillus sp. YP1 plasmid pBUYP1, complete sequence	64696-64725	6	0.8
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NC_021809	Bacillus subtilis subsp. subtilis str. NCIB 3610 plasmid pBS32, complete sequence	71370-71399	6	0.8
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP020103	Bacillus subtilis strain NCIB 3610 plasmid pBS32, complete sequence	62781-62810	6	0.8
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NC_015149	Bacillus subtilis subsp. natto plasmid pLS32 DNA, complete sequence, strain: IAM 11631	28613-28642	6	0.8
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP034485	Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 strain NCIB 3610 plasmid unnamed, complete sequence	26937-26966	6	0.8
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP045923	Bacillus subtilis strain P8_B1 plasmid pBs003, complete sequence	68392-68421	6	0.8
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	KT895374	Bacillus phage vB_BpuM-BpSp, complete genome	253780-253809	6	0.8
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MN693267	Marine virus AFVG_25M289, complete genome	53214-53243	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MN693101	Marine virus AFVG_25M559, complete genome	986-1015	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MK250024	Prevotella phage Lak-B5, complete genome	467353-467382	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MK250028	Prevotella phage Lak-B9, complete genome	471784-471813	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MK250025	Prevotella phage Lak-B6, complete genome	470446-470475	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MK250022	Prevotella phage Lak-B3, complete genome	470537-470566	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MK250020	Prevotella phage Lak-B1, complete genome	471767-471796	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NC_005355	Lactobacillus prophage Lj965, complete genome	11738-11767	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	AY459535	Lactobacillus johnsonii prophage Lj965, complete genome	11738-11767	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_KY352353	Bacillus thuringiensis serovar israelensis strain 1.24 plasmid pT0124-4, complete sequence	48959-48988	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	LC128536	Bacillus thuringiensis serovar israelensis plasmid pBTI-6 DNA, complete sequence, strain: HD522	37278-37307	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP018751	Borreliella garinii strain CIP 103362 isolate 20047 plasmid unnamed4	18582-18611	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NC_010076	Bacillus thuringiensis serovar israelensis plasmid pBtoxis, complete sequence	48960-48989	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NC_018991	Borrelia burgdorferi 297 plasmid 297_lp38, complete sequence	17756-17785	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NC_018510	Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence	125231-125260	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP053973	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed4, complete sequence	78796-78825	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP013279	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-4-128K, complete sequence	47891-47920	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP053469	Fusobacterium nucleatum strain Fn12230 plasmid unnamed, complete sequence	21771-21800	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NC_007772	Clostridium perfringens CPE str. F4969 plasmid pCPF4969, complete sequence	65395-65424	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP045026	Bacillus thuringiensis strain JW-1 plasmid p4, complete sequence	48958-48987	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	LT960552	Yersinia phage fHe-Yen9-03 genome assembly, complete genome: monopartite	291824-291853	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	LT960552	Yersinia phage fHe-Yen9-03 genome assembly, complete genome: monopartite	104849-104878	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	LR596615	Yersinia phage fHe-Yen9-04 genome assembly, chromosome: I	294107-294136	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	LR596615	Yersinia phage fHe-Yen9-04 genome assembly, chromosome: I	104511-104540	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NC_042116	Yersinia phage fHe-Yen9-04 genome assembly, complete genome: monopartite	294107-294136	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NC_042116	Yersinia phage fHe-Yen9-04 genome assembly, complete genome: monopartite	104511-104540	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_KT897280	Clostridium botulinum strain FI1111E1 plasmid pFI1111E1, complete sequence	105569-105598	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_KT897278	Clostridium botulinum strain FWSKR40E1 plasmid pFWSKR40E1, complete sequence	102994-103023	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_KT897279	Clostridium botulinum strain SWKR38E2 plasmid pSWKR38E2, complete sequence	104130-104159	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NC_015712	Clostridium perfringens plasmid pCPPB-1, complete sequence	59805-59834	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NC_017421	Borreliella burgdorferi N40 plasmid N40_lp38, complete sequence	18630-18659	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP028866	Borreliella garinii strain 20047 plasmid lp17, complete sequence	2279-2308	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NC_001856	Borreliella burgdorferi B31 plasmid lp38, complete sequence	18340-18369	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP019853	Borreliella burgdorferi plasmid lp38, complete sequence	18353-18382	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP019764	Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_lp38, complete sequence	18346-18375	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MN657082	Psychrobacter sp. strain ANT_H3 plasmid pA3H2, complete sequence	1832-1861	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP039725	Bacillus thuringiensis strain BT-59 plasmid p4, complete sequence	79698-79727	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP017217	Borreliella burgdorferi strain B331 plasmid B331_lp38, complete sequence	18427-18456	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NC_013940	Deferribacter desulfuricans SSM1 megaplasmid pDF308, complete sequence	151640-151669	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MK250021	Prevotella phage Lak-B2, complete genome	474745-474774	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MK250023	Prevotella phage Lak-B4, complete genome	473979-474008	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MK250029	Prevotella phage Lak-C1, complete genome	122665-122694	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MK250029	Prevotella phage Lak-C1, complete genome	363744-363773	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MK250016	Prevotella phage Lak-A1, complete genome	162439-162468	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MK250016	Prevotella phage Lak-A1, complete genome	258168-258197	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MK250016	Prevotella phage Lak-A1, complete genome	398932-398961	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MK250019	Prevotella phage Lak-A2, complete genome	85486-85515	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MK250019	Prevotella phage Lak-A2, complete genome	179302-179331	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MK250019	Prevotella phage Lak-A2, complete genome	318067-318096	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MK250027	Prevotella phage Lak-B8, complete genome	474508-474537	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MK250026	Prevotella phage Lak-B7, complete genome	473546-473575	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	LR588166	Pseudomonas phage vB_PaeM_MIJ3	154149-154178	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MN694485	Marine virus AFVG_250M19, complete genome	62108-62137	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MH121069	Pseudomonas phage vB_PaeM_PA5oct, complete genome	270686-270715	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MH791397	UNVERIFIED: Enterococcus phage EfsSzw-1, complete genome	24627-24656	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP045822	Bacillus subtilis strain MB8_B7 plasmid pBs001, complete sequence	66326-66355	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP045339	Vibrio sp. THAF190c plasmid pTHAF190c_a, complete sequence	668832-668861	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	CP016195	Bacillus thuringiensis serovar coreanensis strain ST7 plasmid pST7-1, complete sequence	237407-237436	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NC_015149	Bacillus subtilis subsp. natto plasmid pLS32 DNA, complete sequence, strain: IAM 11631	18445-18474	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP016589	Bacillus thuringiensis strain KNU-07 plasmid pBTKNU07-01, complete sequence	313841-313870	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	KY653116	Staphylococcus phage IME1318_01, complete genome	12223-12252	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MN693652	Marine virus AFVG_250M189, complete genome	6590-6619	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MG543995	Staphylococcus phage UPMK_1, partial genome	54667-54696	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MN694367	Marine virus AFVG_250M957, complete genome	4000-4029	7	0.767
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP024657	Bacillus cereus strain MLY1 plasmid pMLY1.1, complete sequence	14301-14330	8	0.733
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NC_022876	Bacillus thuringiensis YBT-1518 plasmid pBMB0231, complete sequence	41657-41686	8	0.733
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_KT897276	Clostridium botulinum strain INGR16-02E1 plasmid pINGR16-02E1, complete sequence	95936-95965	8	0.733
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_KT897275	Clostridium botulinum strain IFR 12/29 plasmid p12/29, complete sequence	100859-100888	8	0.733
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_KT897277	Clostridium botulinum strain ST0210E1 plasmid pST0210E1, complete sequence	95936-95965	8	0.733
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NC_013940	Deferribacter desulfuricans SSM1 megaplasmid pDF308, complete sequence	280064-280093	8	0.733
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	AP014180	Uncultured Mediterranean phage uvMED isolate uvMED-GF-C67-MedDCM-OCT-S37-C48, * SEQUENCING IN PROGRESS *	9654-9683	8	0.733
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP022346	Bacillus thuringiensis strain c25 plasmid unnamed1, complete sequence	254026-254055	8	0.733
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP053305	Spiroplasma citri strain C5 plasmid pScpC5-1, complete sequence	4119-4148	8	0.733
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	MN855818	Myoviridae sp. isolate 237, complete genome	1958-1987	8	0.733
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP046704	Nostoc sp. ATCC 53789 plasmid pNsp_a, complete sequence	99393-99422	8	0.733
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP047436	Spiroplasma citri strain BLH-13 plasmid pSciBLH13-8	333-362	8	0.733
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP047442	Spiroplasma citri strain BLH-MB plasmid pSciBLHMB-5, complete sequence	3141-3170	8	0.733
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP047443	Spiroplasma citri strain BLH-MB plasmid pSciBLHMB-6, complete sequence	3155-3184	8	0.733
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NC_010631	Nostoc punctiforme PCC 73102 plasmid pNPUN01, complete sequence	245913-245942	8	0.733
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	NZ_CP013238	Clostridium butyricum strain CDC_51208 plasmid pNPD4_2, complete sequence	600492-600521	9	0.7
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	AP014297	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C24, * SEQUENCING IN PROGRESS *	25529-25558	9	0.7
NZ_LM655252_1	1.4\|251808\|30\|NZ_LM655252\|CRT	251808-251837	30	KX397372	Erwinia phage vB_EamM_Phobos, complete genome	101337-101366	9	0.7

1. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP039041 (Piscirickettsia salmonis strain Psal-072 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.867

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aaaaataatagtgaaaatattattgaaaaa	Protospacer
.********* ******** *********

2. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.867

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aaaaataataatgaaaatattattgaaaaa	Protospacer
.********* ******** *********

3. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MT774393 (CrAssphage cr127_1, complete genome) position: , mismatch: 4, identity: 0.867

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
ataaatagtattgaaaatagtattgaaaat	Protospacer
. *****.***********.**********

4. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_LR214986 (Mycoplasma cynos strain NCTC10142 plasmid 13) position: , mismatch: 4, identity: 0.867

gaaaataatattgaaaataatattgaaaat---	CRISPR spacer
gaaaaaaatattgaaaataata---aaaatggc	Protospacer
***** ****************   *****

5. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP013238 (Clostridium butyricum strain CDC_51208 plasmid pNPD4_2, complete sequence) position: , mismatch: 4, identity: 0.867

gaaaataatattgaaaataatattgaaaat---	CRISPR spacer
gaaaaaaatattgaaaataata---aaaatgag	Protospacer
***** ****************   *****

6. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_LR214976 (Mycoplasma cynos strain NCTC10142 plasmid 3) position: , mismatch: 4, identity: 0.867

gaaaataatattgaaaataatattgaaaat---	CRISPR spacer
gaaaaaaatattgaaaataata---aaaatggc	Protospacer
***** ****************   *****

7. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP021873 (Borrelia miyamotoi strain CA17-2241 plasmid lp72, complete sequence) position: , mismatch: 5, identity: 0.833

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
ttaaaaaatattgaaaaaaatattgaaaaa	Protospacer
  *** *********** ***********

8. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP017255 (Clostridium taeniosporum strain 1/k plasmid pCt2, complete sequence) position: , mismatch: 5, identity: 0.833

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
agaaataatattaaaaataatattaaaaag	Protospacer
..**********.***********.****

9. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP020558 (Paenibacillus larvae subsp. pulvifaciens strain SAG 10367 plasmid pPLP3, complete sequence) position: , mismatch: 5, identity: 0.833

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
gaaaataatattgaaaaaaatattgcagca	Protospacer
***************** ******* *.

10. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_LR214976 (Mycoplasma cynos strain NCTC10142 plasmid 3) position: , mismatch: 5, identity: 0.833

gaaaataatattgaaaataatattgaaaat---	CRISPR spacer
aaaaaaaatattgaaaataata---aaaatggc	Protospacer
.**** ****************   *****

11. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MK250021 (Prevotella phage Lak-B2, complete genome) position: , mismatch: 5, identity: 0.833

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
gaatataatattgaaaataatactattaat	Protospacer
*** ******************.*.  ***

12. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MK250023 (Prevotella phage Lak-B4, complete genome) position: , mismatch: 5, identity: 0.833

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
gaatataatattgaaaataatactattaat	Protospacer
*** ******************.*.  ***

13. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MK250027 (Prevotella phage Lak-B8, complete genome) position: , mismatch: 5, identity: 0.833

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
gaatataatattgaaaataatactattaat	Protospacer
*** ******************.*.  ***

14. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MK250026 (Prevotella phage Lak-B7, complete genome) position: , mismatch: 5, identity: 0.833

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
gaatataatattgaaaataatactattaat	Protospacer
*** ******************.*.  ***

15. spacer 1.4|251808|30|NZ_LM655252|CRT matches to CP002510 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB28, complete sequence) position: , mismatch: 6, identity: 0.8

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
cccaaaaatattaaaaataatattgaaaaa	Protospacer
   ** ******.****************

16. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NC_015427 (Clostridium botulinum BKT015925 plasmid p4BKT015925, complete sequence) position: , mismatch: 6, identity: 0.8

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
atatataatattaaaaataatattaaaaag	Protospacer
. * ********.***********.****

17. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP041075 (Bacillus tropicus strain LM1212-W3 plasmid p2, complete sequence) position: , mismatch: 6, identity: 0.8

gaaaat----aatattgaaaataatattgaaaat	CRISPR spacer
----attctgaatattcaaaataatattgaaaaa	Protospacer
    **    ****** ****************

18. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP024773 (Bacillus thuringiensis LM1212 plasmid pLM2, complete sequence) position: , mismatch: 6, identity: 0.8

gaaaat----aatattgaaaataatattgaaaat	CRISPR spacer
----attctgaatattcaaaataatattgaaaaa	Protospacer
    **    ****** ****************

19. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP021437 (Bacillus thuringiensis strain C15 plasmid pBMB240, complete sequence) position: , mismatch: 6, identity: 0.8

gaaaat----aatattgaaaataatattgaaaat	CRISPR spacer
----attctaaatattcaaaataatattgaaaaa	Protospacer
    **    ****** ****************

20. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MN698242 (Pelagibacter phage HTVC103P, complete genome) position: , mismatch: 6, identity: 0.8

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aaatctaatattgaaaatcaaattgaaaaa	Protospacer
.**  ************* * ********

21. spacer 1.4|251808|30|NZ_LM655252|CRT matches to LT960552 (Yersinia phage fHe-Yen9-03 genome assembly, complete genome: monopartite) position: , mismatch: 6, identity: 0.8

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
gaaaataacattgaaaataacattatggat	Protospacer
********.***********.***. ..**

22. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MF360958 (Salicola phage SCTP-2, complete genome) position: , mismatch: 6, identity: 0.8

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
caaaacaaaattgaaaataatattgggtat	Protospacer
 ****.** ****************.. **

23. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP035412 (Bacillus subtilis strain SRCM103622 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
gtaattcttattgaaaaaaatattgaaaaa	Protospacer
* ** *  ********* ***********

24. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP028216 (Bacillus subtilis strain SRCM102750 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
gtaattcttattgaaaaaaatattgaaaaa	Protospacer
* ** *  ********* ***********

25. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NC_014633 (Ilyobacter polytropus DSM 2926 plasmid pILYOP01, complete sequence) position: , mismatch: 6, identity: 0.8

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aaaaataacattgaaaataattttccaatt	Protospacer
.*******.************ **  ** *

26. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP035398 (Bacillus subtilis strain SRCM103773 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
gtaattcttattgaaaaaaatattgaaaaa	Protospacer
* ** *  ********* ***********

27. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP030938 (Bacillus sp. DM2 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
gtaattcttattgaaaaaaatattgaaaaa	Protospacer
* ** *  ********* ***********

28. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NC_015419 (Clostridium botulinum BKT015925 plasmid p5BKT015925, complete sequence) position: , mismatch: 6, identity: 0.8

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aaaaataatattaaagataatattttagat	Protospacer
.***********.**.********  *.**

29. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_AP019715 (Bacillus subtilis subsp. subtilis strain NBRC 13719 plasmid pBSU1, complete sequence) position: , mismatch: 6, identity: 0.8

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
gtaattcttattgaaaaaaatattgaaaaa	Protospacer
* ** *  ********* ***********

30. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MN693288 (Marine virus AFVG_25M432, complete genome) position: , mismatch: 6, identity: 0.8

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
gtagataatattgaatataatgttgaagac	Protospacer
* *.*********** *****.*****.*.

31. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP045822 (Bacillus subtilis strain MB8_B7 plasmid pBs001, complete sequence) position: , mismatch: 6, identity: 0.8

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
gtaattcttattgaaaaaaatattgaaaaa	Protospacer
* ** *  ********* ***********

32. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP045813 (Bacillus subtilis strain P8_B3 plasmid pBs005, complete sequence) position: , mismatch: 6, identity: 0.8

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
gtaattcttattgaaaaaaatattgaaaaa	Protospacer
* ** *  ********* ***********

33. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP041758 (Bacillus sp. KBS0812 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
gtaattcttattgaaaaaaatattgaaaaa	Protospacer
* ** *  ********* ***********

34. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP010015 (Bacillus sp. YP1 plasmid pBUYP1, complete sequence) position: , mismatch: 6, identity: 0.8

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
gtaatttttattgaaaaaaatattgaaaaa	Protospacer
* ** *  ********* ***********

35. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NC_021809 (Bacillus subtilis subsp. subtilis str. NCIB 3610 plasmid pBS32, complete sequence) position: , mismatch: 6, identity: 0.8

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
gtaattcttattgaaaaaaatattgaaaaa	Protospacer
* ** *  ********* ***********

36. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP020103 (Bacillus subtilis strain NCIB 3610 plasmid pBS32, complete sequence) position: , mismatch: 6, identity: 0.8

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
gtaattcttattgaaaaaaatattgaaaaa	Protospacer
* ** *  ********* ***********

37. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NC_015149 (Bacillus subtilis subsp. natto plasmid pLS32 DNA, complete sequence, strain: IAM 11631) position: , mismatch: 6, identity: 0.8

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
gtaattcttattgaaaaaaatattgaaaaa	Protospacer
* ** *  ********* ***********

38. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP034485 (Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 strain NCIB 3610 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
gtaattcttattgaaaaaaatattgaaaaa	Protospacer
* ** *  ********* ***********

39. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP045923 (Bacillus subtilis strain P8_B1 plasmid pBs003, complete sequence) position: , mismatch: 6, identity: 0.8

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
gtaattcttattgaaaaaaatattgaaaaa	Protospacer
* ** *  ********* ***********

40. spacer 1.4|251808|30|NZ_LM655252|CRT matches to KT895374 (Bacillus phage vB_BpuM-BpSp, complete genome) position: , mismatch: 6, identity: 0.8

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
tataatgatattgaaaataaaattgatatt	Protospacer
 * ***.************* ***** * *

41. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MN693267 (Marine virus AFVG_25M289, complete genome) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
tttattcatattaaaaataatgttgaaaat	Protospacer
   * * *****.********.********

42. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MN693101 (Marine virus AFVG_25M559, complete genome) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
tttattcatattaaaaataatgttgaaaat	Protospacer
   * * *****.********.********

43. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MK250024 (Prevotella phage Lak-B5, complete genome) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aatcataatattgaaaataatatagatata	Protospacer
.*  ******************* ** *

44. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MK250028 (Prevotella phage Lak-B9, complete genome) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aatcataatattgaaaataatatagatata	Protospacer
.*  ******************* ** *

45. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MK250025 (Prevotella phage Lak-B6, complete genome) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aatcataatattgaaaataatatagatata	Protospacer
.*  ******************* ** *

46. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MK250022 (Prevotella phage Lak-B3, complete genome) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aatcataatattgaaaataatatagatata	Protospacer
.*  ******************* ** *

47. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MK250020 (Prevotella phage Lak-B1, complete genome) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aatcataatattgaaaataatatagatata	Protospacer
.*  ******************* ** *

48. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NC_005355 (Lactobacillus prophage Lj965, complete genome) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aaaaataatattgaaaataattttattgag	Protospacer
.******************** **.  .*

49. spacer 1.4|251808|30|NZ_LM655252|CRT matches to AY459535 (Lactobacillus johnsonii prophage Lj965, complete genome) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aaaaataatattgaaaataattttattgag	Protospacer
.******************** **.  .*

50. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_KY352353 (Bacillus thuringiensis serovar israelensis strain 1.24 plasmid pT0124-4, complete sequence) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aaccataatattgaaaataattttgatgac	Protospacer
.*  ***************** **** .*.

51. spacer 1.4|251808|30|NZ_LM655252|CRT matches to LC128536 (Bacillus thuringiensis serovar israelensis plasmid pBTI-6 DNA, complete sequence, strain: HD522) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aaccataatattgaaaataattttgatgac	Protospacer
.*  ***************** **** .*.

52. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP018751 (Borreliella garinii strain CIP 103362 isolate 20047 plasmid unnamed4) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
ccaaataattttgaaaataattttgatttt	Protospacer
  ******* *********** ****   *

53. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NC_010076 (Bacillus thuringiensis serovar israelensis plasmid pBtoxis, complete sequence) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aaccataatattgaaaataattttgatgac	Protospacer
.*  ***************** **** .*.

54. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NC_018991 (Borrelia burgdorferi 297 plasmid 297_lp38, complete sequence) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
ccaaataattttgaaaataattttgatttt	Protospacer
  ******* *********** ****   *

55. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NC_018510 (Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aaccataatattgaaaataattttgatgac	Protospacer
.*  ***************** **** .*.

56. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP053973 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aaccataatattgaaaataattttgatgac	Protospacer
.*  ***************** **** .*.

57. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP013279 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-4-128K, complete sequence) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aaccataatattgaaaataattttgatgac	Protospacer
.*  ***************** **** .*.

58. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP053469 (Fusobacterium nucleatum strain Fn12230 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
attagtaaaattgaagataatattgaaaaa	Protospacer
.  *.*** ******.*************

59. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NC_007772 (Clostridium perfringens CPE str. F4969 plasmid pCPF4969, complete sequence) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aacaataataatgaaaatgatattgaatca	Protospacer
.* ******* *******.********

60. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP045026 (Bacillus thuringiensis strain JW-1 plasmid p4, complete sequence) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aaccataatattgaaaataattttgatgac	Protospacer
.*  ***************** **** .*.

61. spacer 1.4|251808|30|NZ_LM655252|CRT matches to LT960552 (Yersinia phage fHe-Yen9-03 genome assembly, complete genome: monopartite) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
agtactaatattgaaaataatattaaatgt	Protospacer
.. * *******************.** .*

62. spacer 1.4|251808|30|NZ_LM655252|CRT matches to LT960552 (Yersinia phage fHe-Yen9-03 genome assembly, complete genome: monopartite) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
tttagaaatgttgaaaataacattgaaaat	Protospacer
   *. ***.**********.*********

63. spacer 1.4|251808|30|NZ_LM655252|CRT matches to LR596615 (Yersinia phage fHe-Yen9-04 genome assembly, chromosome: I) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
agtactaatattgaaaataatattaaatgt	Protospacer
.. * *******************.** .*

64. spacer 1.4|251808|30|NZ_LM655252|CRT matches to LR596615 (Yersinia phage fHe-Yen9-04 genome assembly, chromosome: I) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
tttagaaatgttgaaaataacattgaaaat	Protospacer
   *. ***.**********.*********

65. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NC_042116 (Yersinia phage fHe-Yen9-04 genome assembly, complete genome: monopartite) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
agtactaatattgaaaataatattaaatgt	Protospacer
.. * *******************.** .*

66. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NC_042116 (Yersinia phage fHe-Yen9-04 genome assembly, complete genome: monopartite) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
tttagaaatgttgaaaataacattgaaaat	Protospacer
   *. ***.**********.*********

67. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_KT897280 (Clostridium botulinum strain FI1111E1 plasmid pFI1111E1, complete sequence) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aaaaataataatggaaataatattgggatg	Protospacer
.********* **.***********..*

68. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_KT897278 (Clostridium botulinum strain FWSKR40E1 plasmid pFWSKR40E1, complete sequence) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aaaaataataatggaaataatattgggatg	Protospacer
.********* **.***********..*

69. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_KT897279 (Clostridium botulinum strain SWKR38E2 plasmid pSWKR38E2, complete sequence) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aaaaataataatggaaataatattgggatg	Protospacer
.********* **.***********..*

70. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NC_015712 (Clostridium perfringens plasmid pCPPB-1, complete sequence) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aacaataataatgaaaatgatattgaatca	Protospacer
.* ******* *******.********

71. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NC_017421 (Borreliella burgdorferi N40 plasmid N40_lp38, complete sequence) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
ccaaataattttgaaaataattttgatttt	Protospacer
  ******* *********** ****   *

72. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP028866 (Borreliella garinii strain 20047 plasmid lp17, complete sequence) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
ccaaataattttgaaaataattttgatttt	Protospacer
  ******* *********** ****   *

73. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NC_001856 (Borreliella burgdorferi B31 plasmid lp38, complete sequence) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
ccaaataattttgaaaataattttgatttt	Protospacer
  ******* *********** ****   *

74. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP019853 (Borreliella burgdorferi plasmid lp38, complete sequence) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
ccaaataattttgaaaataattttgatttt	Protospacer
  ******* *********** ****   *

75. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP019764 (Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_lp38, complete sequence) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
ccaaataattttgaaaataattttgatttt	Protospacer
  ******* *********** ****   *

76. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MN657082 (Psychrobacter sp. strain ANT_H3 plasmid pA3H2, complete sequence) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
agagttaatattgaaaataataatgaacct	Protospacer
..*. ***************** ****  *

77. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP039725 (Bacillus thuringiensis strain BT-59 plasmid p4, complete sequence) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aaccataatattgaaaataattttgatgac	Protospacer
.*  ***************** **** .*.

78. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP017217 (Borreliella burgdorferi strain B331 plasmid B331_lp38, complete sequence) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
ccaaataattttgaaaataattttgatttt	Protospacer
  ******* *********** ****   *

79. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NC_013940 (Deferribacter desulfuricans SSM1 megaplasmid pDF308, complete sequence) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
attgataatattgtaaataatattgagagt	Protospacer
.  .********* ************.*.*

80. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MK250021 (Prevotella phage Lak-B2, complete genome) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aatcataatattgaaaataatatagatata	Protospacer
.*  ******************* ** *

81. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MK250023 (Prevotella phage Lak-B4, complete genome) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aatcataatattgaaaataatatagatata	Protospacer
.*  ******************* ** *

82. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MK250029 (Prevotella phage Lak-C1, complete genome) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aatcataatattgaaaataatatagatata	Protospacer
.*  ******************* ** *

83. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MK250029 (Prevotella phage Lak-C1, complete genome) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
gaatatattattgaaaataatatactgaac	Protospacer
*** *** ***************   .**.

84. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MK250016 (Prevotella phage Lak-A1, complete genome) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aatcataatattgaaaataatatagatata	Protospacer
.*  ******************* ** *

85. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MK250016 (Prevotella phage Lak-A1, complete genome) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
tcattgaatattaaaaattatattgaaaat	Protospacer
  *   ******.***** ***********

86. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MK250016 (Prevotella phage Lak-A1, complete genome) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
gaatatattattgaaaataatatactgaac	Protospacer
*** *** ***************   .**.

87. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MK250019 (Prevotella phage Lak-A2, complete genome) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aatcataatattgaaaataatatagatata	Protospacer
.*  ******************* ** *

88. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MK250019 (Prevotella phage Lak-A2, complete genome) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
tcattgaatattaaaaattatattgaaaat	Protospacer
  *   ******.***** ***********

89. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MK250019 (Prevotella phage Lak-A2, complete genome) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
gaatatattattgaaaataatatactgaac	Protospacer
*** *** ***************   .**.

90. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MK250027 (Prevotella phage Lak-B8, complete genome) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aatcataatattgaaaataatatagatata	Protospacer
.*  ******************* ** *

91. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MK250026 (Prevotella phage Lak-B7, complete genome) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aatcataatattgaaaataatatagatata	Protospacer
.*  ******************* ** *

92. spacer 1.4|251808|30|NZ_LM655252|CRT matches to LR588166 (Pseudomonas phage vB_PaeM_MIJ3) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aaaaataatatttaaaattatattttatag	Protospacer
.*********** ***** *****  * *

93. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MN694485 (Marine virus AFVG_250M19, complete genome) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aaagaacctattgaaaataaaattgaaaaa	Protospacer
.**.*   ************ ********

94. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MH121069 (Pseudomonas phage vB_PaeM_PA5oct, complete genome) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aaaaataatatttaaaattatattttatag	Protospacer
.*********** ***** *****  * *

95. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MH791397 (UNVERIFIED: Enterococcus phage EfsSzw-1, complete genome) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
tcagaggatattgaaaattttattgaaaat	Protospacer
  *.* .***********  **********

96. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP045822 (Bacillus subtilis strain MB8_B7 plasmid pBs001, complete sequence) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
cgacatattattgaaaataatattcaagag	Protospacer
 .* *** **************** **.*

97. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP045339 (Vibrio sp. THAF190c plasmid pTHAF190c_a, complete sequence) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
acatttcataatgaaaataatattgaaatt	Protospacer
. *  * *** ***************** *

98. spacer 1.4|251808|30|NZ_LM655252|CRT matches to CP016195 (Bacillus thuringiensis serovar coreanensis strain ST7 plasmid pST7-1, complete sequence) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
tcatttaatattaaaaataatattgatgat	Protospacer
  *  *******.************* .**

99. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NC_015149 (Bacillus subtilis subsp. natto plasmid pLS32 DNA, complete sequence, strain: IAM 11631) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
cgacatattattgaaaataatattcaagag	Protospacer
 .* *** **************** **.*

100. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP016589 (Bacillus thuringiensis strain KNU-07 plasmid pBTKNU07-01, complete sequence) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
ttaaataatctagaaaataatattgctgat	Protospacer
  ******* * *************  .**

101. spacer 1.4|251808|30|NZ_LM655252|CRT matches to KY653116 (Staphylococcus phage IME1318_01, complete genome) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aaaatcaatattgaaaataatattacagct	Protospacer
.*** .******************. *. *

102. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MN693652 (Marine virus AFVG_250M189, complete genome) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
ataaataaaattgaaaatgatattgctaaa	Protospacer
. ****** *********.******  **

103. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MG543995 (Staphylococcus phage UPMK_1, partial genome) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aaagaatttattcaaaataatattgaaaaa	Protospacer
.**.*   **** ****************

104. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MN694367 (Marine virus AFVG_250M957, complete genome) position: , mismatch: 7, identity: 0.767

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
caaaatgatattgaaaataataacaatatt	Protospacer
 *****.*************** ..* * *

105. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP024657 (Bacillus cereus strain MLY1 plasmid pMLY1.1, complete sequence) position: , mismatch: 8, identity: 0.733

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
agtctaaatattcaaaataatattgaaaaa	Protospacer
..    ****** ****************

106. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NC_022876 (Bacillus thuringiensis YBT-1518 plasmid pBMB0231, complete sequence) position: , mismatch: 8, identity: 0.733

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
agtctgaatattaaaaataatattgaaaaa	Protospacer
..    ******.****************

107. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_KT897276 (Clostridium botulinum strain INGR16-02E1 plasmid pINGR16-02E1, complete sequence) position: , mismatch: 8, identity: 0.733

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aaaaataataatggaaataatattgggttg	Protospacer
.********* **.***********..

108. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_KT897275 (Clostridium botulinum strain IFR 12/29 plasmid p12/29, complete sequence) position: , mismatch: 8, identity: 0.733

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aaaaataataatggaaataatattgggttg	Protospacer
.********* **.***********..

109. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_KT897277 (Clostridium botulinum strain ST0210E1 plasmid pST0210E1, complete sequence) position: , mismatch: 8, identity: 0.733

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aaaaataataatggaaataatattgggttg	Protospacer
.********* **.***********..

110. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NC_013940 (Deferribacter desulfuricans SSM1 megaplasmid pDF308, complete sequence) position: , mismatch: 8, identity: 0.733

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
cctctttatattgaaaataattttgtaaat	Protospacer
     * ************** *** ****

111. spacer 1.4|251808|30|NZ_LM655252|CRT matches to AP014180 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-C67-MedDCM-OCT-S37-C48, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 8, identity: 0.733

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
gaaattaatattgaaaaaaatattacttta	Protospacer
**** ************ ******.

112. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP022346 (Bacillus thuringiensis strain c25 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aatctaaaaattaaaaataatattgaaaaa	Protospacer
.*    ** ***.****************

113. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP053305 (Spiroplasma citri strain C5 plasmid pScpC5-1, complete sequence) position: , mismatch: 8, identity: 0.733

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aaaaattatattgaaaaaaatatttctttt	Protospacer
.***** ********** ******     *

114. spacer 1.4|251808|30|NZ_LM655252|CRT matches to MN855818 (Myoviridae sp. isolate 237, complete genome) position: , mismatch: 8, identity: 0.733

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
tgtcataatattgataataattttgaacaa	Protospacer
 .  ********** ****** ***** *

115. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP046704 (Nostoc sp. ATCC 53789 plasmid pNsp_a, complete sequence) position: , mismatch: 8, identity: 0.733

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
gaaattaatactgaaaataatatataccgc	Protospacer
**** *****.************  *  ..

116. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP047436 (Spiroplasma citri strain BLH-13 plasmid pSciBLH13-8) position: , mismatch: 8, identity: 0.733

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aaaaattatattgaaaaaaatatttctttt	Protospacer
.***** ********** ******     *

117. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP047442 (Spiroplasma citri strain BLH-MB plasmid pSciBLHMB-5, complete sequence) position: , mismatch: 8, identity: 0.733

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aaaaattatattgaaaaaaatatttctttt	Protospacer
.***** ********** ******     *

118. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP047443 (Spiroplasma citri strain BLH-MB plasmid pSciBLHMB-6, complete sequence) position: , mismatch: 8, identity: 0.733

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aaaaattatattgaaaaaaatatttctttt	Protospacer
.***** ********** ******     *

119. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NC_010631 (Nostoc punctiforme PCC 73102 plasmid pNPUN01, complete sequence) position: , mismatch: 8, identity: 0.733

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
gaaattaatagtgaaaataatatataccgc	Protospacer
**** ***** ************  *  ..

120. spacer 1.4|251808|30|NZ_LM655252|CRT matches to NZ_CP013238 (Clostridium butyricum strain CDC_51208 plasmid pNPD4_2, complete sequence) position: , mismatch: 9, identity: 0.7

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
atggctaatattgaaaataaaattgataca	Protospacer
. .. *************** ***** *

121. spacer 1.4|251808|30|NZ_LM655252|CRT matches to AP014297 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C24, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 9, identity: 0.7

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
ccttttgatattgaaactaatattgaaagc	Protospacer
     *.********* ***********..

122. spacer 1.4|251808|30|NZ_LM655252|CRT matches to KX397372 (Erwinia phage vB_EamM_Phobos, complete genome) position: , mismatch: 9, identity: 0.7

gaaaataatattgaaaataatattgaaaat	CRISPR spacer
aaaaataatattgaagatattattacgtgg	Protospacer
.**************.*** ****. . .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

143497 : 156143

Dickeya_phage(14.29%)

tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045086202.1\|143497_147187_-	methionine synthase	A0A140XBC7	Dickeya_phage	3.3e-14	57.4
WP_045086203.1\|147225_147849_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_052661160.1\|147841_148693_-	EamA family transporter	NA	NA	NA	NA
WP_045086204.1\|148795_149203_+	SufE family protein	NA	NA	NA	NA
WP_045086205.1\|149211_149640_-	phosphoribosyl-AMP cyclohydrolase	A0A2H4UVM0	Bodo_saltans_virus	5.0e-07	29.1
WP_045086369.1\|149678_150383_-	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	1.1e-32	43.0
WP_045086206.1\|150388_150832_-	ribonuclease HI	V9M0C8	Vibrio_phage	5.8e-27	38.4
WP_045086207.1\|150848_151334_-	6,7-dimethyl-8-ribityllumazine synthase	NA	NA	NA	NA
WP_045086208.1\|152199_153291_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.1e-87	46.5
WP_045086209.1\|153328_153655_+	iron-sulfur cluster assembly accessory protein	A0A2H4N7N5	Lake_Baikal_phage	1.3e-12	36.7
WP_045086210.1\|153687_154755_+	23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN	NA	NA	NA	NA
WP_082041942.1\|154859_156143_+\|tRNA	histidine--tRNA ligase	A0A2I2L577	Orpheovirus	1.3e-23	25.4

DBSCAN-SWA_2

277705 : 284066

Acinetobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045086300.1\|277705_278623_-	decarboxylating 6-phosphogluconate dehydrogenase	A0A1D8KPW3	Synechococcus_phage	2.1e-55	36.3
WP_045086301.1\|278639_280043_-	NADP-dependent phosphogluconate dehydrogenase	A0A1D7RS56	Synechococcus_phage	4.0e-29	29.0
WP_045086302.1\|280081_281572_+	anthranilate synthase component I	A0A0B5J984	Pandoravirus	1.1e-29	37.6
WP_045086303.1\|281580_282177_+	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	3.0e-58	54.0
WP_045086304.1\|282200_283214_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	4.1e-52	37.7
WP_102029577.1\|283268_284066_+	indole-3-glycerol-phosphate synthase	A0A0P0IR83	Acinetobacter_phage	1.9e-36	39.5

DBSCAN-SWA_3

314176 : 323172

Vibrio_phage(16.67%)

tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045086323.1\|314176_315988_+	sigma-70 family RNA polymerase sigma factor	A0A2I7SAT0	Vibrio_phage	2.6e-41	40.9
WP_045086324.1\|316201_317110_+	folate-binding protein YgfZ	NA	NA	NA	NA
WP_045086325.1\|317106_318321_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.4e-110	51.3
WP_102029579.1\|318342_318960_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	4.7e-51	52.3
WP_045086327.1\|319294_320161_+	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	1.1e-29	34.5
WP_045086328.1\|320162_321539_-\|tRNA	cysteine--tRNA ligase	A0A161HRB7	Powai_lake_megavirus	1.4e-42	29.6
WP_045086396.1\|321525_323172_-\|tRNA	glutamine--tRNA ligase/YqeY domain fusion protein	A0A222YZ70	Escherichia_phage	1.6e-162	51.3

Anti-CRISPR protein detection

Acr_ID: NZ_LM655252.1|WP_045086323.1|314176_315988_+|sigma-70-family-RNA-polymerase-sigma-factor

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_LM655252.1|WP_045086323.1|314176_315988_+|sigma-70-family-RNA-polymerase-sigma-factor

314176_315988_+

603 aa aa

314176-323172

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_LM655252_1	Orphan	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	316562-316579	1
NZ_LM655252_1	Orphan	1.5\|251856\|18\|NZ_LM655252\|CRT	251856-251873	18	314378-314395	2

1. spacer 1.5|251856|18|NZ_LM655252|CRT matches to NZ_LM655252 position: 316562-316579, mismatch: 1

aaaaaaaatattaaaaaa	CRISPR spacer
aaaacaaatattaaaaaa	Protospacer
**** *************

2. spacer 1.5|251856|18|NZ_LM655252|CRT matches to NZ_LM655252 position: 314378-314395, mismatch: 2

aaaaaaaatattaaaaaa	CRISPR spacer
aaaaaatatattaataaa	Protospacer
****** ******* ***

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_LM655252

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information