CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP009920	Bacillus megaterium NBRC 15308 = ATCC 14581 chromosome, complete genome	10 crisprs	csa3,WYL,DEDDh,cas3,DinG,RT	1	3	6
NZ_CP009919	Bacillus megaterium NBRC 15308 = ATCC 14581 plasmid pBMV_1, complete sequence	0 crisprs	NA	0	0	8
NZ_CP009921	Bacillus megaterium NBRC 15308 = ATCC 14581 plasmid pBMV_2, complete sequence	2 crisprs	RT,DEDDh	0	2	22
NZ_CP009916	Bacillus megaterium NBRC 15308 = ATCC 14581 plasmid pBMV_5, complete sequence	0 crisprs	NA	0	0	0
NZ_CP009917	Bacillus megaterium NBRC 15308 = ATCC 14581 plasmid pBMV_6, complete sequence	0 crisprs	NA	0	0	0
NZ_CP009918	Bacillus megaterium NBRC 15308 = ATCC 14581 plasmid pBMV_4, complete sequence	0 crisprs	NA	0	0	0
NZ_CP009915	Bacillus megaterium NBRC 15308 = ATCC 14581 plasmid pBMV_3, complete sequence	0 crisprs	NA	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 6099

Klosneuvirus(100.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034656350.1\|1110_2553_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_034656304.1\|2575_3631_-	homoserine dehydrogenase	NA	NA	NA	NA
WP_034656302.1\|3620_4868_-	amidohydrolase	NA	NA	NA	NA
WP_034656301.1\|4899_6099_-	cystathionine gamma-synthase family protein	A0A1V0SL56	Klosneuvirus	2.1e-15	22.5

DBSCAN-SWA_2

14209 : 15925

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034656287.1\|14209_15925_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.1e-60	31.0

DBSCAN-SWA_3

19416 : 20217

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_116758304.1\|19416_20217_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.2e-14	28.3

DBSCAN-SWA_4

23790 : 24681

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034656273.1\|23790_24681_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.7e-23	28.4

DBSCAN-SWA_5

38179 : 44711

Geobacillus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034656255.1\|38179_39067_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.5e-42	40.7
WP_034656253.1\|39160_39856_-	hypothetical protein	Q0H249	Geobacillus_phage	2.1e-31	36.2
WP_034656251.1\|39852_40986_-	chromosome partitioning protein ParA	Q0H250	Geobacillus_phage	6.9e-56	34.1
WP_034656248.1\|40998_41298_-	hypothetical protein	NA	NA	NA	NA
WP_034656245.1\|41653_42445_-	DUF817 domain-containing protein	NA	NA	NA	NA
WP_034656243.1\|42583_42805_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_034656240.1\|42815_43292_-	DUF2975 domain-containing protein	NA	NA	NA	NA
WP_034656238.1\|43736_44711_-	zinc-dependent alcohol dehydrogenase family protein	E3SJ82	Synechococcus_phage	2.1e-05	25.2

DBSCAN-SWA_6

48889 : 55204

Ostreococcus_lucimarinus_virus(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034656342.1\|48889_50542_-	thiamine pyrophosphate-binding protein	E5ERI2	Ostreococcus_lucimarinus_virus	5.6e-22	24.8
WP_034656228.1\|50547_52176_-	ATP-binding protein	A0A2K9L5I4	Tupanvirus	2.9e-07	26.9
WP_080743146.1\|52299_52464_-	Spo0E family sporulation regulatory protein-aspartic acid phosphatase	NA	NA	NA	NA
WP_034650889.1\|52809_54342_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_034656340.1\|54436_55204_-	ATP-binding protein	U5N3V8	Enterobacteria_phage	5.5e-41	37.3

DBSCAN-SWA_7

60164 : 65398

Bacillus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034656338.1\|60164_60566_+	transcriptional regulator Spx	M1PLC0	Streptococcus_phage	2.1e-07	31.2
WP_050690765.1\|61561_61777_+	hypothetical protein	A0A0S2SXM9	Bacillus_phage	3.7e-27	81.4
WP_050690778.1\|62101_62857_+	S8 family serine peptidase	A0A1B0T6A2	Bacillus_phage	3.9e-31	37.6
WP_115648278.1\|63569_63785_+	hypothetical protein	NA	NA	NA	NA
WP_034656334.1\|63802_64120_+	hypothetical protein	NA	NA	NA	NA
WP_144406913.1\|64249_65398_+\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.0e-38	63.0

DBSCAN-SWA_8

69219 : 70683

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034656352.1\|69219_70683_-	ABC-F type ribosomal protection protein	A0A1B0RXA0	Streptococcus_phage	1.3e-107	42.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP009920

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP009920_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009920_1

832320-832414

Orphan

Consensus_repeat	Method
CCTTGGCCCCCTCCTCCAGGTGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP009920_1

>merge|NZ_CP009920|1|832320-832414|CRISPRCasFinder
CCTTGGCCCCCTCCTCCAGGTGGTGGTGGTGGAAATCCTTGACCTCCTCCTCCAGGTGGCGGCGGTGGAAATCCTTGGCCTCCTCCTCCAGGTGG

>NZ_CP009920|1|1|832320-832414|CRISPRCasFinder
CCTTGGCCCCCTCCTCCAGGTGG	TGGTGGTGGAAATCCTTGACCTCCTCCTCCAGGTGGCGGCGGTGGAAAT
CCTTGGCCTCCTCCTCCAGGTGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009920.1\|WP_013058702.1\|827295_827568_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_034649382.1\|838629_839256_-\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239486
NZ_CP009920.1\|WP_016765302.1\|831266_831893_-\|FMN-dependent-NADH-azoreductase	unknown	unknown	gnl\|CDD\|224103
NZ_CP009920.1\|WP_013058713.1\|838059_838383_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_034649381.1\|840248_841085_-\|serine/threonine-protein-kinase	unknown	unknown	gnl\|CDD\|270916
NZ_CP009920.1\|WP_013058701.1\|826455_827274_-\|membrane-protein-insertase-YidC	unknown	unknown	gnl\|CDD\|179508
NZ_CP009920.1\|WP_016765306.1\|839491_840262_-\|sporulation-protein	unknown	unknown	gnl\|CDD\|369195
NZ_CP009920.1\|WP_016765297.1\|823640_824483_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP009920.1\|WP_013084668.1\|830203_830701_-\|PTS-glucose-transporter-subunit-IIA	unknown	unknown	gnl\|CDD\|376324
NZ_CP009920.1\|WP_013084671.1\|832649_833195_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_034649394.1\|825148_826354_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_034649400.1\|822952_823639_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_013058712.1\|837855_838008_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_034649384.1\|835293_836742_-\|SulP-family-inorganic-anion-transporter	unknown	unknown	gnl\|CDD\|223732
NZ_CP009920.1\|WP_034649397.1\|824603_825113_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP009920.1\|WP_013084672.1\|833883_835050_+\|rod-shape-determining-protein-RodA	unknown	unknown	gnl\|CDD\|274033
NZ_CP009920.1\|WP_034649390.1\|827779_829159_-\|PTS-sucrose-transporter-subunit-IIBC	unknown	unknown	gnl\|CDD\|131051
NZ_CP009920.1\|WP_074893265.1\|841088_841343_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_034649389.1\|829338_830166_-\|PRD-domain-containing-protein	unknown	unknown	gnl\|CDD\|170086
NZ_CP009920.1\|WP_013058711.1\|836956_837661_-\|purine-nucleoside-phosphorylase	unknown	unknown	gnl\|CDD\|180275

Protein	Function_ID	Function_description	E-value
NZ_CP009920.1\|WP_034649382.1\|838629_839256_-\|phosphatase-PAP2-family-protein	gnl\|CDD\|239486	cd03392, PAP2_like_2, PAP2_like_2 proteins. PAP2 is a super-family of phosphatases and haloperoxidases. This subgroup, which is specific to bacteria, lacks functional characterization and may act as a membrane-associated lipid phosphatase.	6.26267e-46
NZ_CP009920.1\|WP_016765302.1\|831266_831893_-\|FMN-dependent-NADH-azoreductase	gnl\|CDD\|224103	COG1182, AcpD, Acyl carrier protein phosphodiesterase [Lipid metabolism].	3.62998e-85
NZ_CP009920.1\|WP_034649381.1\|840248_841085_-\|serine/threonine-protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	1.14208e-51
NZ_CP009920.1\|WP_013058701.1\|826455_827274_-\|membrane-protein-insertase-YidC	gnl\|CDD\|179508	PRK02944, PRK02944, YidC family membrane integrase SpoIIIJ.	6.90293e-106
NZ_CP009920.1\|WP_016765306.1\|839491_840262_-\|sporulation-protein	gnl\|CDD\|369195	pfam07070, Spo0M, SpoOM protein. This family consists of several bacterial SpoOM proteins which are thought to control sporulation in Bacillus subtilis.Spo0M exerts certain negative effects on sporulation and its gene expression is controlled by sigmaH.	1.36583e-92
NZ_CP009920.1\|WP_016765297.1\|823640_824483_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	1.01039e-46
NZ_CP009920.1\|WP_013084668.1\|830203_830701_-\|PTS-glucose-transporter-subunit-IIA	gnl\|CDD\|376324	pfam00358, PTS_EIIA_1, phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1.	2.28018e-69
NZ_CP009920.1\|WP_034649384.1\|835293_836742_-\|SulP-family-inorganic-anion-transporter	gnl\|CDD\|223732	COG0659, SUL1, Sulfate permease and related transporters (MFS superfamily) [Inorganic ion transport and metabolism].	9.59774e-137
NZ_CP009920.1\|WP_013058711.1\|836956_837661_-\|purine-nucleoside-phosphorylase	gnl\|CDD\|180275	PRK05819, deoD, DeoD-type purine-nucleoside phosphorylase.	1.12353e-162
NZ_CP009920.1\|WP_034649397.1\|824603_825113_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	8.64084e-16
NZ_CP009920.1\|WP_013084672.1\|833883_835050_+\|rod-shape-determining-protein-RodA	gnl\|CDD\|274033	TIGR02210, Rod_shape-determining_protein_RodA, rod shape-determining protein RodA. This protein is a member of the FtsW/RodA/SpoVE family (pfam01098). It is found only in species with rod (or spiral) shapes. In many species, mutation of rodA has been shown to correlate with loss of the normal rod shape. Note that RodA homologs are found, scoring below the cutoffs for this model, in a number of both rod-shaped and coccoid bacteria, including four proteins in Bacillus anthracis, for example. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Cell division].	2.86899e-108
NZ_CP009920.1\|WP_034649390.1\|827779_829159_-\|PTS-sucrose-transporter-subunit-IIBC	gnl\|CDD\|131051	TIGR01996, Includes:_Phosphotransferase_enzyme_IIB_component, PTS system, sucrose-specific IIBC component. This model represents the fused enzyme II B and C components of the sucrose-specific PTS sugar transporter system. Sucrose is converted to sucrose-6-phosphate in the process of translocation into the cell. Some of these transporters lack their own IIA domains and instead use the glucose IIA protein (IIAglc or Crr). The exceptions to this rule are Staphylococci, Streptococci, Lactococci, Lactobacilli, etc. which contain their own A domain as a C-terminal fusion. This family is closely related to the trehalose transporting PTS IIBC enzymes and the B and C domains of each are described by subfamily-domain level TIGRFAMs models (TIGR00826 and TIGR00852, respectively).	0
NZ_CP009920.1\|WP_034649389.1\|829338_830166_-\|PRD-domain-containing-protein	gnl\|CDD\|170086	PRK09772, PRK09772, transcriptional antiterminator BglG; Provisional.	2.32979e-49

>NZ_CP009920.1|WP_016765302.1|831266_831893_-|FMN-dependent-NADH-azoreductase
MANVLYVKVNPQVDEASFSTRLAQVFLDEYKTANPTDTVTTLDLYKETVPFIDGDVLAAWGKAGAGEELSAVELEKVTRMGELVEQFLQADKVIFSAPMWNLSFPPLMKAYIDNILIAGKTFKYTENGPVGLASDKKVVLLEARGGVYSEGPAAELEFTQSYLRTVMSFIGVQDFHLVVAEGMAYTPAEADNILAKASEKAKEVASTF
>NZ_CP009920.1|WP_013084668.1|830203_830701_-|PTS-glucose-transporter-subunit-IIA
MFKKLFGNKTKSKETTVLAPLSGNILPISEVPDPVFAQKMMGDGFAIEPSEGQVVSPVAGEVVQLFHTKHAVGLKTEAGTEVLIHIGLETVAMEGEGFEAHVAQGDKVSVGTPLITFDLALIQEKAKSIITPIVITNSDASESFEILAQGTVQKGETACAKVTMK
>NZ_CP009920.1|WP_034649389.1|829338_830166_-|PRD-domain-containing-protein
MKILKVLNNNAVVFKEGGVEKIAMGPGIAFQKGKNDLINAAKVEKVFVMKEEQEKFQELLKNLPEEHIQVAEEIISYAEQQLSATLSHHVHITLSDHLSFAVERIARGISIQNKLLNEIKSLYQPEYAIGVWALKHIKKRLDITMPIDEAGYIALHIHTAKLNSPGMQQLMMNTTIINEMVTIIKKELNMEIDENSMSYQRLLTHLRFALNRLAQNEPFHEMDEEMLNVLKVKYKKSYQCAETIKQFVKDEYEINFPEAELGYITLHICRIEQRI
>NZ_CP009920.1|WP_034649390.1|827779_829159_-|PTS-sucrose-transporter-subunit-IIBC
MDVKEIAEKLVPLLGGKGNIASAQHCATRLRLVIRDESKIDQKGLDEIEDVKGAFSNSGQFQIIFGTGLVNKIHAAFVKELGDDEAAAPADHQEEMKKKMNPFARFARMLSNIFVPIIPAIVASGLLMGLLGMMKAFHWVSEDSALFVLLDMFSGAAFIILPILIGFSAAKEFGSNPYLGAVIGGILTHPMLLNPWTLADAKPEYMDLFGLSIPLIGYQGTVVPILLAIYVMSKIEKGLRKIVPNSVDLLVTPFLTVIITGFVSLVFIGPFGRYIGDLISISLQSLYDVAGVFAGILFGGLYSTIVLTGLQHSFHAIEAGLLANPKIGVNFLLPIWACANVAQGGAGLAVYFKTKNAKTKKIAIPAAISSFLGITEPIIFGVNLRLRKPFIAAAIGGAAGGGYVVLMHVVANAYGLTGIPMMAIAAPLGMSNLIHYIIGMIISVGVAFGVTWFMKLKED
>NZ_CP009920.1|WP_013058702.1|827295_827568_-|hypothetical-protein
MEFYHDLFLYAPYLSAFVLYILCYYMLREARFTAFHAEPVTDHVNAGIDPSVLTIWKRRNVFIHVYRKTPVKEKNNDEEDPFLLKNTSYI
>NZ_CP009920.1|WP_013058701.1|826455_827274_-|membrane-protein-insertase-YidC
MKRNKKLLLLGLMGALLLALAGCSSTKTPVTATSGGFWDHYFVYPLSMALTKIAEWAGGSYGLSIIIATVIIRLVLLPLILKQQKSTMAMQALRPEMEKIQKKYAGKKDPETQQKQQKEMMQLYQTHKINPVGGCLPIFIQMPIIIAFYNAIARTHEIAQHSFLWVSLGKPDPYFILPVVAAITTFLQIRVSMTDEIQPPMKMMMNIMPIFILVAGISLPSALALYWVIGNLFGIGQGYYLKKRMSLLKEKDAANNTAQAKTKPSPKSKSKS
>NZ_CP009920.1|WP_034649394.1|825148_826354_-|hypothetical-protein
MVKKIALCLLFLMLFPMQINAANTVKVSFIRQGNLWVYDNGTERQLSYARHASMPQWSSHGDIVAYAENDSLMIAPLKGKPLLVEHDVTHYQWSPVAEELAYISNGILVYYNVKTHEKKRVAVGVDQFSWFPEGDRFLITSAAALAPTGWGPVKLYTVSKYAGLDVKKVEAFTTLPAENDSFFAYTTSSFKWSPNGQWISFIAIPTASMSADANKLCIITKEGKAFQVVGDMLNVPNWFKWSNEEQVLAFIDGEGRFATENKKFTLKEMPVFKEHVFTPKGFADWDFTWTEKDNIIISRVPEAGWSNDEKKRPLPFLYSMDVKTNKQSQFTFPQKGLGDYAPVYHKATNQTMWIRTNRKQANLLTRVKDTKNDKVLISGLDLPGNYYELYRWNEVFSVYNP
>NZ_CP009920.1|WP_034649397.1|824603_825113_-|GNAT-family-N-acetyltransferase
MNIRLLVKEDADMYFELRLRALKDHPESFILSYEEEYEKEIADIRNYFPSSQSEFVVGAFMEKQLVGIVGFQQQKPLKVQHKGDIWGMYVAPEARGKGLGKKLLKTAVEQAFSKTNVLQIYLAVAAKNEGVKALYKSLGFTSYAYEKRALQVDGEFIDEEHMVLSIKSL
>NZ_CP009920.1|WP_016765297.1|823640_824483_-|ATP-binding-cassette-domain-containing-protein
MEKLIELKNVAKVYKKHTVLENVHTTLYKGETVAIVGKNGAGKSTFLKLIGGLSKPTKGTVHLHKETGTPGFVVEQFPQELRFTLAGYLQHMGRIQGLSKKKRSSRIEELLETFEMVEFRHEEIISFSKGMKQKVNMMQALLSSSKLLLLDEPLSGLDARAQLEVERIFTKLKERGMTIVFTCHEERLIHAVADRVITIGSQRILKNERVQLIEHLTVIEANVILNKPLRLLKEKCTKIEQHGNYWIFYIDKKYVNEFLAELLAVQAEVVKLYHMEREEI
>NZ_CP009920.1|WP_034649400.1|822952_823639_-|hypothetical-protein
MGALIRYHFITYIKSYRYIPPLALYIISLCMNYTYRPNPVLDSFFNTALFLFFLTTWFTMSLFHAEDSGQEVITKLHVGKKNKYFMSKLISCTLLFTFLSAVSIAYPVLLDMFEVDISTRQMVFGFIIHWTFSLLGMSIGLVFTRDVVREGSLSWFGPLFILIVTLAAAGVSFPYQGGGLLLYVLPPVSAIIQFINEGLNKFLVFGWALLYAIALISLYLWRANRRDV
>NZ_CP009920.1|WP_013084671.1|832649_833195_-|hypothetical-protein
MIIGASVTALLLLWWTIFYSGRYYHYVSEPVGKRISLHVGIHVTLVVGVNACLWLEQPLLFSSILAGCAGLGAGWFVGIPFSVKSILSGIMGGIGTGVSFYISMSMWMDQFNWLSFLLIGTSVIFSGSSLFQVLKSIPSFEKVLVKMWIQHPFLIAPILITVFWLYNFIEKYFPQADPTRK
>NZ_CP009920.1|WP_013084672.1|833883_835050_+|rod-shape-determining-protein-RodA
MGENQRNVSRFDWNLAFLIFLLFCVSVVAIHSAEKIGQYDKNFVAQQVVFYIIGMVIIGFVMRFDSDQLQKLTWVFYGFGNFLLLLLLVAPSSIAREINGAKSWFTLPGFSLQPSEFMKVFLIITLSTVIVKHNEKYRIRTVREDFLLLGKLGAVLALPLLLIMQQPDLGTALVFLAITVGLVFVSGVSWKIIAPAFLGITAVGSVILGLVVYAPSLLEKYLGVKQYQFGRIYSWLDPESYSSGEGYHLKKSLDAIGSGMVNGKGIGNGVVYLPEGQTDFIFAVIGEEFGFIGASIVISLFFVLVYYLIKLGLETKNEFNSYLCVGVISMLTFHVFQNIGMTIQVLPITGIPLPFISYGGSSLMGNMFAMGLMFGISWHHKRYMFGND
>NZ_CP009920.1|WP_034649384.1|835293_836742_-|SulP-family-inorganic-anion-transporter
MVASIKQQWFSNVRADILSGMTVALALIPEALAFSIIAGVDPMVGLYASFCMAIVIAFTGGRPAMISAATGAMSLLMINLVKDHGIEYLFAATVLTGIIQILLGVLKVGRFLSFLPQTVMIGFVNALGILIFTAQLPHFQGANWMMYAMVAGTLLIVYLFPLMTKAIPSPLVAIVLMTIVAIVFHLDLKTVGDMGNITRSLPVLHFPKVDLSVEMLLIILPYSLPLAIVGLLESMLTATVLDEITDTPSNKNKEARGQGIANIVTGFFGGMAGCAMIGQSMINVKSGGRGRLSTLVAGVFLLFLIMVLGDVVKQIPMAALVGVMFMVAAGTFDWQSLKDLTKYPLSDAIVMVVTVVIVLFTHNLALGVMVGIVLSTIAFGWKMAKIKTTSQTEGNMKQYRVSGQLFFATISFFMDEFQYETDPDTIIIDFSSSHIWDQSAVIGISKIIDKYERLNKKVIVKGLNEDSKKIVRQIGITSLSNK
>NZ_CP009920.1|WP_013058711.1|836956_837661_-|purine-nucleoside-phosphorylase
MSVHIGAKQGDIAETILLPGDPLRAKYIAETFLEDVTCYNEVRGMLGFTGTYKGKRVSVQGTGMGVPSIAIYVNELMNEYGVQNLIRVGTCGAIQKDVKVRDVILAMSSSSDSQMNRVKFGPIDYAPTANFDLLKRAYDAGVEKGLQLKVGSVFTSDQFYNEDGQLEKLAAHGVLAVEMETTALYTLAAKYGRNALSVLTVSDHIFTGEETTSEERQTTFNDMIVVALEAAINE
>NZ_CP009920.1|WP_013058712.1|837855_838008_+|hypothetical-protein
MGKKHRNRINSPKKNNHIPKEAIIAEHEAHGDEYSATNRKNGPGHHTRDY
>NZ_CP009920.1|WP_013058713.1|838059_838383_-|hypothetical-protein
MLSVWTTIKKQFNISTEYDVTIMQTEEKGEKRGYKPVHRLTITAFDHQDAATQVFQMFNIADNLPKDCDARFISTGDILLIDEGTRGKYYYKLWTDGWQKVNRLHVR
>NZ_CP009920.1|WP_034649382.1|838629_839256_-|phosphatase-PAP2-family-protein
MVNRTTKYSLFIVSLLAFFLLILFTFNTPWVKQLDFNVLHTIEGWRTDTLTPIIIFITTVGSWYVTAPIWFAIIVLLLYKRKGLLVLYITLVFWGVRALNWGLKEIFARPRPDWSQVVPASHYSFPSGHAMNSMAFYSGILLLIWMYTRSRAVKTAAACVIAIVILLIGFSRLYLGVHFLTDILAGYCLGLAWSLGVYLLSKRLYNQK
>NZ_CP009920.1|WP_016765306.1|839491_840262_-|sporulation-protein
MALFNKALARIGIGAARVDAKLVNDEFRAGEKIEGIVEVYGGNVEQKIDSIYLRLFTTYVKERDDKKYKQDIELNTFKINDPFTIQPSETKSIPFTFQLPDDTPVTLGRTRVWVATSLDIKDAVDPSDIDHVKVLPNLMVTSTIEAMEQLGFRLRQVECEEAPRRMRKRLPFVQEFEFVPSGGVYAGKVDEIEIIVQPSGLHDYNLFIEVDRRARGFGGFLSEMLDADESLVHVHVSEKEIPQLKNILTSIISRYS
>NZ_CP009920.1|WP_034649381.1|840248_841085_-|serine/threonine-protein-kinase
MMKNRMFKYFYRWLVDRPFKKGKVICGRYEIIDVLGMGSYGITYVANDIVQQKKVVVKQLRKTKQRTSQGLKSYHYEAKLLSQLNHPQIPSLYEAIETDEGCFLVMELIQGKTFEDLIFEEKCVYTEEQALNILLNILDVVSAIHEQGIVHRDLRIPNIIDVNGTIYVIDFGLARFLGDHEETSTLIEEQQFMRQTSAASDIYALGHFLLFLLYSGYEPTEQQERSWEQELHLSAPIKTIIQKMLRTDESYESIKSLQKDIYDYINSKNSGRGKYGAI
>NZ_CP009920.1|WP_074893265.1|841088_841343_-|hypothetical-protein
MFRKIFESLTGSKHRRYSSSDRHYRRARHYSSSDHHYRRPRHHSSSSDYKRSKYYDSHSHSKYGHHHYKRKRKSGSFFSSFFSS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009920_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009920_2

2523110-2523208

Orphan

Consensus_repeat	Method
GTGAAACAACAAAATGCTCAAGCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP009920_2

>merge|NZ_CP009920|2|2523110-2523208|CRISPRCasFinder
GTGAAACAACAAAATGCTCAAGCATCTAAAAACAATTTCGGTACTGAATTTGGTAGCGAAACAAATGTACAAGAAGTGAAACAACAAAATGCTCAAGCA

>NZ_CP009920|2|2|2523110-2523208|CRISPRCasFinder
GTGAAACAACAAAATGCTCAAGCA	TCTAAAAACAATTTCGGTACTGAATTTGGTAGCGAAACAAATGTACAAGAA
GTGAAACAACAAAATGCTCAAGCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009920.1\|WP_034654802.1\|2515673_2516576_-\|TIGR01777-family-protein	unknown	unknown	gnl\|CDD\|187553
NZ_CP009920.1\|WP_034654806.1\|2520745_2521840_+\|A/G-specific-adenine-glycosylase	unknown	unknown	gnl\|CDD\|224115
NZ_CP009920.1\|WP_016762869.1\|2524812_2526564_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP009920.1\|WP_013081552.1\|2530743_2531535_+\|ABC-2-family-transporter-protein	unknown	unknown	gnl\|CDD\|226953
NZ_CP009920.1\|WP_014461824.1\|2523649_2523910_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372951
NZ_CP009920.1\|WP_014461827.1\|2521873_2522098_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_034655325.1\|2531544_2532330_+\|ABC-2-family-transporter-protein	unknown	unknown	gnl\|CDD\|226218
NZ_CP009920.1\|WP_034654809.1\|2529737_2530751_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|213234
NZ_CP009920.1\|WP_170836848.1\|2522211_2522964_+\|enoyl-[acyl-carrier-protein]-reductase-FabL	unknown	unknown	gnl\|CDD\|236145
NZ_CP009920.1\|WP_026106492.1\|2519525_2520506_-\|metal-dependent-hydrolase	unknown	unknown	gnl\|CDD\|224899
NZ_CP009920.1\|WP_016762864.1\|2517772_2518426_-\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|187643
NZ_CP009920.1\|WP_013081554.1\|2532423_2532816_+\|two-pore-domain-potassium-channel-family-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_013055171.1\|2532885_2533356_+\|thioredoxin-dependent-thiol-peroxidase	unknown	unknown	gnl\|CDD\|224146
NZ_CP009920.1\|WP_016762865.1\|2518901_2519057_-\|small,-acid-soluble-spore-protein-K	unknown	unknown	gnl\|CDD\|285399
NZ_CP009920.1\|WP_034654804.1\|2518508_2518823_+\|YfhH-family-protein	unknown	unknown	gnl\|CDD\|378063
NZ_CP009920.1\|WP_013055163.1\|2524106_2524643_+\|DUF402-domain-containing-protein	unknown	unknown	gnl\|CDD\|184219
NZ_CP009920.1\|WP_028410116.1\|2528236_2529535_-\|glutamate-1-semialdehyde-2,1-aminomutase	unknown	unknown	gnl\|CDD\|183493
NZ_CP009920.1\|WP_013055156.1\|2519192_2519462_+\|YfhJ-family-protein	unknown	unknown	gnl\|CDD\|379438
NZ_CP009920.1\|WP_013081550.1\|2526599_2527688_-\|aromatic-acid-exporter-family-protein	unknown	unknown	gnl\|CDD\|226614
NZ_CP009920.1\|WP_013081541.1\|2516673_2517483_+\|recombination-regulator-RecX	unknown	unknown	gnl\|CDD\|237619

Protein	Function_ID	Function_description	E-value
NZ_CP009920.1\|WP_034654802.1\|2515673_2516576_-\|TIGR01777-family-protein	gnl\|CDD\|187553	cd05242, SDR_a8, atypical (a) SDRs, subgroup 8. This subgroup contains atypical SDRs of unknown function. Proteins in this subgroup have a glycine-rich NAD(P)-binding motif consensus that resembles that of the extended SDRs, (GXXGXXG or GGXGXXG), but lacks the characteristic active site residues of the SDRs. A Cys often replaces the usual Lys of the YXXXK active site motif, while the upstream Ser is generally present and Arg replaces the usual Asn. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.78071e-138
NZ_CP009920.1\|WP_034654806.1\|2520745_2521840_+\|A/G-specific-adenine-glycosylase	gnl\|CDD\|224115	COG1194, MutY, A/G-specific DNA glycosylase [DNA replication, recombination, and repair].	2.13935e-151
NZ_CP009920.1\|WP_016762869.1\|2524812_2526564_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	0
NZ_CP009920.1\|WP_013081552.1\|2530743_2531535_+\|ABC-2-family-transporter-protein	gnl\|CDD\|226953	COG4587, COG4587, ABC-type uncharacterized transport system, permease component [General function prediction only].	2.41995e-29
NZ_CP009920.1\|WP_014461824.1\|2523649_2523910_+\|hypothetical-protein	gnl\|CDD\|372951	pfam14182, YgaB, YgaB-like protein. The YgaB-like protein family includes the B. subtilis YgaB protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length.	8.73208e-20
NZ_CP009920.1\|WP_034655325.1\|2531544_2532330_+\|ABC-2-family-transporter-protein	gnl\|CDD\|226218	COG3694, COG3694, ABC-type uncharacterized transport system, permease component [General function prediction only].	2.51572e-45
NZ_CP009920.1\|WP_034654809.1\|2529737_2530751_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|213234	cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA. NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake. NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the proton-motive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunorubicin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single integral membrane protein.	6.91854e-121
NZ_CP009920.1\|WP_170836848.1\|2522211_2522964_+\|enoyl-[acyl-carrier-protein]-reductase-FabL	gnl\|CDD\|236145	PRK08063, PRK08063, enoyl-[acyl-carrier-protein] reductase FabL.	8.81546e-173
NZ_CP009920.1\|WP_026106492.1\|2519525_2520506_-\|metal-dependent-hydrolase	gnl\|CDD\|224899	COG1988, COG1988, Predicted membrane-bound metal-dependent hydrolases [General function prediction only].	3.50396e-35
NZ_CP009920.1\|WP_016762864.1\|2517772_2518426_-\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|187643	cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine reductase (KDSR) and related proteins, classical (c) SDR. These proteins include members identified as KDSR, ribitol type dehydrogenase, and others. The group shows strong conservation of the active site tetrad and glycine rich NAD-binding motif of the classical SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	6.21581e-56
NZ_CP009920.1\|WP_013055171.1\|2532885_2533356_+\|thioredoxin-dependent-thiol-peroxidase	gnl\|CDD\|224146	COG1225, Bcp, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones].	5.31486e-80
NZ_CP009920.1\|WP_016762865.1\|2518901_2519057_-\|small,-acid-soluble-spore-protein-K	gnl\|CDD\|285399	pfam08176, SspK, Small acid-soluble spore protein K family. This family consists of the small acid-soluble spore proteins (SASP) belonging to the K type (sspK). The sspK are unique to the spores of Bacillus subtilis and are expressed only in the forespore compartment of sporulating cells of this organism. The sspK gene is monocistronic and transcription is primarily by the RNA polymerase with the forespore-specific sigma factor, sigma-G. Mutation deleting sspK results in loss of SspK from the spore but had no discernible effect on sporulation, spore properties or spore germination.	2.11098e-16
NZ_CP009920.1\|WP_034654804.1\|2518508_2518823_+\|YfhH-family-protein	gnl\|CDD\|378063	pfam08838, DUF1811, Protein of unknown function (DUF1811). This is a bacterial family of uncharacterized proteins. Some of the proteins are annotated as being transcriptional regulators. The structure of one of the proteins in this family has revealed a beta-barrel like structure with helix-turn-helix like motif.	2.3812e-59
NZ_CP009920.1\|WP_013055163.1\|2524106_2524643_+\|DUF402-domain-containing-protein	gnl\|CDD\|184219	PRK13662, PRK13662, hypothetical protein; Provisional.	2.65481e-127
NZ_CP009920.1\|WP_028410116.1\|2528236_2529535_-\|glutamate-1-semialdehyde-2,1-aminomutase	gnl\|CDD\|183493	PRK12389, PRK12389, glutamate-1-semialdehyde aminotransferase; Provisional.	0
NZ_CP009920.1\|WP_013055156.1\|2519192_2519462_+\|YfhJ-family-protein	gnl\|CDD\|379438	pfam14043, WVELL, WVELL protein. This family includes the B. subtilis YfjH protein, which is functionally uncharacterized. This is not a homolog of E. coli YfjH, a synonym for IscX, which belongs to pfam04384. This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length and contain a highly conserved WVELL motif.	7.28774e-43
NZ_CP009920.1\|WP_013081550.1\|2526599_2527688_-\|aromatic-acid-exporter-family-protein	gnl\|CDD\|226614	COG4129, COG4129, Predicted membrane protein [Function unknown].	3.54796e-67
NZ_CP009920.1\|WP_013081541.1\|2516673_2517483_+\|recombination-regulator-RecX	gnl\|CDD\|237619	PRK14135, recX, recombination regulator RecX; Provisional.	8.10118e-120

>NZ_CP009920.1|WP_170836848.1|2522211_2522964_+|enoyl-[acyl-carrier-protein]-reductase-FabL
MMSQKVALVTGSSRGIGKEIALRLAKEGYDIVLNYARSKSAAQEVAEEIKALGREALVVKANVGKVEKIKEMFEQIDEAFGRLDVFVSNAASGVLRPIMELEETHWNWTMDINSKGYLFCAQEAAKRMEKVGGGKIVTISSLGSIRYLENYTTVGVSKAAVEALTRYLAVELAPKNIVVNAVSGGAVDTEALKHFPNRDELLDDARKHTPAGRMVEPKDMVDAVMFLVSDQANMICGQTLIIDGGRSLLM
>NZ_CP009920.1|WP_014461827.1|2521873_2522098_-|hypothetical-protein
MYVGRDMTALSMISKSEWKDSELAFFHHSLQQMTPYLNAEGQSIHQQIIKEIEARGGLQRHEADYTHGTHVSYD
>NZ_CP009920.1|WP_034654806.1|2520745_2521840_+|A/G-specific-adenine-glycosylase
MKQSKDIVQNFDIRAFQDDLISWFEQEQRILPWRQDQDPYKVWVSEIMLQQTRVDTVIPYFNNFISKFPTIKDLAYANEDDVLKAWEGLGYYSRARNLQTAVREVHEQYGGEVPNTPAEISKLKGVGPYTTGAILSIAYGVPQPAVDGNVMRVLSRILSVWDDIAKPKTRKLFEDIVHEIISKDNPSYFNQGMMELGAIVCTPTSPSCLLCPVREHCRAFEEGVQNELPVKSKKKAPRALQLAAVVIRDEDGNYLIHKRPSKGLLANLWEFPNIEVDLSIAPDHQQLQAFIQNEYGADIKINAPFTTIQHVFSHIVWNVTVYEAELVSDISALKNLKVVSEKDLEQYAFPVSHQKILKEYLLVK
>NZ_CP009920.1|WP_026106492.1|2519525_2520506_-|metal-dependent-hydrolase
MDTGTHIAMGIALGGLATLDPTVSANTATLDAVMIGVMAGSLAPDLDTVLKLRNNAQYIRNHRGITHSIPAVILWPLLIVLILSLLLPGANLLHLWMWTFAGVIIHVFVDIFNAYGTQALRPFTNKWIALGVINTFDYVIFSAHVLAILIWFIGAEPGPTFITLYVLLAFYYGLRFYMRHQIAKKLRKQFPDVIKLNISPTLRFTHWHLAVTTEKYFHVGRAIGEEIFIYDTFDKVPIPESAVIEVAKKDENLSAFLSFSPIYRWELDEYNDHIEVRFIDLRYRSKDYYPFVAVVQLDYDLNIICSYTGWIFSEKKLRKKLDYLPH
>NZ_CP009920.1|WP_013055156.1|2519192_2519462_+|YfhJ-family-protein
MNDIFERLTNQLLNKNSSLSYAQARTWVELFWEDFESSYAKAGYDYKGKEATEKVVTMYINSYGDKLHEIAVKNPKYQHLLNNDDYLKH
>NZ_CP009920.1|WP_016762865.1|2518901_2519057_-|small,-acid-soluble-spore-protein-K
MRNKAKDFTNQHHTKLEGEPRAKAEYASKRANGTINTHPQERMHASNEREE
>NZ_CP009920.1|WP_034654804.1|2518508_2518823_+|YfhH-family-protein
MSEKRYSDMTTYELQQEIGSLQEKARKAEQLGMVNEYAVLERKVTMARSYLLDPEAFKAGEVYEIQGDPGSYFKIDYMNGVFAWGFRLGSPQNEEALPISMLKK
>NZ_CP009920.1|WP_016762864.1|2517772_2518426_-|SDR-family-NAD(P)-dependent-oxidoreductase
MKTVLITGGATGLGKELAKLYAKDYNVILAGRNQHKLKEAQHELGDNVYTMSVDITKYEEVGKSVEKLLMQHSVDILINNAGIGHFGPLTDYTKQAIDEVIDTNVKGTIFLTQALMPHLLTRPEPKVMNIISTAGLRGKANESVYVASKFGVRGFTESLKVEYQDTSLHVIAAYMGGMNTPFWDHNNHIKDKSRLRSASEIAEIIYKQQNDSEDILF
>NZ_CP009920.1|WP_013081541.1|2516673_2517483_+|recombination-regulator-RecX
MPVVTKITTQKNSGERYNVYLDYGKGEEFGFGVDENVLIKYDLKKGRELDEFELTEIQYADDEKKAYNLAITYLSYRMRSEKEVHDYLKKKEINSTIIQQVIQKLVSHRYLNDEEFAKAFVLTQMNTTSKGPSVIQRELKEKGISDSTITLSLCEYPEEQQIQTAVKLIEKLKGKYKKLSQVMMKQKMEQALAVKGYSFSIIQEAFQRTNTEKESDEAWEALQYQGMKAHRRFSKYEGWEYQQKMKQALYRKGFSIDQIQSFLDSIEEE
>NZ_CP009920.1|WP_034654802.1|2515673_2516576_-|TIGR01777-family-protein
MKIVIAGGTGFVGKALTKHFLTQKHYVYILTRNADKAARDPKLKYVEWMQESSQPEEHVEGADVFINLAGVSLNSGRWTDERKKAIVESRLSSTQEILRIMAALPEKPSLYVNASAVGYYGTSTTETFTEASPSIGTDFLAETVKKWENEALKAMELNIRTVLTRFGVILGKDGGALPSTALPYKLFAGGTVGSGEQWMSWVHLQDVVKIIDYCIHTKQIEGPVNVTAPNPVQMKEFGKKIGKVLNRPHWMPVPSFGLQLLMGEMSMIILKGQRVLPEKLIQQNYIFTYTVLEDALRDLL
>NZ_CP009920.1|WP_014461824.1|2523649_2523910_+|hypothetical-protein
MKKFDQLVTQQLETMDQLLFLQSEIERCQEIEGELVKLHEEAKLHSVQDEISEMKLKLKEIQLTFEAQTEDIIRTYKSEGACSTLA
>NZ_CP009920.1|WP_013055163.1|2524106_2524643_+|DUF402-domain-containing-protein
MGIPVEGETIQIHSYKHNGHIHRVWDRTTVLKATNNLVIGGNDRTVVTESDGRTWVTREPAICYFHAQQWFNVIGMIREDGIYYYCNISSPFIYDDNEALKYIDYDLDIKVYPDMTYTLLDEDEYEKHRKEMNYPEVIDRILHNHVEELKGWIRQRKGPFAPDFIDIWYERFLTYRHS
>NZ_CP009920.1|WP_016762869.1|2524812_2526564_+|ABC-transporter-ATP-binding-protein
MGSIRRYMKFVQPYKWQIVGTVLIGIIKFAIPLLIPLLLKYVLDDIVNGHGMSSSEKVHKMVTIMGISFVVFLVLRPPIEYYRQYYAQWVSSKVLYDIRDQLFSHIQKLSLRYYANTRAGEVISRVINDVEQTKNFVITGLMNVWLDMMTIVIAIVIMFTMNVPLTLVSIILLPVYAFSVKYFYSRLRHLTRVRSQALAEVQGHLHERVQGISVIRSFAIEPHEQKQFDKQNSNFLQKAINHTNWNAKTFAVVNTITDLAPLIVITFAGYQVITESLSVGTMVAFVAYIDRLYNPLRRLVNSSTTLTQSVASMDRVFEFIDEEYDITDKKDAKECTELHGKVQFEHVSFAYEEEEKPVIHDINLDVEKGKSVAFVGMSGGGKSTLISLIPRFYDVTEGKILIDDIDIKTYKVRSLRDKIGIVLQDTVLFSDTVKNNILLGKPGATDEEVIAAAKAANAHDFIMNLPEGYDTKVGERGMKLSGGQKQRISISRVFLKNPAILIFDEATSALDLESEHYIQEALAELAKDRTTFIVAHRLSTITHVDEIVLLENGRVVERGSHEELIKKKGHYYQLFNVQQLDTI
>NZ_CP009920.1|WP_013081550.1|2526599_2527688_-|aromatic-acid-exporter-family-protein
MKLGARILKTGIAITLSLLLGEFLSLPSPIFAAIAAVFAIQPSIYRSYLTILEQIQANVIGAASAVCFGLIFGTHPIIIGFTAVVVIAVNLKLRINNTIGLALVTVIAIMENPGDNFVEYALIRFGTVLLGVFSAFIVNLIFIPPKYETRLYYKIVSTTEEIIKWIRMNLYHASEHTLLKEDIEKMKDNVAKMNQIFDFYKEERTYSTKKRFVKSRKLVLFRQMITVTTRALTTLKLLHRVENDLQVMPQQFQDLIKSEVECLLMYHEQVLLKFIGKLRVQPTTTVPNEACVGKRALIDKFMQYKIYDNDEENKVIYHIFPLISVIIEYSEELEHLDKLIDTFQNYHKDANSFDINHQRQED
>NZ_CP009920.1|WP_028410116.1|2528236_2529535_-|glutamate-1-semialdehyde-2,1-aminomutase
MQFTKSEQLHAEALEHIVGGVNSPSRSYKAVGGGAPVAMEKASGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKAITKAAETGVLYGTPTAHEVTFAKMLKEAMPALDKVRFVNSGTEAVMTTIRVARAYTGRDKIIKFAGCYHGHSDLVLVAAGSGPSTLGTPDSAGVPKSIANEVITVPFNDIEPYKEALEKWGDQIAAVLVEPIVGNFGIVEPEPGFLEQVNELTHEAGALVIYDEVITAFRFMYGGAQDLLGVKPDLTAFGKIIGGGLPIGAYGGKKEIMEKVAPLGPAYQAGTMAGNPASILSGIACLEVLKQEGVYEQLDKLGAMLEEGILKHARTYNMPITINRLKGALTVYFTTETVKNYEQAENTDGELFARFFKLMLHQGVNLAPSKYEAWFLTTAHTEQDITDTLEAVEKAFKQLSEER
>NZ_CP009920.1|WP_034654809.1|2529737_2530751_+|ATP-binding-cassette-domain-containing-protein
MKNAIEVNQLRKEFKAYSSRSGLKGAFRDLFTRNYRVMKAVNDISFTVKQGEMVGYIGENGAGKSTTIKMLTGILTPTSGDITVNGMNPHKEREKFAQTIGVVFGQRSQLWWDIAVQESFRLLKKVYKVSDEDYNVHMEHVIQTLDIGPLLDKPVRKLSLGQRMRCELAAALIHNPPLLFLDEPTIGLDVLVKLKIRQFLKEINEKYNTTILLTTHDLADIEALCERVVMLDEGSIIYDGSLQKLRSNWGDLKQVTFEFGTAPNKEQLKLLTQGMPVNWIEGDQKYLWTAQLQNKGDLMSQLIAKVVAKHEISDINIEEISTEEIIRNIYEEGVVNG
>NZ_CP009920.1|WP_013081552.1|2530743_2531535_+|ABC-2-family-transporter-protein
MDKYIEMIRIRFLMMLAYRTNYYSGILIYAINIGAYYFLWSAIYGGKENIQGLSITQMTTYVAVSWMARAFYFNNIDREMATEIKDGKVAVELIKPYSYLGMKTMQGLGEGIFRLLFFSVPGMIIVAFLFPVQFSANAATWLYFGLSLIFSFIINTQINLLTGITTFFLFNNDGLIRAKRVVIDLFSGLLLPISFYPFWAQHIMSYFPFQAISYIPSMIFTNGFKGQEVINALITQAVWSGLLFIPIACLWNIAKKKMVIQGG
>NZ_CP009920.1|WP_034655325.1|2531544_2532330_+|ABC-2-family-transporter-protein
MFYFSIFFQYIGQYMKTRLQYRTDMVVEIISDLLFQTVNLIFILVVFGHTQSLHGWSREEIIFIYGFFLVPFAIFSSFFNIWDFNERYIVKGEMDRILTRPIHSLFQVILERMELESLFGGVTGIAVMAYAASSLHLHFQWYDVFIFLLFILGGALVYAGIFIALASIGFWSDARTSIMPTIYNIGNYGRYPVDIYNNVIRYVLTWILPFAFVGVYPAAYFLGRSEWYGYAFLTPVMGIVFFVISIFLWNTGVKKYRGAGN
>NZ_CP009920.1|WP_013081554.1|2532423_2532816_+|two-pore-domain-potassium-channel-family-protein
MVIFLILVIIVFVIGSMKFLFEKELGEFHFFSIGHFFVLFYSYITVLLGFSLIYTVCEMGSIPVLSGGFEHEGHYFYTLFNSMYFSAATLFSVGYGDMYPVGIGKLFATFEAFIGYIMPAIFVMRTVTRT
>NZ_CP009920.1|WP_013055171.1|2532885_2533356_+|thioredoxin-dependent-thiol-peroxidase
MTAVVGEKAPDFVLMSTNGEQVSLASMKGKNVVLYFYPKDMTPGCTTEACDFRDQHENFEELDAVILGVSPDPIDKHHKFIDKHGLPFLLLADEDHSVAEEYGVWTLKKNFGKEYMGIERSTFIINKEGMLVKEYRKVRVKGHVEEALSFIKEKMA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009920_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009920_3

3720585-3720667

Orphan

Consensus_repeat	Method
TGATTTTTGGAAGTAGCTTCTCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP009920_3

>merge|NZ_CP009920|3|3720585-3720667|CRISPRCasFinder
TGATTTTTGGAAGTAGCTTCTCCGCCTTTTTCACCAATTTCTTGGTAAAACTCTTTGTCATGATTTTTGGAAGTAGCTTTTCC

>NZ_CP009920|3|3|3720585-3720667|CRISPRCasFinder
TGATTTTTGGAAGTAGCTTCTCC	GCCTTTTTCACCAATTTCTTGGTAAAACTCTTTGTCA
TGATTTTTGGAAGTAGCTTTTCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009920.1\|WP_013058452.1\|3724670_3724880_-\|alpha/beta-type-small-acid-soluble-spore-protein	unknown	unknown	gnl\|CDD\|365990
NZ_CP009920.1\|WP_155276310.1\|3719667_3719814_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_034653224.1\|3726282_3727524_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|236549
NZ_CP009920.1\|WP_034653236.1\|3715586_3716930_+\|amino-acid-permease	unknown	unknown	gnl\|CDD\|224038
NZ_CP009920.1\|WP_080743096.1\|3714832_3715459_+\|LysE-family-transporter	unknown	unknown	gnl\|CDD\|280058
NZ_CP009920.1\|WP_013082476.1\|3717000_3717141_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_034653229.1\|3722459_3723845_+\|amino-acid-permease	unknown	unknown	gnl\|CDD\|182694
NZ_CP009920.1\|WP_034655246.1\|3727545_3729003_+\|glycoside-hydrolase-family-32-protein	unknown	unknown	gnl\|CDD\|224536
NZ_CP009920.1\|WP_013082482.1\|3721266_3721998_-\|ZIP-family-metal-transporter	unknown	unknown	gnl\|CDD\|223505
NZ_CP009920.1\|WP_034653232.1\|3720026_3720443_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_013082478.1\|3719458_3719599_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_034653227.1\|3724970_3725954_-\|LacI-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380514
NZ_CP009920.1\|WP_034653234.1\|3717567_3719241_-\|ribonuclease-J	unknown	unknown	gnl\|CDD\|223668
NZ_CP009920.1\|WP_034653240.1\|3713440_3714289_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293807
NZ_CP009920.1\|WP_034653221.1\|3729276_3730737_+\|YdiU-family-protein	unknown	unknown	gnl\|CDD\|234583
NZ_CP009920.1\|WP_034653238.1\|3714425_3714662_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_016763597.1\|3724380_3724581_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_016763596.1\|3724000_3724222_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_013056278.1\|3717187_3717340_-\|YpzG-family-protein	unknown	unknown	gnl\|CDD\|372924
NZ_CP009920.1\|WP_016763593.1\|3720944_3721169_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP009920.1\|WP_034653221.1\|3729276_3730737_+\|YdiU-family-protein	gnl\|CDD\|234583	PRK00029, PRK00029, YdiU family protein.	0
NZ_CP009920.1\|WP_034653236.1\|3715586_3716930_+\|amino-acid-permease	gnl\|CDD\|224038	COG1113, AnsP, Gamma-aminobutyrate permease and related permeases [Amino acid transport and metabolism].	2.37915e-121
NZ_CP009920.1\|WP_080743096.1\|3714832_3715459_+\|LysE-family-transporter	gnl\|CDD\|280058	pfam01810, LysE, LysE type translocator. This family consists of various hypothetical proteins and an l-lysine exporter LysE from Corynebacterium glutamicum which is proposed to be the first of a novel family of translocators. LysE exports l-lysine from the cell into the surrounding medium and is predicted to span the membrane six times. The physiological function of the exporter is to excrete excess l-Lysine as a result of natural flux imbalances or peptide hydrolysis; and also after artificial deregulation of l-Lysine biosynthesis as used by the biotechnology. industry for the production of l-lysine.	7.62247e-26
NZ_CP009920.1\|WP_034655246.1\|3727545_3729003_+\|glycoside-hydrolase-family-32-protein	gnl\|CDD\|224536	COG1621, SacC, Beta-fructosidases (levanase/invertase) [Carbohydrate transport and metabolism].	3.24349e-176
NZ_CP009920.1\|WP_034653229.1\|3722459_3723845_+\|amino-acid-permease	gnl\|CDD\|182694	PRK10746, PRK10746, putative transport protein YifK; Provisional.	0
NZ_CP009920.1\|WP_013058452.1\|3724670_3724880_-\|alpha/beta-type-small-acid-soluble-spore-protein	gnl\|CDD\|365990	pfam00269, SASP, Small, acid-soluble spore proteins, alpha/beta type.	1.44763e-21
NZ_CP009920.1\|WP_034653227.1\|3724970_3725954_-\|LacI-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|380514	cd06291, PBP1_Qymf-like, ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus Metalliredigens (strain Qymf) and its close homologs. This group includes the ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus metalliredigens (strain Qymf) and its close homologs. Qymf is a strict anaerobe that could be grown in the presence of borax and its cells are straight rods that produce endospores. This group is a member of the LacI-GalR family repressors that are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type 1 periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.	5.88572e-109
NZ_CP009920.1\|WP_034653234.1\|3717567_3719241_-\|ribonuclease-J	gnl\|CDD\|223668	COG0595, COG0595, mRNA degradation ribonucleases J1/J2 (metallo-beta-lactamase superfamily) [Translation, ribosomal structure and biogenesis; Replication, recombination and repair].	0
NZ_CP009920.1\|WP_034653240.1\|3713440_3714289_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293807	cd07721, yflN-like_MBL-fold, uncharacterized subgroup which includes Bacillus subtilis yflN; MBL-fold metallo hydrolase domain. This subgroup includes the uncharacterized Bacillus subtilis yflN protein. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) from which this fold was named are only a small fraction of the activities which are included in this superfamily. Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	3.27876e-70
NZ_CP009920.1\|WP_013082482.1\|3721266_3721998_-\|ZIP-family-metal-transporter	gnl\|CDD\|223505	COG0428, COG0428, Predicted divalent heavy-metal cations transporter [Inorganic ion transport and metabolism].	1.43193e-13
NZ_CP009920.1\|WP_013056278.1\|3717187_3717340_-\|YpzG-family-protein	gnl\|CDD\|372924	pfam14139, YpzG, YpzG-like protein. The YpzG-like protein family includes the B. subtilis YpzG protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 50 amino acids in length. There is a conserved QVNG sequence motif.	2.24591e-14
NZ_CP009920.1\|WP_034653224.1\|3726282_3727524_+\|MFS-transporter	gnl\|CDD\|236549	PRK09528, lacY, galactoside permease; Reviewed.	0

>NZ_CP009920.1|WP_034653232.1|3720026_3720443_+|hypothetical-protein
MNLHDFVHGVDPTIKLVIEDEFPGTRCVGGKYVPSTHSIFLYEEDINIQCQHLFGSNECLESYQWIILAHELGHALDEDLLSLSAKFDQTDDIGLLYRIECNAWEIGEKLIPFINSELFSFIKDQSLAHYHKEMEKIS
>NZ_CP009920.1|WP_155276310.1|3719667_3719814_+|hypothetical-protein
MSENKSSQYKEENKSTPSRPLEYKERTNQSQSTRQMLRSILEYSSRYR
>NZ_CP009920.1|WP_013082478.1|3719458_3719599_+|hypothetical-protein
MSKQNKSKNQGVSSSAAAVDNVNKSILSNDIHTDELQKAKVSRHNK
>NZ_CP009920.1|WP_034653234.1|3717567_3719241_-|ribonuclease-J
MSTNRNTLSIFALGGINEIGKNMYAVQYDDDIIVIDCGSKFPDESLLGIDLIIPDITYLQENREKVRALVVTHGHEDHIGGIPYLLKQLNLPIYATSLTLGLIDIKLQEHQLSAETELIEINEESEITLGNIPLSFFKTNHSIPDCLGIVFHTPEGAVVHTGDFKFDLTPVNDQYPDLHKMAKIGSEGVLALISESTNAERPGFTPSEKLVGRHVEEAFRKAKRKVIISTFASNVNRVQQIVDAAIKTNRKLALLGRSMVNVVSVALEKGYLTIPEGMLIEPYEVHSLAPEQVAILCTGSQGEPMAALSRLASGNHRQVEILPEDTVILSAGPIPGNERNISRIVDSLFTLGAHVIYGSGSATGMHVSGHGYQEELKLMATLMKPKYFIPIHGEFRMLHHHSLLAESVGVEKENIFIINNGDIVDIKGGAAVQTRKIPAGNVYVDGFGIGDVGNAILRDRKQLSEDGMLVIVITLNKAEGKIVSGPDTISRGFVYTRDSEQLLKDVNRQVTKIVNQLQKAHVHQWSIMKKEIKTTLGQFLYNQTKRRPMILPVIIEV
>NZ_CP009920.1|WP_013056278.1|3717187_3717340_-|YpzG-family-protein
MNDKNQVDQHSELFRHNWTRPKRSKSQVNGHTEMSQTNIILRSNAKAHRW
>NZ_CP009920.1|WP_013082476.1|3717000_3717141_+|hypothetical-protein
MPKNKQTPSSQVDQKQVVDDKAKALRENNYEDGHIRKITQSGADGQ
>NZ_CP009920.1|WP_034653236.1|3715586_3716930_+|amino-acid-permease
MKKKIGCGSQVEGKLKWWQLSLIGVGCIIGTGYFLGSSIAIKATGPSVLIAFLLAAVCTFVVFDALAKMSAQDPQKGSFRSYAKKAYGRWAGFSSGWVYWSSEMLIMGSQLTALSLFTRFWFDGIPLWVFASIYAVLGIAVVLIGTKGFERMENVFAVTKVAAILMFIVLASLALFGFLDQGAKQGVPRTISEVFPHGFLGLWGALLYAFYAFGGIEVMGIMTVRLEKKEDAPKAGRSMLILLGIIYIVSLSLAILIVPFHDFHGNQSPFITALETYHLPFFPHVFNGAMIVAGFSTMSASFFSVTTMIVTLSEDGDAPALFSKQKKKKLQFPLPALLLTTAGLVVSIVLSLLLPGKIYEYITTAAGLMLIYNWFFILISFHRLIKQTVWDKVKQAVGLLLILLAVSGTLLESASRPGFFASLGFLIVISLVILKLRHKWKEEEAAS
>NZ_CP009920.1|WP_080743096.1|3714832_3715459_+|LysE-family-transporter
MGAFFSYVLLGLSLAAPIGPINAAQLDKGIKNGFLHAWFLGIGATSVDALYMLVVYFGSVHFLSSDFMKTFLFSFGCFVLIYTGIEGLMSAGKITQHRNAKGDSVVKCFFSGFLISLTNPLTILFWLGIYGSVLAKTANTYETEQLILYSCAIFTGILCWDIAMAALASTFRRYLAATFLTAVSVISGLSLIGFGIYFGWQAVQQLII
>NZ_CP009920.1|WP_034653238.1|3714425_3714662_-|hypothetical-protein
MNSYTHIKEALQLAEQAVYQGQMNLNGANFQNAQMHLTIVQQQINEQKKQASSDKELKRMEEHLRHLREAQQAIQQNF
>NZ_CP009920.1|WP_034653240.1|3713440_3714289_+|MBL-fold-metallo-hydrolase
MNREMHGSSSTESFIPMSSIASGKGVEVAPDIYSYTTQIVNVCFIGNPDKENSFVLVDAGMPNSASMIIKEAEERFGKEKKPKAIILTHAHFDHIGSIIELVEKWNIPVYVHPLELPYVTGKKNYPTPDGTVEGGLVAKLSPLFPTEAIDLGSHVQALPADGSVPHMPEWEWIHTPGHSPGHISLFRKQDLALIAGDAFVTTKQEYLLDVLEQELEISGPPRYLTTDWASAKRSVEVLQSLHPSVAVTGHGKPVSGEWLSTNLLKLTKNFDEIARPDYGKYV
>NZ_CP009920.1|WP_016763593.1|3720944_3721169_+|hypothetical-protein
MSKYVEMDTASLRRKIQEYKELIWRVGPGSERTIEAVQEIQGMEKELKARNAEFEATDWKTFTQEIKENYDFTY
>NZ_CP009920.1|WP_013082482.1|3721266_3721998_-|ZIP-family-metal-transporter
MWQAAMWGGISGSAVLLGALAAVFLPIGKKIIGYIMAFGTGVLIGASTYELLGDSVHNGGLKATSLGFLAGAVVFTFLDYLISRQGANKRKRSTKQMAASSSGIAIFIGTVMDAIPESIMIGASLIENATVSWLLVIAIFISNIPEGLSSTTGLVKSGFSKKKIFLLWAAVLFISAFSSWTGFVFLDHASETLMAAIAAFAGGGIIAMVGSTMMPEAYEEGGSITGLIAALGLLASLILDHFS
>NZ_CP009920.1|WP_034653229.1|3722459_3723845_+|amino-acid-permease
MADKQLKRGLESRHIQMIALGGTIGVGLFMGSASTIQWTGPSVLLAYAICGMFIFFIMRAMGEMLYMEPSTGSFATFGHKYIHPLAGYMAAWSNWFQFVIVGMSEIIAVGAYMHYWFPHLPAWVPGIIAMLILGTANLVSVKSFGEFEFWFAMIKIVTIILMIIAGLGLIFFGFGNGGDAIGLSNLWAHGGFFAGGWSGFFFALSLVVAAYQGVELIGITAGEAKDPKKTLRNAIQSIIWRILIFYIGAIFVIVTVYPWNELDSLGSPFVSTFAKVGVTAAAGIINFVVITAAMSGCNSGIFSAGRMLYTLGVNGQAPKFFTKISRNGVPIYSTLAVMIGLVIGVVLNYIAPPNVFVYVYSASVLPGMIPWFIILISQIRFRKAKGAEMDSHPFKMPFAPVTNYVTIAFLLMVLVGMWFNDETRISLIVGVIFLALVVISFYAFGINKRMIPDTENGQIKK
>NZ_CP009920.1|WP_016763596.1|3724000_3724222_+|hypothetical-protein
MRSHRYIIKDSLKADEVAKDLELQLDINRMSDVRILSVNAQNEILVQMQEENEEAGDVIDVFMKEYKTGEIIE
>NZ_CP009920.1|WP_016763597.1|3724380_3724581_+|hypothetical-protein
MKVKKNGEGHVLFIILGGLFILIGTLFANTSVYFLISGWIAAVCCLGISAVLKKEKTKSVSKEEEE
>NZ_CP009920.1|WP_013058452.1|3724670_3724880_-|alpha/beta-type-small-acid-soluble-spore-protein
MANNKSSNNNELLVYGAEQAIDQMKYEIASEFGVNLGADTTARANGSVGGEITKRLVQLAEQQLGGGRF
>NZ_CP009920.1|WP_034653227.1|3724970_3725954_-|LacI-family-DNA-binding-transcriptional-regulator
MKAKISDVAKIAGVSPTTVSRVLNNRGYISKETRENVYKAMKEINYFPNDIARSLFNKRTNLIGMIVPQTSNPFFGELAFHIESICASLNYKVLLCNSLNRIDKEKKYVEMLIRNQVDGVIAVTYNRGIFDSESQSLPVVAVDHYLSTDIPTVSSDNYSGGKQATELLISKDCKHIIHINGPLKLETPANLRRKAYENVMKKYGKQPITYEISNTFDRNIQRETISKVFEENPEVDGIFASDDLLAALVVAEAQKRGKNIPRDLKIVGYDGTEASQTLLPGLTTVQQPIESIAQTAIDILLKEIEGEFSNIPREICLPVKLLEGQTT
>NZ_CP009920.1|WP_034653224.1|3726282_3727524_+|MFS-transporter
MKSSKSLYWKLSAYFFFFFFTWSSSYSLFSIWLGQEIKLNGSATGLIFSVNAIFALCMQPLYGYISDRIGLKKHVLFFISCLLVFVGPFYIFVYGPLLQYNVVIGAIIGGLYLGVAFLAGIGAIETYIEKVSRKYKFEYGKSRMWGSLGWAAATFFAGQLFNINPHINFWVASVSAVILVAIIFSVKVEMSSYEMEKAESVTLRDVGSLFLLKEFWFFMIYVVGVTCVYGVYDQQFPIYYASLFPTESIGNQVFGYLNSFQVFLEAGMMFAAPFIVNKIGAKNSLILAGFLMGFRIIGSGLVVGPIGISSMKLIHALELPIMLIAIFKYLAANFDTRLSSILYLVGFQFASQIGASVLSPIVGGLYDSVGFSRTYLIMGGMVLVFNVISMFTLLNSKKHRFIRKDVQENTQII
>NZ_CP009920.1|WP_034655246.1|3727545_3729003_+|glycoside-hydrolase-family-32-protein
MNKIEQAQHSLNEAEKKVNHQYRLGYHIMAPANWINDPNGLVQYKGEYHVFYQHHPYDENWGPMHWGHVKSKDLVHWQHLPIALAPGDSFDKDGCFSGSAVDNEGELTLIYTGHNYIDKELDTFFQNQNIAVSKDGITFEKAEANPVIAEPPADSSHHFRDPKVWKHEGFWYMILGNSTKKQEGRVILYRSSNLQKWEYVGVLAKSDGDLGYMWECPDFFELDGKHVLMISPQGIEAKGDSYHNLFQTGYLVGEYNYGTNTFHHGSFTELDYGHDFYAVQTLLDDKGRRIAIGWMDMWEANMPTKEDGWCGALTLPRELTLREDKVLMNPVQELTSLRKTQYNMLTNKALSNSYVVEVNEDLLEIQAVFDLADCQASSVGIKIRGINNEETLMCYNLNEQKLLLDCTHSGKEDGVRKVALQAGETLALRIFVDRSSVEVFANEGQATMTSRIYPKESRLGIELFTEGGNVIVKELTYWNLKDIWG
>NZ_CP009920.1|WP_034653221.1|3729276_3730737_+|YdiU-family-protein
MTNQKETGWNLRNSYAELPNIFFTPLDPNPVSSPKIVKFNDSLAASLGLQKEQLQSPEGVSILAGNSFPKGAFPLAQAYGGHQFGHFNMLGDGRALLIGEQVTPSGEKVDIQLKGSGRTPYSRGGDGRAALGPMLREYIISEAMHALGIPTTRSLAVVTTGESIVREKELPGAILTRVASSHLRFGTFQFAAKWGTVENLQALADYALERHFPHIEKNEKKYLSLLQEVIKRHATLVAKWQLIGFIHGVMNTDNMTISGETIDYGPCAFMDTYDPETVFSSIDVQGRYAYQNQPGITGWNLARFAEALLPLLDQDIEKAVEIAQSAVTEFPKFYRENWLAGMQAKLGLFNEEKEDEALFQDLLTIMKTYKADYTNTFRALTAEKLENSDLFESKKFAQWHELWQKRLGRQKQSKAESQELMKNNNPAVIPRNHRVEEALDAAQKKDYSVMETLLEVISSPYESPGQPEYCTPSAPSKQPYQTYCGT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009920_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009920_4

4261721-4261810

Orphan

Consensus_repeat	Method
TCAAATGCAGCCGCCAAGCGGTTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP009920_4

>merge|NZ_CP009920|4|4261721-4261810|CRISPRCasFinder
TCAAATGCAGCCGCCAAGCGGTTCATCGAACGGCGGTCAAATGCCGGGTGGTTCGTCCAATAATGGTCAAATGCAGCCGCCAAGCGGTTC

>NZ_CP009920|4|4|4261721-4261810|CRISPRCasFinder
TCAAATGCAGCCGCCAAGCGGTTC	ATCGAACGGCGGTCAAATGCCGGGTGGTTCGTCCAATAATGG
TCAAATGCAGCCGCCAAGCGGTTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009920.1\|WP_155276307.1\|4255382_4255613_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_034652601.1\|4252727_4253093_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_013082941.1\|4256713_4257406_+\|LrgB-family-protein	unknown	unknown	gnl\|CDD\|224265
NZ_CP009920.1\|WP_034655195.1\|4253166_4254591_+\|phospholipase-D-family-protein	unknown	unknown	gnl\|CDD\|197210
NZ_CP009920.1\|WP_016763911.1\|4254762_4255293_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|226489
NZ_CP009920.1\|WP_034652577.1\|4270050_4270917_+\|sulfate-ABC-transporter-permease-subunit-CysW	unknown	unknown	gnl\|CDD\|226665
NZ_CP009920.1\|WP_034652594.1\|4259207_4259780_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP009920.1\|WP_034652584.1\|4265374_4266754_+\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_CP009920.1\|WP_034652598.1\|4257669_4258542_+\|STAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|132912
NZ_CP009920.1\|WP_013082940.1\|4256339_4256744_+\|CidA/LrgA-family-holin-like-protein	unknown	unknown	gnl\|CDD\|167253
NZ_CP009920.1\|WP_016763919.1\|4268042_4269107_+\|sulfate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224529
NZ_CP009920.1\|WP_034652578.1\|4269201_4270038_+\|sulfate-ABC-transporter-permease-subunit-CysT	unknown	unknown	gnl\|CDD\|131194
NZ_CP009920.1\|WP_013056824.1\|4267126_4267291_+\|YezD-family-protein	unknown	unknown	gnl\|CDD\|378371
NZ_CP009920.1\|WP_016763912.1\|4255716_4256148_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP009920.1\|WP_034652587.1\|4264698_4265373_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NZ_CP009920.1\|WP_034652596.1\|4258662_4259139_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_034652591.1\|4262307_4263273_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133030
NZ_CP009920.1\|WP_034652581.1\|4267637_4267790_+\|Fur-regulated-basic-protein-FbpA	unknown	unknown	gnl\|CDD\|315692
NZ_CP009920.1\|WP_034652588.1\|4263666_4264554_+\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	unknown	unknown	gnl\|CDD\|224131
NZ_CP009920.1\|WP_013082947.1\|4263265_4263670_+\|GtrA-family-protein	unknown	unknown	gnl\|CDD\|377229

Protein	Function_ID	Function_description	E-value
NZ_CP009920.1\|WP_013082947.1\|4263265_4263670_+\|GtrA-family-protein	gnl\|CDD\|377229	pfam04138, GtrA, GtrA-like protein. Members of this family are predicted to be integral membrane proteins with three or four transmembrane spans. They are involved in the synthesis of cell surface polysaccharides. The GtrA family are a subset of this family. GtrA is predicted to be an integral membrane protein with 4 transmembrane spans. It is involved is in O antigen modification by Shigella flexneri bacteriophage X (SfX), but does not determine the specificity of glucosylation. Its function remains unknown, but it may play a role in translocation of undecaprenyl phosphate linked glucose (UndP-Glc) across the cytoplasmic membrane. Another member of this family is a DTDP-glucose-4-keto-6-deoxy-D-glucose reductase, which catalyzes the conversion of dTDP-4-keto-6-deoxy-D-glucose to dTDP-D-fucose, which is involved in the biosynthesis of the serotype-specific polysaccharide antigen of Actinobacillus actinomycetemcomitans Y4 (serotype b). This family also includes the teichoic acid glycosylation protein, GtcA, which is a serotype-specific protein in some Listeria innocua and monocytogenes strains. Its exact function is not known, but it is essential for decoration of cell wall teichoic acids with glucose and galactose.	5.70964e-22
NZ_CP009920.1\|WP_013082941.1\|4256713_4257406_+\|LrgB-family-protein	gnl\|CDD\|224265	COG1346, LrgB, Putative effector of murein hydrolase [Cell envelope biogenesis, outer membrane].	6.80824e-77
NZ_CP009920.1\|WP_034655195.1\|4253166_4254591_+\|phospholipase-D-family-protein	gnl\|CDD\|197210	cd09111, PLDc_ymdC_like_1, Putative catalytic domain, repeat 1, of Escherichia coli uncharacterized protein ymdC and similar proteins. Putative catalytic domain, repeat 1, of Escherichia coli uncharacterized protein ymdC and similar proteins. In Escherichia coli, there are two genes, f413 (ybhO) and o493 (ymdC), which are homologous to gene cls that encodes the Escherichia coli cardiolipin (CL) synthase. The prototype of this subfamily is an uncharacterized protein ymdC specified by the o493 (ymdC) gene. Although the functional characterization of ymdC and similar proteins remains unknown, members of this subfamily show high sequence homology to bacterial CL synthases, which catalyze the reversible phosphatidyl group transfer between two phosphatidylglycerol molecules to form CL and glycerol. Moreover, ymdC and its similar proteins contain two HKD motifs (H-x-K-x(4)-D, where x represents any amino acid residue) that characteriszes the phospholipase D (PLD) superfamily. The two motifs may be part of the active site and may be involved in phosphatidyl group transfer.	6.02673e-61
NZ_CP009920.1\|WP_016763911.1\|4254762_4255293_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|226489	COG3981, COG3981, Predicted acetyltransferase [General function prediction only].	7.1318e-55
NZ_CP009920.1\|WP_034652577.1\|4270050_4270917_+\|sulfate-ABC-transporter-permease-subunit-CysW	gnl\|CDD\|226665	COG4208, CysW, ABC-type sulfate transport system, permease component [Inorganic ion transport and metabolism].	1.13762e-145
NZ_CP009920.1\|WP_034652594.1\|4259207_4259780_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	1.32675e-41
NZ_CP009920.1\|WP_034652598.1\|4257669_4258542_+\|STAS-domain-containing-protein	gnl\|CDD\|132912	cd07041, STAS_RsbR_RsbS_like, Sulphate Transporter and Anti-Sigma factor antagonist domain of the "stressosome" complex proteins RsbS and RsbR, regulators of the bacterial stress activated alternative sigma factor sigma-B by phosphorylation. The STAS (Sulphate Transporter and Anti-Sigma factor antagonist) domain of proteins related to RsbS and RsbR which are part of the "stressosome" complex that plays an important role in the regulation of the bacterial stress activated alternative sigma factor sigma-B. During stress conditions RsbS and RsbR are phosphorylated which leads to the release of RsbT, an activator of of the RsbU phosphatase, which in turn activates RsbV which leads to the release and activation of sigma factor B. RsbS is a single domain protein (STAS domain), while RsbR-like proteins have a well-conserved C-terminal STATS domain and a variable N-terminal domain. The STAS domain is also found in the C- terminal region of sulphate transporters and anti-anti-sigma factors.	1.03886e-40
NZ_CP009920.1\|WP_013082940.1\|4256339_4256744_+\|CidA/LrgA-family-holin-like-protein	gnl\|CDD\|167253	PRK01658, PRK01658, CidA/LrgA family holin-like protein.	8.07581e-35
NZ_CP009920.1\|WP_016763919.1\|4268042_4269107_+\|sulfate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224529	COG1613, Sbp, ABC-type sulfate transport system, periplasmic component [Inorganic ion transport and metabolism].	0
NZ_CP009920.1\|WP_034652578.1\|4269201_4270038_+\|sulfate-ABC-transporter-permease-subunit-CysT	gnl\|CDD\|131194	TIGR02139, permease_CysT, sulfate ABC transporter, permease protein CysT. This model represents CysT, one of two homologous, tandem permeases in the sulfate ABC transporter system; the other is CysW (TIGR02140). The sulfate transporter has been described in E. coli as transporting sulfate, thiosulfate, selenate, and selenite. Sulfate transporters may also transport molybdate ion if a specific molybdate transporter is not present. [Transport and binding proteins, Anions].	4.53624e-143
NZ_CP009920.1\|WP_013056824.1\|4267126_4267291_+\|YezD-family-protein	gnl\|CDD\|378371	pfam10055, DUF2292, Uncharacterized small protein (DUF2292). Members of this family of hypothetical bacterial proteins have no known function.	2.45935e-11
NZ_CP009920.1\|WP_016763912.1\|4255716_4256148_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	7.91168e-17
NZ_CP009920.1\|WP_034652587.1\|4264698_4265373_+\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	3.98553e-79
NZ_CP009920.1\|WP_034652591.1\|4262307_4263273_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133030	cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.	8.12629e-98
NZ_CP009920.1\|WP_034652581.1\|4267637_4267790_+\|Fur-regulated-basic-protein-FbpA	gnl\|CDD\|315692	pfam13076, Fur_reg_FbpA, Fur-regulated basic protein A. This family of proteins is regulated by the ferric uptake regulator protein Fur. This family does not regulate the lutABC operon encoding iron sulfur-containing enzymes necessary for growth on lactate.	1.40615e-07
NZ_CP009920.1\|WP_034652588.1\|4263666_4264554_+\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	gnl\|CDD\|224131	COG1210, GalU, UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane].	2.77379e-162
NZ_CP009920.1\|WP_034652584.1\|4265374_4266754_+\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	7.50931e-62

>NZ_CP009920.1|WP_034652594.1|4259207_4259780_-|GNAT-family-N-acetyltransferase
MIQVKDIYGNLPTLETERLRLRKVTKKDVRDMFEYASNEKVSRYVNWEKHRKLQDTKEFVSFVLKQYSNQSISPWAMEIKALKKCIGTIDFVTWNPTHRIAEIGYAISEEYWNKGFVTEAAEKVIAFGFEEMDLVRIQARCFVENAASEKVMKKIGMSYEGTIRKAMFIKGTHQDLKLYSILREEYTRNA
>NZ_CP009920.1|WP_034652596.1|4258662_4259139_-|hypothetical-protein
MLKQAIQHLDLSAHGLWFPITVSLCLFILALVLFKRQLTWRDFYITFCVVGFVGWLCDVIITRVFNMIDLGDPKVTGLGDILSYTFIPPSLSILFLTYLTAKNKWVLSLLFCAGSLLIEYGMIKSGYMHLNGWFFIYSIVLYFLVYAFVLPWHMAFIK
>NZ_CP009920.1|WP_034652598.1|4257669_4258542_+|STAS-domain-containing-protein
MKEELVYIGKKILEHKYSLSEKLAERLDSTHTLSIEELKEKKILKWRVSIMEYFGRALFEEQEDVLKLVKEWALDTGKYAVEKNIPLEKALGILPIYRSVIWDVFTRELEEHQFAAITMLHVSERIDPLLDTVTYVFGQIYDEHNRYMMNLAYTSLEELSVPLVPVTKGIAIMPIIGEIDTHRSQVIMETCLKKGTSLQLSYLILDISGVVIIDTMVADNLFKIHRSLKLVGVEAIITGIRPEIAQTVVKLGINFNQIKTEANLEAALLKIGFRRPEEHSRAHVSSQRIK
>NZ_CP009920.1|WP_013082941.1|4256713_4257406_+|LrgB-family-protein
MQEFFIALFIIIATVALYLVMAKVYVRFSYPILIPVLTTTVFVILLLLAFHISYDEYMIGGKWINSLLGPAVVALAYPLYKQREMLVKYSIPIIGGVFVGLFAGMISGLVFAEVFGIDRSLILSIVPKSITTPVAIQIATGLGGVPSMTVVFVMIAGFSGVILGPLLLKWIRIKSSLGKGIALGSASHALGTSKAFEYGELTVSMSSVSMTLSAVLGSVFGPIVVWLFQV
>NZ_CP009920.1|WP_013082940.1|4256339_4256744_+|CidA/LrgA-family-holin-like-protein
MKVIRIILQIAILYAFSMIGEAVHHILHLPIPGSIIGLILMLICLTCKIVPIKVIEDGASFLLSFLPLLFIPAMAGVMNYPSLLSSSGAILFLIIVLSTIITMAAAGAASQLLEKKANKRKEKQQCKNSLSRSL
>NZ_CP009920.1|WP_016763912.1|4255716_4256148_-|MarR-family-transcriptional-regulator
MQEKNSIELIEYELTTFIRRAVYLDNSENKIGNLERSAYLLLRQLDEFGPARVKELAEAFKLDISTLSRQAAALENKKLISRSSDPSDGRVSLFDITPRGKRMLQTDKQMRLERYHSMLKKWSSEEKELFGKLLMRMNDAFID
>NZ_CP009920.1|WP_155276307.1|4255382_4255613_+|hypothetical-protein
MPVFLLNCTDLLWSKDSQGIAHHMSGMIRNLHSINHGIYSSSLHHLQDSRAHCSRDHTIYSRGRGRAWLSVCSEQT
>NZ_CP009920.1|WP_016763911.1|4254762_4255293_+|GNAT-family-N-acetyltransferase
METAVLMKPDVAYKKAYMSFYHEWKASGEKMIPWVIAKDPAYFEKMVQELLDAEKGIGLKKGYVPDSTYWLMHHEKVIGVVNIRHELSEILRNSGGHIGYGIRPSERQKGYAKLLLKLSLQEIKKLGVQRALVVCDDWNTASRRTILANGGIQDEDYIEENGAVVQRFWIHTDKMA
>NZ_CP009920.1|WP_034655195.1|4253166_4254591_+|phospholipase-D-family-protein
MIKIAVKGLLIILSLYILYVVITAVVLFYVPLKKGEETTSIKPASFFGHRESTDRVRLLEDGYEAGRVRIQMIQEAEKSIDITYYSIGKGESTDLIMAALFKAADRGVHTRVLLDGIANGLRGNRRGVLYALASHPNIEVKYYEPLQLFKPWAWQNRMHDKIMIVDGELGIIGGRNIGDKYLAKKPPPDFVYDRDVFITNSKHKQDSVITQMQNYINELWAHPYTKKAFHHLTQYQVDQGKRMKALLLQQYDKAKQVGETFATPKIDWNASTVPTKRVSFIHNPIERFNKRPFMWKTFINLAEGANRSVLIQSPYVVPTNAMRKYIAMKKNPAVQWTLLTNSVTSTPNVLAFSGYISMRDKIMKTGVKLYEYQGPYSIHAKSVIYDQRLSAVGSFNLDSRSTFLNNESMVIIDSQEFAKKLTMAMENKMDKSILIANHKRWIKSPDIQKKEEPVMKRTFLYALAKVTRFFKEFI
>NZ_CP009920.1|WP_034652601.1|4252727_4253093_-|hypothetical-protein
MIALRFVFLTHLFFLIHYLYSMLVHIIERRMMVMEEYSFRFHITDSYPLQNENDKIEAVVRTKIKHADRGCLYEGYLRVHITNIGVFPVAKDIAEAIGVRSLRQQLAAELKRYVRPHRNFL
>NZ_CP009920.1|WP_034652591.1|4262307_4263273_+|glycosyltransferase-family-2-protein
MSSIVKYSIVVPVYNEEEVIHETYRRLTEVMHSTKEAYELLFVNDGSRDRTAEMIKEYSEQDPAVVLLDFARNFGHQIAITAGMDYARGEAVVVIDADLQDPPELILEMIEKWKQGFDVVYAKRTKRKGETYFKKQTAAMFYRFLRAMTDIDIPLDTGDFRLLDRKVCNQMNSIQEKNRFVRGLVSWVGFKQIAVEYERDERLAGESKYPLKKMLKLSMDGITSFSYKPLKLASYAGVTLSGIGFIYLLVVLYLKLFTDSTITGWSSLIVIQLFFSGIILIILGMIGEYIGRIYDETKNRPLYIVREKYQLEPRKEVSLRD
>NZ_CP009920.1|WP_013082947.1|4263265_4263670_+|GtrA-family-protein
MTNKWISFIKFALVGVLNTLIDFVVYALLTTIGVNYILAQWISYSAGILNSYVMNRKWTFERKEKSSKREVISFVIVNLITLSLTSFLLTVLYNKWGVALLLSKLLITIVSVGINFIGTKLFVFTTKKERGIHI
>NZ_CP009920.1|WP_034652588.1|4263666_4264554_+|UTP--glucose-1-phosphate-uridylyltransferase-GalU
MTIKKAVIPVGGLGTRFLPATKAQPKEMLPIVDKPAVQYIVEEAVKSGIESIIFITGRNKKSIEDHFDKSIELEQMLEEKHKFQMLKEVQMISSMASIHYIRQKEPLGLGHAILCAEQFIGDEPFAVLLGDDIMTSEEPALKQMIQAYETTNQSVIGVQKVDVEEVSKYGIIQPKNKSGSLHEVNDLIEKPSIEQAPSTIAVMGRYILNPSIFSYLKTIERGVGNELQLTDALGVVCEKERLFALELEGQRFDIGDKVGYMKAMVEVALKRRDLRQTFLSYLEGIVEKERANNFS
>NZ_CP009920.1|WP_034652587.1|4264698_4265373_+|response-regulator-transcription-factor
MIQILVADDDQHIRELISLYLENQGFKIIKAADGEEAWAKMEEFRIDLAVVDIMMPFKDGWELTKEIKEYFDIPVLMVTARGESHDKLKGFDIGTDDYVVKPFDPQEMVARVKALLRRYQVEANNVIYMGNIKLDRTKLEMSAGETSEQLPLKEFELLFTLVSSPGKIFTRDQLIQLIWGYDYEGDERTVDVHIKRLRERLNHMKNVGMEIKTIRGLGYRAEGC
>NZ_CP009920.1|WP_034652584.1|4265374_4266754_+|HAMP-domain-containing-histidine-kinase
MKSIYVKLVLSFIITILLSVVITVVVTTFLSKQKLEMRLGQDMVKMGEDFIDLYGAEDSDKAARFLSNSSFIHFSFIIIDDEHKEKVLGQPGPPIPITPKEVGQVLDGERYSNLNEEKDDRPQPNVVGLPFKENGRSYALFIQSHPQRQFSVIQDVQNIQLITILLVGIVLFAYVSMIIIKPIKRLSTAMKVVGQGEYNVQVEHAANDEIGLLTKNFNQMTKELNKIETMRQEFIASVSHEIQSPLTSIRGFSAALKDDIVSEDKKIQYLTIIEKESTRLSQLSSNLLKLASLDSEHQTLMLQQYRLDEQIRHVVMALEPQWTKKNIEIDLDLSNVQIEADKDLLEQVWLNLVTNAIKYTPENGFVKISIHQKNEEIDVKIKDNGIGIAEEDQKYIFESFYKVDKSRTLKGSGLGLAITKKIVRLHEGAVRVESKKEQGSIFTVTLPIQKNRAKKDSSV
>NZ_CP009920.1|WP_013056824.1|4267126_4267291_+|YezD-family-protein
MASITQEKLDYIVKLLTEINYGSVLITLHDGQITQVDSTEKNRFLAKSKVASHK
>NZ_CP009920.1|WP_034652581.1|4267637_4267790_+|Fur-regulated-basic-protein-FbpA
MENLLRAAVRQRKQYLIEELLKKGIYKKENHHLFELTLSDLEKEYLARSK
>NZ_CP009920.1|WP_016763919.1|4268042_4269107_+|sulfate-ABC-transporter-substrate-binding-protein
MKKKAVQFLMVLTALLVVLAGCGNGKSTETAGKDSSASKNDSKKPVELLNVSYDPTRELYQEFNKSFASYWKDKTGQDVTIKQSHGGSGKQGRAVIDGLEADVVTLALAYDIDEIAQTRQLLNKDWEKELAHNSTPYTSTIVFLVRKGNPKGIKDWDDLTKKGTSVITPNPKTSGGARWNYLAAWAYAKNKYNGDNKKVEDFMGKLYGNVEVLDSGARGATTTFVERGIGDVLIAWENEAYLSLNELGKDKFEIVTPSLSILAEPPVAVVDKVAEKKGTTKVAKAYLKYLYTEKGQEIAAENYYRPRNEKVLEKHKDQFPSLNLVTIKDFGGWKKAQETHFNDGGTFDQIYQPK
>NZ_CP009920.1|WP_034652578.1|4269201_4270038_+|sulfate-ABC-transporter-permease-subunit-CysT
MSVLQRQKKKESILPGFGLSLGFTVFYASILVLFPLAMIFLNTASMGWSDFIKTVTDSRVVASYKLSFGAAFAAGIINVIFGTIIAWVLVRYHFPGKRFIDGLVDLPFALPTAVAGIALTTLYVPKGWIGQLFTFKIAFTPIGIIIALTFIGLPFVVRMVQPVLQNFNAEIEEASASLGASRMQTFRKVIFPELVPAILTGFSLSFARALGEYGSVVFIAGNMPMKTEITPLIIMTKLEQYDYAGATAIASVMLVVSFFLLLLINIIQWWTNRKFVHS
>NZ_CP009920.1|WP_034652577.1|4270050_4270917_+|sulfate-ABC-transporter-permease-subunit-CysW
MAGHVPMQHAKTTVKLNHSSLKEPKVVQWLLTFIALAFLALFLVLPLITIFMTAFQKGLETYLAAITNPDALAAIKLTLIVVLITVPLNAVFGVVAAWLITKFDFKGKNILITLIDLPFAVSPIIAGLVFILLFGAQGLFGEWLFNHDIKIVFAIPGIILATLFVTLPFVAKELIPLMQAQGSAEEEASLTLGASGFKTFFLVTLPNIKWGLLYGIILCNARAIGEFGAVSVVSGHIRGMTNTMPLHIEILYNEYQFAAAFAVASLMSILAIFTLIIKNIIEWKVKHI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009920_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009920_5

4501737-4501828

Orphan

Consensus_repeat	Method
GGGTAAAATGGCCGAGGGCGAGG	CRISPRCasFinder

1 spacers

DEDDh

The CRISPR arrays of NZ_CP009920_5

>merge|NZ_CP009920|5|4501737-4501828|CRISPRCasFinder
GGGTAAAATGGCCGAGGGCGAGGGTAAAAGTAAGGGGGGTGGTAATAAATGGGACGAGGATAAGGGTAAGGATAAAATGGCCGAGGGCGAGG

>NZ_CP009920|5|5|4501737-4501828|CRISPRCasFinder
GGGTAAAATGGCCGAGGGCGAGG	GTAAAAGTAAGGGGGGTGGTAATAAATGGGACGAGGATAAGGGTAA
GGATAAAATGGCCGAGGGCGAGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009920.1\|WP_013056997.1\|4495624_4495828_+\|alpha/beta-type-small-acid-soluble-spore-protein	unknown	unknown	gnl\|CDD\|365990
NZ_CP009920.1\|WP_034652166.1\|4499967_4500657_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|173412
NZ_CP009920.1\|WP_034652150.1\|4505877_4506726_+\|STAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|132912
NZ_CP009920.1\|WP_013057013.1\|4508935_4509103_+\|Fur-regulated-basic-protein-FbpA	unknown	unknown	gnl\|CDD\|315692
NZ_CP009920.1\|WP_034652151.1\|4504008_4504986_+\|ring-cleaving-dioxygenase	unknown	unknown	gnl\|CDD\|319935
NZ_CP009920.1\|WP_034652175.1\|4496016_4496865_+\|YihY/virulence-factor-BrkB-family-protein	unknown	unknown	gnl\|CDD\|377085
NZ_CP009920.1\|WP_034652164.1\|4500805_4501699_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|276809
NZ_CP009920.1\|WP_034652181.1\|4492258_4494430_-\|MMPL-family-transporter	unknown	unknown	gnl\|CDD\|225272
NZ_CP009920.1\|WP_013083119.1\|4507012_4507210_+\|DUF3311-domain-containing-protein	unknown	unknown	gnl\|CDD\|371707
NZ_CP009920.1\|WP_155276302.1\|4499774_4499927_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_013083117.1\|4505136_4505643_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372729
NZ_CP009920.1\|WP_034652173.1\|4497365_4498298_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|369561
NZ_CP009920.1\|WP_016764068.1\|4498985_4499243_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_034652178.1\|4494636_4495497_+\|dimethylarginine-dimethylaminohydrolase-family-protein	unknown	unknown	gnl\|CDD\|224747
NZ_CP009920.1\|WP_013083113.1\|4502090_4502603_-\|PIN-domain-containing-protein	unknown	unknown	gnl\|CDD\|350305
NZ_CP009920.1\|WP_034652154.1\|4503201_4503762_+\|acetyltransferase	unknown	unknown	gnl\|CDD\|182235
NZ_CP009920.1\|WP_025752355.1\|4496898_4497174_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227109
NZ_CP009920.1\|WP_013083122.1\|4509336_4509930_-\|DNA-polymerase-III-subunit-epsilon	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|236397
NZ_CP009920.1\|WP_016764077.1\|4507209_4508703_+\|sodium:solute-symporter	unknown	unknown	gnl\|CDD\|223664
NZ_CP009920.1\|WP_034652156.1\|4502610_4502967_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP009920.1\|WP_013056997.1\|4495624_4495828_+\|alpha/beta-type-small-acid-soluble-spore-protein	gnl\|CDD\|365990	pfam00269, SASP, Small, acid-soluble spore proteins, alpha/beta type.	2.60115e-16
NZ_CP009920.1\|WP_034652166.1\|4499967_4500657_+\|hypothetical-protein	gnl\|CDD\|173412	PTZ00121, PTZ00121, MAEBL; Provisional.	0.000255302
NZ_CP009920.1\|WP_034652150.1\|4505877_4506726_+\|STAS-domain-containing-protein	gnl\|CDD\|132912	cd07041, STAS_RsbR_RsbS_like, Sulphate Transporter and Anti-Sigma factor antagonist domain of the "stressosome" complex proteins RsbS and RsbR, regulators of the bacterial stress activated alternative sigma factor sigma-B by phosphorylation. The STAS (Sulphate Transporter and Anti-Sigma factor antagonist) domain of proteins related to RsbS and RsbR which are part of the "stressosome" complex that plays an important role in the regulation of the bacterial stress activated alternative sigma factor sigma-B. During stress conditions RsbS and RsbR are phosphorylated which leads to the release of RsbT, an activator of of the RsbU phosphatase, which in turn activates RsbV which leads to the release and activation of sigma factor B. RsbS is a single domain protein (STAS domain), while RsbR-like proteins have a well-conserved C-terminal STATS domain and a variable N-terminal domain. The STAS domain is also found in the C- terminal region of sulphate transporters and anti-anti-sigma factors.	1.42953e-34
NZ_CP009920.1\|WP_013057013.1\|4508935_4509103_+\|Fur-regulated-basic-protein-FbpA	gnl\|CDD\|315692	pfam13076, Fur_reg_FbpA, Fur-regulated basic protein A. This family of proteins is regulated by the ferric uptake regulator protein Fur. This family does not regulate the lutABC operon encoding iron sulfur-containing enzymes necessary for growth on lactate.	0.00793209
NZ_CP009920.1\|WP_034652151.1\|4504008_4504986_+\|ring-cleaving-dioxygenase	gnl\|CDD\|319935	cd08347, PcpA_C_like, C-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins. The C-terminal domain of Sphingobium chlorophenolicum (formerly Sphingomonas chlorophenolica) 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins. PcpA is a key enzyme in the pentachlorophenol (PCP) degradation pathway, catalyzing the conversion of 2,6-dichloro-p-hydroquinone to 2-chloromaleylacetate. This domain belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases.	4.84405e-63
NZ_CP009920.1\|WP_034652175.1\|4496016_4496865_+\|YihY/virulence-factor-BrkB-family-protein	gnl\|CDD\|377085	pfam03631, Virul_fac_BrkB, Virulence factor BrkB. This family acts as a virulence factor. In Bordetella pertussis, BrkB is essential for resistance to complement-dependent killing by serum. This family was originally predicted to be ribonuclease BN, but this prediction has since been shown to be incorrect.	2.75009e-68
NZ_CP009920.1\|WP_034652164.1\|4500805_4501699_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	5.39928e-07
NZ_CP009920.1\|WP_034652181.1\|4492258_4494430_-\|MMPL-family-transporter	gnl\|CDD\|225272	COG2409, COG2409, Predicted drug exporters of the RND superfamily [General function prediction only].	8.56021e-81
NZ_CP009920.1\|WP_013083119.1\|4507012_4507210_+\|DUF3311-domain-containing-protein	gnl\|CDD\|371707	pfam11755, DUF3311, Protein of unknown function (DUF3311). This is a family of short bacterial proteins of unknown function.	2.53955e-11
NZ_CP009920.1\|WP_016764077.1\|4507209_4508703_+\|sodium:solute-symporter	gnl\|CDD\|223664	COG0591, PutP, Na+/proline symporter [Amino acid transport and metabolism / General function prediction only].	7.09121e-68
NZ_CP009920.1\|WP_013083117.1\|4505136_4505643_-\|hypothetical-protein	gnl\|CDD\|372729	pfam13798, PCYCGC, Protein of unknown function with PCYCGC motif. This domain contains a PCYCGC motif and four other conserved cysteines. Its function is unknown.	2.72643e-74
NZ_CP009920.1\|WP_034652173.1\|4497365_4498298_+\|alpha/beta-hydrolase	gnl\|CDD\|369561	pfam07859, Abhydrolase_3, alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.	2.94339e-95
NZ_CP009920.1\|WP_034652178.1\|4494636_4495497_+\|dimethylarginine-dimethylaminohydrolase-family-protein	gnl\|CDD\|224747	COG1834, COG1834, N-Dimethylarginine dimethylaminohydrolase [Amino acid transport and metabolism].	2.43948e-90
NZ_CP009920.1\|WP_013083113.1\|4502090_4502603_-\|PIN-domain-containing-protein	gnl\|CDD\|350305	cd18738, PIN_VapC4-5_FitB-like, uncharacterized subgroup of the PIN_VapC4-5_FitB-like subfamily of the PIN domain superfamily. The PIN_VapC4-5_FitB-like subfamily includes the Virulence associated protein C (VapC)-like PIN (PilT N terminus) domain of Mycobacterium tuberculosis VapC4 and VapC5 ribonuclease toxins of the VapBC toxin/antitoxin (TA) system, and Neisseria gonorrhoeae FitB toxin of the FitAB TA system. This subfamily belongs to the VapC-like family of the PIN domain nuclease superfamily. VapC is the PIN-domain ribonuclease toxin from prokaryotic VapBC toxin-antitoxin (TA) systems. VapB is a transcription factor-like protein antitoxin acting as an inhibitor. Other members of the VapC-like nuclease family include eukaryotic ribonucleases such as Smg6, ribosome assembly factor NOB1, exosome subunit Rrp44 endoribonuclease and rRNA-processing protein Fcf1. The structural properties of the PIN (PilT N terminus) domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions, in some members, additional metal coordinating residues can be found. Some members of the superfamily lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	8.72592e-20
NZ_CP009920.1\|WP_025752355.1\|4496898_4497174_-\|hypothetical-protein	gnl\|CDD\|227109	COG4768, COG4768, Uncharacterized protein containing a divergent version of the methyl-accepting chemotaxis-like domain [General function prediction only].	4.38078e-05
NZ_CP009920.1\|WP_013083122.1\|4509336_4509930_-\|DNA-polymerase-III-subunit-epsilon	gnl\|CDD\|236397	PRK09182, PRK09182, DNA polymerase III subunit epsilon; Validated.	5.73016e-58
NZ_CP009920.1\|WP_034652154.1\|4503201_4503762_+\|acetyltransferase	gnl\|CDD\|182235	PRK10092, PRK10092, maltose O-acetyltransferase; Provisional.	1.11684e-101

>NZ_CP009920.1|WP_034652164.1|4500805_4501699_+|helix-turn-helix-transcriptional-regulator
MNDKKQVGQLIQDLRKIAEMTTVELSEGICTEEELHRFEQGEIHASSEVLYHLSKRLGVPMNYFFEAGELTPNDYSKEIKSTIRHYIRKRDYETVLHMVNKEKDNPMFQDPFHAQFFLWHEAICDYYIGNKFEQALRKLEKAIAFTRTSEQFYSEKEIAILNSIAIIYEEEGHLKKAFSTFMEGLQHIALLPKLKDPLVKIRILYGLSRALLQMERYEKSIKYAQAGLELCIQHETLYLLGELHYQIGEALCQLGELKQGIAYLEKAITVFEIEQNEAFVTIIQEEMSKYQETKKKS
>NZ_CP009920.1|WP_034652166.1|4499967_4500657_+|hypothetical-protein
MKKLLVGSILLSLSLTMGACDQGEEKNAETSKKETAVKPEKKTNEIELNKKSESIQIQDEQKDLRAYATKVEEERKAKELAEQKAKEEAEAKRQVEIAEQQRPQKIAEEQRVSAQQAEQKKEAESPVSQETIDNYEANQAETWAEEAEIEEELNKEEEERLAKEKAEQEAYEAQIIAEQDANFSDEAKEQIQKEIDEEGYSQTSYYCDQVMTAVQRGDMTKEEAGGCLK
>NZ_CP009920.1|WP_155276302.1|4499774_4499927_+|hypothetical-protein
MNEQLKPEEISIEVKLELLKICNDVMNNIVTPKELIKDLEKLVSQISLSV
>NZ_CP009920.1|WP_016764068.1|4498985_4499243_+|hypothetical-protein
MDYKQKDYYISAKENEYYKVINVVDHMLEEAQSNNKYPVWGEKLRTELKESAGNNLTPWHFNMIISTLLDYVPEEVKNKSNAKSL
>NZ_CP009920.1|WP_034652173.1|4497365_4498298_+|alpha/beta-hydrolase
MPLDPHIQIFLNQYNEMPRPALEDVTPPQLREMEKMSLTPSKEVVKKVYNEEIELNERMLTIRVYEPEGTGPFPALVYYHGGGWVLGSLDTHDSICRSYANEANCIVVSVDYRLAPEDKFPAAVNDAYDALDWISAHASQLNINSNKIAVGGDSAGGNLAAVVSILAKERQGPSIVHQLLIYPSVGFKNQHPASMKENGEGYFLSKDLMDWFRLHYLNNKEEEQHPYNAPVLLEDLSSLPSATIITAQYDPLRDSGKDYADALKNHGVPVTYENYETMIHGFLGFHEFVPLAQQAINKSAAQLRQVFDSI
>NZ_CP009920.1|WP_025752355.1|4496898_4497174_-|hypothetical-protein
MIIVYISLAVVLASLAYLIYAGVSFNKKIKPTVNSVNATSQHLQNETDHIKEKTNHLKVTQAAIKTDVQYKKDSVKYTANSFKQLVNSFKR
>NZ_CP009920.1|WP_034652175.1|4496016_4496865_+|YihY/virulence-factor-BrkB-family-protein
MKKLLSFGKSLGKEIQEDQATGLAAEQAYYYMLSLFPMLILLISIVPYLSIKPEEAIDVLQSVMPGETAAIFKDNVAHFISQPNGGLLTVGILGTIWSASNGMNAFIRAMNQAYDVKEQRSFIKVRGLSILLTIGLIVTIVVSLLLPVFGGVLLNWISEWFSLPSGTTVVLNILRWIIGVGIMVLVLSVLYRLAPNKTFPFAHVWPGALAATLLWQLTSLGFSFYVSNFGNYSATYGSLGGVIVLMLWLFLTGLILVIGGEINAIYHRNKTAAPPKDTSQAM
>NZ_CP009920.1|WP_013056997.1|4495624_4495828_+|alpha/beta-type-small-acid-soluble-spore-protein
MANRNPILVQGAEQLLDQLKTEIAGRLNVQLGAEQTARANGSVGGEMTKHLVAMAQQQLSGAQGHIR
>NZ_CP009920.1|WP_034652178.1|4494636_4495497_+|dimethylarginine-dimethylaminohydrolase-family-protein
MQMKQPAKMTNSYGCKNEYDTLKRVVVCPPTYMKIEEIINETQKHYADENIDESLASKQHRQFVECLQKEGVEVIGLSAQEPFPEQVFTRDIGYTLGDTVIVTKMGSEIRSGEEQVLADWLQQQDIPFHQVPDHPIEGGDVLIDGQAIFIALSDRTSKEGVEHIQELLPAYEVVPIPIDRSYLHLDCVLNILSPTEALVFSPALHEKELNLLRMKYDLIEVTKEEQFTMGTNVLSIGNQRVISLPMNTEVNEELRKRGYKVIEVDISEIIKSGGSFRCCTMPLERV
>NZ_CP009920.1|WP_034652181.1|4492258_4494430_-|MMPL-family-transporter
MNKVANALYASRKFLLILWIILIIGFGFYAAKLPSVLGGNGFEMKGMYKDTEQLLVNKFDVSEAQIIVLFEKKDGVSDSKFQQTIAQYMQKAKEKSDASKVDIPTASNKMIKGSTAYGIIHFNHDDGTMDKRVEKIRTLSAEEKEMSVKLTGGPIIEKDMNTASQADLAKAEAIGIPVALVVLLLAFGGVVAAAIPLMIGIVTVVTTMGVVYFFHPYTELSIFILNVIPMIGLALSIDFALLFINRFKEEIQTKSVEQAIKITIQTAGRSVIFSGLCVFIGLAGMLFIQVDIFRNVALGGMAVVFIAVFSALTLLPSILAILGTRINRLRILKVSEQGGQSRWRSFATFVMKKPVTMTIVSLIILLVALIPVRDMHLEIPSSEALPTKYESRQAFDTYNNTFINKNTADVYFVLEAKQNMLNEKPLTNAFTFIKQLKEDSLVKQVDSISTALNVKSSDQLQAMLENPQISAQTKPAVDSFINGHYMLIKATLDTDQNSDQAKDFVRKWKDKRSTFTVHIGGYPKFEQEIFDEIYEKAPYGLALVLFSTYVILMIAFRSVLIPLKAIIMNILSLTATFGLLVWLFQNGHLGLTESNIALVLPVFVFGLVFGLSMDYEVFLISRIHEVYHQTRDNNVATVEGLASTSKIITSAALIMIVITGAFAFTDVTPVKQMGVGIALAIFIDATIVRMLLVPSLMKLLGDANWWFFTKKHDKSSSNEQLKS
>NZ_CP009920.1|WP_013083113.1|4502090_4502603_-|PIN-domain-containing-protein
MLDEKVIIDTNIWASHALNYPEVVEYINELISNNAEFLMPTVVEMELLSHWEVETNPQVKAVKNHYIYDMTDKIVDVTSEIAQLAAQIRRKAKIESNKKIKGPDAMIAASAFIHNAKLISNNNKDFAWITFNFSYRGQPLSYVNPIKDTIAYASFIKSFEHPTLPDADNL
>NZ_CP009920.1|WP_034652156.1|4502610_4502967_-|hypothetical-protein
MKAQRLVDDQKGTYSKEVQKHFNLKINGKIYTQPSPQLPPSPPMQKKNLKYKPQNKVLRTYDKKDKTLNDTQEKLIKSAKTRLTKYEKLLLSNQLSESAALYSPFGLEELVRMASREE
>NZ_CP009920.1|WP_034652154.1|4503201_4503762_+|acetyltransferase
MKTEKQKMLDGELYLSADPQLIKERENARRLTRLYNQTTEREEERRTNLLKELFGSTGNSLCIEPTFRCDYGSNIHVGENFYANFDCVLLDVCEIRIGDNCFLAPGVHIYTATHPLHALERISGAEFGKRVEIGNNVWIGGRAVINPGVKIGNNAVIASGTVVTKNVPDNVVVGGNPAVIIKHIEN
>NZ_CP009920.1|WP_034652151.1|4504008_4504986_+|ring-cleaving-dioxygenase
MNHLKGIHHVTAITSSAEKNYEFFTYVLGMRLVKKTVNQDDIQTYHLFFADDKGSAGTDMTFFDFPGIPKGFHGTNEISKTSFRVPNDAALDYWVKRFDRLEVNHTGIQELFGKKTLSFVDFDDQQYQLISDEGNQGVESGTPWQKGPVPLQYAITGLGPIFIRIAEFNYFKEMMEKVLLFKEIAQEGDLHLFEVGEGGNGAQVVVEYNEKLPQAQQGFGTVHHVAFRVENRQALEEWINRMPSFGFHTSGYVNRHFFESLYARVAPQILFEFATDGPGFMGDEPYETLGEKLSLPPFLEPKRAEIEKLVRPIDTVRSTKEFVKE
>NZ_CP009920.1|WP_013083117.1|4505136_4505643_-|hypothetical-protein
MKKSIILLGILATSIGLSACSNNTTTSSATNSSAHSGHEHHKAAVADIREETPGADVLPQFLKNQPKDMKLVYLSVAKNRELLEKIPCYCGCGMEANHKNSYDCFIFKNKRNGAVVWDDHGTKCGLCIEIAAKAMLDYNRGKSIKDIRKDIDEKYKEGYAQPTPTPSL
>NZ_CP009920.1|WP_034652150.1|4505877_4506726_+|STAS-domain-containing-protein
MSEQNQRLFEYILENSASISEEWLRQRSNIKGSIYSKDADSSVEKKLREQHLYTIETIASGFLDDQKIFKQRMVKWTTEVVNSRIKFDTPIYEVVEALSKTRKIIWTYVKTYSLIHSSITKEDILSWSEVYHTTFDKLINEFSEQYYKITRQKISLQQELIDETSFPVIPIVDHIAVLPLVGLIDEIKGDSIIEVVPKKCAEKHIRHLVIDLSGVNYVDTYVAHKFFDLINILQLLGIHAIMSGVSPDMAQTAVNVGISFNKIETFGHLHQALSSLGVKNKV
>NZ_CP009920.1|WP_013083119.1|4507012_4507210_+|DUF3311-domain-containing-protein
MKIIYLLCLLPFVGILGLLPFVNKVTPFILGMPFFLFWIVMWVILTSFIMGIVYKLDPAVKGGDK
>NZ_CP009920.1|WP_016764077.1|4507209_4508703_+|sodium:solute-symporter
MNTALIIIFGFLLLAIYLGIRATRGKKMDLEQWSVGGRGFGTVFVFFLMAGEIYTTFTFLGGSAWAYGKGGPAFYILAYISLAYVLGYWIGPQIWRYAKQHKLMSQPDFFVSKYNSPFLGIVVSCAGVLAIVPYIILQFKGLGIIVSEASYGSISSTAAIWIGAISLTVYLMISGIHGSAWTAIVKDIMIFIVVLFLGIYMPFHYYGGLQPMFEAVHQANPTFLTLPKTGLSISWFISTVMLTVLGFYMWPHTFNATYSAENENVFRKNSIISPIYTLMLLFVFFVGFTALMQVPGLQGAEADLSLLRLSIQTFDPWIVGFIGAAGLLTALVPGSMLLMAASTSLSKNVYGVLVPSATGKQISILAKCFVPVIALVSVYFTLHGGNTIVTLLLMGYSIVTQLFPAFIFSLMKNNIVTKYGACAGIVAGIASVMYITITETTLGTLFPALPQIIKDTNVGVISLFINLVVLMVVSLATKKIAAQPHFESGAVDGKQIL
>NZ_CP009920.1|WP_013057013.1|4508935_4509103_+|Fur-regulated-basic-protein-FbpA
MTSEKAFEQKKDLLMNQIIESGYFKAEDGRHLYELNLSELEQTHHDLQNQKIREV
>NZ_CP009920.1|WP_013083122.1|4509336_4509930_-|DNA-polymerase-III-subunit-epsilon
MSTEQVKLAAVLDVETTGLSAQTCDIIELAIAVVSYDSSTGEIIDIVEEYEEFNMPSTPIFPYITNLTGITNEMVKNKTLDDKKVESLLTSVSAIIAHNASFDRSFLLKRYPSLSNQKWHCSMRAVKWKEYGFPNKKLTTLLDHHNIEREHAHRAMDDVKGTIDLLRQQNPSGEPYFSEVLKKAMSKPKKTAASTRF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009920_8

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009920_8

5152550-5152634

Orphan

Consensus_repeat	Method
CTTTTGCCGTTTTTGGCGTACTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP009920_8

>merge|NZ_CP009920|8|5152550-5152634|CRISPRCasFinder
CTTTTGCTGTTTTTAGCGTACTACTCTTCACTTTTGCTATTTTTGGCGTACTATACTGAGCCTTTTGCCGTTTTTTACGTACTAA

>NZ_CP009920|8|8|5152550-5152634|CRISPRCasFinder
CTTTTGCTGTTTTTAGCGTACTA	CTCTTCACTTTTGCTATTTTTGGCGTACTATACTGAGC
CTTTTGCCGTTTTTTACGTACTAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009920.1\|WP_080743167.1\|5159138_5159393_+\|DUF4183-domain-containing-protein	unknown	unknown	gnl\|CDD\|372730
NZ_CP009920.1\|WP_013057538.1\|5145342_5146002_-\|2OG-Fe(II)-oxygenase	unknown	unknown	gnl\|CDD\|177683
NZ_CP009920.1\|WP_013083667.1\|5150467_5151931_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_013057548.1\|5157131_5157551_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|349995
NZ_CP009920.1\|WP_013083665.1\|5147871_5148696_-\|kinase/pyrophosphorylase	unknown	unknown	gnl\|CDD\|377080
NZ_CP009920.1\|WP_016764590.1\|5146248_5147751_-\|malate:quinone-oxidoreductase	unknown	unknown	gnl\|CDD\|377591
NZ_CP009920.1\|WP_034651041.1\|5141387_5142218_-\|YitT-family-protein	unknown	unknown	gnl\|CDD\|224203
NZ_CP009920.1\|WP_016764587.1\|5143174_5143729_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP009920.1\|WP_016764601.1\|5160909_5161704_-\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
NZ_CP009920.1\|WP_034651024.1\|5159533_5160766_-\|aminopeptidase	unknown	unknown	gnl\|CDD\|376723
NZ_CP009920.1\|WP_016764594.1\|5154766_5155363_+\|mechanosensitive-ion-channel	unknown	unknown	gnl\|CDD\|366370
NZ_CP009920.1\|WP_034651031.1\|5149272_5150154_-\|Cof-type-HAD-IIB-family-hydrolase	unknown	unknown	gnl\|CDD\|369792
NZ_CP009920.1\|WP_034651028.1\|5155365_5155944_-\|HAD-IA-family-hydrolase	unknown	unknown	gnl\|CDD\|319825
NZ_CP009920.1\|WP_034651036.1\|5144097_5144922_-\|thermonuclease-family-protein	unknown	unknown	gnl\|CDD\|214615
NZ_CP009920.1\|WP_016764597.1\|5157958_5158450_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_115648261.1\|5158722_5159016_-\|DUF4183-domain-containing-protein	unknown	unknown	gnl\|CDD\|372730
NZ_CP009920.1\|WP_034651026.1\|5156072_5157059_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226728
NZ_CP009920.1\|WP_155276297.1\|5143888_5144032_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_034651039.1\|5142416_5142977_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|276809
NZ_CP009920.1\|WP_034651029.1\|5152900_5153923_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP009920.1\|WP_080743167.1\|5159138_5159393_+\|DUF4183-domain-containing-protein	gnl\|CDD\|372730	pfam13799, DUF4183, Domain of unknown function (DUF4183). This domain of unknown function contains a highly conserved ING motif.	3.92132e-12
NZ_CP009920.1\|WP_013057538.1\|5145342_5146002_-\|2OG-Fe(II)-oxygenase	gnl\|CDD\|177683	PLN00052, PLN00052, prolyl 4-hydroxylase; Provisional.	1.55318e-40
NZ_CP009920.1\|WP_034651036.1\|5144097_5144922_-\|thermonuclease-family-protein	gnl\|CDD\|214615	smart00318, SNc, Staphylococcal nuclease homologues.	4.25242e-38
NZ_CP009920.1\|WP_013057548.1\|5157131_5157551_-\|hypothetical-protein	gnl\|CDD\|349995	cd18551, ABC_6TM_LmrA_like, Six-transmembrane helical domain of the multidrug resistance ABC transporter LmrA and similar proteins. This group represents the six-transmembrane helical domain of the multidrug resistance ABC transporter LmrA from Lactococcus lactis and similar proteins. This transmembrane (TM) subunit possesses the ATP-binding cassette (ABC) exporter fold, which is characterized by 6 TM helices per subunit (domain), or a total of 12 TM helices for the complete transporter. The ABC exporters are found in both prokaryotes and eukaryotes, where they mediate the cellular secretion of toxic compounds, a various type of lipids and polypeptides. ABC transporters typically consist of two transmembrane domains (TMDs) and two nucleotide-binding domains (NBDs). The sequences and structures of the TMDs are quite varied between the different type of transporters, suggesting significant structural diversity of the translocated substrates, while NBDs are conserved among all ABC transporters. The two NBDs together bind and hydrolyze ATP, thereby providing the driving force for transport, while the TMDs participate in substrate recognition and translocation across the lipid membrane by alternating between inward- and outward-facing conformations. Moreover, some ABC genes are organized as half-transporters, which must form either homodimers or heterodimers to form a functional transporter. The ABC exporters play a role in multidrug resistance to antibiotics and anticancer agents, and mutations in these proteins have been shown to cause severe human diseases such as cystic fibrosis.	0.00168085
NZ_CP009920.1\|WP_013083665.1\|5147871_5148696_-\|kinase/pyrophosphorylase	gnl\|CDD\|377080	pfam03618, Kinase-PPPase, Kinase/pyrophosphorylase. This family of regulatory proteins has ADP-dependent kinase and inorganic phosphate-dependent pyrophosphorylase activity.	5.97841e-145
NZ_CP009920.1\|WP_016764590.1\|5146248_5147751_-\|malate:quinone-oxidoreductase	gnl\|CDD\|377591	pfam06039, Mqo, Malate:quinone oxidoreductase (Mqo). This family consists of several bacterial Malate:quinone oxidoreductase (Mqo) proteins (EC:1.1.99.16). Mqo takes part in the citric acid cycle. It oxidizes L-malate to oxaloacetate and donates electrons to ubiquinone-1 and other artificial acceptors or, via the electron transfer chain, to oxygen. NAD is not an acceptor and the natural direct acceptor for the enzyme is most likely a quinone. The enzyme is therefore called malate:quinone oxidoreductase, abbreviated to Mqo. Mqo is a peripheral membrane protein and can be released from the membrane by addition of chelators.	0
NZ_CP009920.1\|WP_034651041.1\|5141387_5142218_-\|YitT-family-protein	gnl\|CDD\|224203	COG1284, COG1284, Uncharacterized conserved protein [Function unknown].	4.03327e-71
NZ_CP009920.1\|WP_016764587.1\|5143174_5143729_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	4.70491e-12
NZ_CP009920.1\|WP_034651024.1\|5159533_5160766_-\|aminopeptidase	gnl\|CDD\|376723	pfam02073, Peptidase_M29, Thermophilic metalloprotease (M29).	0
NZ_CP009920.1\|WP_034651031.1\|5149272_5150154_-\|Cof-type-HAD-IIB-family-hydrolase	gnl\|CDD\|369792	pfam08282, Hydrolase_3, haloacid dehalogenase-like hydrolase. This family contains haloacid dehalogenase-like hydrolase enzymes.	1.02771e-57
NZ_CP009920.1\|WP_034651028.1\|5155365_5155944_-\|HAD-IA-family-hydrolase	gnl\|CDD\|319825	cd07523, HAD_YsbA-like, uncharacterized family of the haloacid dehalogenase-like superfamily, similar to the uncharacterized Lactococcus lactis YsbA. The specific function of Lactococcus lactis YsbA is unknown. Members of this family belong to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	6.09488e-43
NZ_CP009920.1\|WP_016764601.1\|5160909_5161704_-\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	1.35575e-94
NZ_CP009920.1\|WP_115648261.1\|5158722_5159016_-\|DUF4183-domain-containing-protein	gnl\|CDD\|372730	pfam13799, DUF4183, Domain of unknown function (DUF4183). This domain of unknown function contains a highly conserved ING motif.	3.13602e-20
NZ_CP009920.1\|WP_034651026.1\|5156072_5157059_-\|hypothetical-protein	gnl\|CDD\|226728	COG4278, COG4278, Uncharacterized conserved protein [Function unknown].	1.0302e-07
NZ_CP009920.1\|WP_034651039.1\|5142416_5142977_-\|hypothetical-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	0.0082524
NZ_CP009920.1\|WP_016764594.1\|5154766_5155363_+\|mechanosensitive-ion-channel	gnl\|CDD\|366370	pfam00924, MS_channel, Mechanosensitive ion channel. Two members of this protein family of M. jannaschii have been functionally characterized. Both proteins form mechanosensitive (MS) ion channels upon reconstitution into liposomes and functional examination by the patch-clamp technique. Therefore this family are likely to also be MS channel proteins.	1.31751e-24

>NZ_CP009920.1|WP_013083667.1|5150467_5151931_+|hypothetical-protein
MNEPSNFSPYLIKQISDAIDDNIKAKCIDFLYDSHSFFSNEKDFIEDYILNILQDTFVLENKLINPKEIRNPAYKRRQSNKKNWLQTLKKDIKAEKPNPIFEDIELAKKVMDKKVDTEHLKKLFGVEKPEDILKIKLKEVEAWAKSKKTNITDFPYLDSKMNYQIEKAFHTDFTFLIAEIILEKYNGNLSNWIDKRLNSWVEAPIFSNESHSLKTNMEVKTNSQEVVLYNDYKVDEEYFIRTIIPVNDNQTVLSKRNMVLDPKDSQIIQFALSQRDEMFYKEKTVTLDLADIVKEIYNSKGVKNYEAVEARIMKIARYHVEGVAKKKNSRDTKFAINFFQKAVIETDEVTGRRYATIVFSDDTHQGFLNQQFVQIYSDVIKKFKDNSLSSLLLYAFQKERLDCYLQEKSYTHFYPYQYFASKVRFRSKKIDVNLKLINESLAEFVSNQVLIQSYQQKLQGFEISFIPLQNYEIQDYFGGEHRETLEG
>NZ_CP009920.1|WP_034651031.1|5149272_5150154_-|Cof-type-HAD-IIB-family-hydrolase
MLLKPKAIFLDMDGTILNRSNKVSIQTKEIIDELRKQGIFVFIATGRAFDEIEELVPEGFQVDGFITSNGMAGYVGKESVFQHSLSLQLVETIIEKARANKVYYELFPYGTPRVTLKQDQSYVENEIREPKPDSVEINEWLSRKQAIKEEIDWKDSVEGSEFSKFYFFARTHEHIDKWKEELEELKKEIDFTTSTSSKHNVEVMVANVNKATGIQQMLKHFNLPEQDILAIGDSNNDLPMFQFASYAVAMKNAPDHIQEIVDDVTEFNCDENGVSHYLSKFLLQKSTRSNPVL
>NZ_CP009920.1|WP_013083665.1|5147871_5148696_-|kinase/pyrophosphorylase
MNKRKIVYIVSDSVGETAELMVKAVLTQFSGEDIEIQNTSYVEDEGNIDNIIAEARCNEAIIAYTIVIPPLKQYLDQKAQEEGIVAIDLMTPLMSAFSQTFNKEPNLQPRLTRKLDDNYFRRVEAVEFAVKYDDGQDFRGIKRADLVLIGVSRTSKTPLSMYLAHKSLKVANIPLVPEVTPPDELFTIPKNKCIGLVITPDKLNEIRKERLKNLGLASQANYANVDRILEELDYAEKIMKRIGCPIVNVSGKAVEETAEVILSMLKKDKMKGYV
>NZ_CP009920.1|WP_016764590.1|5146248_5147751_-|malate:quinone-oxidoreductase
MSNVYKKTDVILIGAGVMSATLGSLLKELAPEWEIKVFEKLADAGEESSNEWNNAGTGHAALCELNYTSEQADGSIDITKAVRINEQFQLSRQFWSYLVSSNLIHHPQEFIMPIPHMSFVQGEKNVSFLKKRFEALSNNPLFQGMEYSDRPEKLKEWMPLVMKGRTSTEAIAATKIDSGTDVNFGALTRMLFTHLKSKRVEINYNHSVENLTRTADGSWEVKVHDIHTGKQEYHTANFVFIGGGGGSLSLLQKTGIPESKHIGGFPVSGLFMVCNNPEVVAQHHGKVYGKAKVGAPPMSVPHLDTRYIDRKKTLLFGPFAGFSPKFLKTGSNLDLINSVKPNNILTMLAAGVKEMGLTKYLIQQVLLSDEKRMEELREFIPNAKSEDWDIVVAGQRVQVIKDTEAGGKGTLQFGTEVVSSADGSVAALLGASPGASTAVHVMLEVLEKCFPQHMKKWESKIKEMIPSYGLSLVENPALFNEIHASTSQTLDLSKKELVYR
>NZ_CP009920.1|WP_013057538.1|5145342_5146002_-|2OG-Fe(II)-oxygenase
MILTNTSLLTKEQTIFNHTGNKIKLEDREIDIVARFEEPLVLVLGNVLSNEECDELIQLSKDKMQRSKIGAAREVNSIRTSSGMFFEESENELVHQIERRLSKIMGPSIEYAEGLQVLKYLPDQEYKAHHDYFTSASKASKNNRISTLVMYLNDVEEGGETYFPKLGLSVSPTKGMAVYFEYFYSDAELNDRTLHGGAPVIKGEKWVATQWMRKQKIRS
>NZ_CP009920.1|WP_034651036.1|5144097_5144922_-|thermonuclease-family-protein
MKEIKAIICTMLAMFMLLLTGCSDEQASHSSTSSADTKQAVQVEDSSDQEEDHSPSKANREDVVGEAATVERVVDGDTLKVKMLNGKRDRVRLLLVDTPETKHPKLGVQPFGPEASAYTKKRLEGQEITLEFDVQERDQYGRLLAYVWIDNELYNEELLAKGLARVAVFPPNTKYVDEFKKIQEQARKSEKGIWSIENYAQEKGYNTDAVKNQSSSKQKDTQSAKSCEGKIKGNQNSKIYHVPTGAHYNQTMNHVIWFCTEKDAQEAGYKKAKN
>NZ_CP009920.1|WP_155276297.1|5143888_5144032_+|hypothetical-protein
MKKHRQQKDTTVSGWEVLAEILLQVPQLLIWPLRLLIRIGRSLLDGI
>NZ_CP009920.1|WP_016764587.1|5143174_5143729_-|GNAT-family-N-acetyltransferase
MKIRKARKEDASAVTELLYDMLGSIARSHTAATTNEEALLRLKAFILSEKNRYSYHHITIAEVEEKVVGLMLCYEGSMLQTLYEPVKRFVRAKLNNPAWEIDIETEHGDYYIDSLCVDEAYRGKGIGTALLNVAKQEAKKRKMFLSLNVEYNNVEAKKLYQRIGFQEHKTIFIDKKPFFYMKTA
>NZ_CP009920.1|WP_034651039.1|5142416_5142977_-|hypothetical-protein
MNIRDLPFNMSYRFNEQLREVPVNPHQMKQGIIYLKKRALEEEDECAAAKTYGHIGVYERILGELTSSERHLLLAIYLYDRHADTIGEFLNTIRLGHTYHWQEQWDKANETFQLLIEQLKADEDLHIYEDFVYQHYGKCLLDQRVVSRAHHYFQRALEIRLKKGDKELIESTNSCIRLCLNKLKHS
>NZ_CP009920.1|WP_034651041.1|5141387_5142218_-|YitT-family-protein
MSKTVKDVIFLLIGSFVFSLAVNMFVIPIGLGEGGVTGISIILYYTTHLSTGSTNFILNGILLIVGYKFLEKKTIVYTMITIIATSIFLHVTEGWGLHLHEELIGMVFAGVLLGVGIGMILRVGGTTAGSAIIARILNKFLNWKVSHALLIVDLLVVLASYFIIGIEKLLFTIVMLYITTKVIDFVIEGFDAKKAVTVISSNKNEVADQINEQLDRGVTILNGRGNYTKESKEILYVVINKQELIKLQKLIKKIDDEAFVIVHDVRDVIGKGFLSA
>NZ_CP009920.1|WP_034651029.1|5152900_5153923_+|hypothetical-protein
MIKKEFAKIGKQIIRQLSSTVEKYKDIEDHMDLDAHGNPTIKTVAEHHRLSKSQISQLIFYHFLHVDERGIICDVSEKEIAAALNCTVRTVRNNNVVLAETELISYSRSGKGINICIVPYPQYFEEHGFGFMELEYTRFEELILIENVNALRLELRKELVYDNDTIKRQFNPAENTSKISFNDYKIFTPKYTHYKGMMQKIAETQTSAFKTVVQGSTIFFVLKDGAKNGKMSKQEKKDQYAAAIRRTIEETFVKLSGHSTDSTGIIMSSFQNEDIADLVQLSFEYGIERVKSALYSLIEQAFFSHDAQVVENYGGKIRTLIRKELSKNLQDQVPAELTAS
>NZ_CP009920.1|WP_016764594.1|5154766_5155363_+|mechanosensitive-ion-channel
MKDIQWVQKTLFNTGKWIDISEVIIKIILIFIIAQIVIRFARSVINKIFDFRFKTKLLRYNERKEITLKKLCLSIVMYVVYFIVLITSLEAIGINMKALLAGISVAGFITGLGAQNLIKDILNGFFILFEDQFSVGDHVSINDTKGTVEEIGLRTTKIRGVDGEFYFFANSNITKVANYTLGEIPEVHKPEQIKTREE
>NZ_CP009920.1|WP_034651028.1|5155365_5155944_-|HAD-IA-family-hydrolase
MNILWDFDGTIFDTYPTIVKAFKELLTDQTISEDDILKQMKISSDIAIKHFDIKKSLFDKHFHVLEQKINPKDKPAFPHVEDVLSFADTNVIVTHKSRQSTLDILAFFNMEHYFTEIITKDDGYKRKPDSGAYAYLHDKYQLDLVIGDRELDLKPARELGIKTCAFQNDDIEADYHLTSYDQFFTTVVNKNS
>NZ_CP009920.1|WP_034651026.1|5156072_5157059_-|hypothetical-protein
MITAIIVGAVILLALIIKGIGKPRGFRLYKEELPDELGIHEGNGFEDIVHSLEDSLPKAYVQQVKQRMQGRNTKDDEVEWTFFEMKRYFLLNAVIKDVPMFSAKVDEVWHEMIMFTVDYGRFTDRFFDRFLHHQPNVDTTPSPQPDKRAFFDWMYAHLFDITGNSRLLWGKFFQHPLDKSTLQDFQRLSEDELLDRYFLRNGKWEKLQRALIQTLKEEINAARKRKKAGGSTYFKKTAKKGNVSNELLLQGFVFYSLYKAANFSSHMNELLLYKKTMYAGDTASYSGYSCSSPWEDNRHHHQHDGGHHHHDSGSSCSSSSCGSGCSSS
>NZ_CP009920.1|WP_013057548.1|5157131_5157551_-|hypothetical-protein
MSLSAKKILLLVLVVICLVLVVMQFINRSAEPTSEQAQETLSKLPEQETVKEKAKGDEEAHKYRVYYITIEKIENGTYSGTTKEGTGIKFSDKNLNEPIPSNLKKGDIVKAYFDLEYSTKGLVKVEKVDEMPDDDESSS
>NZ_CP009920.1|WP_016764597.1|5157958_5158450_+|hypothetical-protein
MMFALIVVVGIVALGVASFYVIKRPQGAVDPEDRKPLVSVNGHVKFAEGINQISISKIDMYDQRLVINQVAIIPFNRIQRAEFSKVVKNEKGLHGAPVQRYFGELTIHFTDKNGQETYISCETPKKNQFHLIYQYDLMKRQLNKRLGLEDLQPYLTLQEPYEL
>NZ_CP009920.1|WP_115648261.1|5158722_5159016_-|DUF4183-domain-containing-protein
MLPQQEFRYIFPKKVRIFEYYTVAGGSKRIFTDQDALKEYGTQHILDPESYSYSNLFINGVLQPSSNYSVQKGLLIINTEDIPLEKSPVILQMIKVI
>NZ_CP009920.1|WP_080743167.1|5159138_5159393_+|DUF4183-domain-containing-protein
MPLQIMKLAIAATALPALATDNSYYNVYINGVLQMAGLSIYTPGATGVGSLAITVPAGSSVLTGSPIVLEVVNFAPDSTTDVQT
>NZ_CP009920.1|WP_034651024.1|5159533_5160766_-|aminopeptidase
MEQFERNIEKYAELAVKVGVNIQKGQILNINADISSADFVREIAKKAYEAGAKSVDVDWHDDHLVRLKYEKADESVFSEFPAWKAQAREELVKNGGAVLSVISSGPDLLKGVDGKRIAAFQKVSGKAMKKFREAIQSDKISWSIVAVPSKDWAAKVFPDVPEEQQQEKLWEAIFKSVRVDQEDPVAAWEEHNASLHTKVDILNEKRFAKLHYKAPGTDLTIELPDKHIWVGAGSVNEDGNSFMANMPTEEVFTLPKKDGVNGQVTSTKPLSYAGNLIENFTLTFENGKIVDVKAEEGEETLKHLIETDEGAKYLGEVALVPHQSPISQSNIIFYNTLFDENASNHLAIGSSYSFCLEGGKTMSKEELSQNGANDSITHVDFMIGSAEMDIDGIKADGTSEPVFRKGNWAF
>NZ_CP009920.1|WP_016764601.1|5160909_5161704_-|IclR-family-transcriptional-regulator
MERENMVKSVSRALDIVTIVSMEREGVGVTEIAKQMDINKSSVYRILTTLAQYGYIEQDQETGRYKLGYKFLEVSSKLLDSIDLRTEAKPFLQELESETNEVIHLVVYDQGEVVYIEKLEGNQTLRMHSKVGKRAPMHCTSVGKAILAFLPLNTVTSILERKGLPAHTDHTITDEESFLRELSEVKQKGYALDLEENEYGITCIAAPIFDHLGQVVAAVSISGATMRMTNERLTYFQERMVDIGKNISERLGYKTESVKDKSLF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009920_7

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009920_7

5152362-5152447

Orphan

Consensus_repeat	Method
CTTTTGCCGTTTTTGGCGTACTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP009920_7

>merge|NZ_CP009920|7|5152362-5152447|CRISPRCasFinder
CTTTTGCCATTTTTGACGTACCAAACAAAAACTTTTGCTGTTTTTATCGTACTACTACGTCGTTTTTGACGCTTTTCACGTACTAA

>NZ_CP009920|7|7|5152362-5152447|CRISPRCasFinder
CTTTTGCCATTTTTGACGTACCA	AACAAAAACTTTTGCTGTTTTTATCGTACTACTACGTCG
TTTTTGACGCTTTTCACGTACTAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009920.1\|WP_080743167.1\|5159138_5159393_+\|DUF4183-domain-containing-protein	unknown	unknown	gnl\|CDD\|372730
NZ_CP009920.1\|WP_013057538.1\|5145342_5146002_-\|2OG-Fe(II)-oxygenase	unknown	unknown	gnl\|CDD\|177683
NZ_CP009920.1\|WP_013083667.1\|5150467_5151931_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_013057548.1\|5157131_5157551_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|349995
NZ_CP009920.1\|WP_013083665.1\|5147871_5148696_-\|kinase/pyrophosphorylase	unknown	unknown	gnl\|CDD\|377080
NZ_CP009920.1\|WP_016764590.1\|5146248_5147751_-\|malate:quinone-oxidoreductase	unknown	unknown	gnl\|CDD\|377591
NZ_CP009920.1\|WP_034651041.1\|5141387_5142218_-\|YitT-family-protein	unknown	unknown	gnl\|CDD\|224203
NZ_CP009920.1\|WP_016764587.1\|5143174_5143729_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP009920.1\|WP_016764601.1\|5160909_5161704_-\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
NZ_CP009920.1\|WP_034651024.1\|5159533_5160766_-\|aminopeptidase	unknown	unknown	gnl\|CDD\|376723
NZ_CP009920.1\|WP_016764594.1\|5154766_5155363_+\|mechanosensitive-ion-channel	unknown	unknown	gnl\|CDD\|366370
NZ_CP009920.1\|WP_034651031.1\|5149272_5150154_-\|Cof-type-HAD-IIB-family-hydrolase	unknown	unknown	gnl\|CDD\|369792
NZ_CP009920.1\|WP_034651028.1\|5155365_5155944_-\|HAD-IA-family-hydrolase	unknown	unknown	gnl\|CDD\|319825
NZ_CP009920.1\|WP_034651036.1\|5144097_5144922_-\|thermonuclease-family-protein	unknown	unknown	gnl\|CDD\|214615
NZ_CP009920.1\|WP_016764597.1\|5157958_5158450_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_115648261.1\|5158722_5159016_-\|DUF4183-domain-containing-protein	unknown	unknown	gnl\|CDD\|372730
NZ_CP009920.1\|WP_034651026.1\|5156072_5157059_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226728
NZ_CP009920.1\|WP_155276297.1\|5143888_5144032_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_034651039.1\|5142416_5142977_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|276809
NZ_CP009920.1\|WP_034651029.1\|5152900_5153923_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP009920.1\|WP_080743167.1\|5159138_5159393_+\|DUF4183-domain-containing-protein	gnl\|CDD\|372730	pfam13799, DUF4183, Domain of unknown function (DUF4183). This domain of unknown function contains a highly conserved ING motif.	3.92132e-12
NZ_CP009920.1\|WP_013057538.1\|5145342_5146002_-\|2OG-Fe(II)-oxygenase	gnl\|CDD\|177683	PLN00052, PLN00052, prolyl 4-hydroxylase; Provisional.	1.55318e-40
NZ_CP009920.1\|WP_034651036.1\|5144097_5144922_-\|thermonuclease-family-protein	gnl\|CDD\|214615	smart00318, SNc, Staphylococcal nuclease homologues.	4.25242e-38
NZ_CP009920.1\|WP_013057548.1\|5157131_5157551_-\|hypothetical-protein	gnl\|CDD\|349995	cd18551, ABC_6TM_LmrA_like, Six-transmembrane helical domain of the multidrug resistance ABC transporter LmrA and similar proteins. This group represents the six-transmembrane helical domain of the multidrug resistance ABC transporter LmrA from Lactococcus lactis and similar proteins. This transmembrane (TM) subunit possesses the ATP-binding cassette (ABC) exporter fold, which is characterized by 6 TM helices per subunit (domain), or a total of 12 TM helices for the complete transporter. The ABC exporters are found in both prokaryotes and eukaryotes, where they mediate the cellular secretion of toxic compounds, a various type of lipids and polypeptides. ABC transporters typically consist of two transmembrane domains (TMDs) and two nucleotide-binding domains (NBDs). The sequences and structures of the TMDs are quite varied between the different type of transporters, suggesting significant structural diversity of the translocated substrates, while NBDs are conserved among all ABC transporters. The two NBDs together bind and hydrolyze ATP, thereby providing the driving force for transport, while the TMDs participate in substrate recognition and translocation across the lipid membrane by alternating between inward- and outward-facing conformations. Moreover, some ABC genes are organized as half-transporters, which must form either homodimers or heterodimers to form a functional transporter. The ABC exporters play a role in multidrug resistance to antibiotics and anticancer agents, and mutations in these proteins have been shown to cause severe human diseases such as cystic fibrosis.	0.00168085
NZ_CP009920.1\|WP_013083665.1\|5147871_5148696_-\|kinase/pyrophosphorylase	gnl\|CDD\|377080	pfam03618, Kinase-PPPase, Kinase/pyrophosphorylase. This family of regulatory proteins has ADP-dependent kinase and inorganic phosphate-dependent pyrophosphorylase activity.	5.97841e-145
NZ_CP009920.1\|WP_016764590.1\|5146248_5147751_-\|malate:quinone-oxidoreductase	gnl\|CDD\|377591	pfam06039, Mqo, Malate:quinone oxidoreductase (Mqo). This family consists of several bacterial Malate:quinone oxidoreductase (Mqo) proteins (EC:1.1.99.16). Mqo takes part in the citric acid cycle. It oxidizes L-malate to oxaloacetate and donates electrons to ubiquinone-1 and other artificial acceptors or, via the electron transfer chain, to oxygen. NAD is not an acceptor and the natural direct acceptor for the enzyme is most likely a quinone. The enzyme is therefore called malate:quinone oxidoreductase, abbreviated to Mqo. Mqo is a peripheral membrane protein and can be released from the membrane by addition of chelators.	0
NZ_CP009920.1\|WP_034651041.1\|5141387_5142218_-\|YitT-family-protein	gnl\|CDD\|224203	COG1284, COG1284, Uncharacterized conserved protein [Function unknown].	4.03327e-71
NZ_CP009920.1\|WP_016764587.1\|5143174_5143729_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	4.70491e-12
NZ_CP009920.1\|WP_034651024.1\|5159533_5160766_-\|aminopeptidase	gnl\|CDD\|376723	pfam02073, Peptidase_M29, Thermophilic metalloprotease (M29).	0
NZ_CP009920.1\|WP_034651031.1\|5149272_5150154_-\|Cof-type-HAD-IIB-family-hydrolase	gnl\|CDD\|369792	pfam08282, Hydrolase_3, haloacid dehalogenase-like hydrolase. This family contains haloacid dehalogenase-like hydrolase enzymes.	1.02771e-57
NZ_CP009920.1\|WP_034651028.1\|5155365_5155944_-\|HAD-IA-family-hydrolase	gnl\|CDD\|319825	cd07523, HAD_YsbA-like, uncharacterized family of the haloacid dehalogenase-like superfamily, similar to the uncharacterized Lactococcus lactis YsbA. The specific function of Lactococcus lactis YsbA is unknown. Members of this family belong to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	6.09488e-43
NZ_CP009920.1\|WP_016764601.1\|5160909_5161704_-\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	1.35575e-94
NZ_CP009920.1\|WP_115648261.1\|5158722_5159016_-\|DUF4183-domain-containing-protein	gnl\|CDD\|372730	pfam13799, DUF4183, Domain of unknown function (DUF4183). This domain of unknown function contains a highly conserved ING motif.	3.13602e-20
NZ_CP009920.1\|WP_034651026.1\|5156072_5157059_-\|hypothetical-protein	gnl\|CDD\|226728	COG4278, COG4278, Uncharacterized conserved protein [Function unknown].	1.0302e-07
NZ_CP009920.1\|WP_034651039.1\|5142416_5142977_-\|hypothetical-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	0.0082524
NZ_CP009920.1\|WP_016764594.1\|5154766_5155363_+\|mechanosensitive-ion-channel	gnl\|CDD\|366370	pfam00924, MS_channel, Mechanosensitive ion channel. Two members of this protein family of M. jannaschii have been functionally characterized. Both proteins form mechanosensitive (MS) ion channels upon reconstitution into liposomes and functional examination by the patch-clamp technique. Therefore this family are likely to also be MS channel proteins.	1.31751e-24

>NZ_CP009920.1|WP_013083667.1|5150467_5151931_+|hypothetical-protein
MNEPSNFSPYLIKQISDAIDDNIKAKCIDFLYDSHSFFSNEKDFIEDYILNILQDTFVLENKLINPKEIRNPAYKRRQSNKKNWLQTLKKDIKAEKPNPIFEDIELAKKVMDKKVDTEHLKKLFGVEKPEDILKIKLKEVEAWAKSKKTNITDFPYLDSKMNYQIEKAFHTDFTFLIAEIILEKYNGNLSNWIDKRLNSWVEAPIFSNESHSLKTNMEVKTNSQEVVLYNDYKVDEEYFIRTIIPVNDNQTVLSKRNMVLDPKDSQIIQFALSQRDEMFYKEKTVTLDLADIVKEIYNSKGVKNYEAVEARIMKIARYHVEGVAKKKNSRDTKFAINFFQKAVIETDEVTGRRYATIVFSDDTHQGFLNQQFVQIYSDVIKKFKDNSLSSLLLYAFQKERLDCYLQEKSYTHFYPYQYFASKVRFRSKKIDVNLKLINESLAEFVSNQVLIQSYQQKLQGFEISFIPLQNYEIQDYFGGEHRETLEG
>NZ_CP009920.1|WP_034651031.1|5149272_5150154_-|Cof-type-HAD-IIB-family-hydrolase
MLLKPKAIFLDMDGTILNRSNKVSIQTKEIIDELRKQGIFVFIATGRAFDEIEELVPEGFQVDGFITSNGMAGYVGKESVFQHSLSLQLVETIIEKARANKVYYELFPYGTPRVTLKQDQSYVENEIREPKPDSVEINEWLSRKQAIKEEIDWKDSVEGSEFSKFYFFARTHEHIDKWKEELEELKKEIDFTTSTSSKHNVEVMVANVNKATGIQQMLKHFNLPEQDILAIGDSNNDLPMFQFASYAVAMKNAPDHIQEIVDDVTEFNCDENGVSHYLSKFLLQKSTRSNPVL
>NZ_CP009920.1|WP_013083665.1|5147871_5148696_-|kinase/pyrophosphorylase
MNKRKIVYIVSDSVGETAELMVKAVLTQFSGEDIEIQNTSYVEDEGNIDNIIAEARCNEAIIAYTIVIPPLKQYLDQKAQEEGIVAIDLMTPLMSAFSQTFNKEPNLQPRLTRKLDDNYFRRVEAVEFAVKYDDGQDFRGIKRADLVLIGVSRTSKTPLSMYLAHKSLKVANIPLVPEVTPPDELFTIPKNKCIGLVITPDKLNEIRKERLKNLGLASQANYANVDRILEELDYAEKIMKRIGCPIVNVSGKAVEETAEVILSMLKKDKMKGYV
>NZ_CP009920.1|WP_016764590.1|5146248_5147751_-|malate:quinone-oxidoreductase
MSNVYKKTDVILIGAGVMSATLGSLLKELAPEWEIKVFEKLADAGEESSNEWNNAGTGHAALCELNYTSEQADGSIDITKAVRINEQFQLSRQFWSYLVSSNLIHHPQEFIMPIPHMSFVQGEKNVSFLKKRFEALSNNPLFQGMEYSDRPEKLKEWMPLVMKGRTSTEAIAATKIDSGTDVNFGALTRMLFTHLKSKRVEINYNHSVENLTRTADGSWEVKVHDIHTGKQEYHTANFVFIGGGGGSLSLLQKTGIPESKHIGGFPVSGLFMVCNNPEVVAQHHGKVYGKAKVGAPPMSVPHLDTRYIDRKKTLLFGPFAGFSPKFLKTGSNLDLINSVKPNNILTMLAAGVKEMGLTKYLIQQVLLSDEKRMEELREFIPNAKSEDWDIVVAGQRVQVIKDTEAGGKGTLQFGTEVVSSADGSVAALLGASPGASTAVHVMLEVLEKCFPQHMKKWESKIKEMIPSYGLSLVENPALFNEIHASTSQTLDLSKKELVYR
>NZ_CP009920.1|WP_013057538.1|5145342_5146002_-|2OG-Fe(II)-oxygenase
MILTNTSLLTKEQTIFNHTGNKIKLEDREIDIVARFEEPLVLVLGNVLSNEECDELIQLSKDKMQRSKIGAAREVNSIRTSSGMFFEESENELVHQIERRLSKIMGPSIEYAEGLQVLKYLPDQEYKAHHDYFTSASKASKNNRISTLVMYLNDVEEGGETYFPKLGLSVSPTKGMAVYFEYFYSDAELNDRTLHGGAPVIKGEKWVATQWMRKQKIRS
>NZ_CP009920.1|WP_034651036.1|5144097_5144922_-|thermonuclease-family-protein
MKEIKAIICTMLAMFMLLLTGCSDEQASHSSTSSADTKQAVQVEDSSDQEEDHSPSKANREDVVGEAATVERVVDGDTLKVKMLNGKRDRVRLLLVDTPETKHPKLGVQPFGPEASAYTKKRLEGQEITLEFDVQERDQYGRLLAYVWIDNELYNEELLAKGLARVAVFPPNTKYVDEFKKIQEQARKSEKGIWSIENYAQEKGYNTDAVKNQSSSKQKDTQSAKSCEGKIKGNQNSKIYHVPTGAHYNQTMNHVIWFCTEKDAQEAGYKKAKN
>NZ_CP009920.1|WP_155276297.1|5143888_5144032_+|hypothetical-protein
MKKHRQQKDTTVSGWEVLAEILLQVPQLLIWPLRLLIRIGRSLLDGI
>NZ_CP009920.1|WP_016764587.1|5143174_5143729_-|GNAT-family-N-acetyltransferase
MKIRKARKEDASAVTELLYDMLGSIARSHTAATTNEEALLRLKAFILSEKNRYSYHHITIAEVEEKVVGLMLCYEGSMLQTLYEPVKRFVRAKLNNPAWEIDIETEHGDYYIDSLCVDEAYRGKGIGTALLNVAKQEAKKRKMFLSLNVEYNNVEAKKLYQRIGFQEHKTIFIDKKPFFYMKTA
>NZ_CP009920.1|WP_034651039.1|5142416_5142977_-|hypothetical-protein
MNIRDLPFNMSYRFNEQLREVPVNPHQMKQGIIYLKKRALEEEDECAAAKTYGHIGVYERILGELTSSERHLLLAIYLYDRHADTIGEFLNTIRLGHTYHWQEQWDKANETFQLLIEQLKADEDLHIYEDFVYQHYGKCLLDQRVVSRAHHYFQRALEIRLKKGDKELIESTNSCIRLCLNKLKHS
>NZ_CP009920.1|WP_034651041.1|5141387_5142218_-|YitT-family-protein
MSKTVKDVIFLLIGSFVFSLAVNMFVIPIGLGEGGVTGISIILYYTTHLSTGSTNFILNGILLIVGYKFLEKKTIVYTMITIIATSIFLHVTEGWGLHLHEELIGMVFAGVLLGVGIGMILRVGGTTAGSAIIARILNKFLNWKVSHALLIVDLLVVLASYFIIGIEKLLFTIVMLYITTKVIDFVIEGFDAKKAVTVISSNKNEVADQINEQLDRGVTILNGRGNYTKESKEILYVVINKQELIKLQKLIKKIDDEAFVIVHDVRDVIGKGFLSA
>NZ_CP009920.1|WP_034651029.1|5152900_5153923_+|hypothetical-protein
MIKKEFAKIGKQIIRQLSSTVEKYKDIEDHMDLDAHGNPTIKTVAEHHRLSKSQISQLIFYHFLHVDERGIICDVSEKEIAAALNCTVRTVRNNNVVLAETELISYSRSGKGINICIVPYPQYFEEHGFGFMELEYTRFEELILIENVNALRLELRKELVYDNDTIKRQFNPAENTSKISFNDYKIFTPKYTHYKGMMQKIAETQTSAFKTVVQGSTIFFVLKDGAKNGKMSKQEKKDQYAAAIRRTIEETFVKLSGHSTDSTGIIMSSFQNEDIADLVQLSFEYGIERVKSALYSLIEQAFFSHDAQVVENYGGKIRTLIRKELSKNLQDQVPAELTAS
>NZ_CP009920.1|WP_016764594.1|5154766_5155363_+|mechanosensitive-ion-channel
MKDIQWVQKTLFNTGKWIDISEVIIKIILIFIIAQIVIRFARSVINKIFDFRFKTKLLRYNERKEITLKKLCLSIVMYVVYFIVLITSLEAIGINMKALLAGISVAGFITGLGAQNLIKDILNGFFILFEDQFSVGDHVSINDTKGTVEEIGLRTTKIRGVDGEFYFFANSNITKVANYTLGEIPEVHKPEQIKTREE
>NZ_CP009920.1|WP_034651028.1|5155365_5155944_-|HAD-IA-family-hydrolase
MNILWDFDGTIFDTYPTIVKAFKELLTDQTISEDDILKQMKISSDIAIKHFDIKKSLFDKHFHVLEQKINPKDKPAFPHVEDVLSFADTNVIVTHKSRQSTLDILAFFNMEHYFTEIITKDDGYKRKPDSGAYAYLHDKYQLDLVIGDRELDLKPARELGIKTCAFQNDDIEADYHLTSYDQFFTTVVNKNS
>NZ_CP009920.1|WP_034651026.1|5156072_5157059_-|hypothetical-protein
MITAIIVGAVILLALIIKGIGKPRGFRLYKEELPDELGIHEGNGFEDIVHSLEDSLPKAYVQQVKQRMQGRNTKDDEVEWTFFEMKRYFLLNAVIKDVPMFSAKVDEVWHEMIMFTVDYGRFTDRFFDRFLHHQPNVDTTPSPQPDKRAFFDWMYAHLFDITGNSRLLWGKFFQHPLDKSTLQDFQRLSEDELLDRYFLRNGKWEKLQRALIQTLKEEINAARKRKKAGGSTYFKKTAKKGNVSNELLLQGFVFYSLYKAANFSSHMNELLLYKKTMYAGDTASYSGYSCSSPWEDNRHHHQHDGGHHHHDSGSSCSSSSCGSGCSSS
>NZ_CP009920.1|WP_013057548.1|5157131_5157551_-|hypothetical-protein
MSLSAKKILLLVLVVICLVLVVMQFINRSAEPTSEQAQETLSKLPEQETVKEKAKGDEEAHKYRVYYITIEKIENGTYSGTTKEGTGIKFSDKNLNEPIPSNLKKGDIVKAYFDLEYSTKGLVKVEKVDEMPDDDESSS
>NZ_CP009920.1|WP_016764597.1|5157958_5158450_+|hypothetical-protein
MMFALIVVVGIVALGVASFYVIKRPQGAVDPEDRKPLVSVNGHVKFAEGINQISISKIDMYDQRLVINQVAIIPFNRIQRAEFSKVVKNEKGLHGAPVQRYFGELTIHFTDKNGQETYISCETPKKNQFHLIYQYDLMKRQLNKRLGLEDLQPYLTLQEPYEL
>NZ_CP009920.1|WP_115648261.1|5158722_5159016_-|DUF4183-domain-containing-protein
MLPQQEFRYIFPKKVRIFEYYTVAGGSKRIFTDQDALKEYGTQHILDPESYSYSNLFINGVLQPSSNYSVQKGLLIINTEDIPLEKSPVILQMIKVI
>NZ_CP009920.1|WP_080743167.1|5159138_5159393_+|DUF4183-domain-containing-protein
MPLQIMKLAIAATALPALATDNSYYNVYINGVLQMAGLSIYTPGATGVGSLAITVPAGSSVLTGSPIVLEVVNFAPDSTTDVQT
>NZ_CP009920.1|WP_034651024.1|5159533_5160766_-|aminopeptidase
MEQFERNIEKYAELAVKVGVNIQKGQILNINADISSADFVREIAKKAYEAGAKSVDVDWHDDHLVRLKYEKADESVFSEFPAWKAQAREELVKNGGAVLSVISSGPDLLKGVDGKRIAAFQKVSGKAMKKFREAIQSDKISWSIVAVPSKDWAAKVFPDVPEEQQQEKLWEAIFKSVRVDQEDPVAAWEEHNASLHTKVDILNEKRFAKLHYKAPGTDLTIELPDKHIWVGAGSVNEDGNSFMANMPTEEVFTLPKKDGVNGQVTSTKPLSYAGNLIENFTLTFENGKIVDVKAEEGEETLKHLIETDEGAKYLGEVALVPHQSPISQSNIIFYNTLFDENASNHLAIGSSYSFCLEGGKTMSKEELSQNGANDSITHVDFMIGSAEMDIDGIKADGTSEPVFRKGNWAF
>NZ_CP009920.1|WP_016764601.1|5160909_5161704_-|IclR-family-transcriptional-regulator
MERENMVKSVSRALDIVTIVSMEREGVGVTEIAKQMDINKSSVYRILTTLAQYGYIEQDQETGRYKLGYKFLEVSSKLLDSIDLRTEAKPFLQELESETNEVIHLVVYDQGEVVYIEKLEGNQTLRMHSKVGKRAPMHCTSVGKAILAFLPLNTVTSILERKGLPAHTDHTITDEESFLRELSEVKQKGYALDLEENEYGITCIAAPIFDHLGQVVAAVSISGATMRMTNERLTYFQERMVDIGKNISERLGYKTESVKDKSLF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009920_9

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009920_9

5152700-5152791

Orphan

Consensus_repeat	Method
CTTTTGCCGTTTTTGGCGTACTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP009920_9

>merge|NZ_CP009920|9|5152700-5152791|CRISPRCasFinder
CTTTTGCCGTTTTTGGCGTACTAAAAAACCTATACGCTTCACCCCTTGATATGACAGCATTCTTTGAACCTTTTGCCGTTTTTAGCGTACTA

>NZ_CP009920|9|9|5152700-5152791|CRISPRCasFinder
CTTTTGCCGTTTTTGGCGTACTA	AAAAACCTATACGCTTCACCCCTTGATATGACAGCATTCTTTGAAC
CTTTTGCCGTTTTTAGCGTACTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009920.1\|WP_080743167.1\|5159138_5159393_+\|DUF4183-domain-containing-protein	unknown	unknown	gnl\|CDD\|372730
NZ_CP009920.1\|WP_013057538.1\|5145342_5146002_-\|2OG-Fe(II)-oxygenase	unknown	unknown	gnl\|CDD\|177683
NZ_CP009920.1\|WP_013083667.1\|5150467_5151931_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_013057548.1\|5157131_5157551_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|349995
NZ_CP009920.1\|WP_013083665.1\|5147871_5148696_-\|kinase/pyrophosphorylase	unknown	unknown	gnl\|CDD\|377080
NZ_CP009920.1\|WP_016764590.1\|5146248_5147751_-\|malate:quinone-oxidoreductase	unknown	unknown	gnl\|CDD\|377591
NZ_CP009920.1\|WP_034651041.1\|5141387_5142218_-\|YitT-family-protein	unknown	unknown	gnl\|CDD\|224203
NZ_CP009920.1\|WP_016764587.1\|5143174_5143729_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP009920.1\|WP_016764601.1\|5160909_5161704_-\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
NZ_CP009920.1\|WP_034651024.1\|5159533_5160766_-\|aminopeptidase	unknown	unknown	gnl\|CDD\|376723
NZ_CP009920.1\|WP_016764594.1\|5154766_5155363_+\|mechanosensitive-ion-channel	unknown	unknown	gnl\|CDD\|366370
NZ_CP009920.1\|WP_034651031.1\|5149272_5150154_-\|Cof-type-HAD-IIB-family-hydrolase	unknown	unknown	gnl\|CDD\|369792
NZ_CP009920.1\|WP_034651028.1\|5155365_5155944_-\|HAD-IA-family-hydrolase	unknown	unknown	gnl\|CDD\|319825
NZ_CP009920.1\|WP_034651036.1\|5144097_5144922_-\|thermonuclease-family-protein	unknown	unknown	gnl\|CDD\|214615
NZ_CP009920.1\|WP_016764597.1\|5157958_5158450_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_115648261.1\|5158722_5159016_-\|DUF4183-domain-containing-protein	unknown	unknown	gnl\|CDD\|372730
NZ_CP009920.1\|WP_034651026.1\|5156072_5157059_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226728
NZ_CP009920.1\|WP_155276297.1\|5143888_5144032_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_034651039.1\|5142416_5142977_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|276809
NZ_CP009920.1\|WP_034651029.1\|5152900_5153923_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP009920.1\|WP_080743167.1\|5159138_5159393_+\|DUF4183-domain-containing-protein	gnl\|CDD\|372730	pfam13799, DUF4183, Domain of unknown function (DUF4183). This domain of unknown function contains a highly conserved ING motif.	3.92132e-12
NZ_CP009920.1\|WP_013057538.1\|5145342_5146002_-\|2OG-Fe(II)-oxygenase	gnl\|CDD\|177683	PLN00052, PLN00052, prolyl 4-hydroxylase; Provisional.	1.55318e-40
NZ_CP009920.1\|WP_034651036.1\|5144097_5144922_-\|thermonuclease-family-protein	gnl\|CDD\|214615	smart00318, SNc, Staphylococcal nuclease homologues.	4.25242e-38
NZ_CP009920.1\|WP_013057548.1\|5157131_5157551_-\|hypothetical-protein	gnl\|CDD\|349995	cd18551, ABC_6TM_LmrA_like, Six-transmembrane helical domain of the multidrug resistance ABC transporter LmrA and similar proteins. This group represents the six-transmembrane helical domain of the multidrug resistance ABC transporter LmrA from Lactococcus lactis and similar proteins. This transmembrane (TM) subunit possesses the ATP-binding cassette (ABC) exporter fold, which is characterized by 6 TM helices per subunit (domain), or a total of 12 TM helices for the complete transporter. The ABC exporters are found in both prokaryotes and eukaryotes, where they mediate the cellular secretion of toxic compounds, a various type of lipids and polypeptides. ABC transporters typically consist of two transmembrane domains (TMDs) and two nucleotide-binding domains (NBDs). The sequences and structures of the TMDs are quite varied between the different type of transporters, suggesting significant structural diversity of the translocated substrates, while NBDs are conserved among all ABC transporters. The two NBDs together bind and hydrolyze ATP, thereby providing the driving force for transport, while the TMDs participate in substrate recognition and translocation across the lipid membrane by alternating between inward- and outward-facing conformations. Moreover, some ABC genes are organized as half-transporters, which must form either homodimers or heterodimers to form a functional transporter. The ABC exporters play a role in multidrug resistance to antibiotics and anticancer agents, and mutations in these proteins have been shown to cause severe human diseases such as cystic fibrosis.	0.00168085
NZ_CP009920.1\|WP_013083665.1\|5147871_5148696_-\|kinase/pyrophosphorylase	gnl\|CDD\|377080	pfam03618, Kinase-PPPase, Kinase/pyrophosphorylase. This family of regulatory proteins has ADP-dependent kinase and inorganic phosphate-dependent pyrophosphorylase activity.	5.97841e-145
NZ_CP009920.1\|WP_016764590.1\|5146248_5147751_-\|malate:quinone-oxidoreductase	gnl\|CDD\|377591	pfam06039, Mqo, Malate:quinone oxidoreductase (Mqo). This family consists of several bacterial Malate:quinone oxidoreductase (Mqo) proteins (EC:1.1.99.16). Mqo takes part in the citric acid cycle. It oxidizes L-malate to oxaloacetate and donates electrons to ubiquinone-1 and other artificial acceptors or, via the electron transfer chain, to oxygen. NAD is not an acceptor and the natural direct acceptor for the enzyme is most likely a quinone. The enzyme is therefore called malate:quinone oxidoreductase, abbreviated to Mqo. Mqo is a peripheral membrane protein and can be released from the membrane by addition of chelators.	0
NZ_CP009920.1\|WP_034651041.1\|5141387_5142218_-\|YitT-family-protein	gnl\|CDD\|224203	COG1284, COG1284, Uncharacterized conserved protein [Function unknown].	4.03327e-71
NZ_CP009920.1\|WP_016764587.1\|5143174_5143729_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	4.70491e-12
NZ_CP009920.1\|WP_034651024.1\|5159533_5160766_-\|aminopeptidase	gnl\|CDD\|376723	pfam02073, Peptidase_M29, Thermophilic metalloprotease (M29).	0
NZ_CP009920.1\|WP_034651031.1\|5149272_5150154_-\|Cof-type-HAD-IIB-family-hydrolase	gnl\|CDD\|369792	pfam08282, Hydrolase_3, haloacid dehalogenase-like hydrolase. This family contains haloacid dehalogenase-like hydrolase enzymes.	1.02771e-57
NZ_CP009920.1\|WP_034651028.1\|5155365_5155944_-\|HAD-IA-family-hydrolase	gnl\|CDD\|319825	cd07523, HAD_YsbA-like, uncharacterized family of the haloacid dehalogenase-like superfamily, similar to the uncharacterized Lactococcus lactis YsbA. The specific function of Lactococcus lactis YsbA is unknown. Members of this family belong to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	6.09488e-43
NZ_CP009920.1\|WP_016764601.1\|5160909_5161704_-\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	1.35575e-94
NZ_CP009920.1\|WP_115648261.1\|5158722_5159016_-\|DUF4183-domain-containing-protein	gnl\|CDD\|372730	pfam13799, DUF4183, Domain of unknown function (DUF4183). This domain of unknown function contains a highly conserved ING motif.	3.13602e-20
NZ_CP009920.1\|WP_034651026.1\|5156072_5157059_-\|hypothetical-protein	gnl\|CDD\|226728	COG4278, COG4278, Uncharacterized conserved protein [Function unknown].	1.0302e-07
NZ_CP009920.1\|WP_034651039.1\|5142416_5142977_-\|hypothetical-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	0.0082524
NZ_CP009920.1\|WP_016764594.1\|5154766_5155363_+\|mechanosensitive-ion-channel	gnl\|CDD\|366370	pfam00924, MS_channel, Mechanosensitive ion channel. Two members of this protein family of M. jannaschii have been functionally characterized. Both proteins form mechanosensitive (MS) ion channels upon reconstitution into liposomes and functional examination by the patch-clamp technique. Therefore this family are likely to also be MS channel proteins.	1.31751e-24

>NZ_CP009920.1|WP_013083667.1|5150467_5151931_+|hypothetical-protein
MNEPSNFSPYLIKQISDAIDDNIKAKCIDFLYDSHSFFSNEKDFIEDYILNILQDTFVLENKLINPKEIRNPAYKRRQSNKKNWLQTLKKDIKAEKPNPIFEDIELAKKVMDKKVDTEHLKKLFGVEKPEDILKIKLKEVEAWAKSKKTNITDFPYLDSKMNYQIEKAFHTDFTFLIAEIILEKYNGNLSNWIDKRLNSWVEAPIFSNESHSLKTNMEVKTNSQEVVLYNDYKVDEEYFIRTIIPVNDNQTVLSKRNMVLDPKDSQIIQFALSQRDEMFYKEKTVTLDLADIVKEIYNSKGVKNYEAVEARIMKIARYHVEGVAKKKNSRDTKFAINFFQKAVIETDEVTGRRYATIVFSDDTHQGFLNQQFVQIYSDVIKKFKDNSLSSLLLYAFQKERLDCYLQEKSYTHFYPYQYFASKVRFRSKKIDVNLKLINESLAEFVSNQVLIQSYQQKLQGFEISFIPLQNYEIQDYFGGEHRETLEG
>NZ_CP009920.1|WP_034651031.1|5149272_5150154_-|Cof-type-HAD-IIB-family-hydrolase
MLLKPKAIFLDMDGTILNRSNKVSIQTKEIIDELRKQGIFVFIATGRAFDEIEELVPEGFQVDGFITSNGMAGYVGKESVFQHSLSLQLVETIIEKARANKVYYELFPYGTPRVTLKQDQSYVENEIREPKPDSVEINEWLSRKQAIKEEIDWKDSVEGSEFSKFYFFARTHEHIDKWKEELEELKKEIDFTTSTSSKHNVEVMVANVNKATGIQQMLKHFNLPEQDILAIGDSNNDLPMFQFASYAVAMKNAPDHIQEIVDDVTEFNCDENGVSHYLSKFLLQKSTRSNPVL
>NZ_CP009920.1|WP_013083665.1|5147871_5148696_-|kinase/pyrophosphorylase
MNKRKIVYIVSDSVGETAELMVKAVLTQFSGEDIEIQNTSYVEDEGNIDNIIAEARCNEAIIAYTIVIPPLKQYLDQKAQEEGIVAIDLMTPLMSAFSQTFNKEPNLQPRLTRKLDDNYFRRVEAVEFAVKYDDGQDFRGIKRADLVLIGVSRTSKTPLSMYLAHKSLKVANIPLVPEVTPPDELFTIPKNKCIGLVITPDKLNEIRKERLKNLGLASQANYANVDRILEELDYAEKIMKRIGCPIVNVSGKAVEETAEVILSMLKKDKMKGYV
>NZ_CP009920.1|WP_016764590.1|5146248_5147751_-|malate:quinone-oxidoreductase
MSNVYKKTDVILIGAGVMSATLGSLLKELAPEWEIKVFEKLADAGEESSNEWNNAGTGHAALCELNYTSEQADGSIDITKAVRINEQFQLSRQFWSYLVSSNLIHHPQEFIMPIPHMSFVQGEKNVSFLKKRFEALSNNPLFQGMEYSDRPEKLKEWMPLVMKGRTSTEAIAATKIDSGTDVNFGALTRMLFTHLKSKRVEINYNHSVENLTRTADGSWEVKVHDIHTGKQEYHTANFVFIGGGGGSLSLLQKTGIPESKHIGGFPVSGLFMVCNNPEVVAQHHGKVYGKAKVGAPPMSVPHLDTRYIDRKKTLLFGPFAGFSPKFLKTGSNLDLINSVKPNNILTMLAAGVKEMGLTKYLIQQVLLSDEKRMEELREFIPNAKSEDWDIVVAGQRVQVIKDTEAGGKGTLQFGTEVVSSADGSVAALLGASPGASTAVHVMLEVLEKCFPQHMKKWESKIKEMIPSYGLSLVENPALFNEIHASTSQTLDLSKKELVYR
>NZ_CP009920.1|WP_013057538.1|5145342_5146002_-|2OG-Fe(II)-oxygenase
MILTNTSLLTKEQTIFNHTGNKIKLEDREIDIVARFEEPLVLVLGNVLSNEECDELIQLSKDKMQRSKIGAAREVNSIRTSSGMFFEESENELVHQIERRLSKIMGPSIEYAEGLQVLKYLPDQEYKAHHDYFTSASKASKNNRISTLVMYLNDVEEGGETYFPKLGLSVSPTKGMAVYFEYFYSDAELNDRTLHGGAPVIKGEKWVATQWMRKQKIRS
>NZ_CP009920.1|WP_034651036.1|5144097_5144922_-|thermonuclease-family-protein
MKEIKAIICTMLAMFMLLLTGCSDEQASHSSTSSADTKQAVQVEDSSDQEEDHSPSKANREDVVGEAATVERVVDGDTLKVKMLNGKRDRVRLLLVDTPETKHPKLGVQPFGPEASAYTKKRLEGQEITLEFDVQERDQYGRLLAYVWIDNELYNEELLAKGLARVAVFPPNTKYVDEFKKIQEQARKSEKGIWSIENYAQEKGYNTDAVKNQSSSKQKDTQSAKSCEGKIKGNQNSKIYHVPTGAHYNQTMNHVIWFCTEKDAQEAGYKKAKN
>NZ_CP009920.1|WP_155276297.1|5143888_5144032_+|hypothetical-protein
MKKHRQQKDTTVSGWEVLAEILLQVPQLLIWPLRLLIRIGRSLLDGI
>NZ_CP009920.1|WP_016764587.1|5143174_5143729_-|GNAT-family-N-acetyltransferase
MKIRKARKEDASAVTELLYDMLGSIARSHTAATTNEEALLRLKAFILSEKNRYSYHHITIAEVEEKVVGLMLCYEGSMLQTLYEPVKRFVRAKLNNPAWEIDIETEHGDYYIDSLCVDEAYRGKGIGTALLNVAKQEAKKRKMFLSLNVEYNNVEAKKLYQRIGFQEHKTIFIDKKPFFYMKTA
>NZ_CP009920.1|WP_034651039.1|5142416_5142977_-|hypothetical-protein
MNIRDLPFNMSYRFNEQLREVPVNPHQMKQGIIYLKKRALEEEDECAAAKTYGHIGVYERILGELTSSERHLLLAIYLYDRHADTIGEFLNTIRLGHTYHWQEQWDKANETFQLLIEQLKADEDLHIYEDFVYQHYGKCLLDQRVVSRAHHYFQRALEIRLKKGDKELIESTNSCIRLCLNKLKHS
>NZ_CP009920.1|WP_034651041.1|5141387_5142218_-|YitT-family-protein
MSKTVKDVIFLLIGSFVFSLAVNMFVIPIGLGEGGVTGISIILYYTTHLSTGSTNFILNGILLIVGYKFLEKKTIVYTMITIIATSIFLHVTEGWGLHLHEELIGMVFAGVLLGVGIGMILRVGGTTAGSAIIARILNKFLNWKVSHALLIVDLLVVLASYFIIGIEKLLFTIVMLYITTKVIDFVIEGFDAKKAVTVISSNKNEVADQINEQLDRGVTILNGRGNYTKESKEILYVVINKQELIKLQKLIKKIDDEAFVIVHDVRDVIGKGFLSA
>NZ_CP009920.1|WP_034651029.1|5152900_5153923_+|hypothetical-protein
MIKKEFAKIGKQIIRQLSSTVEKYKDIEDHMDLDAHGNPTIKTVAEHHRLSKSQISQLIFYHFLHVDERGIICDVSEKEIAAALNCTVRTVRNNNVVLAETELISYSRSGKGINICIVPYPQYFEEHGFGFMELEYTRFEELILIENVNALRLELRKELVYDNDTIKRQFNPAENTSKISFNDYKIFTPKYTHYKGMMQKIAETQTSAFKTVVQGSTIFFVLKDGAKNGKMSKQEKKDQYAAAIRRTIEETFVKLSGHSTDSTGIIMSSFQNEDIADLVQLSFEYGIERVKSALYSLIEQAFFSHDAQVVENYGGKIRTLIRKELSKNLQDQVPAELTAS
>NZ_CP009920.1|WP_016764594.1|5154766_5155363_+|mechanosensitive-ion-channel
MKDIQWVQKTLFNTGKWIDISEVIIKIILIFIIAQIVIRFARSVINKIFDFRFKTKLLRYNERKEITLKKLCLSIVMYVVYFIVLITSLEAIGINMKALLAGISVAGFITGLGAQNLIKDILNGFFILFEDQFSVGDHVSINDTKGTVEEIGLRTTKIRGVDGEFYFFANSNITKVANYTLGEIPEVHKPEQIKTREE
>NZ_CP009920.1|WP_034651028.1|5155365_5155944_-|HAD-IA-family-hydrolase
MNILWDFDGTIFDTYPTIVKAFKELLTDQTISEDDILKQMKISSDIAIKHFDIKKSLFDKHFHVLEQKINPKDKPAFPHVEDVLSFADTNVIVTHKSRQSTLDILAFFNMEHYFTEIITKDDGYKRKPDSGAYAYLHDKYQLDLVIGDRELDLKPARELGIKTCAFQNDDIEADYHLTSYDQFFTTVVNKNS
>NZ_CP009920.1|WP_034651026.1|5156072_5157059_-|hypothetical-protein
MITAIIVGAVILLALIIKGIGKPRGFRLYKEELPDELGIHEGNGFEDIVHSLEDSLPKAYVQQVKQRMQGRNTKDDEVEWTFFEMKRYFLLNAVIKDVPMFSAKVDEVWHEMIMFTVDYGRFTDRFFDRFLHHQPNVDTTPSPQPDKRAFFDWMYAHLFDITGNSRLLWGKFFQHPLDKSTLQDFQRLSEDELLDRYFLRNGKWEKLQRALIQTLKEEINAARKRKKAGGSTYFKKTAKKGNVSNELLLQGFVFYSLYKAANFSSHMNELLLYKKTMYAGDTASYSGYSCSSPWEDNRHHHQHDGGHHHHDSGSSCSSSSCGSGCSSS
>NZ_CP009920.1|WP_013057548.1|5157131_5157551_-|hypothetical-protein
MSLSAKKILLLVLVVICLVLVVMQFINRSAEPTSEQAQETLSKLPEQETVKEKAKGDEEAHKYRVYYITIEKIENGTYSGTTKEGTGIKFSDKNLNEPIPSNLKKGDIVKAYFDLEYSTKGLVKVEKVDEMPDDDESSS
>NZ_CP009920.1|WP_016764597.1|5157958_5158450_+|hypothetical-protein
MMFALIVVVGIVALGVASFYVIKRPQGAVDPEDRKPLVSVNGHVKFAEGINQISISKIDMYDQRLVINQVAIIPFNRIQRAEFSKVVKNEKGLHGAPVQRYFGELTIHFTDKNGQETYISCETPKKNQFHLIYQYDLMKRQLNKRLGLEDLQPYLTLQEPYEL
>NZ_CP009920.1|WP_115648261.1|5158722_5159016_-|DUF4183-domain-containing-protein
MLPQQEFRYIFPKKVRIFEYYTVAGGSKRIFTDQDALKEYGTQHILDPESYSYSNLFINGVLQPSSNYSVQKGLLIINTEDIPLEKSPVILQMIKVI
>NZ_CP009920.1|WP_080743167.1|5159138_5159393_+|DUF4183-domain-containing-protein
MPLQIMKLAIAATALPALATDNSYYNVYINGVLQMAGLSIYTPGATGVGSLAITVPAGSSVLTGSPIVLEVVNFAPDSTTDVQT
>NZ_CP009920.1|WP_034651024.1|5159533_5160766_-|aminopeptidase
MEQFERNIEKYAELAVKVGVNIQKGQILNINADISSADFVREIAKKAYEAGAKSVDVDWHDDHLVRLKYEKADESVFSEFPAWKAQAREELVKNGGAVLSVISSGPDLLKGVDGKRIAAFQKVSGKAMKKFREAIQSDKISWSIVAVPSKDWAAKVFPDVPEEQQQEKLWEAIFKSVRVDQEDPVAAWEEHNASLHTKVDILNEKRFAKLHYKAPGTDLTIELPDKHIWVGAGSVNEDGNSFMANMPTEEVFTLPKKDGVNGQVTSTKPLSYAGNLIENFTLTFENGKIVDVKAEEGEETLKHLIETDEGAKYLGEVALVPHQSPISQSNIIFYNTLFDENASNHLAIGSSYSFCLEGGKTMSKEELSQNGANDSITHVDFMIGSAEMDIDGIKADGTSEPVFRKGNWAF
>NZ_CP009920.1|WP_016764601.1|5160909_5161704_-|IclR-family-transcriptional-regulator
MERENMVKSVSRALDIVTIVSMEREGVGVTEIAKQMDINKSSVYRILTTLAQYGYIEQDQETGRYKLGYKFLEVSSKLLDSIDLRTEAKPFLQELESETNEVIHLVVYDQGEVVYIEKLEGNQTLRMHSKVGKRAPMHCTSVGKAILAFLPLNTVTSILERKGLPAHTDHTITDEESFLRELSEVKQKGYALDLEENEYGITCIAAPIFDHLGQVVAAVSISGATMRMTNERLTYFQERMVDIGKNISERLGYKTESVKDKSLF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009920_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009920_6

5152020-5152167

Orphan

Consensus_repeat	Method
CTTTTGCCGTTTTTGGCGTACTA	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP009920_6

>merge|NZ_CP009920|6|5152020-5152167|CRISPRCasFinder
GTTTTGTCATTTTTAACGTACTAACCAGAAGCTTTTGCTGTTTTTGACGTACCTGTTCGCTTCTTTTGCCGTTTTTAGCGTACTAATTACTACCTTTTGCTGTTTTTGACGTACCACTCTGATTCTTTTGCCATTTTTGACGTACTAC

>NZ_CP009920|6|6|5152020-5152167|CRISPRCasFinder
GTTTTGTCATTTTTAACGTACTA	ACCAGAAGCTTTTGCTGTTTTTGACGTACCTGTTCGCTT
CTTTTGCCGTTTTTAGCGTACTA	ATTACTACCTTTTGCTGTTTTTGACGTACCACTCTGATT
CTTTTGCCATTTTTGACGTACTAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009920.1\|WP_080743167.1\|5159138_5159393_+\|DUF4183-domain-containing-protein	unknown	unknown	gnl\|CDD\|372730
NZ_CP009920.1\|WP_013057538.1\|5145342_5146002_-\|2OG-Fe(II)-oxygenase	unknown	unknown	gnl\|CDD\|177683
NZ_CP009920.1\|WP_013083667.1\|5150467_5151931_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_013057548.1\|5157131_5157551_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|349995
NZ_CP009920.1\|WP_013083665.1\|5147871_5148696_-\|kinase/pyrophosphorylase	unknown	unknown	gnl\|CDD\|377080
NZ_CP009920.1\|WP_016764590.1\|5146248_5147751_-\|malate:quinone-oxidoreductase	unknown	unknown	gnl\|CDD\|377591
NZ_CP009920.1\|WP_034651041.1\|5141387_5142218_-\|YitT-family-protein	unknown	unknown	gnl\|CDD\|224203
NZ_CP009920.1\|WP_016764587.1\|5143174_5143729_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP009920.1\|WP_016764601.1\|5160909_5161704_-\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
NZ_CP009920.1\|WP_034651024.1\|5159533_5160766_-\|aminopeptidase	unknown	unknown	gnl\|CDD\|376723
NZ_CP009920.1\|WP_016764594.1\|5154766_5155363_+\|mechanosensitive-ion-channel	unknown	unknown	gnl\|CDD\|366370
NZ_CP009920.1\|WP_034651031.1\|5149272_5150154_-\|Cof-type-HAD-IIB-family-hydrolase	unknown	unknown	gnl\|CDD\|369792
NZ_CP009920.1\|WP_034651028.1\|5155365_5155944_-\|HAD-IA-family-hydrolase	unknown	unknown	gnl\|CDD\|319825
NZ_CP009920.1\|WP_034651036.1\|5144097_5144922_-\|thermonuclease-family-protein	unknown	unknown	gnl\|CDD\|214615
NZ_CP009920.1\|WP_016764597.1\|5157958_5158450_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_115648261.1\|5158722_5159016_-\|DUF4183-domain-containing-protein	unknown	unknown	gnl\|CDD\|372730
NZ_CP009920.1\|WP_034651026.1\|5156072_5157059_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226728
NZ_CP009920.1\|WP_155276297.1\|5143888_5144032_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_034651039.1\|5142416_5142977_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|276809
NZ_CP009920.1\|WP_034651029.1\|5152900_5153923_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP009920.1\|WP_080743167.1\|5159138_5159393_+\|DUF4183-domain-containing-protein	gnl\|CDD\|372730	pfam13799, DUF4183, Domain of unknown function (DUF4183). This domain of unknown function contains a highly conserved ING motif.	3.92132e-12
NZ_CP009920.1\|WP_013057538.1\|5145342_5146002_-\|2OG-Fe(II)-oxygenase	gnl\|CDD\|177683	PLN00052, PLN00052, prolyl 4-hydroxylase; Provisional.	1.55318e-40
NZ_CP009920.1\|WP_034651036.1\|5144097_5144922_-\|thermonuclease-family-protein	gnl\|CDD\|214615	smart00318, SNc, Staphylococcal nuclease homologues.	4.25242e-38
NZ_CP009920.1\|WP_013057548.1\|5157131_5157551_-\|hypothetical-protein	gnl\|CDD\|349995	cd18551, ABC_6TM_LmrA_like, Six-transmembrane helical domain of the multidrug resistance ABC transporter LmrA and similar proteins. This group represents the six-transmembrane helical domain of the multidrug resistance ABC transporter LmrA from Lactococcus lactis and similar proteins. This transmembrane (TM) subunit possesses the ATP-binding cassette (ABC) exporter fold, which is characterized by 6 TM helices per subunit (domain), or a total of 12 TM helices for the complete transporter. The ABC exporters are found in both prokaryotes and eukaryotes, where they mediate the cellular secretion of toxic compounds, a various type of lipids and polypeptides. ABC transporters typically consist of two transmembrane domains (TMDs) and two nucleotide-binding domains (NBDs). The sequences and structures of the TMDs are quite varied between the different type of transporters, suggesting significant structural diversity of the translocated substrates, while NBDs are conserved among all ABC transporters. The two NBDs together bind and hydrolyze ATP, thereby providing the driving force for transport, while the TMDs participate in substrate recognition and translocation across the lipid membrane by alternating between inward- and outward-facing conformations. Moreover, some ABC genes are organized as half-transporters, which must form either homodimers or heterodimers to form a functional transporter. The ABC exporters play a role in multidrug resistance to antibiotics and anticancer agents, and mutations in these proteins have been shown to cause severe human diseases such as cystic fibrosis.	0.00168085
NZ_CP009920.1\|WP_013083665.1\|5147871_5148696_-\|kinase/pyrophosphorylase	gnl\|CDD\|377080	pfam03618, Kinase-PPPase, Kinase/pyrophosphorylase. This family of regulatory proteins has ADP-dependent kinase and inorganic phosphate-dependent pyrophosphorylase activity.	5.97841e-145
NZ_CP009920.1\|WP_016764590.1\|5146248_5147751_-\|malate:quinone-oxidoreductase	gnl\|CDD\|377591	pfam06039, Mqo, Malate:quinone oxidoreductase (Mqo). This family consists of several bacterial Malate:quinone oxidoreductase (Mqo) proteins (EC:1.1.99.16). Mqo takes part in the citric acid cycle. It oxidizes L-malate to oxaloacetate and donates electrons to ubiquinone-1 and other artificial acceptors or, via the electron transfer chain, to oxygen. NAD is not an acceptor and the natural direct acceptor for the enzyme is most likely a quinone. The enzyme is therefore called malate:quinone oxidoreductase, abbreviated to Mqo. Mqo is a peripheral membrane protein and can be released from the membrane by addition of chelators.	0
NZ_CP009920.1\|WP_034651041.1\|5141387_5142218_-\|YitT-family-protein	gnl\|CDD\|224203	COG1284, COG1284, Uncharacterized conserved protein [Function unknown].	4.03327e-71
NZ_CP009920.1\|WP_016764587.1\|5143174_5143729_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	4.70491e-12
NZ_CP009920.1\|WP_034651024.1\|5159533_5160766_-\|aminopeptidase	gnl\|CDD\|376723	pfam02073, Peptidase_M29, Thermophilic metalloprotease (M29).	0
NZ_CP009920.1\|WP_034651031.1\|5149272_5150154_-\|Cof-type-HAD-IIB-family-hydrolase	gnl\|CDD\|369792	pfam08282, Hydrolase_3, haloacid dehalogenase-like hydrolase. This family contains haloacid dehalogenase-like hydrolase enzymes.	1.02771e-57
NZ_CP009920.1\|WP_034651028.1\|5155365_5155944_-\|HAD-IA-family-hydrolase	gnl\|CDD\|319825	cd07523, HAD_YsbA-like, uncharacterized family of the haloacid dehalogenase-like superfamily, similar to the uncharacterized Lactococcus lactis YsbA. The specific function of Lactococcus lactis YsbA is unknown. Members of this family belong to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	6.09488e-43
NZ_CP009920.1\|WP_016764601.1\|5160909_5161704_-\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	1.35575e-94
NZ_CP009920.1\|WP_115648261.1\|5158722_5159016_-\|DUF4183-domain-containing-protein	gnl\|CDD\|372730	pfam13799, DUF4183, Domain of unknown function (DUF4183). This domain of unknown function contains a highly conserved ING motif.	3.13602e-20
NZ_CP009920.1\|WP_034651026.1\|5156072_5157059_-\|hypothetical-protein	gnl\|CDD\|226728	COG4278, COG4278, Uncharacterized conserved protein [Function unknown].	1.0302e-07
NZ_CP009920.1\|WP_034651039.1\|5142416_5142977_-\|hypothetical-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	0.0082524
NZ_CP009920.1\|WP_016764594.1\|5154766_5155363_+\|mechanosensitive-ion-channel	gnl\|CDD\|366370	pfam00924, MS_channel, Mechanosensitive ion channel. Two members of this protein family of M. jannaschii have been functionally characterized. Both proteins form mechanosensitive (MS) ion channels upon reconstitution into liposomes and functional examination by the patch-clamp technique. Therefore this family are likely to also be MS channel proteins.	1.31751e-24

>NZ_CP009920.1|WP_013083667.1|5150467_5151931_+|hypothetical-protein
MNEPSNFSPYLIKQISDAIDDNIKAKCIDFLYDSHSFFSNEKDFIEDYILNILQDTFVLENKLINPKEIRNPAYKRRQSNKKNWLQTLKKDIKAEKPNPIFEDIELAKKVMDKKVDTEHLKKLFGVEKPEDILKIKLKEVEAWAKSKKTNITDFPYLDSKMNYQIEKAFHTDFTFLIAEIILEKYNGNLSNWIDKRLNSWVEAPIFSNESHSLKTNMEVKTNSQEVVLYNDYKVDEEYFIRTIIPVNDNQTVLSKRNMVLDPKDSQIIQFALSQRDEMFYKEKTVTLDLADIVKEIYNSKGVKNYEAVEARIMKIARYHVEGVAKKKNSRDTKFAINFFQKAVIETDEVTGRRYATIVFSDDTHQGFLNQQFVQIYSDVIKKFKDNSLSSLLLYAFQKERLDCYLQEKSYTHFYPYQYFASKVRFRSKKIDVNLKLINESLAEFVSNQVLIQSYQQKLQGFEISFIPLQNYEIQDYFGGEHRETLEG
>NZ_CP009920.1|WP_034651031.1|5149272_5150154_-|Cof-type-HAD-IIB-family-hydrolase
MLLKPKAIFLDMDGTILNRSNKVSIQTKEIIDELRKQGIFVFIATGRAFDEIEELVPEGFQVDGFITSNGMAGYVGKESVFQHSLSLQLVETIIEKARANKVYYELFPYGTPRVTLKQDQSYVENEIREPKPDSVEINEWLSRKQAIKEEIDWKDSVEGSEFSKFYFFARTHEHIDKWKEELEELKKEIDFTTSTSSKHNVEVMVANVNKATGIQQMLKHFNLPEQDILAIGDSNNDLPMFQFASYAVAMKNAPDHIQEIVDDVTEFNCDENGVSHYLSKFLLQKSTRSNPVL
>NZ_CP009920.1|WP_013083665.1|5147871_5148696_-|kinase/pyrophosphorylase
MNKRKIVYIVSDSVGETAELMVKAVLTQFSGEDIEIQNTSYVEDEGNIDNIIAEARCNEAIIAYTIVIPPLKQYLDQKAQEEGIVAIDLMTPLMSAFSQTFNKEPNLQPRLTRKLDDNYFRRVEAVEFAVKYDDGQDFRGIKRADLVLIGVSRTSKTPLSMYLAHKSLKVANIPLVPEVTPPDELFTIPKNKCIGLVITPDKLNEIRKERLKNLGLASQANYANVDRILEELDYAEKIMKRIGCPIVNVSGKAVEETAEVILSMLKKDKMKGYV
>NZ_CP009920.1|WP_016764590.1|5146248_5147751_-|malate:quinone-oxidoreductase
MSNVYKKTDVILIGAGVMSATLGSLLKELAPEWEIKVFEKLADAGEESSNEWNNAGTGHAALCELNYTSEQADGSIDITKAVRINEQFQLSRQFWSYLVSSNLIHHPQEFIMPIPHMSFVQGEKNVSFLKKRFEALSNNPLFQGMEYSDRPEKLKEWMPLVMKGRTSTEAIAATKIDSGTDVNFGALTRMLFTHLKSKRVEINYNHSVENLTRTADGSWEVKVHDIHTGKQEYHTANFVFIGGGGGSLSLLQKTGIPESKHIGGFPVSGLFMVCNNPEVVAQHHGKVYGKAKVGAPPMSVPHLDTRYIDRKKTLLFGPFAGFSPKFLKTGSNLDLINSVKPNNILTMLAAGVKEMGLTKYLIQQVLLSDEKRMEELREFIPNAKSEDWDIVVAGQRVQVIKDTEAGGKGTLQFGTEVVSSADGSVAALLGASPGASTAVHVMLEVLEKCFPQHMKKWESKIKEMIPSYGLSLVENPALFNEIHASTSQTLDLSKKELVYR
>NZ_CP009920.1|WP_013057538.1|5145342_5146002_-|2OG-Fe(II)-oxygenase
MILTNTSLLTKEQTIFNHTGNKIKLEDREIDIVARFEEPLVLVLGNVLSNEECDELIQLSKDKMQRSKIGAAREVNSIRTSSGMFFEESENELVHQIERRLSKIMGPSIEYAEGLQVLKYLPDQEYKAHHDYFTSASKASKNNRISTLVMYLNDVEEGGETYFPKLGLSVSPTKGMAVYFEYFYSDAELNDRTLHGGAPVIKGEKWVATQWMRKQKIRS
>NZ_CP009920.1|WP_034651036.1|5144097_5144922_-|thermonuclease-family-protein
MKEIKAIICTMLAMFMLLLTGCSDEQASHSSTSSADTKQAVQVEDSSDQEEDHSPSKANREDVVGEAATVERVVDGDTLKVKMLNGKRDRVRLLLVDTPETKHPKLGVQPFGPEASAYTKKRLEGQEITLEFDVQERDQYGRLLAYVWIDNELYNEELLAKGLARVAVFPPNTKYVDEFKKIQEQARKSEKGIWSIENYAQEKGYNTDAVKNQSSSKQKDTQSAKSCEGKIKGNQNSKIYHVPTGAHYNQTMNHVIWFCTEKDAQEAGYKKAKN
>NZ_CP009920.1|WP_155276297.1|5143888_5144032_+|hypothetical-protein
MKKHRQQKDTTVSGWEVLAEILLQVPQLLIWPLRLLIRIGRSLLDGI
>NZ_CP009920.1|WP_016764587.1|5143174_5143729_-|GNAT-family-N-acetyltransferase
MKIRKARKEDASAVTELLYDMLGSIARSHTAATTNEEALLRLKAFILSEKNRYSYHHITIAEVEEKVVGLMLCYEGSMLQTLYEPVKRFVRAKLNNPAWEIDIETEHGDYYIDSLCVDEAYRGKGIGTALLNVAKQEAKKRKMFLSLNVEYNNVEAKKLYQRIGFQEHKTIFIDKKPFFYMKTA
>NZ_CP009920.1|WP_034651039.1|5142416_5142977_-|hypothetical-protein
MNIRDLPFNMSYRFNEQLREVPVNPHQMKQGIIYLKKRALEEEDECAAAKTYGHIGVYERILGELTSSERHLLLAIYLYDRHADTIGEFLNTIRLGHTYHWQEQWDKANETFQLLIEQLKADEDLHIYEDFVYQHYGKCLLDQRVVSRAHHYFQRALEIRLKKGDKELIESTNSCIRLCLNKLKHS
>NZ_CP009920.1|WP_034651041.1|5141387_5142218_-|YitT-family-protein
MSKTVKDVIFLLIGSFVFSLAVNMFVIPIGLGEGGVTGISIILYYTTHLSTGSTNFILNGILLIVGYKFLEKKTIVYTMITIIATSIFLHVTEGWGLHLHEELIGMVFAGVLLGVGIGMILRVGGTTAGSAIIARILNKFLNWKVSHALLIVDLLVVLASYFIIGIEKLLFTIVMLYITTKVIDFVIEGFDAKKAVTVISSNKNEVADQINEQLDRGVTILNGRGNYTKESKEILYVVINKQELIKLQKLIKKIDDEAFVIVHDVRDVIGKGFLSA
>NZ_CP009920.1|WP_034651029.1|5152900_5153923_+|hypothetical-protein
MIKKEFAKIGKQIIRQLSSTVEKYKDIEDHMDLDAHGNPTIKTVAEHHRLSKSQISQLIFYHFLHVDERGIICDVSEKEIAAALNCTVRTVRNNNVVLAETELISYSRSGKGINICIVPYPQYFEEHGFGFMELEYTRFEELILIENVNALRLELRKELVYDNDTIKRQFNPAENTSKISFNDYKIFTPKYTHYKGMMQKIAETQTSAFKTVVQGSTIFFVLKDGAKNGKMSKQEKKDQYAAAIRRTIEETFVKLSGHSTDSTGIIMSSFQNEDIADLVQLSFEYGIERVKSALYSLIEQAFFSHDAQVVENYGGKIRTLIRKELSKNLQDQVPAELTAS
>NZ_CP009920.1|WP_016764594.1|5154766_5155363_+|mechanosensitive-ion-channel
MKDIQWVQKTLFNTGKWIDISEVIIKIILIFIIAQIVIRFARSVINKIFDFRFKTKLLRYNERKEITLKKLCLSIVMYVVYFIVLITSLEAIGINMKALLAGISVAGFITGLGAQNLIKDILNGFFILFEDQFSVGDHVSINDTKGTVEEIGLRTTKIRGVDGEFYFFANSNITKVANYTLGEIPEVHKPEQIKTREE
>NZ_CP009920.1|WP_034651028.1|5155365_5155944_-|HAD-IA-family-hydrolase
MNILWDFDGTIFDTYPTIVKAFKELLTDQTISEDDILKQMKISSDIAIKHFDIKKSLFDKHFHVLEQKINPKDKPAFPHVEDVLSFADTNVIVTHKSRQSTLDILAFFNMEHYFTEIITKDDGYKRKPDSGAYAYLHDKYQLDLVIGDRELDLKPARELGIKTCAFQNDDIEADYHLTSYDQFFTTVVNKNS
>NZ_CP009920.1|WP_034651026.1|5156072_5157059_-|hypothetical-protein
MITAIIVGAVILLALIIKGIGKPRGFRLYKEELPDELGIHEGNGFEDIVHSLEDSLPKAYVQQVKQRMQGRNTKDDEVEWTFFEMKRYFLLNAVIKDVPMFSAKVDEVWHEMIMFTVDYGRFTDRFFDRFLHHQPNVDTTPSPQPDKRAFFDWMYAHLFDITGNSRLLWGKFFQHPLDKSTLQDFQRLSEDELLDRYFLRNGKWEKLQRALIQTLKEEINAARKRKKAGGSTYFKKTAKKGNVSNELLLQGFVFYSLYKAANFSSHMNELLLYKKTMYAGDTASYSGYSCSSPWEDNRHHHQHDGGHHHHDSGSSCSSSSCGSGCSSS
>NZ_CP009920.1|WP_013057548.1|5157131_5157551_-|hypothetical-protein
MSLSAKKILLLVLVVICLVLVVMQFINRSAEPTSEQAQETLSKLPEQETVKEKAKGDEEAHKYRVYYITIEKIENGTYSGTTKEGTGIKFSDKNLNEPIPSNLKKGDIVKAYFDLEYSTKGLVKVEKVDEMPDDDESSS
>NZ_CP009920.1|WP_016764597.1|5157958_5158450_+|hypothetical-protein
MMFALIVVVGIVALGVASFYVIKRPQGAVDPEDRKPLVSVNGHVKFAEGINQISISKIDMYDQRLVINQVAIIPFNRIQRAEFSKVVKNEKGLHGAPVQRYFGELTIHFTDKNGQETYISCETPKKNQFHLIYQYDLMKRQLNKRLGLEDLQPYLTLQEPYEL
>NZ_CP009920.1|WP_115648261.1|5158722_5159016_-|DUF4183-domain-containing-protein
MLPQQEFRYIFPKKVRIFEYYTVAGGSKRIFTDQDALKEYGTQHILDPESYSYSNLFINGVLQPSSNYSVQKGLLIINTEDIPLEKSPVILQMIKVI
>NZ_CP009920.1|WP_080743167.1|5159138_5159393_+|DUF4183-domain-containing-protein
MPLQIMKLAIAATALPALATDNSYYNVYINGVLQMAGLSIYTPGATGVGSLAITVPAGSSVLTGSPIVLEVVNFAPDSTTDVQT
>NZ_CP009920.1|WP_034651024.1|5159533_5160766_-|aminopeptidase
MEQFERNIEKYAELAVKVGVNIQKGQILNINADISSADFVREIAKKAYEAGAKSVDVDWHDDHLVRLKYEKADESVFSEFPAWKAQAREELVKNGGAVLSVISSGPDLLKGVDGKRIAAFQKVSGKAMKKFREAIQSDKISWSIVAVPSKDWAAKVFPDVPEEQQQEKLWEAIFKSVRVDQEDPVAAWEEHNASLHTKVDILNEKRFAKLHYKAPGTDLTIELPDKHIWVGAGSVNEDGNSFMANMPTEEVFTLPKKDGVNGQVTSTKPLSYAGNLIENFTLTFENGKIVDVKAEEGEETLKHLIETDEGAKYLGEVALVPHQSPISQSNIIFYNTLFDENASNHLAIGSSYSFCLEGGKTMSKEELSQNGANDSITHVDFMIGSAEMDIDGIKADGTSEPVFRKGNWAF
>NZ_CP009920.1|WP_016764601.1|5160909_5161704_-|IclR-family-transcriptional-regulator
MERENMVKSVSRALDIVTIVSMEREGVGVTEIAKQMDINKSSVYRILTTLAQYGYIEQDQETGRYKLGYKFLEVSSKLLDSIDLRTEAKPFLQELESETNEVIHLVVYDQGEVVYIEKLEGNQTLRMHSKVGKRAPMHCTSVGKAILAFLPLNTVTSILERKGLPAHTDHTITDEESFLRELSEVKQKGYALDLEENEYGITCIAAPIFDHLGQVVAAVSISGATMRMTNERLTYFQERMVDIGKNISERLGYKTESVKDKSLF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009920_10

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009920_10

5283640-5283933

Orphan

Consensus_repeat	Method
TCCGCCATGACNNCCGCC	CRT

6 spacers

The CRISPR arrays of NZ_CP009920_10

>merge|NZ_CP009920|10|5283640-5283933|CRT
ACCGCCATGACAACCGCCGTGACCTCCACCGTGGTTACCGCCGTGACCTCCGCCGTGGTTACCGCCGTGACCTCCGCCGTGGTTGCCGCCGTGACCTCCGCCATGACAACCGCCGTGACCTCCGCCATGACTGCCGCCGTGACCTCCGCCATGACTGCCGCCATGACTGCCGCCGTGACCTCCGCCATGACTGCCGCCATGACTGCCGCCGTGACTGCCGCCGTGACCTCCGCCATGGTTGCCACCATGATCTCCGCCATGGTTACCGTCGTGACCTCCGCTATGGTTGCCACC

>NZ_CP009920|10|1|5283640-5283933|CRT
ACCGCCATGACAACCGCC	GTGACCTCCACCGTGGTT
ACCGCCGTGACCTCCGCC	GTGGTTACCGCCGTGACCTCCGCCGTGGTTGCCGCCGTGACC
TCCGCCATGACAACCGCC	GTGACCTCCGCCATGACTGCCGCCGTGACC
TCCGCCATGACTGCCGCC	ATGACTGCCGCCGTGACC
TCCGCCATGACTGCCGCC	ATGACTGCCGCCGTGACTGCCGCCGTGACC
TCCGCCATGGTTGCCACC	ATGATCTCCGCCATGGTTACCGTCGTGACC
TCCGCTATGGTTGCCACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009920.1\|WP_162837684.1\|5277789_5277963_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_034650815.1\|5294118_5294577_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP009920.1\|WP_013057684.1\|5278056_5278338_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223393
NZ_CP009920.1\|WP_013057694.1\|5288261_5288507_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_016764703.1\|5285051_5286023_-\|PHB-depolymerase-family-esterase	unknown	unknown	gnl\|CDD\|313683
NZ_CP009920.1\|WP_155276296.1\|5286388_5286547_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_013083783.1\|5282494_5283448_-\|sporulation-protein	unknown	unknown	gnl\|CDD\|369195
NZ_CP009920.1\|WP_034650818.1\|5289935_5290793_-\|prephenate-dehydrogenase	unknown	unknown	gnl\|CDD\|235824
NZ_CP009920.1\|WP_013057680.1\|5276217_5276487_+\|membrane-protein	unknown	unknown	gnl\|CDD\|379504
NZ_CP009920.1\|WP_013083781.1\|5279005_5279557_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009920.1\|WP_013083777.1\|5275372_5275933_-\|copper-resistance-protein-CopC	unknown	unknown	gnl\|CDD\|225247
NZ_CP009920.1\|WP_013057697.1\|5290813_5291980_-\|chorismate-synthase	unknown	unknown	gnl\|CDD\|171518
NZ_CP009920.1\|WP_025751201.1\|5278530_5278983_+\|DNA-starvation/stationary-phase-protection-protein	unknown	unknown	gnl\|CDD\|153102
NZ_CP009920.1\|WP_034650831.1\|5276538_5277240_-\|poly-gamma-glutamate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|368663
NZ_CP009920.1\|WP_013057698.1\|5292235_5293309_-\|bifunctional-3-deoxy-7-phosphoheptulonate-synthase/chorismate-mutase	unknown	unknown	gnl\|CDD\|183614
NZ_CP009920.1\|WP_034650826.1\|5281139_5282465_+\|HlyC/CorC-family-transporter	unknown	unknown	gnl\|CDD\|224173
NZ_CP009920.1\|WP_034650820.1\|5288648_5289920_-\|3-phosphoshikimate-1-carboxyvinyltransferase	unknown	unknown	gnl\|CDD\|235037
NZ_CP009920.1\|WP_016764699.1\|5279765_5280398_+\|spore-coat-protein	unknown	unknown	gnl\|CDD\|227864
NZ_CP009920.1\|WP_013083785.1\|5286674_5288219_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|223737
NZ_CP009920.1\|WP_013057690.1\|5284291_5284711_-\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341404

Protein	Function_ID	Function_description	E-value
NZ_CP009920.1\|WP_034650815.1\|5294118_5294577_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.32784e-11
NZ_CP009920.1\|WP_016764699.1\|5279765_5280398_+\|spore-coat-protein	gnl\|CDD\|227864	COG5577, COG5577, Spore coat protein [Cell envelope biogenesis, outer membrane].	5.46515e-28
NZ_CP009920.1\|WP_016764703.1\|5285051_5286023_-\|PHB-depolymerase-family-esterase	gnl\|CDD\|313683	pfam10503, Esterase_phd, Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.	7.0466e-60
NZ_CP009920.1\|WP_013057698.1\|5292235_5293309_-\|bifunctional-3-deoxy-7-phosphoheptulonate-synthase/chorismate-mutase	gnl\|CDD\|183614	PRK12595, PRK12595, bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed.	0
NZ_CP009920.1\|WP_013083783.1\|5282494_5283448_-\|sporulation-protein	gnl\|CDD\|369195	pfam07070, Spo0M, SpoOM protein. This family consists of several bacterial SpoOM proteins which are thought to control sporulation in Bacillus subtilis.Spo0M exerts certain negative effects on sporulation and its gene expression is controlled by sigmaH.	6.10493e-53
NZ_CP009920.1\|WP_013057680.1\|5276217_5276487_+\|membrane-protein	gnl\|CDD\|379504	pfam14206, Cys_rich_CPCC, Cysteine-rich CPCC. This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria, archaea, eukaryotes and viruses. Proteins in this family are typically between 68 and 104 amino acids in length. There are six conserved cysteines and a conserved CPCC sequence motif.	2.7471e-32
NZ_CP009920.1\|WP_034650818.1\|5289935_5290793_-\|prephenate-dehydrogenase	gnl\|CDD\|235824	PRK06545, PRK06545, prephenate dehydrogenase; Validated.	2.46369e-105
NZ_CP009920.1\|WP_013083777.1\|5275372_5275933_-\|copper-resistance-protein-CopC	gnl\|CDD\|225247	COG2372, CopC, Uncharacterized protein, homolog of Cu resistance protein CopC [General function prediction only].	1.97192e-19
NZ_CP009920.1\|WP_013057697.1\|5290813_5291980_-\|chorismate-synthase	gnl\|CDD\|171518	PRK12463, PRK12463, chorismate synthase; Reviewed.	0
NZ_CP009920.1\|WP_025751201.1\|5278530_5278983_+\|DNA-starvation/stationary-phase-protection-protein	gnl\|CDD\|153102	cd01043, DPS, DPS protein, ferritin-like diiron-binding domain. DPS (DNA Protecting protein under Starved conditions) domain is a member of a broad superfamily of ferritin-like diiron-carboxylate proteins. Some DPS proteins nonspecifically bind DNA, protecting it from cleavage caused by reactive oxygen species such as the hydroxyl radicals produced during oxidation of Fe(II) by hydrogen peroxide. These proteins assemble into dodecameric structures, some form DPS-DNA co-crystalline complexes, and possess iron and H2O2 detoxification capabilities. Expression of DPS is induced by oxidative or nutritional stress, including metal ion starvation. Members of the DPS family are homopolymers formed by 12 four-helix bundle subunits that assemble with 23 symmetry into a hollow shell. The DPS ferroxidase site is unusual in that it is not located in a four-helix bundle as in ferritin, but is shared by 2-fold symmetry-related subunits providing the iron ligands. Many DPS sequences (e.g., E. coli) display an N-terminal extension of variable length that contains two or three positively charged lysine residues that extends into the solvent and is thought to play an important role in the stabilization of the complex with DNA. DPS Listeria Flp, Bacillus anthracis Dlp-1 and Dlp-2, and Helicobacter pylori HP-NAP which lack the N-terminal extension, do not bind DNA. DPS proteins from Helicobacter pylori, Treponema pallidum, and Borrelia burgdorferi are highly immunogenic.	1.51292e-57
NZ_CP009920.1\|WP_034650831.1\|5276538_5277240_-\|poly-gamma-glutamate-hydrolase-family-protein	gnl\|CDD\|368663	pfam05908, Gamma_PGA_hydro, Poly-gamma-glutamate hydrolase. This family consists of a number of bacterial and phage proteins that function as gamma-PGA hydrolase enzymes. Structurally the protein in this family adopted an open alpha/beta mixed core structure with a seven-stranded parallel/anti-parallel beta-sheet. This structure shows similarity to mammalian carboxypeptidase A and related enzymes.	8.85167e-88
NZ_CP009920.1\|WP_034650826.1\|5281139_5282465_+\|HlyC/CorC-family-transporter	gnl\|CDD\|224173	COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only].	2.457e-143
NZ_CP009920.1\|WP_034650820.1\|5288648_5289920_-\|3-phosphoshikimate-1-carboxyvinyltransferase	gnl\|CDD\|235037	PRK02427, PRK02427, 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional.	0
NZ_CP009920.1\|WP_013057684.1\|5278056_5278338_-\|hypothetical-protein	gnl\|CDD\|223393	COG0316, sufA, Fe-S cluster assembly scaffold protein [Posttranslational modification, protein turnover, chaperones].	0.00315288
NZ_CP009920.1\|WP_013083785.1\|5286674_5288219_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|223737	COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism].	1.38713e-47
NZ_CP009920.1\|WP_013057690.1\|5284291_5284711_-\|CBS-domain-containing-protein	gnl\|CDD\|341404	cd09834, CBS_pair_bac, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains present in bacteria. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	2.21099e-64

>NZ_CP009920.1|WP_013083783.1|5282494_5283448_-|sporulation-protein
MFKKMFAKIGVGAAKVDLRLNETAYTLGHVIEGAIVIQGGNVQQHINLIDVEFWLEVQLKSGQMHTHRVESLRAASSFTINEGEKKEIPFTYHLPLDLPISASNVSYFFKTHLDIEGGVDSTDRDPVRIKAPKSLYQLVEGFEALGFREKHHSGKFNGYKQEFSFFPTDFLKGYVNEVEFEVAIEREGIRVLLELDLPSFGREREIKNELFFTNDELSQPSTIARLLEEAMEEMMENPRDYEYYKSPHYDQHSHHPRMSGLGGAMGGFAAGMLGGLLIENLMDDMFEDSALGEIGEDIEEAGEDLLDGDFFDGGDDW
>NZ_CP009920.1|WP_034650826.1|5281139_5282465_+|HlyC/CorC-family-transporter
MIAVKLLLVAVLIALTAFFVATEFAIVKVRSSKINQLLEEGHKKAVSAKHVITHLDEYLSACQLGITITALGLGWLGEPTLDRLLHPLFTTFHTNEPLAGILSFVIAFVVITFLHVVLGELAPKTFAIQMAEQITLNFAKPIIVFYKLMYPFIKILNGSARMLTKIFGITMISENEAAHSEEELRILLSESFEGGEINQSEYRYMSKIFDLDDRLAKEVMVPRTEIVSASKDDVVEVFLQIANVEKYTRYPIVEDGDKDKVIGLVNIKEIYNDIVFNEKDGTNTLESYVKPIFKVIETVPIHDLLVKMQKERIQMAILFDEYGGTAGLVTVEDIIEEIVGEIRDEFDTDEIPYVQKIKDDHYILDGKMLISQVNDLLGTDISDEEVDTIAGWVLTEKFDVTKNDIIQHEQFYFKVLIIEDFHIKYIEVKKRKKKEKKDDHH
>NZ_CP009920.1|WP_016764699.1|5279765_5280398_+|spore-coat-protein
MNNHELPTNMQTGAVPPQLNHGGHELFDVHETLAGSINVMDQFMMFRQYVKEQELLDIIDRQYQFILNEYNLIVEAFSTGQKPADSTHVYNMKQSHTFVYGLKPSQPKKPNQSVEEINEKGISGHMLGLVKSQASLLTMTALEITNPVVRRIFGDSVPNWIEMAYEISLYQNKHHYYQVPQLAKADMQQMITSFAKATASPQMPNNHKLH
>NZ_CP009920.1|WP_013083781.1|5279005_5279557_-|hypothetical-protein
MNELLSYSSELKHEANQLVVSSHLLDLLREYGCLLSGESFELNVMTNRIINFYVGNDEMDEESIFHMGYQLTKRFSPYKMIFANEKDKYQWSVYMIQKGEEWKLDISVLPENIVKGKVEKQELLKSLFTEKKRECILFFKQQSGYNRYYTSDHVYKAVLEDDIHDDMSFFMWLQRQKKVNQQT
>NZ_CP009920.1|WP_025751201.1|5278530_5278983_+|DNA-starvation/stationary-phase-protection-protein
MNLENVLNQQIADFNVLYTKLHRFHWYVKGPQFFTLHEKFEEFYNETADYIDEYAERLLAIGGSPIATMKQFLQAATLSEDGNEQTSEEMVETLINDYTLLVKNLKNAVENAEAAHDHVTADLFIGTIGNIEKHIWMLKAALPVKTSVNA
>NZ_CP009920.1|WP_013057684.1|5278056_5278338_-|hypothetical-protein
MHITPEAKQLINNILEEQEITGIRLYFKGISCEIPNIGLAFEEPFENDEMYEVDGVQVAMEASIVPYTNELMLDVHTTPYGPGLALVGAKEAE
>NZ_CP009920.1|WP_162837684.1|5277789_5277963_-|hypothetical-protein
MLLSHHVTVEQRQQIKRFKQQIQDAKTLEERRLYQAQLNKFVERLFIENRLQRSGEQ
>NZ_CP009920.1|WP_034650831.1|5276538_5277240_-|poly-gamma-glutamate-hydrolase-family-protein
MKSYRLVSFSTLCICLLFLFISPFQDTSSASTDKYQNFKQLSQHESSASYKVTTKETKSPVLIFAPHGGGIEGGTSEIAQELGKQNALYLFESLKSKGSRDLHLTSTHFDEPTARKMVSKYDNVLSLHGYSENEKHIFVGGTDRERAKKLTQLLNQNGFPAELITKGHDEIAGINSGNIANKNRTGKSIQLEISQPLRSAMFHSFTSKGRASSKTQTFYKFTNVLSTFASTSY
>NZ_CP009920.1|WP_013057680.1|5276217_5276487_+|membrane-protein
MKKYTCPCCGYQSLDSDGDYDICEICFWEDDPYQKLNANELGANSISLIEAQENFIVYGACNKESLQHVRKPSVQDVKDFNWKPIISHE
>NZ_CP009920.1|WP_013083777.1|5275372_5275933_-|copper-resistance-protein-CopC
MKKIIGLLLACFLAVPTVSFAHTHVQTTVPENGATVTAPLKEIKLTFETHIEKISTVTVTKDGQKISLASQKVEGHDLIASLDQPLKNGSYTVDWEIVGEDGHVMKDSIAFKVDVKDEAKEENTQAAGKDSEKKQDATQSEQHQKSAVANDEKTENNDSSSFFVIMIIAIVVVVGALLLIFRKKKS
>NZ_CP009920.1|WP_013057690.1|5284291_5284711_-|CBS-domain-containing-protein
MNIAFFLVPKSDVVTLNIQSTLRQALEKMEYHRYSTVPLVDDDGKYVGVLTEGDLLWKLKSLGDYRFQDTENIKLTEIDRYQDYNPVAIYDEVQNILSKAIDQNFVPVTDDQGVFIGIVRRREILEFYAESASKVKNQI
>NZ_CP009920.1|WP_016764703.1|5285051_5286023_-|PHB-depolymerase-family-esterase
MLGSLPNVINTSTLVSSSEQQEASSESFKTYTHKGKKFKVYLPKSYHILKSYPLMVMLHGCTQNADDFAIGTQMNELADEKEFIVVYPQQSSNSNMNKCWNWFEPLHQIRGFGEPAIIAGIVKKVQNMHFIQKNKVFIAGLSAGGAMSIVMGVTYPELFAGIGVSAGIEYQAALNVFNAYSVMASKGPSPVKQGRIAYQQMGKRAKPLPLIVFHGNADSTVNVANADQVVHQWITTNNLAYNGRIDGWIQDSPVKTREEKILFGRDYTTYRYESSKGELAIDKYIINGMGHAWSGGNSAGSYTDPKGPNASRIMWDFFMSQKV
>NZ_CP009920.1|WP_155276296.1|5286388_5286547_-|hypothetical-protein
MIAISLCIIVANEEEVKPKHLLFKILLFKRGFCTYTLPFAAKEVVNKKQSIK
>NZ_CP009920.1|WP_013083785.1|5286674_5288219_+|FAD-dependent-oxidoreductase
MANIPKDTEPYWRDHLKFPTYPSLSENRKVDVVVVGGGISGITTAYLLQKEGLNVALIEADNILNGTTGHTTAKITAQHDVIYDELLSHIGEEKTLLYYKANEQALQFMKNLIQTENIDCDFSVQDAYLYGETLEFDHRVRKEFRAYQRLHIPCEFATELPFNFDIRAAAIMKDQAQFHPLKYLLHLVKKFTESGGLIFENTVATDVEESTSPTVVTRDGHRISCKYVVACSHFPFYDGAGFYYTRMYAKRSYVLAAKVEQAYPGGMYLSADQPTHSLRSTKVDGEELILIGGEGHKAGQGINTMFHYESLQRFAEENFTVQHFRYKWSAQDLFTLDKIPYIGPIKESKPNIFIATGFKKWGMTHSTIAAHIIRDAITGKDNPYAELYNPSRFYADPSLKHFFRQNLDVAEHFITGKFSMPEKGLDQLQNDEGSVVYVNSKRTGAYKDPQGKLHCVDTTCTHLGCEVNWNAGDRTWDCPCHGSRFSYDGSVVEGPAKKPLTPVDVDSSDKKSTP
>NZ_CP009920.1|WP_013057694.1|5288261_5288507_-|hypothetical-protein
MFLMIVYIGAILFFIKMFMDRDFIWFLFLLPFLMFVMFFETDYLDHVPESGRLIIFTFSFLVIYAMVLVYNRYFRKEGCKE
>NZ_CP009920.1|WP_034650820.1|5288648_5289920_-|3-phosphoshikimate-1-carboxyvinyltransferase
MTVKALRGTIQIPGDKSISHRSVMFGSIAEGTTTINGFLPGDDCLSTISCFQKLGVDIQMIDEQSVVVKGKGIQALKEPSDILDVGNSGTTIRLMMGILANTPFHSTLIGDESIAKRPMKRVTGPLRDMNIHLDGRKDANFTPLVIRGGKAKGIHYTSPVASAQVKSAILLAGLQAEGTTSVTEPAKSRDHTERMLEAFGVKVEEEGLTVSIEGGQTLRGTHVEVPGDISSAAFFLVAGAIVANSRIEIQKVGMNPTRTGILDVLSNMGASIETVKETKETAEPYADLVVEASHLKGTEVGGDLIPRLIDEIPIIALAATQAEGITIIKDAAELKVKETNRIDTVVNELTKMGANIEATEDGMIIHGGAKLHGANVNSHGDHRIGMMLAVASCIAEGETIIENRDAVSVSYPQFFAHLESLQQ
>NZ_CP009920.1|WP_034650818.1|5289935_5290793_-|prephenate-dehydrogenase
MKTRVLLIGVGLIGGSLALAMKKHRHVTVVGADINTNEVQVANQLGIVDYVAEDIKTEAAQADYIVLATPVEYTTAWIHDLSTWKLKETVIVTDVGSTKGEIMKAAEALNKKRISFIGGHPMAGSHTSGAVNARADLFCSARYILTPFENEQKEKIDALMHLLEPTGAQFVLLDAATHDQITGVVSHLPHVIATSLVRQVKGYSAQNHLVTEMAAGGFRDITRIASSNPHMWRDILKQNRSMLLTLLDDWMKEMEQVKLLVEKGDGHELFDYFSDAKEFRDSLHA
>NZ_CP009920.1|WP_013057697.1|5290813_5291980_-|chorismate-synthase
MRYLTAGESHGPQLTAIIEGVPAGLELTAEHINEDLARRQKGHGRGRRMQIEKDQVQIKGGVRHGETLGSPIALVVENKDFTHWRNIMGADPVDHDEEVKRQITKPRPGHADLNGAIKYGHRDMRNVLERSSARETTVRVATGAVAKQVLKAVGVNIACHVLEIGGVKAEKTAYESLTELQEKTEASPVRCLDEEAGQKMMKAIDDAKENGDSIGGVVEVVVEGMPTAVGSYVHYDRKLDSKLAAAIMSINAFKGVEIGVGFEAARRPGSEVHDEILWDEQNGYTRKTNNAGGLEGGMTTGMPIVVRGVMKPIPTLYKPLQSVDIDTKEPFAASIERSDSCAVPAAAVVAESVIAWELASAIIDQFGADRIQLIQENVKKHEEYAKQF
>NZ_CP009920.1|WP_013057698.1|5292235_5293309_-|bifunctional-3-deoxy-7-phosphoheptulonate-synthase/chorismate-mutase
MTKSLEQLRGQIDEINLEILELLNKRGEIAQEIGKVKGTQGVNRFDPVRERKSLDQILANHNGPFEASTIQHIFKEIFKASLELQEDDHRKALLVSRKKKSEDTIVDINGTKVGPGNLEFVMGPCAVESYEQVKEVGLALKEQGITLMRGGAFKPRTSPYDFQGLGVEGLKILRQVGDELGLSIISEIVSPQDIETALDYVDVIQIGARNMQNFELLKAAGSVDKPILLKRGLAATIEEFINAAEYIMSRGNGNIILCERGIRTYERATRNTLDISAVPILKKETHLPVVVDVTHSTGRKDLLLPCAKAAIAIGADAVMAEVHPDPAVALSDSAQQMNIPEFHKFMEELKGAAVKLS
>NZ_CP009920.1|WP_034650815.1|5294118_5294577_-|GNAT-family-N-acetyltransferase
MVEKAVLENVQDLVNLRILLMKELGELNGNEELFRKATEEYFTTNINNPHSYTAILKANGEIVSAGSIVFFIRPPSPSNLQGKEAYVMNMYTAFDHRKHGYSSAVLKHLMQYCQKNGVNRIWLNASSAGKSLYQKHGFIEYESEMEYKFEKN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP009920_2	2.1\|2523134\|51\|NZ_CP009920\|CRISPRCasFinder	2523134-2523184	51	NZ_CP009920.1	2523239-2523289	0	1.0

1. spacer 2.1|2523134|51|NZ_CP009920|CRISPRCasFinder matches to position: 2523239-2523289, mismatch: 0, identity: 1.0

tctaaaaacaatttcggtactgaatttggtagcgaaacaaatgtacaagaa	CRISPR spacer
tctaaaaacaatttcggtactgaatttggtagcgaaacaaatgtacaagaa	Protospacer
***************************************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP009920_10	10.3\|5283754\|30\|NZ_CP009920\|CRT	5283754-5283783	30	NZ_CP007797	Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence	387816-387845	5	0.833
NZ_CP009920_10	10.3\|5283754\|30\|NZ_CP009920\|CRT	5283754-5283783	30	NC_011143	Phenylobacterium zucineum HLK1 plasmid, complete sequence	315397-315426	6	0.8
NZ_CP009920_10	10.5\|5283838\|30\|NZ_CP009920\|CRT	5283838-5283867	30	NZ_CP012477	Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence	200835-200864	6	0.8
NZ_CP009920_10	10.3\|5283754\|30\|NZ_CP009920\|CRT	5283754-5283783	30	NZ_CP025912	Escherichia coli strain 204446 plasmid p204446_92, complete sequence	61383-61412	7	0.767
NZ_CP009920_10	10.3\|5283754\|30\|NZ_CP009920\|CRT	5283754-5283783	30	NZ_CP023348	Escherichia coli strain ETEC-2265 plasmid unnamed2, complete sequence	28337-28366	7	0.767
NZ_CP009920_10	10.3\|5283754\|30\|NZ_CP009920\|CRT	5283754-5283783	30	NZ_KT754161	Shigella dysenteriae 1 strain CAR10 plasmid pCAR10, complete sequence	41389-41418	7	0.767
NZ_CP009920_10	10.3\|5283754\|30\|NZ_CP009920\|CRT	5283754-5283783	30	NZ_CP038299	Escherichia coli O157:H7 strain TB182A plasmid pTB182A-5, complete sequence	65212-65241	7	0.767
NZ_CP009920_10	10.3\|5283754\|30\|NZ_CP009920\|CRT	5283754-5283783	30	NC_022333	Escherichia coli plasmid pCss165Kan DNA, complete genome, strain: 4266 delta cssB::Km	25789-25818	7	0.767
NZ_CP009920_10	10.3\|5283754\|30\|NZ_CP009920\|CRT	5283754-5283783	30	NZ_CP024259	Escherichia coli O25:H16 strain F5505-C1 plasmid unnamed2, complete sequence	51770-51799	7	0.767
NZ_CP009920_10	10.3\|5283754\|30\|NZ_CP009920\|CRT	5283754-5283783	30	NZ_CP024255	Escherichia coli strain ATCC 43886 plasmid unnamed2, complete sequence	60254-60283	7	0.767
NZ_CP009920_10	10.3\|5283754\|30\|NZ_CP009920\|CRT	5283754-5283783	30	CP025909	Escherichia coli strain 204576 plasmid p204576_83, complete sequence	9257-9286	7	0.767
NZ_CP009920_10	10.3\|5283754\|30\|NZ_CP009920\|CRT	5283754-5283783	30	NZ_CP030780	Escherichia albertii strain 05-3106 plasmid unnamed2, complete sequence	40489-40518	7	0.767
NZ_CP009920_10	10.3\|5283754\|30\|NZ_CP009920\|CRT	5283754-5283783	30	NZ_CP024250	Escherichia coli O182:H21 strain D181 plasmid unnamed2, complete sequence	64137-64166	7	0.767
NZ_CP009920_10	10.3\|5283754\|30\|NZ_CP009920\|CRT	5283754-5283783	30	NZ_CP020338	Shigella flexneri 4c strain 1602 plasmid unnamed2, complete sequence	89980-90009	7	0.767
NZ_CP009920_10	10.3\|5283754\|30\|NZ_CP009920\|CRT	5283754-5283783	30	NZ_LT985275	Escherichia coli strain R71 plasmid RCS70_p, complete sequence	51050-51079	7	0.767
NZ_CP009920_10	10.3\|5283754\|30\|NZ_CP009920\|CRT	5283754-5283783	30	NZ_CP025922	Escherichia coli strain 103605 plasmid p103605_83, complete sequence	24267-24296	7	0.767
NZ_CP009920_10	10.3\|5283754\|30\|NZ_CP009920\|CRT	5283754-5283783	30	NZ_CP024224	Escherichia coli O169:H41 strain 2014EL-1345-2 plasmid unnamed1	7507-7536	7	0.767
NZ_CP009920_10	10.3\|5283754\|30\|NZ_CP009920\|CRT	5283754-5283783	30	CP042948	Escherichia coli strain 90-9133 plasmid p90-9133_1, complete sequence	42828-42857	7	0.767
NZ_CP009920_10	10.3\|5283754\|30\|NZ_CP009920\|CRT	5283754-5283783	30	NZ_CP024244	Escherichia coli O128:H27 strain 90-9281 plasmid unnamed, complete sequence	42195-42224	7	0.767
NZ_CP009920_10	10.3\|5283754\|30\|NZ_CP009920\|CRT	5283754-5283783	30	MH450052	Escherichia coli plasmid pHN32wt, complete sequence	78265-78294	7	0.767
NZ_CP009920_10	10.3\|5283754\|30\|NZ_CP009920\|CRT	5283754-5283783	30	MH450053	Escherichia coli plasmid pHN32_1, complete sequence	74187-74216	7	0.767
NZ_CP009920_10	10.3\|5283754\|30\|NZ_CP009920\|CRT	5283754-5283783	30	NZ_CP024977	Escherichia coli strain CV839-15 plasmid pCV839-15-p3, complete sequence	40559-40588	7	0.767
NZ_CP009920_10	10.3\|5283754\|30\|NZ_CP009920\|CRT	5283754-5283783	30	NZ_CP050381	Klebsiella pneumoniae strain 51015 plasmid p51015_OXA_244, complete sequence	53728-53757	7	0.767
NZ_CP009920_10	10.3\|5283754\|30\|NZ_CP009920\|CRT	5283754-5283783	30	CP025898	Escherichia coli strain 500465 plasmid p500465_79, complete sequence	55843-55872	7	0.767
NZ_CP009920_10	10.3\|5283754\|30\|NZ_CP009920\|CRT	5283754-5283783	30	NZ_CP025918	Escherichia coli strain 120899 plasmid p120899_76, complete sequence	50281-50310	7	0.767
NZ_CP009920_10	10.3\|5283754\|30\|NZ_CP009920\|CRT	5283754-5283783	30	NZ_LN832560	Paracoccus aminovorans isolate JCM7685 plasmid II, complete sequence	16002-16031	7	0.767
NZ_CP009920_10	10.3\|5283754\|30\|NZ_CP009920\|CRT	5283754-5283783	30	NC_010510	Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence	384535-384564	7	0.767
NZ_CP009920_10	10.5\|5283838\|30\|NZ_CP009920\|CRT	5283838-5283867	30	NZ_CP020371	Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs417, complete sequence	118605-118634	7	0.767
NZ_CP009920_10	10.5\|5283838\|30\|NZ_CP009920\|CRT	5283838-5283867	30	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	925660-925689	7	0.767
NZ_CP009920_10	10.5\|5283838\|30\|NZ_CP009920\|CRT	5283838-5283867	30	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	1206718-1206747	7	0.767
NZ_CP009920_10	10.5\|5283838\|30\|NZ_CP009920\|CRT	5283838-5283867	30	NZ_LR134465	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence	74640-74669	7	0.767
NZ_CP009920_10	10.5\|5283838\|30\|NZ_CP009920\|CRT	5283838-5283867	30	NZ_CP022193	Yangia pacifica strain YSBP01 plasmid unnamed3, complete sequence	48379-48408	7	0.767
NZ_CP009920_10	10.5\|5283838\|30\|NZ_CP009920\|CRT	5283838-5283867	30	NC_024970	Streptomyces aureofaciens strain CCM3239 plasmid pSA3239, complete sequence	155228-155257	7	0.767
NZ_CP009920_10	10.5\|5283838\|30\|NZ_CP009920\|CRT	5283838-5283867	30	NZ_KJ396772	Streptomyces lavendulae subsp. lavendulae strain CCM3239 plasmid pSA3239, complete sequence	155228-155257	7	0.767
NZ_CP009920_10	10.5\|5283838\|30\|NZ_CP009920\|CRT	5283838-5283867	30	NZ_CP024986	Streptomyces lavendulae subsp. lavendulae strain CCM 3239 plasmid pSA3239, complete sequence	85820-85849	7	0.767
NZ_CP009920_10	10.6\|5283886\|30\|NZ_CP009920\|CRT	5283886-5283915	30	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	872061-872090	7	0.767
NZ_CP009920_10	10.6\|5283886\|30\|NZ_CP009920\|CRT	5283886-5283915	30	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	857236-857265	7	0.767
NZ_CP009920_10	10.6\|5283886\|30\|NZ_CP009920\|CRT	5283886-5283915	30	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	453670-453699	7	0.767
NZ_CP009920_10	10.6\|5283886\|30\|NZ_CP009920\|CRT	5283886-5283915	30	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	866637-866666	7	0.767
NZ_CP009920_10	10.6\|5283886\|30\|NZ_CP009920\|CRT	5283886-5283915	30	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	854609-854638	7	0.767
NZ_CP009920_10	10.6\|5283886\|30\|NZ_CP009920\|CRT	5283886-5283915	30	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	1524235-1524264	7	0.767
NZ_CP009920_10	10.6\|5283886\|30\|NZ_CP009920\|CRT	5283886-5283915	30	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	1210366-1210395	7	0.767
NZ_CP009920_10	10.6\|5283886\|30\|NZ_CP009920\|CRT	5283886-5283915	30	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	1117889-1117918	7	0.767
NZ_CP009920_10	10.6\|5283886\|30\|NZ_CP009920\|CRT	5283886-5283915	30	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	779744-779773	7	0.767
NZ_CP009920_10	10.6\|5283886\|30\|NZ_CP009920\|CRT	5283886-5283915	30	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	1643584-1643613	7	0.767
NZ_CP009920_10	10.6\|5283886\|30\|NZ_CP009920\|CRT	5283886-5283915	30	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	1017368-1017397	7	0.767
NZ_CP009920_10	10.6\|5283886\|30\|NZ_CP009920\|CRT	5283886-5283915	30	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	878304-878333	7	0.767
NZ_CP009920_10	10.6\|5283886\|30\|NZ_CP009920\|CRT	5283886-5283915	30	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	865954-865983	7	0.767
NZ_CP009920_10	10.6\|5283886\|30\|NZ_CP009920\|CRT	5283886-5283915	30	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	834402-834431	7	0.767
NZ_CP009920_10	10.6\|5283886\|30\|NZ_CP009920\|CRT	5283886-5283915	30	NZ_CP025613	Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence	601239-601268	7	0.767
NZ_CP009920_10	10.6\|5283886\|30\|NZ_CP009920\|CRT	5283886-5283915	30	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	932174-932203	7	0.767
NZ_CP009920_10	10.6\|5283886\|30\|NZ_CP009920\|CRT	5283886-5283915	30	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	436323-436352	7	0.767
NZ_CP009920_10	10.6\|5283886\|30\|NZ_CP009920\|CRT	5283886-5283915	30	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	552932-552961	7	0.767
NZ_CP009920_10	10.6\|5283886\|30\|NZ_CP009920\|CRT	5283886-5283915	30	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	68548-68577	7	0.767
NZ_CP009920_10	10.6\|5283886\|30\|NZ_CP009920\|CRT	5283886-5283915	30	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	152317-152346	7	0.767
NZ_CP009920_10	10.6\|5283886\|30\|NZ_CP009920\|CRT	5283886-5283915	30	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	1005718-1005747	7	0.767
NZ_CP009920_10	10.6\|5283886\|30\|NZ_CP009920\|CRT	5283886-5283915	30	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	780357-780386	7	0.767
NZ_CP009920_10	10.6\|5283886\|30\|NZ_CP009920\|CRT	5283886-5283915	30	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	865957-865986	7	0.767
NZ_CP009920_10	10.3\|5283754\|30\|NZ_CP009920\|CRT	5283754-5283783	30	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	566547-566576	8	0.733
NZ_CP009920_10	10.5\|5283838\|30\|NZ_CP009920\|CRT	5283838-5283867	30	NZ_CP042263	Litoreibacter sp. LN3S51 plasmid unnamed2, complete sequence	368314-368343	8	0.733
NZ_CP009920_10	10.5\|5283838\|30\|NZ_CP009920\|CRT	5283838-5283867	30	NZ_CP049244	Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence	1242093-1242122	8	0.733
NZ_CP009920_10	10.5\|5283838\|30\|NZ_CP009920\|CRT	5283838-5283867	30	NZ_CP021405	Celeribacter manganoxidans strain DY25 plasmid pDY25-A, complete sequence	66877-66906	8	0.733
NZ_CP009920_10	10.5\|5283838\|30\|NZ_CP009920\|CRT	5283838-5283867	30	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1656698-1656727	8	0.733
NZ_CP009920_10	10.5\|5283838\|30\|NZ_CP009920\|CRT	5283838-5283867	30	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	115560-115589	8	0.733
NZ_CP009920_10	10.5\|5283838\|30\|NZ_CP009920\|CRT	5283838-5283867	30	NZ_CP038146	Streptomyces sp. S501 plasmid unnamed, complete sequence	158945-158974	8	0.733
NZ_CP009920_10	10.6\|5283886\|30\|NZ_CP009920\|CRT	5283886-5283915	30	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	1026715-1026744	8	0.733
NZ_CP009920_10	10.3\|5283754\|30\|NZ_CP009920\|CRT	5283754-5283783	30	NZ_CP020371	Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs417, complete sequence	118605-118634	9	0.7
NZ_CP009920_10	10.5\|5283838\|30\|NZ_CP009920\|CRT	5283838-5283867	30	NZ_CP024308	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3a, complete sequence	256539-256568	9	0.7
NZ_CP009920_10	10.5\|5283838\|30\|NZ_CP009920\|CRT	5283838-5283867	30	NZ_CP013052	Sinorhizobium americanum CCGM7 plasmid A, complete sequence	181929-181958	9	0.7
NZ_CP009920_10	10.5\|5283838\|30\|NZ_CP009920\|CRT	5283838-5283867	30	MT771344	Microbacterium phage Zhengyi, complete genome	44731-44760	9	0.7

1. spacer 10.3|5283754|30|NZ_CP009920|CRT matches to NZ_CP007797 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence) position: , mismatch: 5, identity: 0.833

gtgacctccgccatgactgccgccgtgacc	CRISPR spacer
atgaccgccgccatgaccgccgccgtgatt	Protospacer
.***** **********.**********..

2. spacer 10.3|5283754|30|NZ_CP009920|CRT matches to NC_011143 (Phenylobacterium zucineum HLK1 plasmid, complete sequence) position: , mismatch: 6, identity: 0.8

gtgacctccgccatgactgccgccgtgacc	CRISPR spacer
gtagccgccgccatgaccgccgccgtggct	Protospacer
**..** **********.*********.*.

3. spacer 10.5|5283838|30|NZ_CP009920|CRT matches to NZ_CP012477 (Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

atgactgccgccgtgactgccgccgtgacc	CRISPR spacer
ctgaccgccgccgcgactgccgccgaggca	Protospacer
 ****.*******.*********** *.*

4. spacer 10.3|5283754|30|NZ_CP009920|CRT matches to NZ_CP025912 (Escherichia coli strain 204446 plasmid p204446_92, complete sequence) position: , mismatch: 7, identity: 0.767

gtgacctccgccatgactgccgccgtgacc	CRISPR spacer
gcaacctccgtcatgaccgccgccgtgcgt	Protospacer
*..*******.******.*********  .

5. spacer 10.3|5283754|30|NZ_CP009920|CRT matches to NZ_CP023348 (Escherichia coli strain ETEC-2265 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gtgacctccgccatgactgccgccgtgacc	CRISPR spacer
gcaacctccgtcatgaccgccgccgtgcgt	Protospacer
*..*******.******.*********  .

6. spacer 10.3|5283754|30|NZ_CP009920|CRT matches to NZ_KT754161 (Shigella dysenteriae 1 strain CAR10 plasmid pCAR10, complete sequence) position: , mismatch: 7, identity: 0.767

gtgacctccgccatgactgccgccgtgacc	CRISPR spacer
gcaacctccgtcatgaccgccgccgtgcgt	Protospacer
*..*******.******.*********  .

7. spacer 10.3|5283754|30|NZ_CP009920|CRT matches to NZ_CP038299 (Escherichia coli O157:H7 strain TB182A plasmid pTB182A-5, complete sequence) position: , mismatch: 7, identity: 0.767

gtgacctccgccatgactgccgccgtgacc	CRISPR spacer
gcaacctccgtcatgaccgccgccgtgcgt	Protospacer
*..*******.******.*********  .

8. spacer 10.3|5283754|30|NZ_CP009920|CRT matches to NC_022333 (Escherichia coli plasmid pCss165Kan DNA, complete genome, strain: 4266 delta cssB::Km) position: , mismatch: 7, identity: 0.767

gtgacctccgccatgactgccgccgtgacc	CRISPR spacer
gcaacctccgtcatgaccgccgccgtgcgt	Protospacer
*..*******.******.*********  .

9. spacer 10.3|5283754|30|NZ_CP009920|CRT matches to NZ_CP024259 (Escherichia coli O25:H16 strain F5505-C1 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gtgacctccgccatgactgccgccgtgacc	CRISPR spacer
gcaacctccgccattactgccgctgtgcgt	Protospacer
*..*********** ********.***  .

10. spacer 10.3|5283754|30|NZ_CP009920|CRT matches to NZ_CP024255 (Escherichia coli strain ATCC 43886 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gtgacctccgccatgactgccgccgtgacc	CRISPR spacer
gcaacctccgccattactgccgctgtgcgt	Protospacer
*..*********** ********.***  .

11. spacer 10.3|5283754|30|NZ_CP009920|CRT matches to CP025909 (Escherichia coli strain 204576 plasmid p204576_83, complete sequence) position: , mismatch: 7, identity: 0.767

gtgacctccgccatgactgccgccgtgacc	CRISPR spacer
gcaacctccgtcatgaccgccgccgtgcgt	Protospacer
*..*******.******.*********  .

12. spacer 10.3|5283754|30|NZ_CP009920|CRT matches to NZ_CP030780 (Escherichia albertii strain 05-3106 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gtgacctccgccatgactgccgccgtgacc	CRISPR spacer
gcaacctccgtcatgaccgccgccgtgcgt	Protospacer
*..*******.******.*********  .

13. spacer 10.3|5283754|30|NZ_CP009920|CRT matches to NZ_CP024250 (Escherichia coli O182:H21 strain D181 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gtgacctccgccatgactgccgccgtgacc	CRISPR spacer
gcaacctccgtcatgaccgccgccgtgcgt	Protospacer
*..*******.******.*********  .

14. spacer 10.3|5283754|30|NZ_CP009920|CRT matches to NZ_CP020338 (Shigella flexneri 4c strain 1602 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gtgacctccgccatgactgccgccgtgacc	CRISPR spacer
gcaacctccgtcatgaccgccgccgtgcgt	Protospacer
*..*******.******.*********  .

15. spacer 10.3|5283754|30|NZ_CP009920|CRT matches to NZ_LT985275 (Escherichia coli strain R71 plasmid RCS70_p, complete sequence) position: , mismatch: 7, identity: 0.767

gtgacctccgccatgactgccgccgtgacc	CRISPR spacer
gcaacctccgtcatgaccgccgccgtgcgt	Protospacer
*..*******.******.*********  .

16. spacer 10.3|5283754|30|NZ_CP009920|CRT matches to NZ_CP025922 (Escherichia coli strain 103605 plasmid p103605_83, complete sequence) position: , mismatch: 7, identity: 0.767

gtgacctccgccatgactgccgccgtgacc	CRISPR spacer
gcaacctccgtcatgaccgccgccgtgcgt	Protospacer
*..*******.******.*********  .

17. spacer 10.3|5283754|30|NZ_CP009920|CRT matches to NZ_CP024224 (Escherichia coli O169:H41 strain 2014EL-1345-2 plasmid unnamed1) position: , mismatch: 7, identity: 0.767

gtgacctccgccatgactgccgccgtgacc	CRISPR spacer
gcaacctccgtcatgaccgccgccgtgcgt	Protospacer
*..*******.******.*********  .

18. spacer 10.3|5283754|30|NZ_CP009920|CRT matches to CP042948 (Escherichia coli strain 90-9133 plasmid p90-9133_1, complete sequence) position: , mismatch: 7, identity: 0.767

gtgacctccgccatgactgccgccgtgacc	CRISPR spacer
gcaacctccgtcatgaccgccgccgtgcgt	Protospacer
*..*******.******.*********  .

19. spacer 10.3|5283754|30|NZ_CP009920|CRT matches to NZ_CP024244 (Escherichia coli O128:H27 strain 90-9281 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

gtgacctccgccatgactgccgccgtgacc	CRISPR spacer
gcaacctccgtcatgaccgccgccgtgcgt	Protospacer
*..*******.******.*********  .

20. spacer 10.3|5283754|30|NZ_CP009920|CRT matches to MH450052 (Escherichia coli plasmid pHN32wt, complete sequence) position: , mismatch: 7, identity: 0.767

gtgacctccgccatgactgccgccgtgacc	CRISPR spacer
gcaacctccgtcatgaccgccgccgtgcgt	Protospacer
*..*******.******.*********  .

21. spacer 10.3|5283754|30|NZ_CP009920|CRT matches to MH450053 (Escherichia coli plasmid pHN32_1, complete sequence) position: , mismatch: 7, identity: 0.767

gtgacctccgccatgactgccgccgtgacc	CRISPR spacer
gcaacctccgtcatgaccgccgccgtgcgt	Protospacer
*..*******.******.*********  .

22. spacer 10.3|5283754|30|NZ_CP009920|CRT matches to NZ_CP024977 (Escherichia coli strain CV839-15 plasmid pCV839-15-p3, complete sequence) position: , mismatch: 7, identity: 0.767

gtgacctccgccatgactgccgccgtgacc	CRISPR spacer
gcaacctccgtcatgaccgccgccgtgcgt	Protospacer
*..*******.******.*********  .

23. spacer 10.3|5283754|30|NZ_CP009920|CRT matches to NZ_CP050381 (Klebsiella pneumoniae strain 51015 plasmid p51015_OXA_244, complete sequence) position: , mismatch: 7, identity: 0.767

gtgacctccgccatgactgccgccgtgacc	CRISPR spacer
gcaacctccgtcatgaccgccgccgtgcgt	Protospacer
*..*******.******.*********  .

24. spacer 10.3|5283754|30|NZ_CP009920|CRT matches to CP025898 (Escherichia coli strain 500465 plasmid p500465_79, complete sequence) position: , mismatch: 7, identity: 0.767

gtgacctccgccatgactgccgccgtgacc	CRISPR spacer
gcaacctccgtcatgaccgccgccgtgcgt	Protospacer
*..*******.******.*********  .

25. spacer 10.3|5283754|30|NZ_CP009920|CRT matches to NZ_CP025918 (Escherichia coli strain 120899 plasmid p120899_76, complete sequence) position: , mismatch: 7, identity: 0.767

gtgacctccgccatgactgccgccgtgacc	CRISPR spacer
gcaacctccgtcatgaccgccgccgtgcgt	Protospacer
*..*******.******.*********  .

26. spacer 10.3|5283754|30|NZ_CP009920|CRT matches to NZ_LN832560 (Paracoccus aminovorans isolate JCM7685 plasmid II, complete sequence) position: , mismatch: 7, identity: 0.767

gtgacctccgccatgactgccgccgtgacc	CRISPR spacer
ccaagcgccgccatgaccgccgccgtgccc	Protospacer
 ..* * **********.********* **

27. spacer 10.3|5283754|30|NZ_CP009920|CRT matches to NC_010510 (Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence) position: , mismatch: 7, identity: 0.767

gtgacctccgccatgactgccgccgtgacc	CRISPR spacer
gagctgttcgccatgactgccgccctgacg	Protospacer
* * . *.**************** ****

28. spacer 10.5|5283838|30|NZ_CP009920|CRT matches to NZ_CP020371 (Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs417, complete sequence) position: , mismatch: 7, identity: 0.767

atgactgccgccgtgactgccgccgtgacc	CRISPR spacer
accgagcccgccgtgactgccgccgtggcc	Protospacer
*. .   ********************.**

29. spacer 10.5|5283838|30|NZ_CP009920|CRT matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.767

atgactgccgccgtgactgccgccgtgacc	CRISPR spacer
cccgctgccgccgtgtctgccgccgtgcct	Protospacer
 . .*********** *********** *.

30. spacer 10.5|5283838|30|NZ_CP009920|CRT matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 7, identity: 0.767

atgactgccgccgtgactgccgccgtgacc	CRISPR spacer
cccgctgccgccgtgtctgccgccgtgcct	Protospacer
 . .*********** *********** *.

31. spacer 10.5|5283838|30|NZ_CP009920|CRT matches to NZ_LR134465 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence) position: , mismatch: 7, identity: 0.767

atgactgccgccgtgactgccgccgtgacc	CRISPR spacer
agcggagccgccgcgaccgccgccgtgacc	Protospacer
*  .  *******.***.************

32. spacer 10.5|5283838|30|NZ_CP009920|CRT matches to NZ_CP022193 (Yangia pacifica strain YSBP01 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.767

atgactgccgccgtgactgccgccgtgacc	CRISPR spacer
ctgtccgccgccgtgactgccgccgcaaag	Protospacer
 ** *.*******************..*

33. spacer 10.5|5283838|30|NZ_CP009920|CRT matches to NC_024970 (Streptomyces aureofaciens strain CCM3239 plasmid pSA3239, complete sequence) position: , mismatch: 7, identity: 0.767

atgactgccgccgtgactgccgccgtgacc	CRISPR spacer
cggaagcccgccgtgaccgccgccgggacc	Protospacer
  **   **********.******* ****

34. spacer 10.5|5283838|30|NZ_CP009920|CRT matches to NZ_KJ396772 (Streptomyces lavendulae subsp. lavendulae strain CCM3239 plasmid pSA3239, complete sequence) position: , mismatch: 7, identity: 0.767

atgactgccgccgtgactgccgccgtgacc	CRISPR spacer
cggaagcccgccgtgaccgccgccgggacc	Protospacer
  **   **********.******* ****

35. spacer 10.5|5283838|30|NZ_CP009920|CRT matches to NZ_CP024986 (Streptomyces lavendulae subsp. lavendulae strain CCM 3239 plasmid pSA3239, complete sequence) position: , mismatch: 7, identity: 0.767

atgactgccgccgtgactgccgccgtgacc	CRISPR spacer
cggaagcccgccgtgaccgccgccgggacc	Protospacer
  **   **********.******* ****

36. spacer 10.6|5283886|30|NZ_CP009920|CRT matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 7, identity: 0.767

atgatctccgccatggttacc-----gtcgtgacc	CRISPR spacer
atgatctcagccatggttacccatcggtca-----	Protospacer
******** ************     ***.

37. spacer 10.6|5283886|30|NZ_CP009920|CRT matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 7, identity: 0.767

atgatctccgccatggttacc-----gtcgtgacc	CRISPR spacer
atgatctcagccatggttacccatcggtca-----	Protospacer
******** ************     ***.

38. spacer 10.6|5283886|30|NZ_CP009920|CRT matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 7, identity: 0.767

atgatctccgccatggttacc-----gtcgtgacc	CRISPR spacer
atgatctcagccatggttacccatcggtca-----	Protospacer
******** ************     ***.

39. spacer 10.6|5283886|30|NZ_CP009920|CRT matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.767

atgatctccgccatggttacc-----gtcgtgacc	CRISPR spacer
atgatctcagccatggttacccatcggtca-----	Protospacer
******** ************     ***.

40. spacer 10.6|5283886|30|NZ_CP009920|CRT matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 7, identity: 0.767

atgatctccgccatggttacc-----gtcgtgacc	CRISPR spacer
atgatctcagccatggttacccatcggtca-----	Protospacer
******** ************     ***.

41. spacer 10.6|5283886|30|NZ_CP009920|CRT matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.767

atgatctccgccatggttacc-----gtcgtgacc	CRISPR spacer
atgatctcagccatggttacccatcggtca-----	Protospacer
******** ************     ***.

42. spacer 10.6|5283886|30|NZ_CP009920|CRT matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.767

atgatctccgccatggttacc-----gtcgtgacc	CRISPR spacer
atgatctcagccatggttacccatcggtca-----	Protospacer
******** ************     ***.

43. spacer 10.6|5283886|30|NZ_CP009920|CRT matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.767

atgatctccgccatggttacc-----gtcgtgacc	CRISPR spacer
atgatctcagccatggttacccatcggtca-----	Protospacer
******** ************     ***.

44. spacer 10.6|5283886|30|NZ_CP009920|CRT matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.767

atgatctccgccatggttacc-----gtcgtgacc	CRISPR spacer
atgatctcagccatggttacccatcggtca-----	Protospacer
******** ************     ***.

45. spacer 10.6|5283886|30|NZ_CP009920|CRT matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.767

atgatctccgccatggttacc-----gtcgtgacc	CRISPR spacer
atgatctcagccatggttacccatcggtca-----	Protospacer
******** ************     ***.

46. spacer 10.6|5283886|30|NZ_CP009920|CRT matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.767

atgatctccgccatggttacc-----gtcgtgacc	CRISPR spacer
atgatctcagccatggttacccatcggtca-----	Protospacer
******** ************     ***.

47. spacer 10.6|5283886|30|NZ_CP009920|CRT matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.767

atgatctccgccatggttacc-----gtcgtgacc	CRISPR spacer
atgatctcagccatggttacccatcggtca-----	Protospacer
******** ************     ***.

48. spacer 10.6|5283886|30|NZ_CP009920|CRT matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.767

atgatctccgccatggttacc-----gtcgtgacc	CRISPR spacer
atgatctcagccatggttacccatcggtca-----	Protospacer
******** ************     ***.

49. spacer 10.6|5283886|30|NZ_CP009920|CRT matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.767

atgatctccgccatggttacc-----gtcgtgacc	CRISPR spacer
atgatctcagccatggttacccatcggtca-----	Protospacer
******** ************     ***.

50. spacer 10.6|5283886|30|NZ_CP009920|CRT matches to NZ_CP025613 (Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

atgatctccgccatggttaccgtcgtgacc	CRISPR spacer
gtggtggatgccatggttaccgtcctgacc	Protospacer
.**.*   .*************** *****

51. spacer 10.6|5283886|30|NZ_CP009920|CRT matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.767

atgatctccgccatggttacc-----gtcgtgacc	CRISPR spacer
atgatctcagccatggttacccatcggtca-----	Protospacer
******** ************     ***.

52. spacer 10.6|5283886|30|NZ_CP009920|CRT matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.767

atgatctccgccatggttacc-----gtcgtgacc	CRISPR spacer
atgatctcagccatggttacccatcggtca-----	Protospacer
******** ************     ***.

53. spacer 10.6|5283886|30|NZ_CP009920|CRT matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.767

atgatctccgccatggttacc-----gtcgtgacc	CRISPR spacer
atgatctcagccatggttacccatcggtca-----	Protospacer
******** ************     ***.

54. spacer 10.6|5283886|30|NZ_CP009920|CRT matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.767

atgatctccgccatggttacc-----gtcgtgacc	CRISPR spacer
atgatctcagccatggttacccatcggtca-----	Protospacer
******** ************     ***.

55. spacer 10.6|5283886|30|NZ_CP009920|CRT matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.767

atgatctccgccatggttacc-----gtcgtgacc	CRISPR spacer
atgatctcagccatggttacccatcggtca-----	Protospacer
******** ************     ***.

56. spacer 10.6|5283886|30|NZ_CP009920|CRT matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.767

atgatctccgccatggttacc-----gtcgtgacc	CRISPR spacer
atgatctcagccatggttacccatcggtca-----	Protospacer
******** ************     ***.

57. spacer 10.6|5283886|30|NZ_CP009920|CRT matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 7, identity: 0.767

atgatctccgccatggttacc-----gtcgtgacc	CRISPR spacer
atgatctcagccatggttacccatcggtca-----	Protospacer
******** ************     ***.

58. spacer 10.6|5283886|30|NZ_CP009920|CRT matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.767

atgatctccgccatggttacc-----gtcgtgacc	CRISPR spacer
atgatctcagccatggttacccatcggtca-----	Protospacer
******** ************     ***.

59. spacer 10.3|5283754|30|NZ_CP009920|CRT matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.733

gtgacctccgccatgactgccgccgtgacc	CRISPR spacer
accatggccgccatgaccgccgccatgacc	Protospacer
.. *.  **********.******.*****

60. spacer 10.5|5283838|30|NZ_CP009920|CRT matches to NZ_CP042263 (Litoreibacter sp. LN3S51 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

atgactgccgccgtgactgccgccgtgacc	CRISPR spacer
gtgcctgccgccgtgaccgccgccaccggc	Protospacer
.** *************.******.. . *

61. spacer 10.5|5283838|30|NZ_CP009920|CRT matches to NZ_CP049244 (Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.733

atgactgccgccgtgactgccgccgtgacc	CRISPR spacer
atcgatgccgccgtgaatgccgccgtcttt	Protospacer
** . *********** *********  ..

62. spacer 10.5|5283838|30|NZ_CP009920|CRT matches to NZ_CP021405 (Celeribacter manganoxidans strain DY25 plasmid pDY25-A, complete sequence) position: , mismatch: 8, identity: 0.733

atgactgccgccgtgactgccgccgtgacc	CRISPR spacer
ccgcctgccgccgtgaccgccgccgcaaga	Protospacer
 .* *************.*******..*

63. spacer 10.5|5283838|30|NZ_CP009920|CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 8, identity: 0.733

atgactgccgccgtgactgccgccgtgacc	CRISPR spacer
cccgccgccgccgtgcctgccgccgtgcct	Protospacer
 . .*.********* *********** *.

64. spacer 10.5|5283838|30|NZ_CP009920|CRT matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.733

atgactgccgccgtgactgccgccgtgacc	CRISPR spacer
cccgccgccgccgtgcctgccgccgtgcct	Protospacer
 . .*.********* *********** *.

65. spacer 10.5|5283838|30|NZ_CP009920|CRT matches to NZ_CP038146 (Streptomyces sp. S501 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

atgactgccgccgtgactgccgccgtgacc	CRISPR spacer
cacgctgccgccgtcactgccgctgtggca	Protospacer
   .********** ********.***.*

66. spacer 10.6|5283886|30|NZ_CP009920|CRT matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 8, identity: 0.733

atgatctccgccatggttaccgtcgtgacc	CRISPR spacer
atgatctcggccatggttacctcttggtgc	Protospacer
******** ************ ..  *  *

67. spacer 10.3|5283754|30|NZ_CP009920|CRT matches to NZ_CP020371 (Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs417, complete sequence) position: , mismatch: 9, identity: 0.7

gtgacctccgccatgactgccgccgtgacc	CRISPR spacer
accgagcccgccgtgactgccgccgtggcc	Protospacer
.. .  .*****.**************.**

68. spacer 10.5|5283838|30|NZ_CP009920|CRT matches to NZ_CP024308 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3a, complete sequence) position: , mismatch: 9, identity: 0.7

atgactgccgccgtgactgccgccgtgacc	CRISPR spacer
cagattgccgccgtgaccgccgccgccgaa	Protospacer
  **.************.*******. .

69. spacer 10.5|5283838|30|NZ_CP009920|CRT matches to NZ_CP013052 (Sinorhizobium americanum CCGM7 plasmid A, complete sequence) position: , mismatch: 9, identity: 0.7

atgactgccgccgtgactgccgccgtgacc	CRISPR spacer
cagattgccgccgtgaccgccgccgccgaa	Protospacer
  **.************.*******. .

70. spacer 10.5|5283838|30|NZ_CP009920|CRT matches to MT771344 (Microbacterium phage Zhengyi, complete genome) position: , mismatch: 9, identity: 0.7

atgactgccgccgtgactgccgccgtgacc	CRISPR spacer
gccaccgccgccgtcactgccgccgtccgt	Protospacer
.. **.******** ***********   .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1179077 : 1188379

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034649041.1\|1179077_1180595_-	ATP-dependent DNA helicase RecQ	M1PGQ0	Moumouvirus	1.7e-54	31.1
WP_034649038.1\|1180618_1181668_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_013059046.1\|1181925_1182174_+	ferredoxin	A0A127AYY7	Bacillus_phage	3.6e-18	54.1
WP_013084915.1\|1182252_1182828_-	ECF transporter S component	NA	NA	NA	NA
WP_034649034.1\|1183423_1184998_+	phosphoglycerate dehydrogenase	A0A2H4PQU8	Staphylococcus_phage	7.6e-29	30.2
WP_034649031.1\|1185031_1185721_-	peptidoglycan DD-metalloendopeptidase family protein	Q8SBN9	Clostridium_phage	5.2e-14	42.1
WP_013084918.1\|1185890_1187663_-	HAMP domain-containing protein	A0A1V0SGX0	Hokovirus	7.5e-25	26.3
WP_013059051.1\|1187662_1188379_-	response regulator transcription factor	W8CYM9	Bacillus_phage	2.2e-47	42.2

DBSCAN-SWA_2

1306162 : 1346669

Bacillus_phage(24.32%)

terminase,plate,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034656753.1\|1306162_1306516_-	hypothetical protein	A0A0K1LMH6	Bacillus_phage	3.3e-17	40.7
WP_034656752.1\|1306528_1306954_-	hypothetical protein	A0A0K1LLM8	Bacillus_phage	3.0e-20	39.4
WP_080743123.1\|1306965_1307556_-	replication-relaxation family protein	B3RH37	Bacillus_virus	3.0e-63	58.2
WP_034656751.1\|1307482_1308850_-	hypothetical protein	B3RH36	Bacillus_virus	2.0e-78	39.0
WP_034656748.1\|1309177_1309402_+	helix-turn-helix transcriptional regulator	Q0H252	Geobacillus_phage	1.4e-08	43.1
WP_034656746.1\|1309589_1310309_+	TIGR04255 family protein	NA	NA	NA	NA
WP_034656744.1\|1310312_1310822_+	hypothetical protein	NA	NA	NA	NA
WP_034656742.1\|1310825_1311188_+	hypothetical protein	NA	NA	NA	NA
WP_052098017.1\|1311265_1312273_-	LysM peptidoglycan-binding domain-containing protein	A0A0S2SXM5	Bacillus_phage	8.3e-154	77.8
WP_034656741.1\|1312335_1312575_-	hypothetical protein	A0A0S2SXN3	Bacillus_phage	7.7e-34	93.7
WP_034656739.1\|1312587_1312866_-	hemolysin XhlA family protein	A0A0S2SXU0	Bacillus_phage	4.8e-11	49.3
WP_034656738.1\|1312928_1313126_-	hypothetical protein	NA	NA	NA	NA
WP_034656737.1\|1313127_1314108_-	hypothetical protein	NA	NA	NA	NA
WP_052098016.1\|1314260_1316456_-	SGNH/GDSL hydrolase family protein	A0A1L2K2Q1	Aeribacillus_phage	3.8e-10	58.0
WP_034656736.1\|1316477_1317095_-	hypothetical protein	A0A2H4J4S3	uncultured_Caudovirales_phage	1.6e-38	39.0
WP_158319975.1\|1317091_1318105_-\|plate	baseplate J/gp47 family protein	A0A2H4J8D2	uncultured_Caudovirales_phage	3.0e-79	45.3
WP_034656734.1\|1318226_1318580_-	DUF2634 domain-containing protein	E5DV62	Deep-sea_thermophilic_phage	7.7e-22	45.2
WP_034656733.1\|1318576_1318909_-	hypothetical protein	A0A2H4JDQ2	uncultured_Caudovirales_phage	3.7e-18	47.3
WP_034656731.1\|1318911_1319739_-	hypothetical protein	E5DV61	Deep-sea_thermophilic_phage	8.8e-93	61.5
WP_034656730.1\|1319735_1320083_-	hypothetical protein	A0A2H4J6L1	uncultured_Caudovirales_phage	5.8e-30	54.7
WP_034656729.1\|1320097_1320640_-	LysM peptidoglycan-binding domain-containing protein	A0A2H4JD33	uncultured_Caudovirales_phage	6.2e-47	54.9
WP_052098015.1\|1320650_1325165_-	peptidoglycan DD-metalloendopeptidase family protein	A0A1L2JY60	Aeribacillus_phage	7.3e-149	55.6
WP_050689182.1\|1325380_1325665_-	hypothetical protein	NA	NA	NA	NA
WP_034656728.1\|1325775_1326174_-	hypothetical protein	A0A1L2K2P1	Aeribacillus_phage	2.6e-26	53.8
WP_034656727.1\|1326189_1327203_-	DUF3383 family protein	A0A1L2JZ70	Aeribacillus_phage	1.3e-93	51.5
WP_034656726.1\|1327204_1327690_-	hypothetical protein	A0A1L2JY58	Aeribacillus_phage	3.7e-43	53.5
WP_034656725.1\|1327670_1328036_-	hypothetical protein	A0A1L2JY57	Aeribacillus_phage	4.7e-22	51.4
WP_034656777.1\|1328028_1328622_-	hypothetical protein	A8ATG9	Listeria_phage	3.6e-48	50.0
WP_138976767.1\|1328650_1328986_-	DUF4054 domain-containing protein	NA	NA	NA	NA
WP_034656722.1\|1329000_1329333_-	hypothetical protein	NA	NA	NA	NA
WP_052098014.1\|1329332_1330232_-	DUF2184 domain-containing protein	A8ATG6	Listeria_phage	8.4e-65	44.5
WP_052098013.1\|1330261_1330723_-	hypothetical protein	NA	NA	NA	NA
WP_034656720.1\|1330756_1331839_-	DUF2213 domain-containing protein	A8ATG4	Listeria_phage	2.6e-84	47.2
WP_155720772.1\|1331873_1332035_-	hypothetical protein	NA	NA	NA	NA
WP_034656718.1\|1332040_1332820_-\|capsid	minor capsid protein	A0A2I7R777	Vibrio_phage	1.5e-22	29.2
WP_034656717.1\|1332821_1334156_-	DUF1073 domain-containing protein	A8ATG1	Listeria_phage	1.0e-135	53.7
WP_034656770.1\|1334160_1335612_-\|terminase	phage terminase large subunit	A8ATG0	Listeria_phage	2.2e-168	59.8
WP_052098011.1\|1335604_1336294_-\|terminase	terminase small subunit	A0A0A0RSW5	Bacillus_phage	2.5e-08	29.1
WP_080743120.1\|1336377_1336554_+	DUF2642 domain-containing protein	NA	NA	NA	NA
WP_034656716.1\|1336783_1337029_-	hypothetical protein	NA	NA	NA	NA
WP_034656715.1\|1337121_1337445_-	hypothetical protein	A0A0H3UZB1	Geobacillus_virus	2.7e-05	54.4
WP_034656714.1\|1337861_1338242_-	ArpU family transcriptional regulator	D6R428	Bacillus_phage	4.1e-37	67.2
WP_142751825.1\|1338458_1339169_-	HNH endonuclease	NA	NA	NA	NA
WP_115648239.1\|1339171_1339366_-	DUF3954 domain-containing protein	NA	NA	NA	NA
WP_155720773.1\|1339492_1339657_-	hypothetical protein	NA	NA	NA	NA
WP_034656712.1\|1339790_1340000_-	hypothetical protein	NA	NA	NA	NA
WP_034656710.1\|1339974_1340355_-	hypothetical protein	NA	NA	NA	NA
WP_080743118.1\|1340351_1340789_-	hypothetical protein	A0A0C5ABF9	Paenibacillus_phage	1.2e-16	53.9
WP_034656709.1\|1340813_1341584_-	phage antirepressor KilAC domain-containing protein	A0A141VTQ8	Staphylococcus_phage	6.5e-50	45.5
WP_034656708.1\|1341624_1342257_-	hypothetical protein	NA	NA	NA	NA
WP_041907480.1\|1342273_1342879_-	hypothetical protein	A0A0K1LLG8	Bacillus_phage	5.2e-10	30.6
WP_080743117.1\|1342894_1343038_-	Fur-regulated basic protein FbpA	NA	NA	NA	NA
WP_034656705.1\|1343055_1343250_-	hypothetical protein	NA	NA	NA	NA
WP_052098010.1\|1343264_1343960_-	ATP-binding protein	A0A2H4J4P8	uncultured_Caudovirales_phage	1.1e-69	55.7
WP_034656704.1\|1344033_1344789_-	DnaD domain protein	A0A0A0RQ10	Bacillus_phage	2.5e-14	31.9
WP_080743124.1\|1344973_1345711_-	PD-(D/E)XK nuclease-like domain-containing protein	A0A2P1JU03	Anoxybacillus_phage	1.8e-52	43.9
WP_034656703.1\|1345733_1346669_-	hypothetical protein	A0A0A7S0A9	Clostridium_phage	1.0e-89	62.9

DBSCAN-SWA_3

1349800 : 1354966

Listeria_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034656690.1\|1349800_1350142_+	helix-turn-helix transcriptional regulator	A0A0B5CYL9	Listeria_phage	1.5e-11	44.3
WP_034656687.1\|1350517_1351009_+	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	4.2e-26	40.5
WP_034656686.1\|1351073_1351643_+	DUF4352 domain-containing protein	A0A2H4PQN2	Staphylococcus_phage	1.7e-26	49.6
WP_052098009.1\|1351730_1352084_+	helix-turn-helix transcriptional regulator	Q0H244	Geobacillus_phage	8.5e-05	32.7
WP_034656684.1\|1352124_1353576_+	recombinase family protein	A0A2P1JU08	Anoxybacillus_phage	3.1e-125	48.3
WP_013059178.1\|1354582_1354966_-	transcriptional regulator Spx	G3MAU4	Bacillus_virus	1.8e-08	29.2

DBSCAN-SWA_4

2379197 : 2387459

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034654674.1\|2379197_2380490_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	7.7e-19	25.5
WP_013055037.1\|2380564_2381272_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3FGF0	Synechococcus_phage	1.2e-42	40.2
WP_013055038.1\|2381279_2381531_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_034654677.1\|2381527_2382214_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_028410200.1\|2382197_2384429_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	2.1e-157	41.3
WP_013055041.1\|2384404_2385820_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	4.3e-55	34.6
WP_013081441.1\|2385846_2386884_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F0L1	Synechococcus_phage	1.7e-69	45.6
WP_014461934.1\|2386880_2387459_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	9.6e-30	39.8

DBSCAN-SWA_5

4348872 : 4357084

Bacillus_virus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034652452.1\|4348872_4349649_+	NUDIX hydrolase	A0A0E3JJF3	Streptomyces_phage	5.1e-10	41.9
WP_013083026.1\|4349720_4350269_+	cysteine hydrolase	G3MA16	Bacillus_virus	1.4e-33	44.4
WP_034652448.1\|4350292_4351762_+	nicotinate phosphoribosyltransferase	G3MA18	Bacillus_virus	5.5e-114	48.2
WP_034652445.1\|4351777_4352458_+	nicotinate (nicotinamide) nucleotide adenylyltransferase	G3MA22	Bacillus_virus	4.1e-40	42.8
WP_034652444.1\|4352492_4353314_+	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	1.1e-92	64.1
WP_013056909.1\|4353495_4353933_+	RNA-binding protein S1	NA	NA	NA	NA
WP_034652443.1\|4354672_4357084_+	S8 family serine peptidase	A0A217EQY2	Bacillus_phage	1.6e-17	36.9

DBSCAN-SWA_6

4360846 : 4390197

Bacillus_phage(29.63%)

portal,tail,terminase,head,protease,integrase,capsid

attL 4357080:4357095|attR 4373859:4373874

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4357080:4357095	attL	NA	NA	NA	NA
WP_172556175.1\|4360846_4361971_-\|integrase	tyrosine-type recombinase/integrase	S5MBZ0	Brevibacillus_phage	1.6e-68	40.2
WP_034652438.1\|4362042_4362324_-	DUF1827 family protein	NA	NA	NA	NA
WP_115648248.1\|4362466_4362892_-	hypothetical protein	A0A0K2CZC9	Paenibacillus_phage	1.5e-32	51.6
WP_034652432.1\|4362954_4363305_-	helix-turn-helix transcriptional regulator	A0A2I7SC14	Paenibacillus_phage	1.4e-23	51.3
WP_051975608.1\|4363477_4363747_+	helix-turn-helix transcriptional regulator	A0A2I7SC17	Paenibacillus_phage	3.0e-18	50.6
WP_034652431.1\|4363739_4364009_+	group-specific protein	A0A1B1P7U4	Bacillus_phage	6.4e-29	66.3
WP_155276304.1\|4364022_4364196_+	hypothetical protein	NA	NA	NA	NA
WP_034652429.1\|4364460_4365180_+	Rha family transcriptional regulator	A0A0S2SXM6	Bacillus_phage	3.5e-45	50.7
WP_034652426.1\|4365292_4366294_+	DnaD domain protein	A0A0S2SXI2	Bacillus_phage	7.9e-64	39.9
WP_115648247.1\|4366301_4366457_+	Fur-regulated basic protein FbpA	A0A0S2SXY0	Bacillus_phage	4.2e-09	68.8
WP_034652424.1\|4366507_4366696_-	DUF4177 domain-containing protein	NA	NA	NA	NA
WP_034652422.1\|4367140_4367419_+	hypothetical protein	U5PRR5	Bacillus_phage	1.8e-13	44.0
WP_034652419.1\|4367463_4367823_-	hypothetical protein	NA	NA	NA	NA
WP_034652416.1\|4368009_4368519_+	DUF3189 family protein	NA	NA	NA	NA
WP_034655187.1\|4368870_4369308_+	transcriptional regulator	A0A0S2SXN1	Bacillus_phage	3.0e-60	83.9
WP_155276303.1\|4369567_4369717_+	hypothetical protein	A0A0S2SXP4	Bacillus_phage	9.7e-19	91.8
WP_034652410.1\|4370068_4370434_+	hypothetical protein	NA	NA	NA	NA
WP_034652408.1\|4370559_4370748_+	hypothetical protein	NA	NA	NA	NA
WP_034652405.1\|4371002_4371533_+	hypothetical protein	NA	NA	NA	NA
WP_177623024.1\|4372361_4372835_+	hypothetical protein	NA	NA	NA	NA
WP_034652399.1\|4373385_4373772_+	hypothetical protein	NA	NA	NA	NA
WP_034652396.1\|4373890_4374118_+	hypothetical protein	NA	NA	NA	NA
4373859:4373874	attR	NA	NA	NA	NA
WP_034652393.1\|4374117_4374438_+	HNH endonuclease	A8ATF8	Listeria_phage	6.1e-34	67.6
WP_034652391.1\|4374575_4374911_+	hypothetical protein	E2ELI1	Clostridium_phage	8.1e-13	40.2
WP_034652388.1\|4374907_4376566_+\|terminase	terminase large subunit	A0A0U4B089	Bacillus_phage	2.8e-263	79.9
WP_051975651.1\|4376628_4377735_+\|portal	phage portal protein	A0A2H4JAJ1	uncultured_Caudovirales_phage	3.1e-170	78.1
WP_034652382.1\|4377718_4378501_+\|protease	Clp protease ClpP	A0A0A7RWX3	Clostridium_phage	5.3e-55	55.6
WP_034652379.1\|4378519_4379671_+\|capsid	phage major capsid protein	A0A2H4JH29	uncultured_Caudovirales_phage	1.4e-141	69.5
WP_034652377.1\|4379685_4379985_+	hypothetical protein	A0A059T7R0	Listeria_phage	3.0e-27	65.1
WP_034652374.1\|4379971_4380340_+\|head,tail	phage head-tail adapter protein	G4KNQ4	Staphylococcus_phage	1.0e-24	46.8
WP_034652362.1\|4380336_4380729_+	hypothetical protein	A0A2H4JB89	uncultured_Caudovirales_phage	1.0e-30	48.0
WP_034652360.1\|4380728_4381103_+	hypothetical protein	A0A0N9SKI2	Staphylococcus_phage	1.4e-18	37.5
WP_034652357.1\|4381117_4381726_+	hypothetical protein	A0A2H4J4E0	uncultured_Caudovirales_phage	1.2e-51	53.8
WP_034652354.1\|4381729_4381921_+	hypothetical protein	A0A2H4JA77	uncultured_Caudovirales_phage	1.5e-11	55.0
WP_034652352.1\|4381976_4382333_+	hypothetical protein	A0A2H4J5B3	uncultured_Caudovirales_phage	1.2e-19	44.8
WP_034652351.1\|4382329_4382518_+	hypothetical protein	A0A1D6Z284	Staphylococcus_phage	5.3e-06	48.1
WP_034652350.1\|4382554_4386286_+\|tail	phage tail tape measure protein	A0A1S7FYZ4	Listeria_phage	6.8e-52	37.5
WP_034652347.1\|4386779_4387253_+	hypothetical protein	NA	NA	NA	NA
WP_034652346.1\|4387236_4388694_+\|tail	phage tail family protein	NA	NA	NA	NA
WP_158319977.1\|4388712_4390197_+\|tail	phage tail protein	A0A0N9SIL8	Paenibacillus_phage	2.0e-55	34.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP009921

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP009921_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009921_1

251364-251463

Orphan

Consensus_repeat	Method
ATAAAAGCCGGAACAAAAGTATTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP009921_1

>merge|NZ_CP009921|1|251364-251463|CRISPRCasFinder
ATTAAAGTCGGTACAACAATTATAGGTAACGGAAAAACAGACGTAAAAGGAAAGTTTTCTGTAGCTATTCCGAAGCAAAAAGCCGGAACAAAAATATTAG

>NZ_CP009921|1|1|251364-251463|CRISPRCasFinder
ATTAAAGTCGGTACAACAATTATA	GGTAACGGAAAAACAGACGTAAAAGGAAAGTTTTCTGTAGCTATTCCGAAG
CAAAAAGCCGGAACAAAAATATTAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009921.1\|WP_034655701.1\|258121_258706_+\|LysE-family-transporter	unknown	unknown	gnl\|CDD\|182377
NZ_CP009921.1\|WP_034655686.1\|245611_245881_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009921.1\|WP_034655678.1\|243647_244406_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009921.1\|WP_034655688.1\|246745_247177_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009921.1\|WP_034655689.1\|247206_247473_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009921.1\|WP_034655705.1\|260393_260657_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009921.1\|WP_034655695.1\|253617_253947_-\|chaperone-CsaA	unknown	unknown	gnl\|CDD\|182232
NZ_CP009921.1\|WP_080743204.1\|259515_259689_+\|Fur-regulated-basic-protein-FbpA	unknown	unknown	gnl\|CDD\|315692
NZ_CP009921.1\|WP_034655704.1\|259733_259916_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|370161
NZ_CP009921.1\|WP_080743140.1\|246283_246676_+\|UPF0715-family-protein	unknown	unknown	gnl\|CDD\|293699
NZ_CP009921.1\|WP_080743202.1\|256391_257282_+\|Rpn-family-recombination-promoting-nuclease/putative-transposase	unknown	unknown	gnl\|CDD\|372314
NZ_CP009921.1\|WP_034655676.1\|243193_243622_-\|DUF3888-domain-containing-protein	unknown	unknown	gnl\|CDD\|379024
NZ_CP009921.1\|WP_034655699.1\|257453_258008_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|380339
NZ_CP009921.1\|WP_034655683.1\|245070_245574_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009921.1\|WP_034655691.1\|247580_247997_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009921.1\|WP_080743203.1\|255244_255667_-\|GerAB/ArcD/ProY-family-transporter	unknown	unknown	gnl\|CDD\|281794
NZ_CP009921.1\|WP_034655680.1\|244466_244919_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009921.1\|WP_034655674.1\|242522_243059_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009921.1\|WP_034655697.1\|254141_254981_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293799
NZ_CP009921.1\|WP_034655693.1\|252110_252707_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP009921.1\|WP_034655704.1\|259733_259916_+\|hypothetical-protein	gnl\|CDD\|370161	pfam08863, YolD, YolD-like protein. Members of this family are functionally uncharacterized. However it has been predicted that these proteins are functionally equivalent to the UmuD subunit of polymerase V from gram-negative bacteria. This family has been shown to belong to the WYL-like superfamily.	0.00943234
NZ_CP009921.1\|WP_080743140.1\|246283_246676_+\|UPF0715-family-protein	gnl\|CDD\|293699	pfam17094, UPF0715, Uncharacterized protein family (UPF0715). This is a family of Bacilli transmembrane proteins. The function is unknown.	8.04845e-09
NZ_CP009921.1\|WP_080743202.1\|256391_257282_+\|Rpn-family-recombination-promoting-nuclease/putative-transposase	gnl\|CDD\|372314	pfam12784, PDDEXK_2, PD-(D/E)XK nuclease family transposase. Members of this family belong to the PD-(D/E)XK nuclease superfamily. These proteins are transposase proteins.	3.9568e-72
NZ_CP009921.1\|WP_034655676.1\|243193_243622_-\|DUF3888-domain-containing-protein	gnl\|CDD\|379024	pfam13027, DUF3888, Protein of unknown function (DUF3888). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 111 and 149 amino acids in length.	1.06898e-09
NZ_CP009921.1\|WP_034655695.1\|253617_253947_-\|chaperone-CsaA	gnl\|CDD\|182232	PRK10089, PRK10089, chaperone CsaA.	6.42471e-60
NZ_CP009921.1\|WP_034655701.1\|258121_258706_+\|LysE-family-transporter	gnl\|CDD\|182377	PRK10323, PRK10323, cysteine/O-acetylserine transporter.	4.48077e-44
NZ_CP009921.1\|WP_034655699.1\|257453_258008_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|380339	cd02209, cupin_XRE_C, XRE (Xenobiotic Response Element) family transcriptional regulators, C-terminal cupin domain. This family contains transcriptional regulators containing an N-terminal XRE (Xenobiotic Response Element) family helix-turn-helix (HTH) DNA-binding domain and a C-terminal cupin domain. Included in this family is Escherichia coli transcription factor SutR (YdcN) that plays a regulatory role in sulfur utilization; it regulates a set of genes involved in the generation of sulfate and its reduction, the synthesis of cysteine, the synthesis of enzymes containing Fe-S as cofactors, and the modification of tRNA with use of sulfur-containing substrates. This family belongs to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	5.80102e-19
NZ_CP009921.1\|WP_080743204.1\|259515_259689_+\|Fur-regulated-basic-protein-FbpA	gnl\|CDD\|315692	pfam13076, Fur_reg_FbpA, Fur-regulated basic protein A. This family of proteins is regulated by the ferric uptake regulator protein Fur. This family does not regulate the lutABC operon encoding iron sulfur-containing enzymes necessary for growth on lactate.	5.70025e-08
NZ_CP009921.1\|WP_034655697.1\|254141_254981_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293799	cd07713, DHPS-like_MBL-fold, Methanocaldococcus jannaschii dihydropteroate synthase, Thermoanaerobacter tengcongensis Tflp, and related proteins; MBL-fold metallo hydrolase domain. This subgroup includes Methanocaldococcus jannaschii 7,8-dihydropterin-6-methyl-4-(beta-D-ribofuranosyl)-aminobenzene-5'-phosphate synthase (EC 2.5.1.15), a folate biosynthetic enzyme also known as dihydropteroate synthase and 7,8 dihydropteroate synthase. Thermoanaerobacter tengcongensis Tflp is a ferredoxin-like member. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	7.07219e-88
NZ_CP009921.1\|WP_080743203.1\|255244_255667_-\|GerAB/ArcD/ProY-family-transporter	gnl\|CDD\|281794	pfam03845, Spore_permease, Spore germination protein.	1.03576e-12

>NZ_CP009921.1|WP_034655691.1|247580_247997_-|hypothetical-protein
MAYLIRKLHLYRWGFTSVLIIFAGMYLYYFFSSQPHLTGQSPSKVWKAEYTRYDTYWEGTLKHSSEGNVTLHKFIIIENGQKVNYSPDKDTISQKSFDFMSLGDRPQKNETYIVQIEWNDSKGSHKETFPLERSYNPF
>NZ_CP009921.1|WP_034655689.1|247206_247473_-|hypothetical-protein
MKKSLQLFGTVLFISGIILFGLMHLAIALYIPHLGEWSDPPGKLIVVLDEIIGWFPYVLSILFMLLGGSMLIFDLWKSKQKEQVGKKS
>NZ_CP009921.1|WP_034655688.1|246745_247177_-|hypothetical-protein
MRDFIKLVVAAFLSTIFLSTAYGIINLTPKSEQEPNIYYFGFTDTFVFTFIYTFPVYIVVGIIFSYLIDMMANKMQTTKVYVSKLAMYSLVGVIPALAFYFLFTGIKLDYRLLFYFFALGIFASNIFYHVLLLINRILNKQKT
>NZ_CP009921.1|WP_080743140.1|246283_246676_+|UPF0715-family-protein
MTFKELLPYHALTVISSSISYSIFLIIIEPSYRAVIAFFMILLITIIPYSVAAVPLQIFLNKWPKKFNVFYLFTYCVVAILFLYISYKLQGNWSDPIWNYRKMFIFAVGAAIIYWFWDSVIMNKKEYPYY
>NZ_CP009921.1|WP_034655686.1|245611_245881_-|hypothetical-protein
MKKRFSQYSLWLSLLGIVIGVGQYFTSIYSLNILYMGVVVYLAGFTCGVIAFGKHERGLMKYFSLTSFVVIPLLIMLGMLFFAMNFGES
>NZ_CP009921.1|WP_034655683.1|245070_245574_+|hypothetical-protein
MNKRAALLLLIIGIFAYGINYGTAFANSIEERNRPEKACSEEFEKYRKKLDDRVLKDIVKSYSLDLSGFQEFTNRELDLKVGDSMNDHSDQISLQHLFVGGSIGSMRLFLENSLEGTRGYFLYKRVDGNNVLKVLNKMGNIWVVMTVDEKKADKLEQKPFNWDKCAD
>NZ_CP009921.1|WP_034655680.1|244466_244919_-|hypothetical-protein
MKKLTLVIVLSFIVLVYPYQANASKMPCSLILEPIDKHLKNAKDTALIYKVQLNPPSFPRTNISILGVHLPKPSSYGRYDGYEGVASVPNEVSWRFRMYPTPEDESPTWAGRFDLITVDMKNVKIQIRLSNSKTEKLGPPILQARMALCK
>NZ_CP009921.1|WP_034655678.1|243647_244406_-|hypothetical-protein
MKQFICLILAIGFLFSETPMASAYSDTRPALYNFVHSLTRMGSEQAEKYVAPNVDIPEIREDTPLLTIQGLPSSKENELILIGYFNDKKVANERIAFIWKVSFTKTQITNINEVYNGSNPFMNEIKTIEKYEKRHHVDILKPTIFPFEVTHVDTHQDKDALIIRYRNDNLHGLFQLKVTKTSHSLEEYASNNVVSYTLRDGTKALYQPNYIPAKQLLFQRGKIRYTIGISQSTKKNVAVSNLLQIANSMISN
>NZ_CP009921.1|WP_034655676.1|243193_243622_-|DUF3888-domain-containing-protein
MRKIIVAIFTLLLVSNASSAYATRDLPTKTKATRENILEDAVIDLLDSQMTQAAEKYYGAKNSKGVRFDCQQVLSIKKLDHPGSMMFEAILEGVSYFGPHNSPSHIFKVTIRKDYHTNGWEMKSFKVRNLKPHEVYECRDPA
>NZ_CP009921.1|WP_034655674.1|242522_243059_-|hypothetical-protein
MKHLLDRFKNTDLLEIYTYEGDVNKCLVAYILQTNEEYTLLATVGTSGLYDGHYVISTESVVSVATETEYLKKIKNLYDLKKQVHPTYTGNTEDLIRGGLEFAKAQNYIVSLMLLDSEEYSTTGFVKEIIENETVVISEVDSFGFVDGKRFIDIEAIEHLTINGEEEQDIKLLFSNNA
>NZ_CP009921.1|WP_034655693.1|252110_252707_-|hypothetical-protein
MKTSKVGIIVSVIINIVLPYLIYTILKTHITSIIALSLAACVPLVDTFYHLIKDKKLDTFSSFIFLGIVLSIVAAWIGGDERFILLRESYVTGIMGLVFLLSILTPKPLIYYFAMRFTADKSVITKRWEEEGSFRHFIRIMAAVWGIGLMIEALVKVVIVYEFPISKALVISPIAQYIVIAILIYWNIHFVKQRKQKA
>NZ_CP009921.1|WP_034655695.1|253617_253947_-|chaperone-CsaA
MATIDDFFKLDIRIGTVVKAEPFPEARKPAIKLEIDFGELGVKCSSAQITKRYKPEQLIGSQVVAVVNFPPMRIAGFKSEVLVIGGVPEEGDVVLLRPSEFVKNGTPIA
>NZ_CP009921.1|WP_034655697.1|254141_254981_-|MBL-fold-metallo-hydrolase
MKLSVLVDNNTLIDRYFLGEPALSFFIEEDDKRILFDTGYSDAFIRNAEKMRIDLRNLDWVALSHGHVDHTWGLTHLISLHMEAKSEALTHHTPTIIGHPLVFESKLLDSVSEIGSVLSYNKLSKHFPINLSKQPFWLTDKLVFLGEIKRKFNFEGKESIGKVNTEKEEFDDFIFDDTALVYKSSEGLVIMVGCAHSGICNIIEYAKEVCSEERIVDIIGGFHLLNPSDFQLENTVKYIEELDPNKLHASHCTDLYSKIALSRVADIEEVGVGLRLEYV
>NZ_CP009921.1|WP_080743203.1|255244_255667_-|GerAB/ArcD/ProY-family-transporter
MLINISVLGVSLTERSQFPLLSIVQSIQVADFLERLYVFFMFALIITSFVKINVFFYAVVIGMTSLFKIQSPSRMTYPLGLVILFLSMTIASNYQEQFYEGQTIVPFILHLPFQVIIPLLLLTVVFLRKTRGRVMKNSKN
>NZ_CP009921.1|WP_080743202.1|256391_257282_+|Rpn-family-recombination-promoting-nuclease/putative-transposase
MTKRLDLRVDFAFKSLFGTHGNESILAAFLNAALRFPDEKKIQTVQLLDPHFNKENQEDKRSILDVHAQLEDGSRVNIEIQLNNKHDMEKRTLYYWSKMYSSQMKEGMDYGELCKTITINIVNFRYLSHITNYHSTFQLYEREQKVLLTDMLEIHFMELPKLLIKWRNREVDPREDQLVRWLLLLEASEDEEITQVLEEIAMQEDQVLKKAMDEWERVSQDPEVLLAYEARKKALLDEKSALKRAENLGKIEGEKIGVEKTIKTMALGMIHKGIDNETISDLTGLSQEEINNLRRQ
>NZ_CP009921.1|WP_034655699.1|257453_258008_-|helix-turn-helix-domain-containing-protein
MKEINLIIAKNLKGFRESKKLSLERVSELTGVSKTMIGQIERGESSPTITTIWKIANGLKISFTSLINDPQPDTKVISKDEIQILSEDNGKYRVYPYFPFEDDRRFEVYSIEIEEGGSVEANLHREGTEEFITVFEGELTISINSNEYIIKRGNAISFRADRPHSYYNRGKTLTRLSMIIYYPV
>NZ_CP009921.1|WP_034655701.1|258121_258706_+|LysE-family-transporter
MPVLSFLLYVFVTSFTPGPNNIMAMLFANKYGLKKTLKFCVGVGAGFLIVMLLCSYLNLLLKNFIPKIEFFMTILGAGYMIYLAIKIIRSRGDNENNNEDRNNSFFMGMLLQFINPKGILYGITAIATFILPYHNSNFSLLMYSLFLALIGFMSTFCWSLFGSFFQKFLSKYRNQFNIVMALLLMYSAVSILIK
>NZ_CP009921.1|WP_080743204.1|259515_259689_+|Fur-regulated-basic-protein-FbpA
MSKQICSDIQRKKNLIIDSLIHLGIYKKGNKQLYELTLHELETEYQIVNPAIQDLSF
>NZ_CP009921.1|WP_034655704.1|259733_259916_+|hypothetical-protein
MFLKKLIKNGLVTVHYYENESLQTCKGRVYNLNLHEQTLSLRDEKQNIFLIRLSGVEDIY
>NZ_CP009921.1|WP_034655705.1|260393_260657_+|hypothetical-protein
MNTTVNELYDFGIVLRGKLLNSNLYAYYLIDAMRRENHFDFLYYFLTATVDSQTPIPERVSNVFLEILSDKEKLSDLTPFVMGLVEK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009921_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009921_2

251610-251708

Orphan

Consensus_repeat	Method
ATAAAAGCCGGAACAAAAGTATTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP009921_2

>merge|NZ_CP009921|2|251610-251708|CRISPRCasFinder
ATAAAAGCCGGAACAAAAGTATTAGCAAGTGGAAAAGTAGATAAAAATGGAAAGTTTAGTATTAAAATAATAAAACAAAAAGCCGGAACAAAAGTATTA

>NZ_CP009921|2|2|251610-251708|CRISPRCasFinder
ATAAAAGCCGGAACAAAAGTATTA	GCAAGTGGAAAAGTAGATAAAAATGGAAAGTTTAGTATTAAAATAATAAAA
CAAAAAGCCGGAACAAAAGTATTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009921.1\|WP_034655701.1\|258121_258706_+\|LysE-family-transporter	unknown	unknown	gnl\|CDD\|182377
NZ_CP009921.1\|WP_034655686.1\|245611_245881_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009921.1\|WP_034655678.1\|243647_244406_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009921.1\|WP_034655688.1\|246745_247177_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009921.1\|WP_034655689.1\|247206_247473_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009921.1\|WP_034655705.1\|260393_260657_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009921.1\|WP_034655695.1\|253617_253947_-\|chaperone-CsaA	unknown	unknown	gnl\|CDD\|182232
NZ_CP009921.1\|WP_080743204.1\|259515_259689_+\|Fur-regulated-basic-protein-FbpA	unknown	unknown	gnl\|CDD\|315692
NZ_CP009921.1\|WP_034655704.1\|259733_259916_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|370161
NZ_CP009921.1\|WP_080743140.1\|246283_246676_+\|UPF0715-family-protein	unknown	unknown	gnl\|CDD\|293699
NZ_CP009921.1\|WP_080743202.1\|256391_257282_+\|Rpn-family-recombination-promoting-nuclease/putative-transposase	unknown	unknown	gnl\|CDD\|372314
NZ_CP009921.1\|WP_034655676.1\|243193_243622_-\|DUF3888-domain-containing-protein	unknown	unknown	gnl\|CDD\|379024
NZ_CP009921.1\|WP_034655699.1\|257453_258008_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|380339
NZ_CP009921.1\|WP_034655683.1\|245070_245574_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009921.1\|WP_034655691.1\|247580_247997_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009921.1\|WP_080743203.1\|255244_255667_-\|GerAB/ArcD/ProY-family-transporter	unknown	unknown	gnl\|CDD\|281794
NZ_CP009921.1\|WP_034655680.1\|244466_244919_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009921.1\|WP_034655674.1\|242522_243059_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009921.1\|WP_034655697.1\|254141_254981_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293799
NZ_CP009921.1\|WP_034655693.1\|252110_252707_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP009921.1\|WP_034655704.1\|259733_259916_+\|hypothetical-protein	gnl\|CDD\|370161	pfam08863, YolD, YolD-like protein. Members of this family are functionally uncharacterized. However it has been predicted that these proteins are functionally equivalent to the UmuD subunit of polymerase V from gram-negative bacteria. This family has been shown to belong to the WYL-like superfamily.	0.00943234
NZ_CP009921.1\|WP_080743140.1\|246283_246676_+\|UPF0715-family-protein	gnl\|CDD\|293699	pfam17094, UPF0715, Uncharacterized protein family (UPF0715). This is a family of Bacilli transmembrane proteins. The function is unknown.	8.04845e-09
NZ_CP009921.1\|WP_080743202.1\|256391_257282_+\|Rpn-family-recombination-promoting-nuclease/putative-transposase	gnl\|CDD\|372314	pfam12784, PDDEXK_2, PD-(D/E)XK nuclease family transposase. Members of this family belong to the PD-(D/E)XK nuclease superfamily. These proteins are transposase proteins.	3.9568e-72
NZ_CP009921.1\|WP_034655676.1\|243193_243622_-\|DUF3888-domain-containing-protein	gnl\|CDD\|379024	pfam13027, DUF3888, Protein of unknown function (DUF3888). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 111 and 149 amino acids in length.	1.06898e-09
NZ_CP009921.1\|WP_034655695.1\|253617_253947_-\|chaperone-CsaA	gnl\|CDD\|182232	PRK10089, PRK10089, chaperone CsaA.	6.42471e-60
NZ_CP009921.1\|WP_034655701.1\|258121_258706_+\|LysE-family-transporter	gnl\|CDD\|182377	PRK10323, PRK10323, cysteine/O-acetylserine transporter.	4.48077e-44
NZ_CP009921.1\|WP_034655699.1\|257453_258008_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|380339	cd02209, cupin_XRE_C, XRE (Xenobiotic Response Element) family transcriptional regulators, C-terminal cupin domain. This family contains transcriptional regulators containing an N-terminal XRE (Xenobiotic Response Element) family helix-turn-helix (HTH) DNA-binding domain and a C-terminal cupin domain. Included in this family is Escherichia coli transcription factor SutR (YdcN) that plays a regulatory role in sulfur utilization; it regulates a set of genes involved in the generation of sulfate and its reduction, the synthesis of cysteine, the synthesis of enzymes containing Fe-S as cofactors, and the modification of tRNA with use of sulfur-containing substrates. This family belongs to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	5.80102e-19
NZ_CP009921.1\|WP_080743204.1\|259515_259689_+\|Fur-regulated-basic-protein-FbpA	gnl\|CDD\|315692	pfam13076, Fur_reg_FbpA, Fur-regulated basic protein A. This family of proteins is regulated by the ferric uptake regulator protein Fur. This family does not regulate the lutABC operon encoding iron sulfur-containing enzymes necessary for growth on lactate.	5.70025e-08
NZ_CP009921.1\|WP_034655697.1\|254141_254981_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293799	cd07713, DHPS-like_MBL-fold, Methanocaldococcus jannaschii dihydropteroate synthase, Thermoanaerobacter tengcongensis Tflp, and related proteins; MBL-fold metallo hydrolase domain. This subgroup includes Methanocaldococcus jannaschii 7,8-dihydropterin-6-methyl-4-(beta-D-ribofuranosyl)-aminobenzene-5'-phosphate synthase (EC 2.5.1.15), a folate biosynthetic enzyme also known as dihydropteroate synthase and 7,8 dihydropteroate synthase. Thermoanaerobacter tengcongensis Tflp is a ferredoxin-like member. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	7.07219e-88
NZ_CP009921.1\|WP_080743203.1\|255244_255667_-\|GerAB/ArcD/ProY-family-transporter	gnl\|CDD\|281794	pfam03845, Spore_permease, Spore germination protein.	1.03576e-12

>NZ_CP009921.1|WP_034655691.1|247580_247997_-|hypothetical-protein
MAYLIRKLHLYRWGFTSVLIIFAGMYLYYFFSSQPHLTGQSPSKVWKAEYTRYDTYWEGTLKHSSEGNVTLHKFIIIENGQKVNYSPDKDTISQKSFDFMSLGDRPQKNETYIVQIEWNDSKGSHKETFPLERSYNPF
>NZ_CP009921.1|WP_034655689.1|247206_247473_-|hypothetical-protein
MKKSLQLFGTVLFISGIILFGLMHLAIALYIPHLGEWSDPPGKLIVVLDEIIGWFPYVLSILFMLLGGSMLIFDLWKSKQKEQVGKKS
>NZ_CP009921.1|WP_034655688.1|246745_247177_-|hypothetical-protein
MRDFIKLVVAAFLSTIFLSTAYGIINLTPKSEQEPNIYYFGFTDTFVFTFIYTFPVYIVVGIIFSYLIDMMANKMQTTKVYVSKLAMYSLVGVIPALAFYFLFTGIKLDYRLLFYFFALGIFASNIFYHVLLLINRILNKQKT
>NZ_CP009921.1|WP_080743140.1|246283_246676_+|UPF0715-family-protein
MTFKELLPYHALTVISSSISYSIFLIIIEPSYRAVIAFFMILLITIIPYSVAAVPLQIFLNKWPKKFNVFYLFTYCVVAILFLYISYKLQGNWSDPIWNYRKMFIFAVGAAIIYWFWDSVIMNKKEYPYY
>NZ_CP009921.1|WP_034655686.1|245611_245881_-|hypothetical-protein
MKKRFSQYSLWLSLLGIVIGVGQYFTSIYSLNILYMGVVVYLAGFTCGVIAFGKHERGLMKYFSLTSFVVIPLLIMLGMLFFAMNFGES
>NZ_CP009921.1|WP_034655683.1|245070_245574_+|hypothetical-protein
MNKRAALLLLIIGIFAYGINYGTAFANSIEERNRPEKACSEEFEKYRKKLDDRVLKDIVKSYSLDLSGFQEFTNRELDLKVGDSMNDHSDQISLQHLFVGGSIGSMRLFLENSLEGTRGYFLYKRVDGNNVLKVLNKMGNIWVVMTVDEKKADKLEQKPFNWDKCAD
>NZ_CP009921.1|WP_034655680.1|244466_244919_-|hypothetical-protein
MKKLTLVIVLSFIVLVYPYQANASKMPCSLILEPIDKHLKNAKDTALIYKVQLNPPSFPRTNISILGVHLPKPSSYGRYDGYEGVASVPNEVSWRFRMYPTPEDESPTWAGRFDLITVDMKNVKIQIRLSNSKTEKLGPPILQARMALCK
>NZ_CP009921.1|WP_034655678.1|243647_244406_-|hypothetical-protein
MKQFICLILAIGFLFSETPMASAYSDTRPALYNFVHSLTRMGSEQAEKYVAPNVDIPEIREDTPLLTIQGLPSSKENELILIGYFNDKKVANERIAFIWKVSFTKTQITNINEVYNGSNPFMNEIKTIEKYEKRHHVDILKPTIFPFEVTHVDTHQDKDALIIRYRNDNLHGLFQLKVTKTSHSLEEYASNNVVSYTLRDGTKALYQPNYIPAKQLLFQRGKIRYTIGISQSTKKNVAVSNLLQIANSMISN
>NZ_CP009921.1|WP_034655676.1|243193_243622_-|DUF3888-domain-containing-protein
MRKIIVAIFTLLLVSNASSAYATRDLPTKTKATRENILEDAVIDLLDSQMTQAAEKYYGAKNSKGVRFDCQQVLSIKKLDHPGSMMFEAILEGVSYFGPHNSPSHIFKVTIRKDYHTNGWEMKSFKVRNLKPHEVYECRDPA
>NZ_CP009921.1|WP_034655674.1|242522_243059_-|hypothetical-protein
MKHLLDRFKNTDLLEIYTYEGDVNKCLVAYILQTNEEYTLLATVGTSGLYDGHYVISTESVVSVATETEYLKKIKNLYDLKKQVHPTYTGNTEDLIRGGLEFAKAQNYIVSLMLLDSEEYSTTGFVKEIIENETVVISEVDSFGFVDGKRFIDIEAIEHLTINGEEEQDIKLLFSNNA
>NZ_CP009921.1|WP_034655693.1|252110_252707_-|hypothetical-protein
MKTSKVGIIVSVIINIVLPYLIYTILKTHITSIIALSLAACVPLVDTFYHLIKDKKLDTFSSFIFLGIVLSIVAAWIGGDERFILLRESYVTGIMGLVFLLSILTPKPLIYYFAMRFTADKSVITKRWEEEGSFRHFIRIMAAVWGIGLMIEALVKVVIVYEFPISKALVISPIAQYIVIAILIYWNIHFVKQRKQKA
>NZ_CP009921.1|WP_034655695.1|253617_253947_-|chaperone-CsaA
MATIDDFFKLDIRIGTVVKAEPFPEARKPAIKLEIDFGELGVKCSSAQITKRYKPEQLIGSQVVAVVNFPPMRIAGFKSEVLVIGGVPEEGDVVLLRPSEFVKNGTPIA
>NZ_CP009921.1|WP_034655697.1|254141_254981_-|MBL-fold-metallo-hydrolase
MKLSVLVDNNTLIDRYFLGEPALSFFIEEDDKRILFDTGYSDAFIRNAEKMRIDLRNLDWVALSHGHVDHTWGLTHLISLHMEAKSEALTHHTPTIIGHPLVFESKLLDSVSEIGSVLSYNKLSKHFPINLSKQPFWLTDKLVFLGEIKRKFNFEGKESIGKVNTEKEEFDDFIFDDTALVYKSSEGLVIMVGCAHSGICNIIEYAKEVCSEERIVDIIGGFHLLNPSDFQLENTVKYIEELDPNKLHASHCTDLYSKIALSRVADIEEVGVGLRLEYV
>NZ_CP009921.1|WP_080743203.1|255244_255667_-|GerAB/ArcD/ProY-family-transporter
MLINISVLGVSLTERSQFPLLSIVQSIQVADFLERLYVFFMFALIITSFVKINVFFYAVVIGMTSLFKIQSPSRMTYPLGLVILFLSMTIASNYQEQFYEGQTIVPFILHLPFQVIIPLLLLTVVFLRKTRGRVMKNSKN
>NZ_CP009921.1|WP_080743202.1|256391_257282_+|Rpn-family-recombination-promoting-nuclease/putative-transposase
MTKRLDLRVDFAFKSLFGTHGNESILAAFLNAALRFPDEKKIQTVQLLDPHFNKENQEDKRSILDVHAQLEDGSRVNIEIQLNNKHDMEKRTLYYWSKMYSSQMKEGMDYGELCKTITINIVNFRYLSHITNYHSTFQLYEREQKVLLTDMLEIHFMELPKLLIKWRNREVDPREDQLVRWLLLLEASEDEEITQVLEEIAMQEDQVLKKAMDEWERVSQDPEVLLAYEARKKALLDEKSALKRAENLGKIEGEKIGVEKTIKTMALGMIHKGIDNETISDLTGLSQEEINNLRRQ
>NZ_CP009921.1|WP_034655699.1|257453_258008_-|helix-turn-helix-domain-containing-protein
MKEINLIIAKNLKGFRESKKLSLERVSELTGVSKTMIGQIERGESSPTITTIWKIANGLKISFTSLINDPQPDTKVISKDEIQILSEDNGKYRVYPYFPFEDDRRFEVYSIEIEEGGSVEANLHREGTEEFITVFEGELTISINSNEYIIKRGNAISFRADRPHSYYNRGKTLTRLSMIIYYPV
>NZ_CP009921.1|WP_034655701.1|258121_258706_+|LysE-family-transporter
MPVLSFLLYVFVTSFTPGPNNIMAMLFANKYGLKKTLKFCVGVGAGFLIVMLLCSYLNLLLKNFIPKIEFFMTILGAGYMIYLAIKIIRSRGDNENNNEDRNNSFFMGMLLQFINPKGILYGITAIATFILPYHNSNFSLLMYSLFLALIGFMSTFCWSLFGSFFQKFLSKYRNQFNIVMALLLMYSAVSILIK
>NZ_CP009921.1|WP_080743204.1|259515_259689_+|Fur-regulated-basic-protein-FbpA
MSKQICSDIQRKKNLIIDSLIHLGIYKKGNKQLYELTLHELETEYQIVNPAIQDLSF
>NZ_CP009921.1|WP_034655704.1|259733_259916_+|hypothetical-protein
MFLKKLIKNGLVTVHYYENESLQTCKGRVYNLNLHEQTLSLRDEKQNIFLIRLSGVEDIY
>NZ_CP009921.1|WP_034655705.1|260393_260657_+|hypothetical-protein
MNTTVNELYDFGIVLRGKLLNSNLYAYYLIDAMRRENHFDFLYYFLTATVDSQTPIPERVSNVFLEILSDKEKLSDLTPFVMGLVEK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Identity
NZ_CP009921_1	1.1\|251388\|51\|NZ_CP009921\|CRISPRCasFinder	251388-251438	51	NZ_CP009921	Bacillus megaterium NBRC 15308 = ATCC 14581 plasmid pBMV_2, complete sequence	251388-251438	1.0
NZ_CP009921_1	1.1\|251388\|51\|NZ_CP009921\|CRISPRCasFinder	251388-251438	51	NZ_CP035095	Bacillus megaterium NBRC 15308 = ATCC 14581 plasmid unnamed1, complete sequence	225535-225585	1.0
NZ_CP009921_2	2.1\|251634\|51\|NZ_CP009921\|CRISPRCasFinder	251634-251684	51	NZ_CP009921	Bacillus megaterium NBRC 15308 = ATCC 14581 plasmid pBMV_2, complete sequence	251634-251684	1.0
NZ_CP009921_2	2.1\|251634\|51\|NZ_CP009921\|CRISPRCasFinder	251634-251684	51	NZ_CP035095	Bacillus megaterium NBRC 15308 = ATCC 14581 plasmid unnamed1, complete sequence	225289-225339	1.0

1. spacer 1.1|251388|51|NZ_CP009921|CRISPRCasFinder matches to NZ_CP009921 (Bacillus megaterium NBRC 15308 = ATCC 14581 plasmid pBMV_2, complete sequence) position: , mismatch: 0, identity: 1.0

ggtaacggaaaaacagacgtaaaaggaaagttttctgtagctattccgaag	CRISPR spacer
ggtaacggaaaaacagacgtaaaaggaaagttttctgtagctattccgaag	Protospacer
***************************************************

2. spacer 1.1|251388|51|NZ_CP009921|CRISPRCasFinder matches to NZ_CP035095 (Bacillus megaterium NBRC 15308 = ATCC 14581 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ggtaacggaaaaacagacgtaaaaggaaagttttctgtagctattccgaag	CRISPR spacer
ggtaacggaaaaacagacgtaaaaggaaagttttctgtagctattccgaag	Protospacer
***************************************************

3. spacer 2.1|251634|51|NZ_CP009921|CRISPRCasFinder matches to NZ_CP009921 (Bacillus megaterium NBRC 15308 = ATCC 14581 plasmid pBMV_2, complete sequence) position: , mismatch: 0, identity: 1.0

gcaagtggaaaagtagataaaaatggaaagtttagtattaaaataataaaa	CRISPR spacer
gcaagtggaaaagtagataaaaatggaaagtttagtattaaaataataaaa	Protospacer
***************************************************

4. spacer 2.1|251634|51|NZ_CP009921|CRISPRCasFinder matches to NZ_CP035095 (Bacillus megaterium NBRC 15308 = ATCC 14581 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gcaagtggaaaagtagataaaaatggaaagtttagtattaaaataataaaa	CRISPR spacer
gcaagtggaaaagtagataaaaatggaaagtttagtattaaaataataaaa	Protospacer
***************************************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 60297

Bacillus_phage(30.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034655754.1\|1678_2311_-	3-hexulose-6-phosphate synthase	NA	NA	NA	NA
WP_034655752.1\|2515_2878_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_034655750.1\|3443_4898_+	glucose-6-phosphate dehydrogenase	M4SP85	Cyanophage	1.1e-74	35.9
WP_034655749.1\|5033_5741_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	1.7e-52	50.2
WP_115648270.1\|6310_7834_-	PLDc N-terminal domain-containing protein	NA	NA	NA	NA
WP_115648271.1\|8036_8501_-	hypothetical protein	NA	NA	NA	NA
WP_034655745.1\|8988_9555_+	recombinase family protein	A0A219Y9V9	Aeromonas_phage	3.8e-31	39.0
WP_155276318.1\|9569_9722_-	hypothetical protein	NA	NA	NA	NA
WP_168797096.1\|9980_10157_-	hypothetical protein	NA	NA	NA	NA
WP_034655743.1\|12110_12971_-	DUF421 domain-containing protein	NA	NA	NA	NA
WP_034655740.1\|13010_13217_-	DUF1657 domain-containing protein	NA	NA	NA	NA
WP_034655737.1\|13229_13580_-	stage V sporulation protein AE	NA	NA	NA	NA
WP_034655735.1\|13585_14596_-	stage V sporulation protein AD	NA	NA	NA	NA
WP_034655733.1\|14595_15075_-	stage V sporulation protein AC	NA	NA	NA	NA
WP_034655731.1\|15091_15565_-	YhcN/YlaJ family sporulation lipoprotein	NA	NA	NA	NA
WP_034655729.1\|15643_15847_-	DUF1657 domain-containing protein	NA	NA	NA	NA
WP_034655727.1\|16176_16725_+	YhcN/YlaJ family sporulation lipoprotein	NA	NA	NA	NA
WP_016766534.1\|17014_17227_+	hypothetical protein	NA	NA	NA	NA
WP_136461703.1\|20651_21959_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_034650889.1\|22342_23875_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_034655810.1\|24037_24475_-	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_034655812.1\|24814_25168_-	DoxX family protein	NA	NA	NA	NA
WP_034655815.1\|25197_25650_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_034655818.1\|25690_26452_-	pirin family protein	NA	NA	NA	NA
WP_115648274.1\|26994_27123_+	anti-repressor SinI family protein	NA	NA	NA	NA
WP_080743139.1\|27181_27295_-	anti-repressor SinI family protein	NA	NA	NA	NA
WP_034655821.1\|27506_28052_-	recombinase family protein	A0A1V0E035	Clostridioides_phage	1.3e-23	36.1
WP_155276319.1\|29030_29204_+	hypothetical protein	NA	NA	NA	NA
WP_034655823.1\|29321_29681_-	hypothetical protein	NA	NA	NA	NA
WP_034655826.1\|29948_30422_-	hypothetical protein	NA	NA	NA	NA
WP_080743217.1\|31343_31517_+	Fur-regulated basic protein FbpA	NA	NA	NA	NA
WP_034655829.1\|31561_31744_+	YolD-like family protein	NA	NA	NA	NA
WP_029325260.1\|32639_32903_+	hypothetical protein	NA	NA	NA	NA
WP_034655833.1\|33070_33343_+	stage V sporulation protein S	J9PTX7	Bacillus_phage	1.5e-12	48.1
WP_029325262.1\|33524_33803_-	HU family DNA-binding protein	A7KV42	Bacillus_phage	1.1e-23	64.4
WP_034655836.1\|34545_34998_-	hypothetical protein	NA	NA	NA	NA
WP_034655838.1\|35086_35833_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_034655841.1\|35952_36384_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_034655843.1\|36477_36927_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_034655845.1\|37238_37781_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_051975665.1\|37764_38685_+	stage II sporulation protein P	NA	NA	NA	NA
WP_115648253.1\|38759_39910_-\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.0e-38	63.0
WP_034655850.1\|40063_40663_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_034655853.1\|40740_41973_-	MFS transporter	NA	NA	NA	NA
WP_034655856.1\|41977_43021_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_034655860.1\|43288_43705_-	hypothetical protein	NA	NA	NA	NA
WP_034655861.1\|44239_45238_+	formamidase	NA	NA	NA	NA
WP_034655863.1\|45718_45901_+	hypothetical protein	NA	NA	NA	NA
WP_034655867.1\|46695_47112_+	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_034655870.1\|47329_48541_+	glycosyl transferase	E5KJ78	Phthorimaea_operculella_granulovirus	2.6e-13	30.4
WP_034655872.1\|48578_49217_+	elongation factor G-binding protein	NA	NA	NA	NA
WP_034655875.1\|49519_50389_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_034655877.1\|50470_50875_+	cytidine deaminase	NA	NA	NA	NA
WP_034655880.1\|51136_52603_+	serine hydrolase	NA	NA	NA	NA
WP_034655882.1\|52799_53402_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_115648272.1\|53579_54122_-	HAD-IIIA family hydrolase	NA	NA	NA	NA
WP_034655887.1\|54298_54733_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_034655892.1\|55568_56450_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.8e-43	42.4
WP_034655895.1\|56458_56755_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_034655899.1\|57382_57901_+	DinB family protein	NA	NA	NA	NA
WP_034656161.1\|57941_58481_+	DUF1697 domain-containing protein	NA	NA	NA	NA
WP_034655903.1\|58868_59222_-	hypothetical protein	NA	NA	NA	NA
WP_034655906.1\|59403_60297_-	MarR family transcriptional regulator	Q0SPI3	Clostridium_phage	1.1e-11	40.6

DBSCAN-SWA_2

63836 : 71143

Bacillus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034655909.1\|63836_64109_-	HU family DNA-binding protein	A7KV42	Bacillus_phage	7.5e-25	67.8
WP_034655911.1\|64530_64749_-	hypothetical protein	NA	NA	NA	NA
WP_034655913.1\|65456_67106_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.2e-87	38.3
WP_034655916.1\|67864_68200_+	PadR family transcriptional regulator	NA	NA	NA	NA
WP_051975669.1\|68201_68741_+	DUF2812 domain-containing protein	NA	NA	NA	NA
WP_034655918.1\|69049_69532_-	hypothetical protein	NA	NA	NA	NA
WP_034656042.1\|69913_71143_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	3.4e-85	50.3

DBSCAN-SWA_3

74190 : 77707

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034655929.1\|74190_75546_-	S8 family serine peptidase	A0A2H4PQH1	Staphylococcus_phage	4.5e-86	40.3
WP_051975671.1\|75577_77707_-	peptidase domain-containing ABC transporter	W8CYL7	Bacillus_phage	2.2e-39	27.1

DBSCAN-SWA_4

82613 : 82808

Brevibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034655944.1\|82613_82808_-	helix-turn-helix transcriptional regulator	S5M643	Brevibacillus_phage	5.5e-06	48.1

DBSCAN-SWA_5

85946 : 86792

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034655954.1\|85946_86792_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.6e-15	28.9

DBSCAN-SWA_6

91471 : 91957

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034655968.1\|91471_91957_-	dihydrofolate reductase	A0A076GDN3	Bacillus_phage	1.1e-31	39.4

DBSCAN-SWA_7

96165 : 106744

Bacillus_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034655986.1\|96165_96984_+	hypothetical protein	Q9AYX4	Lactococcus_phage	9.4e-31	33.6
WP_034655990.1\|97117_99244_+	AAA family ATPase	NA	NA	NA	NA
WP_034655991.1\|99233_101033_+	ATP-dependent helicase	E3T5J8	Cafeteria_roenbergensis_virus	3.6e-22	22.7
WP_034655994.1\|101039_101915_+	DUF4263 domain-containing protein	NA	NA	NA	NA
WP_051975672.1\|102082_103225_+	3'-5' exonuclease	A0A0K2SUJ2	Clostridium_phage	1.5e-21	39.6
WP_034655997.1\|103385_104582_-	RES family NAD+ phosphorylase	NA	NA	NA	NA
WP_034655999.1\|104883_106149_+	damage repair protein	O64031	Bacillus_phage	5.3e-105	48.0
WP_034656002.1\|106168_106504_+	YolD-like family protein	NA	NA	NA	NA
WP_168797093.1\|106567_106744_+	hypothetical protein	A0A1P8CWV7	Bacillus_phage	7.2e-13	64.4

DBSCAN-SWA_8

110378 : 115190

Bacillus_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034656009.1\|110378_110588_+	alpha/beta-type small acid-soluble spore protein	A0A1P8CX76	Bacillus_phage	3.4e-17	71.4
WP_034656012.1\|111020_111320_+	hypothetical protein	NA	NA	NA	NA
WP_034656014.1\|111332_112466_+	chromosome partitioning protein ParA	Q0H250	Geobacillus_phage	1.8e-56	34.4
WP_034656016.1\|112462_113158_+	hypothetical protein	Q0H249	Geobacillus_phage	3.5e-34	37.6
WP_034656018.1\|113453_113681_-	helix-turn-helix transcriptional regulator	A0A0S2GLH4	Bacillus_phage	1.2e-07	42.4
WP_034656020.1\|114296_115190_-	sigma-70 family RNA polymerase sigma factor	A8ATD7	Listeria_phage	2.2e-12	30.5

DBSCAN-SWA_9

120349 : 125393

Streptococcus_phage(66.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_051975680.1\|120349_121747_+	sensor histidine kinase	A0A1B1IUJ1	uncultured_Mediterranean_phage	6.8e-05	21.3
WP_034656181.1\|121746_122307_+	response regulator transcription factor	NA	NA	NA	NA
WP_051975673.1\|122479_122890_-	helix-turn-helix transcriptional regulator	A0A141E0Q5	Streptococcus_phage	1.6e-07	34.7
WP_051975681.1\|123044_123251_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_034656040.1\|123292_123541_+	hypothetical protein	NA	NA	NA	NA
WP_034656042.1\|124163_125393_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	3.4e-85	50.3

DBSCAN-SWA_10

131928 : 133743

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_177623026.1\|131928_133743_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.8e-27	27.8

DBSCAN-SWA_11

141059 : 142091

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_148313028.1\|141059_142091_+	lysozyme family protein	A0A0A0RVE6	Bacillus_phage	1.2e-33	56.0

DBSCAN-SWA_12

152918 : 154088

Clostridium_phage(100.0%)

integrase

attL 152738:152751|attR 154152:154165

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
152738:152751	attL	NA	NA	NA	NA
WP_041907505.1\|152918_154088_+\|integrase	tyrosine-type recombinase/integrase	A0A0A8WIF9	Clostridium_phage	2.2e-12	28.6
WP_041907505.1\|152918_154088_+\|integrase	tyrosine-type recombinase/integrase	A0A0A8WIF9	Clostridium_phage	2.2e-12	28.6
154152:154165	attR	NA	NA	NA	NA

DBSCAN-SWA_13

157981 : 158641

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034656106.1\|157981_158254_-	HU family DNA-binding protein	A7KV42	Bacillus_phage	2.4e-23	66.7
WP_034656103.1\|158428_158641_-	alpha/beta-type small acid-soluble spore protein	A0A1P8CX76	Bacillus_phage	5.3e-18	70.3

DBSCAN-SWA_14

171250 : 171796

Clostridioides_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034655821.1\|171250_171796_-	recombinase family protein	A0A1V0E035	Clostridioides_phage	1.3e-23	36.1

DBSCAN-SWA_15

207954 : 208236

Paenibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034655538.1\|207954_208236_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	2.8e-11	70.8

DBSCAN-SWA_16

212192 : 213362

Clostridium_phage(100.0%)

integrase

attL 212116:212129|attR 213530:213543

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
212116:212129	attL	NA	NA	NA	NA
WP_034652922.1\|212192_213362_-\|integrase	tyrosine-type recombinase/integrase	A0A0A8WIF9	Clostridium_phage	7.4e-13	29.0
WP_034652922.1\|212192_213362_-\|integrase	tyrosine-type recombinase/integrase	A0A0A8WIF9	Clostridium_phage	7.4e-13	29.0
213530:213543	attR	NA	NA	NA	NA

DBSCAN-SWA_17

229892 : 236714

Bacillus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034655635.1\|229892_230117_+	helix-turn-helix transcriptional regulator	A0A0S2GLH4	Bacillus_phage	1.9e-10	47.2
WP_034655638.1\|230195_231395_-	glycosyl transferase	Q8JPS2	Spodoptera_littoralis_nuclear_polyhedrosis_virus	1.6e-15	32.1
WP_013084404.1\|231729_231939_-	alpha/beta-type small acid-soluble spore protein	A0A1P8CX76	Bacillus_phage	3.4e-17	71.4
WP_051975660.1\|232390_232627_+	hypothetical protein	NA	NA	NA	NA
WP_034655641.1\|232776_233655_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_034655644.1\|233852_234197_-	hypothetical protein	NA	NA	NA	NA
WP_034655645.1\|234658_235507_+	MBL fold metallo-hydrolase	Q0H255	Geobacillus_phage	2.6e-100	66.4
WP_034655647.1\|235509_235731_+	DUF3006 domain-containing protein	Q0H256	Geobacillus_phage	3.0e-16	61.1
WP_034655649.1\|236112_236325_+	hypothetical protein	NA	NA	NA	NA
WP_034655652.1\|236429_236714_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	6.8e-05	42.2

DBSCAN-SWA_18

244466 : 244919

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034655680.1\|244466_244919_-	hypothetical protein	O64117	Bacillus_phage	2.8e-53	65.8

DBSCAN-SWA_19

260963 : 265565

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034655707.1\|260963_261938_+	zinc-dependent alcohol dehydrogenase family protein	E3SJ82	Synechococcus_phage	2.8e-05	26.1
WP_115648268.1\|262022_262160_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_016766009.1\|262301_262514_+	alpha/beta-type small acid-soluble spore protein	A0A1P8CX76	Bacillus_phage	1.9e-15	64.2
WP_034655709.1\|263494_265009_+	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	4.6e-23	25.7
WP_034655711.1\|265292_265565_-	HU family DNA-binding protein	A7KV42	Bacillus_phage	1.9e-20	57.8

DBSCAN-SWA_20

274605 : 279510

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034655801.1\|274605_276255_+	catalase	A0A2K9L572	Tupanvirus	9.6e-99	44.7
WP_034655799.1\|276391_277519_-	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	A0A218MNE0	uncultured_virus	1.3e-86	47.3
WP_080743219.1\|278064_278364_+	hypothetical protein	NA	NA	NA	NA
WP_034655796.1\|278376_279510_+	chromosome partitioning protein ParA	Q0H250	Geobacillus_phage	8.1e-57	33.8

DBSCAN-SWA_21

295097 : 296051

Shigella_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082181085.1\|295097_296051_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.1e-42	36.4

DBSCAN-SWA_22

299818 : 300535

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016766130.1\|299818_300535_+	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	2.6e-45	74.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP009919

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP009920

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP009921

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection