CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP009369	Bacillus cereus strain FM1 chromosome, complete genome	2 crisprs	csa3,cas14k,cas3,cas14j,DEDDh,WYL,c2c9_V-U4,Cas14u_CAS-V,DinG	0	1	6	0
NZ_CP009368	Bacillus cereus strain FM1 plasmid unnamed, complete sequence	0 crisprs	cas14j,csa3,Cas14u_CAS-V	0	0	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP009369_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009369_1

3778099-3778354

Orphan

Consensus_repeat	Method
TTCTCATGCGGAAGGTAAACATACA	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP009369_1

>merge|NZ_CP009369|1|3778099-3778354|CRISPRCasFinder
CTCTAATGCAGAGGGTACAGCTTCACATGCAGAAGGGCTTCTGACACATGCAAAAGGGTCTTTCTCTCATGCAGAAGGATCAAAAACGAAAGCAACTGGACATAGTTCCCATAGTGAAGGAAGTGAAACGACAGCAGGTGGCTCTTATTCTCATGCGGAAGGTAAACATACAATCGCTTTAGGCGAAGCAGCACATGCAGAAGGAACCGCTACTATCGCTAACGGATTCTCTTCTCATGCGGAAGGTAATCATACA

>NZ_CP009369|1|1|3778099-3778354|CRISPRCasFinder
CTCTAATGCAGAGGGTACAGCTTCA	CATGCAGAAGGGCTTCTGACACATGCAAAAGGGTCTTT
CTCTCATGCAGAAGGATCAAAAACG	AAAGCAACTGGACATAGTTCCCATAGTGAAGGAAGTGAAACGACAGCAGGTGGCTCTTA
TTCTCATGCGGAAGGTAAACATACA	ATCGCTTTAGGCGAAGCAGCACATGCAGAAGGAACCGCTACTATCGCTAACGGATTCTC
TTCTCATGCGGAAGGTAATCATACA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009369.1\|WP_002194687.1\|3781960_3782539_+\|CYTH-domain-containing-protein	unknown	unknown	gnl\|CDD\|143627
NZ_CP009369.1\|WP_002194685.1\|3784531_3786358_-\|oligoendopeptidase-F	unknown	unknown	gnl\|CDD\|341071
NZ_CP009369.1\|WP_000360642.1\|3783115_3784009_+\|DsbA-family-protein	unknown	unknown	gnl\|CDD\|372699
NZ_CP009369.1\|WP_002194688.1\|3780775_3781414_-\|GTP-pyrophosphokinase-family-protein	unknown	unknown	gnl\|CDD\|225232
NZ_CP009369.1\|WP_001059624.1\|3774415_3775351_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|366154
NZ_CP009369.1\|WP_002194697.1\|3769584_3770274_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369778
NZ_CP009369.1\|WP_001004749.1\|3773650_3774409_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP009369.1\|WP_000428850.1\|3772660_3773506_+\|macrocin-O-methyltransferase	unknown	unknown	gnl\|CDD\|377550
NZ_CP009369.1\|WP_002194686.1\|3782717_3783116_+\|globin-family-protein	unknown	unknown	gnl\|CDD\|381281
NZ_CP009369.1\|WP_000799204.1\|3787733_3789278_-\|cardiolipin-synthase	unknown	unknown	gnl\|CDD\|234967
NZ_CP009369.1\|WP_033691187.1\|3786408_3787653_-\|competence-protein	unknown	unknown	gnl\|CDD\|226875
NZ_CP009369.1\|WP_001180001.1\|3781444_3781816_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009369.1\|WP_042515568.1\|3776732_3777473_+\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	unknown	unknown	gnl\|CDD\|184187
NZ_CP009369.1\|WP_002194692.1\|3775497_3776658_+\|rod-shape-determining-protein-RodA	unknown	unknown	gnl\|CDD\|274033
NZ_CP009369.1\|WP_000654997.1\|3768208_3768889_-\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NZ_CP009369.1\|WP_002194689.1\|3779050_3779944_-\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|223638
NZ_CP009369.1\|WP_000673185.1\|3779959_3780757_-\|NAD-kinase	unknown	unknown	gnl\|CDD\|235317
NZ_CP009369.1\|WP_042515566.1\|3768901_3769588_-\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NZ_CP009369.1\|WP_002194696.1\|3770414_3771512_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133005
NZ_CP009369.1\|WP_042515567.1\|3771677_3772538_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375999

Protein	Function_ID	Function_description	E-value
NZ_CP009369.1\|WP_002194685.1\|3784531_3786358_-\|oligoendopeptidase-F	gnl\|CDD\|341071	cd09608, M3B_PepF, Peptidase family M3B, oligopeptidase F (PepF). Peptidase family M3B oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the Bacillus amyloliquefaciens PepF oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over-expressed from a multicopy plasmid. This PepF family includes Streptococcus agalactiae PepB, a group B streptococcal oligopeptidase which has been shown to degrade a variety of bioactive peptides as well as the synthetic collagen-like substrate N-(3-[2-furyl]acryloyl)-Leu-Gly- Pro-Ala in vitro.	0
NZ_CP009369.1\|WP_000360642.1\|3783115_3784009_+\|DsbA-family-protein	gnl\|CDD\|372699	pfam13743, Thioredoxin_5, Thioredoxin.	7.3476e-93
NZ_CP009369.1\|WP_002194688.1\|3780775_3781414_-\|GTP-pyrophosphokinase-family-protein	gnl\|CDD\|225232	COG2357, COG2357, PpGpp synthetase catalytic domain [General function prediction only].	6.41701e-95
NZ_CP009369.1\|WP_001059624.1\|3774415_3775351_+\|glycosyltransferase	gnl\|CDD\|366154	pfam00535, Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.	1.50811e-21
NZ_CP009369.1\|WP_002194697.1\|3769584_3770274_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369778	pfam08242, Methyltransf_12, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	5.60712e-18
NZ_CP009369.1\|WP_001004749.1\|3773650_3774409_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	1.11413e-18
NZ_CP009369.1\|WP_000428850.1\|3772660_3773506_+\|macrocin-O-methyltransferase	gnl\|CDD\|377550	pfam05711, TylF, Macrocin-O-methyltransferase (TylF). This family consists of bacterial macrocin O-methyltransferase (TylF) proteins. TylF is responsible for the methylation of macrocin to produce tylosin. Tylosin is a macrolide antibiotic used in veterinary medicine to treat infections caused by Gram-positive bacteria and as an animal growth promoter in the swine industry. It is produced by several Streptomyces species. As with other macrolides, the antibiotic activity of tylosin is due to the inhibition of protein biosynthesis by a mechanism that involves the binding of tylosin to the ribosome, preventing the formation of the mRNA-aminoacyl-tRNA-ribosome complex. The structure of one representative sequence from this family, NovP, shows it to be an S-adenosyl-l-methionine-dependent O-methyltransferase that catalyzes the penultimate step in the biosynthesis of the aminocoumarin antibiotic novobiocin. Specifically, it methylates at 4-OH of the noviose moiety, and the resultant methoxy group is important for the potency of the mature antibiotic. It is likely that the key structural features of NovP are common to the rest of the family and include: a helical 'lid' region that gates access to the co-substrate binding pocket and an active centre that contains a 3-Asp putative metal binding site. A further conserved Asp probably acts as the general base that initiates the reaction by de-protonating the 4-OH group of the noviose unit.	1.27737e-148
NZ_CP009369.1\|WP_002194686.1\|3782717_3783116_+\|globin-family-protein	gnl\|CDD\|381281	cd14772, TrHb2_Bs-trHb-like_O, Truncated hemoglobins, group 2 (O); Bacillus subtilis TrHb like. The M- and S families exhibit the canonical secondary structure of hemoglobins, a 3-over-3 alpha-helical sandwich structure (3/3 Mb-fold), built by eight alpha-helical segments. Truncated hemoglobins (TrHbs, 2/2Hb, or 2/2 globins) or the T family globins adopt a 2-on-2 alpha-helical sandwich structure, resulting from extensive and complex modifications of the canonical 3-on-3 alpha-helical sandwich that are distributed throughout the whole protein molecule. TrHbs are classified into three main groups based on their structural properties and named after Mycobacterium sp. genes glbN, glbO, and glbP: TrHb1s (N), TrHb2s (O) and TrHb3s (P). TrHb2's belonging to this group include monomeric Bacillus subtilis trHb (Bs-trHb), which exhibits an extremely high oxygen affinity, and a dimeric TrHb2 from the thermophilic aerobic spore forming bacterium Geobacillus stearothermophilus(Gs-trHb).	2.22492e-69
NZ_CP009369.1\|WP_000799204.1\|3787733_3789278_-\|cardiolipin-synthase	gnl\|CDD\|234967	PRK01642, cls, cardiolipin synthetase; Reviewed.	0
NZ_CP009369.1\|WP_033691187.1\|3786408_3787653_-\|competence-protein	gnl\|CDD\|226875	COG4469, CoiA, Competence protein CoiA-like family, contains a predicted nuclease domain [General function prediction only].	1.43371e-59
NZ_CP009369.1\|WP_002194687.1\|3781960_3782539_+\|CYTH-domain-containing-protein	gnl\|CDD\|143627	cd07762, CYTH-like_Pase_1, Uncharacterized subgroup 1 of the CYTH-like superfamily. Enzymes belonging to the CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) superfamily hydrolyze triphosphate-containing substrates, require metal cations as cofactors, and have a unique active site located at the center of an eight-stranded antiparallel beta barrel tunnel (the triphosphate tunnel). The name CYTH originated from the gene designation for bacterial class IV adenylyl cyclases (CyaB) and from thiamine triphosphatase. Class IV adenylate cyclases catalyze the conversion of ATP to 3',5'-cyclic AMP (cAMP) and PPi. Thiamine triphosphatase is a soluble cytosolic enzyme which converts thiamine triphosphate to thiamine diphosphate. This domain superfamily also contains RNA triphosphatases, membrane-associated polyphosphate polymerases, tripolyphosphatases, nucleoside triphosphatases, nucleoside tetraphosphatases and other proteins with unknown functions. Proteins of this subgroup are of bacterial origin and have not been characterized.	8.27008e-84
NZ_CP009369.1\|WP_042515568.1\|3776732_3777473_+\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	gnl\|CDD\|184187	PRK13625, PRK13625, bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional.	0
NZ_CP009369.1\|WP_002194692.1\|3775497_3776658_+\|rod-shape-determining-protein-RodA	gnl\|CDD\|274033	TIGR02210, Rod_shape-determining_protein_RodA, rod shape-determining protein RodA. This protein is a member of the FtsW/RodA/SpoVE family (pfam01098). It is found only in species with rod (or spiral) shapes. In many species, mutation of rodA has been shown to correlate with loss of the normal rod shape. Note that RodA homologs are found, scoring below the cutoffs for this model, in a number of both rod-shaped and coccoid bacteria, including four proteins in Bacillus anthracis, for example. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Cell division].	1.00668e-99
NZ_CP009369.1\|WP_000654997.1\|3768208_3768889_-\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	7.49705e-107
NZ_CP009369.1\|WP_002194689.1\|3779050_3779944_-\|RluA-family-pseudouridine-synthase	gnl\|CDD\|223638	COG0564, RluA, Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis].	3.37206e-99
NZ_CP009369.1\|WP_000673185.1\|3779959_3780757_-\|NAD-kinase	gnl\|CDD\|235317	PRK04885, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional.	0
NZ_CP009369.1\|WP_042515566.1\|3768901_3769588_-\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	4.62494e-110
NZ_CP009369.1\|WP_002194696.1\|3770414_3771512_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|133005	cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.	3.17044e-53
NZ_CP009369.1\|WP_042515567.1\|3771677_3772538_+\|hypothetical-protein	gnl\|CDD\|375999	pfam18573, BclA_C, BclA C-terminal domain. This is the C-terminal domain of BclA (Bacillus collagen-like protein of anthracis) which is expressed on spores of Bacillus species. Trimers of the C-terminal domain (CTD) form the tips of the spore's hair-like nap and are the immunodominant target of vertebrate antibodies and drive trimerization. Structure analysis indicate the C-terminal region of the peptide folding into an all-beta structure with a jelly-fold topology, similar to the first human complement C1q, a member of the tumor necrosis factor (TNF)-like family. The C-terminal globular domain has been shown to be located on the exterior of the exosporium, and therefore is critical in determining the immunogenicity of the spore in a mammalian host.	1.10617e-18

>NZ_CP009369.1|WP_042515568.1|3776732_3777473_+|bis(5'-nucleosyl)-tetraphosphatase-PrpE
MKYDIIGDIHGCFQEFQDLTKKLGYDWNSDLPIHPDRRKLAFVGDITDRGPHSLRMIEIVWELVINKKVAYYAPGNHCNKLYRFFLGRNVTIAHGLETTVAEYETLPSHKQNMIKEKFITLYEHSPFYHVLDEKRLIVCHAGIRQDYIGRQDKKVQTFVLYGDITGEKHADGSPVRRDWAKEYRGTAWIVYGHTPVKEPRFVNHTVNIDTGAVFGGKLTGLRYPEMETVSVPSSLPFVPEKFRPIS
>NZ_CP009369.1|WP_002194692.1|3775497_3776658_+|rod-shape-determining-protein-RodA
MKDPNSQYQIDYVLLFILFAIGIVSCFAIASAQASLPSFLQNVNFVLKQIQWYFIGFIAIGMIMIIDFDRYQKIAWYLYSFALVLLIGLEFQVPGAITIKGATAWYRLPGIGNFQPSEIMKLFLIIVTGRIIANHNEKYFYRTIHDDFLLLGKICATSLPPLLLIAKEPDLGNTMVISAMLAAMILVSGIRWRFIFGLVSGIFAVGVTLTYIFFTHTKFFKAHILQEYQLNRFYGWLAPYKYDAQGYQLRQAFLATGSGEMQGKGWENGQVYFPEPHTDFIFTNVAEQFGFLGASVIIALFFLLIFRMIHIALESNDPFGSYICAGTIGMFTFQVFQNIGMTIGLLPITGITLPLMSYGGSSLLTYMIAIGFVLNVRSRTKIFMFN
>NZ_CP009369.1|WP_001059624.1|3774415_3775351_+|glycosyltransferase
MNNIKNPPLVSILIPTYNRPHYFKIALESALAQTYPNIEIIVGDDSTNDEIEILMQTHYLPNYKHITYIRNATTLGQFNNSLMLLKQSHGEYINFLMDDDIFYNSKIEKMMFYFQKDLDQNLALITSYRTWINDDGEIIEQHPSMKRLYDEDTLLNGTDLGNHMLILGQNIIGEPTTVLFRKRLLTEPFGTLNGRNYNCSVDMASWISLLSKGDAIYITEPLSSFRLHTGQQVHHKYLEGCEDFSHLVLNSKKYGFLQEIDYYKTSLLKACEWHKNATTFYQLYPELIPTTDTHIRLSHCLNIVTKELRAI
>NZ_CP009369.1|WP_001004749.1|3773650_3774409_+|class-I-SAM-dependent-methyltransferase
MNENEKKTTLIPPPELVQYVGGDFEEVGKEFMQYFIEIGNLKSNETVLDVGCGIGRMAVPLMNYLSDDGTYYGFDLFNKGITWCKNNISTRRNNFHFEHVDIYNQFYNPDGKEDASQYKFPYEDESFDFIFLTSVFTHLLPKELEHYVCEIARVLKKDGRCFITFFLINPESSYYLNAGLSTLGFYHQIDNCYVLNKEIPNFAVAYPEEDIRTLLNKYGLEIQTPPHYGSWCGRTEHTSYQDIILTQKISER
>NZ_CP009369.1|WP_000428850.1|3772660_3773506_+|macrocin-O-methyltransferase
MENKSAVQLYLELLKKTILFEIWLEYEPYLPASLHISKELSYEPVTVPLPLFLKQYIENHNLKIVNPNVSNNERQGGKDWPRAAHSMVGRKRMNQLQEAMETVVRENIEGDFIETGVWRGGSCIFMNGFLQANNIKDRTVWVADSFEGLPAPNLEQYPKDYGDYLHTFDYLRVSLETVQENFRKYDLLNDQVKFLKGWFKDTLPSAPVEKIAIARLDGDMYESTMDSLVNLYDKVSTGGFIIIDDYGLITCAEAVTDFRSERNIKTPMTQIDDFGIYWRKE
>NZ_CP009369.1|WP_042515567.1|3771677_3772538_+|hypothetical-protein
MSNNNYSDGLNPDESLSASAFDPNLVGPTLPPIPPFTLPTGPTGPTGPTGPTGPTVPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGDTGTTGPTGPTGDTGATGPTGPTGDTGATGPTGPTGDTGATGPTGPTGPTGPTGPSGLGLPAGLYAFNSAGISLDLGLNAPVPFNTVGSQFGTAISQLDPDTFVISETGFYKITVIVYTAALSVLGGLTIQVNGVSVPGTGATLISVGAPIVVQAITQITTTPSLVEVIVTGLGLSLALGTNASIIIEKIA
>NZ_CP009369.1|WP_002194696.1|3770414_3771512_-|glycosyltransferase-family-2-protein
MLNKQGITISLCMIVRDEEDTIGRCLEAVEKIVDEIIIVDTGSIDRTKEIVAQYTSNIYDFPWVNDFAAARNFSFSKATQEYILWLDADDVLLEDAQEALKLLKRELDPKIDAVSMPYHLALDSSGKPLYCTKRNRLVKREKQFQWFGKVHEYLAISGETFSSNVAITHKKEKKVTNRNLKIFQNAVAAGEELSPRDLFYYANESMDNQKYDDAVMLYETFLNQDEGWYEEKIYACGKLGDCYAKLGSWEKAIESCVKSFRYDVPRGENCTRIGYIYMEQQKYNEAIFWFKLATEVPMATESPFHSPASYTWLPYLQMCICYSKLGEQDKAYYYNELAAAYVPNNAAIEYNRKYFRSVFDKQYKV
>NZ_CP009369.1|WP_002194697.1|3769584_3770274_-|class-I-SAM-dependent-methyltransferase
MNPEKSSLYEEKSEHYYNAANPNLLKHIKKEWKEVLDIGCSGGALGAAIKENGTRVSGIEAFPEAAEKAKERLDHVILGDIEKINLPYEEEQFDCVIFGDVLEHLFDPWAVIEKVKPYIKENGVILASIPNVAHISVLAPLLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYIDHKVYEPLIEELYGICKKYRLGSGFMAETVVFQYIIEAEKSQL
>NZ_CP009369.1|WP_042515566.1|3768901_3769588_-|streptomycin-biosynthesis-protein-StrF
MSAAEKTILFVTCINDRKMYAQCVRHILSLAVPPGYTVQFMPIRNAKSMTSGYNQAISHPAKYKVYIHQDVFIMNVAFLYGLLQLFNEHEHLGMIGMIGAQYVPPNGIWNEGKGVVGKVIGYMNDLFYMATQEQPYHESKTFMPVECIDGLLMATQYDIPWREDLFDGFDYYDVSQSFEFRKAGYTVGVPVQRDAWCIHYHIDVNMTNYDKYRKIFVENYMSDVNQDE
>NZ_CP009369.1|WP_000654997.1|3768208_3768889_-|streptomycin-biosynthesis-protein-StrF
MKDRTILVVVCVNNEELFEQCERQIRNLFVPPDYVVQIFPIRDAKSMASAYNRALSYPAKYKVYIHQDTYLINREMFYTLISLFKDNEKLGLIGVAGAQFLPSNGIWWEGKNLVGKVIEYRRRNYQLLNLDQGFYGSQSFMSVQAIDGLFMATQYDIPWREDLFQGFHFYDVSQSLEFQRAGYLIGIPNQSNLWCIHYNGDEFDADTYEKDRKVFVEQYKDILSPS
>NZ_CP009369.1|WP_002194689.1|3779050_3779944_-|RluA-family-pseudouridine-synthase
MNRFTLKWDIDSAEEGTLVREFLKTKGISKAALTDIKFHGGAIEVNGQYASVRHQLQAGEELRVFFPVEERSEGMIAEDIPLCIVYEDDAVLVINKEANMSTIPSREHPAGSVANALLSHYDKQHLASTVHIVTRLDRDTSGLMLIAKNRFMHHLLSKQHQQKAVKRTYEAIVHGEMVEREGTIDAPIGRKSDSIIERTVCEEGQRAVTHFRVIDSANHKTHVSLELDTGRTHQIRVHMAHIGHPLLGDNLYGGKRDEMKRQALHSTSLTFYHPILEKEMSFTTTIPNDMQAVVRHT
>NZ_CP009369.1|WP_000673185.1|3779959_3780757_-|NAD-kinase
MKFTIMSKGDQSSDALASTMKEYLLDFGFIMDEQEPDIVISVGGDGTLLYAFHRYYNRLDETAFVGVHTGHLGFYADWLPTEVEKLVIAIAKTPFQVVEYPLLEVIIRYVNGSKESQYLAMNEATVKSAEGTLVTEVEIRGEYFETFRGDGLCISTPSGSTAYNKALGGAIIHPSIEAIQIAEMASINNRVFRTVGSPLVLPKHHTCVLKPTAGMNLQITVDHLTMVHQDVKSIQYRVANEKVRFVRFRPFPFWKRVRDSFVADK
>NZ_CP009369.1|WP_002194688.1|3780775_3781414_-|GTP-pyrophosphokinase-family-protein
MNRNWEEFLAPYHQAVAELKVKLKGMRTQFAMLTEHSPIEFVTGRVKSVASIIDKAEKRNVPLDRLREDMQDIAGLRMMCQFVDEIKPVVEYLRKRNDFEIVEERDYVTQKKDSGYRSYHVVISYPVQTIQGEQKVLVEIQIRTLAMNFWATIEHSLNYKYSGRFPKDIKIRLQRAAEAAFLLDEEMSSIRLEIQEAQKAFSRKQETKDSES
>NZ_CP009369.1|WP_001180001.1|3781444_3781816_-|hypothetical-protein
MQNKIQVKSVEKRENALIFCAENSEIEVKELSARNHVLVDSDNLSFLYILENESSFIYVSIPHTCWEAMHEAMNNDMVMFVRVNDIEMELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
>NZ_CP009369.1|WP_002194687.1|3781960_3782539_+|CYTH-domain-containing-protein
MTQEIEIEFKNMVTEEEFNTLCKSFSIEVFTKQVNHYFETPNFSLKEAGSALRIRHKGETYTLTLKQPAEVGLLETHQVVTESEARMMMETNVIISGAVMDQLRKLQIPVSALTYMGSLTTERAETLFEGGTLVFDHSFYYNHDDYEIEFEVQDEETGKAAFIHLLTQHTIPIRHTNNKVKRFFLAKQNKAR
>NZ_CP009369.1|WP_002194686.1|3782717_3783116_+|globin-family-protein
MSKQPMTPFEAIGGEQCIAILVDTFYSYVSQHPDLSPIFPDDLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVHGHIREFVFERLALTAQHMVNTPDETGEI
>NZ_CP009369.1|WP_000360642.1|3783115_3784009_+|DsbA-family-protein
MDKQEAKHINMPSPSACEHKSVEAYLFIDPLCKDCWEIEPFIIKLWLEYGKYFSIRHIVTGKVDGTNASSHKWNKPANIRFVWEKTTSLQGFSCDGKVHMQEASSTPYLVSMAIKAAELQGRKAGSKFLRKLQEYIFLENVSNPDCELLLACAKDSDIDVEEFKKDLYSASAKKAFQCDLKFTNEMHITEIPSLVFFHANSDEEGIKIAGTYSYDVYVQLLKELVKCEIEPEPLPPLEVLLEATQFISSKEVAFIYDCSKQEIERELKKLQLKRKVQMIDVKCERYWKWIAKEKDLV
>NZ_CP009369.1|WP_002194685.1|3784531_3786358_-|oligoendopeptidase-F
MSEQNTAKALPDRNEIEESSTWRLEDIFQTDAEWEKEFQAIKELLPKLTEFKGKLGDSANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAYIVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASSNTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNTFASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLVESVNDNLHLLHRYIDIRKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLHVLGDEYVDILKEAYENRWVDVYENKGKRSGAYSSGAYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVYGDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHMIHKKVQEGHAVTPDMLTEIYYNLNKKYFGDALVIDEEIGLEWSRIPHFYYNYYVYQYATGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQVFEEKLNELEALLFEEK
>NZ_CP009369.1|WP_033691187.1|3786408_3787653_-|competence-protein
MIPMFIAKRENGEKIHLLDHHDEELLHRMRKRESFFCTACGKEVLMRLGKQKKWHFAHKKVDSCLAFYEAESIYHMHGKELLYRWLKRQNFHVEIEHYLPEIQQRPDIFIERAGRKIAIEYQCANLSIEQLYKRTHSYWRASIQVIWIIGGNQLKKHSAYWMKFSTLMAFSLQSYPQPLLIFFCSKRKLFMKCTFIISFSTSISFSHIIYLPTETTTFEMLFSSVPFQKEILEREWKKRKDYFRKNALPIWNYNHKSLLRLLYQCKCTPANFPSEIGVPLPSSFAFQTNPFIWQAFIYMKCIGELAVGDCISLEYVCSYIKKYTKRRMLPYFSQHIWKVAVTEYMIFLCYVGVLQKVGTYKYRKKRRIVMLKTEEEVMKYDEVCLAYALSLFEAKYNMREGKGDIIKTDREGIT
>NZ_CP009369.1|WP_000799204.1|3787733_3789278_-|cardiolipin-synthase
MKNTLKLIFFVLLLFALFVSLRMFIDVAFYSDVIGIKDVSILGIISILFTVSAFLIGCVIFLENRHPSKTLTWLIVLGIFPVFGFFAYLLFGQNFRRKRMFQKKALLDEQAFLQYKGHEDYEERILRNHKHQELLFRLADRLGALNISFQTETRTLTNGDETFQAILDGLKRAKHHIHMEYYIVRDDKLGTEIKDILIQKSKEGVVVRFLYDAVGSFKLSKSYIEELNDAGVEMIPFFPVRFPILNDKINYRNHRKIVIIDGNEGFVGGLNIGDEYLGKDKYFGFWRDTHLYLRGEAVQSLQLIFLQDWFYMTGEAVLAPEYLQAKAVEGEHWGGVQLVAGGPDNKWETIKHLYFAMIASARKSIWIATPYFIPDDDILSALKVAALAGIDVRLLMPSKPDKRTVFYASRSYFPELLDAGVKIYEYEKGFLHSKVVIVDSDLASIGTANMDMRSFHLNFEVNAFLYDTDSIRKLVQDFKDDLEESSEIHVDRFHKRRLHRRIVESTYRLLSPLL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP009369_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP009369_2

5119219-5119308

Orphan

Consensus_repeat	Method
GATATATTTAAAAAATCGCTGATATAATT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP009369_2

>merge|NZ_CP009369|2|5119219-5119308|CRISPRCasFinder
GATATATTTAAAAAATCGCTGATATAATTCGAGTTACGGTCGATATATTTAAAAAATCGCCGATATAATTCGAGTTGCGCTGATATATTT

>NZ_CP009369|2|2|5119219-5119308|CRISPRCasFinder
GATATATTTAAAAAATCGCTGATATAATT	CGAGTTACGGTCGATATATTTAAAAAATCGCC
GATATAATTCGAGTTGCGCTGATATATTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP009369.1\|WP_042515832.1\|5128289_5136704_+\|Cna-B-type-domain-containing-protein	unknown	unknown	gnl\|CDD\|377553
NZ_CP009369.1\|WP_001209831.1\|5118048_5118921_+\|agmatinase	unknown	unknown	gnl\|CDD\|273514
NZ_CP009369.1\|WP_042515830.1\|5112233_5114285_-\|PBP1A-family-penicillin-binding-protein	unknown	unknown	gnl\|CDD\|273955
NZ_CP009369.1\|WP_001086456.1\|5122676_5124347_+\|arginine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234964
NZ_CP009369.1\|WP_000996321.1\|5119390_5120428_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|379113
NZ_CP009369.1\|WP_001980638.1\|5124566_5125100_+\|RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|183571
NZ_CP009369.1\|WP_042515831.1\|5115675_5116839_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341027
NZ_CP009369.1\|WP_001980635.1\|5126075_5126450_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009369.1\|WP_033691422.1\|5125378_5126050_+\|ECF-type-sigma-factor-negative-effector	unknown	unknown	gnl\|CDD\|379473
NZ_CP009369.1\|WP_001147171.1\|5110691_5110877_-\|4-oxalocrotonate-tautomerase	unknown	unknown	gnl\|CDD\|235013
NZ_CP009369.1\|WP_000424696.1\|5117003_5117831_+\|spermidine-synthase	unknown	unknown	gnl\|CDD\|234843
NZ_CP009369.1\|WP_000656673.1\|5125080_5125395_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP009369.1\|WP_000262739.1\|5109347_5110652_+\|HD-domain-containing-protein	unknown	unknown	gnl\|CDD\|224004
NZ_CP009369.1\|WP_033691419.1\|5114384_5115110_-\|glycerophosphodiester-phosphodiesterase	unknown	unknown	gnl\|CDD\|176506
NZ_CP009369.1\|WP_000136678.1\|5111688_5112198_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378039
NZ_CP009369.1\|WP_001980643.1\|5121050_5122037_-\|LD-carboxypeptidase	unknown	unknown	gnl\|CDD\|132883
NZ_CP009369.1\|WP_000372447.1\|5110988_5111663_+\|site-2-protease-family-protein	unknown	unknown	gnl\|CDD\|100079
NZ_CP009369.1\|WP_002194939.1\|5115262_5115670_+\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133401
NZ_CP009369.1\|WP_000414868.1\|5122239_5122677_+\|DUF1934-domain-containing-protein	unknown	unknown	gnl\|CDD\|378129
NZ_CP009369.1\|WP_000779938.1\|5120662_5121025_+\|YxeA-family-protein	unknown	unknown	gnl\|CDD\|227613

Protein	Function_ID	Function_description	E-value
NZ_CP009369.1\|WP_042515832.1\|5128289_5136704_+\|Cna-B-type-domain-containing-protein	gnl\|CDD\|377553	pfam05738, Cna_B, Cna protein B-type domain. This domain is found in Staphylococcus aureus collagen-binding surface protein. The structure of the repetitive B-region has been solved and forms a beta sandwich structure.	1.45099e-25
NZ_CP009369.1\|WP_001209831.1\|5118048_5118921_+\|agmatinase	gnl\|CDD\|273514	TIGR01230, Agmatinase_Agmatine_ureohydrolase_AUH., agmatinase. Members of this family include known and predicted examples of agmatinase (agmatine ureohydrolase). The seed includes members of archaea, for which no definitive agmatinase sequence has yet been made available. However, archaeal sequences are phylogenetically close to the experimentally verified B. subtilis sequence. One species of Halobacterium has been demonstrated in vitro to produce agmatine from arginine, but no putrescine from ornithine, suggesting that arginine decarboxylase and agmatinase, rather than arginase and ornithine decarboxylase, lead from Arg to polyamine biosynthesis. Note: a history of early misannotation of members of this family is detailed in PUBMED:10931887.	1.75128e-134
NZ_CP009369.1\|WP_042515830.1\|5112233_5114285_-\|PBP1A-family-penicillin-binding-protein	gnl\|CDD\|273955	TIGR02074, Includes:_Penicillin-insensitive_transglycosylase, penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan].	0
NZ_CP009369.1\|WP_001086456.1\|5122676_5124347_+\|arginine--tRNA-ligase	gnl\|CDD\|234964	PRK01611, argS, arginyl-tRNA synthetase; Reviewed.	0
NZ_CP009369.1\|WP_000996321.1\|5119390_5120428_-\|transcriptional-regulator	gnl\|CDD\|379113	pfam13303, PTS_EIIC_2, Phosphotransferase system, EIIC. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. The sugar-specific permease of the PTS consists of three domains (IIA, IIB and IIC). The IIC domain catalyzes the transfer of a phosphoryl group from IIB to the sugar substrate.	9.83601e-53
NZ_CP009369.1\|WP_001980638.1\|5124566_5125100_+\|RNA-polymerase-sigma-factor	gnl\|CDD\|183571	PRK12522, PRK12522, RNA polymerase sigma factor; Provisional.	8.60093e-87
NZ_CP009369.1\|WP_042515831.1\|5115675_5116839_+\|MFS-transporter	gnl\|CDD\|341027	cd17474, MFS_YfmO_like, Bacillus subtilis multidrug efflux protein YfmO and similar transporters of the Major Facilitator Superfamily. This family is composed of Bacillus subtilis multidrug efflux protein YfmO, bacillibactin exporter YmfD/YmfE, uncharacterized MFS-type transporter YvmA, and similar proteins. YfmO acts to efflux copper or a copper complex, and could contribute to copper resistance. YmfD/YmfE is involved in secretion of bacillibactin. The YfmO-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.07528e-97
NZ_CP009369.1\|WP_033691422.1\|5125378_5126050_+\|ECF-type-sigma-factor-negative-effector	gnl\|CDD\|379473	pfam14108, DUF4281, Domain of unknown function (DUF4281). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria and eukaryotes. Proteins in this family are typically between 147 and 232 amino acids in length. There are two completely conserved residues (W and P) that may be functionally important.	0.00380212
NZ_CP009369.1\|WP_001147171.1\|5110691_5110877_-\|4-oxalocrotonate-tautomerase	gnl\|CDD\|235013	PRK02220, PRK02220, 4-oxalocrotonate tautomerase; Provisional.	6.28264e-28
NZ_CP009369.1\|WP_000424696.1\|5117003_5117831_+\|spermidine-synthase	gnl\|CDD\|234843	PRK00811, PRK00811, polyamine aminopropyltransferase.	2.2788e-169
NZ_CP009369.1\|WP_000262739.1\|5109347_5110652_+\|HD-domain-containing-protein	gnl\|CDD\|224004	COG1078, COG1078, HD superfamily phosphohydrolases [General function prediction only].	1.47047e-151
NZ_CP009369.1\|WP_033691419.1\|5114384_5115110_-\|glycerophosphodiester-phosphodiesterase	gnl\|CDD\|176506	cd08563, GDPD_TtGDE_like, Glycerophosphodiester phosphodiesterase domain of Thermoanaerobacter tengcongensis and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in Thermoanaerobacter tengcongensis glycerophosphodiester phosphodiesterase (TtGDE, EC 3.1.4.46) and its uncharacterized homologs. Members in this family show high sequence similarity to Escherichia coli GP-GDE, which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols. Despite the fact that most of GDPD family members exist as the monomer, TtGDE can function as a dimeric unit. Its catalytic mechanism is based on the general base-acid catalysis, which is similar to that of phosphoinositide-specific phospholipases C (PI-PLCs, EC 3.1.4.11). A divalent metal cation is required for the enzyme activity of TtGDE.	9.12113e-123
NZ_CP009369.1\|WP_000136678.1\|5111688_5112198_+\|hypothetical-protein	gnl\|CDD\|378039	pfam08741, YwhD, YwhD family. This family of proteins are currently uncharacterized. They are around 170 amino acids in length.	7.61321e-115
NZ_CP009369.1\|WP_001980643.1\|5121050_5122037_-\|LD-carboxypeptidase	gnl\|CDD\|132883	cd07062, Peptidase_S66_mccF_like, Microcin C7 self-immunity protein determines resistance to exogenous microcin C7. Microcin C7 self-immunity protein (mccF): MccF, a homolog of the LD-carboxypeptidase family, mediates resistance against exogenously added microcin C7 (MccC7), a ribosomally-encoded peptide antibiotic that contains a phosphoramidate linkage to adenosine monophosphate at its C-terminus. The plasmid-encoded mccF gene is transcribed in the opposite direction to the other five genes (mccA-E) and is required for the full expression of immunity but not for production. The catalytic triad residues (Ser, His, Glu) of LD-carboxypeptidase are also conserved in MccF, strongly suggesting that MccF shares the hydrolytic activity with LD-carboxypeptidases. Substrates of MccF have not been deduced, but could likely be microcin C7 precursors. The possible role of MccF is to defend producer cells against exogenous microcin from re-entering after having been exported. It is suggested that MccF is involved in microcin degradation or sequestration in the periplasm.	2.90236e-120
NZ_CP009369.1\|WP_000372447.1\|5110988_5111663_+\|site-2-protease-family-protein	gnl\|CDD\|100079	cd06158, S2P-M50_like_1, Uncharacterized homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group includes bacterial, eukaryotic, and Archaeal S2P/M50s homologs with a minimal core protein and no PDZ domains.	5.07685e-60
NZ_CP009369.1\|WP_002194939.1\|5115262_5115670_+\|MerR-family-transcriptional-regulator	gnl\|CDD\|133401	cd04774, HTH_YfmP, Helix-Turn-Helix DNA binding domain of the YfmP transcription regulator. Helix-turn-helix (HTH) transcription regulator, YfmP, and related proteins; N-terminal domain. YfmP regulates the multidrug efflux protein, YfmO, and indirectly regulates the expression of the Bacillus subtilis copZA operon encoding a metallochaperone, CopZ, and a CPx-type ATPase efflux protein, CopA. These proteins belong to the MerR superfamily of transcription regulators that promote expression of several stress regulon genes by reconfiguring the spacer between the -35 and -10 promoter elements. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	2.41442e-36
NZ_CP009369.1\|WP_000414868.1\|5122239_5122677_+\|DUF1934-domain-containing-protein	gnl\|CDD\|378129	pfam09148, DUF1934, Domain of unknown function (DUF1934). Members of this family are found in a set of hypothetical bacterial proteins. Their precise function has not, as yet, been defined.	2.78037e-28
NZ_CP009369.1\|WP_000779938.1\|5120662_5121025_+\|YxeA-family-protein	gnl\|CDD\|227613	COG5294, COG5294, Uncharacterized protein conserved in bacteria [Function unknown].	3.76761e-11

>NZ_CP009369.1|WP_001209831.1|5118048_5118921_+|agmatinase
MRFDEAYSGKVFIKSHPSFEESKVVIYGMPMDWTVSYRPGSRFGPARIREVSIGLEEYSPYLDRELEEVKYFDAGDIPLPFGNAQRSLDMIEEYVSKLLDADKFPLGLGGEHLVSWPIFKAMAKKYPDLAIIHMDAHTDLRESYEGEPLSHSTPIRKVCDLIGPENVYSFGIRSGMKEEFEWAKEVGMNLYKFDVLEPLKEVLPKLAGRPVYVTIDIDVLDPAHAPGTGTLEAGGITSKELLDSIVAIANSNINVVGADLVEVAPVYDHSDQTPVAASKFVREMLLGWVK
>NZ_CP009369.1|WP_000424696.1|5117003_5117831_+|spermidine-synthase
MELWFTEKQTKHFGITARINRTLHTEQTEFQKLDMVETEEFGNMLILDGMVMTTEKDEFVYHEMVAHVPLFTHPNPENVLVVGGGDGGVIREVLKHPSVKKATLVEIDGKVIEYSKQYLPSIAGALDNERVEVKVGDGFLHIAESENEYDVIMVDSTEPVGPAVNLFTKGFYAGISKALKEDGIFVAQTDNPWFTPELITTVFKDVKEIFPITRLYTANIPTYPSGLWTFTIGSKKHDPLEVSEERFHEIETKYYTKELHNAAFALPKFVGDLIK
>NZ_CP009369.1|WP_042515831.1|5115675_5116839_+|MFS-transporter
MESKQKLGRLITVVATFLAFSGIGVVDPILPIIAEKIGASHWQVEMLFTAYILTMAIMMLPAGIFASRFGDKRMMTIGLAIVTVFAFICGISQTIAQLSLFRAGWGLGNAMFFATAMTLLIALSKEVHEAVGLYEAAIGLGMAGGPLLGGILGGHSWRYPFFATSILIFLAFILVFFFVKEPERKVKRKAAGVGELLNLVKYKPFMQGAISGMLYYYGFFVVLAYSPLIMHLTAIQLGFVFCGWGLALAYGSAILAHKLEGKYEPKALLKGSLLVFALFLIALFFVKIMWLQIVLIVLSGLASGLNNALFTSYVMDISPYERSVTSGVYNFVRWLGGAIAPILSGIIGHTVSPQSPFLVGGIVVLVGCVMILIPIRKQVEVETKALS
>NZ_CP009369.1|WP_002194939.1|5115262_5115670_+|MerR-family-transcriptional-regulator
MYKIDEVTKQVGLTKRTLRYYEEIGLIHPPERSEGNIRLYTDADIARIKRIVEAKEVLGITLQEMQHFLSLKERMEQRRNSENPRDREVIQEIKEMLEKQVQTLDEKMEQMQRVKAELEDSLHRAVTFLENTKGE
>NZ_CP009369.1|WP_033691419.1|5114384_5115110_-|glycerophosphodiester-phosphodiesterase
MSKPLIFAHRGVKGTHPENTMIAFQEAERIGAHGIELDVHLSKDGELVVIHDETVDRTTNGIGLVSEKTVAELQALDAGSYKDPSFHEAKIPTLREVFIWLSTTSLQLNIELKTDVIHYPNIEEKAVALVREYHLSNQIVFSSFNHDSVSLLAEIAPEIPRAILYDTPLADPIAEAQTREATGLHPNFELLTKEFVQLAQKQGYVFRPYTINEYKDLQTMIDYGVDVIITDWPARAFELLS
>NZ_CP009369.1|WP_042515830.1|5112233_5114285_-|PBP1A-family-penicillin-binding-protein
MDQTMNPKLKKYKRLFFTVMFSSVLFFVFSFFVIIIVAKIMGPPPVAVPQTSVFYANDDTVIGQSNEVQKRYNVSLNEISPYVKEATLSIEDQRFYKHHGFDMKRIAGAIVADLKAMAKVQGASTITQQYARNLYLDHDKTWKRKLLEAMYTIRLEVNYNKNHILEGYLNTIYYGHGAYGIEAASRLYFDKTAKELTLAEASMLAGIPKGPSVYSPFLKEDRAKERQSLILDEMVEQGYITKKQAASAKKESLTFASLDTKKVAEVAPYFQDAVQASLLRDIGLDEQALQKGGLRIYTTLDPKLQSVAEQAIKDHIPDTTNIQTALVSMNPKTGEVAALVGGTDYNTSQFNRATQAARQPGSTFKPFLYYAALERGFTPATRLKSEYTVFTLGDGVSKYKPKNYKDYYADDFVTMAQALAVSDNVYAVKTNLFLGEDILTKTAKQFGIKSALKDVPSLALGTSPVKPIEMVNAYSMFANGGKEVKPIFIRRIMDHEGNMLYDAHLESKQILDKSKAFVMEEMMTGMFNKKLSSYAAVTGQSMLSKLSRTYAGKSGSTETDSWMIGFTPQIVTGVWVGYDQPKSISNVAEQGYAKRIWTDTMEKGLDGQPKKEFKQPSDVVAVDINPENGKIATKNCPISVKMYFAKGTEPTEYCMDHVDDNEEFEKTTEEKEKTSWWKKYLPW
>NZ_CP009369.1|WP_000136678.1|5111688_5112198_+|hypothetical-protein
MTEKKKKIGFNIVKNDSTDGHGGFGVGALSLENISPVFVDVLEKTAFVDIGAMHARSTVEKGIKFLTNKDEVPNGKPFWLVWVTIERTATGAYYAGVTACEMTVDREIRRGYKSLPEHVNKMDKSLKRHIMVDHMDESSKKVLGTFLKEHNEAIWNESSEELRRALLSE
>NZ_CP009369.1|WP_000372447.1|5110988_5111663_+|site-2-protease-family-protein
MDQLFRYPLHQIPLVAMAIIIALSVHEFAHAYVAYKFGDDTAKKQGRLTLSPMAHLDPIGMIAVLILGFGWARPVPVNPYNFKRPRLAGILVSIAGPISNLILSAIGLIIWYSLLKFGVLYSIPSAVADTLAQFFQIFITLNIVLLVFNLLPIPPLDGYRVVEDLAPTNIRAKMTQYEKYGAIALLILVITPLSNYTIQPIFNVVIPYVFVFLDSIIAPIFGLL
>NZ_CP009369.1|WP_001147171.1|5110691_5110877_-|4-oxalocrotonate-tautomerase
MPYVTVKMLEGRTEEQKKALAEKVTAAVSETTGAPEENIVVFIEEMSKNHYAVGGKRLSDK
>NZ_CP009369.1|WP_000262739.1|5109347_5110652_+|HD-domain-containing-protein
MVYLNDKLSETKVFKDPVHKYVHVRDRVIWDLIGTKEFQRLRRIKQLGTTFFTFHGAEHSRFTHSLGVYEIIRRMIDDVFDGRPNWNAEDRLLCLCAALLHDVGHGPFSHSFEKVFSLDHEKFTQKIIVGDTEINRVLSRVDKDFPQKVADVIAKTSTNKLAISMISSQIDADRMDYLLRDAYFTGVKYGNFDMERILRVMRPYGNQVVIKNSGMHAVEHYIMSRYQMYWQVYFHPVTRSAEVILTKILHRAKSLHEKYYTFKNHPVHFYSLFEEEVTVEDYLKLDENVMYYYFQVWQDEEDPILSDLCRRFMNRNLFKYVEFTDKHGLDNWMELSSLFKKIGLDPEYYLVVDSTSDLPYDFYRAGEEEERLPILLLMPNGELRELSRESDIVEAITGKKRRDQKLFYPHDLIYEDGRKGKYKERIIELLEGKK
>NZ_CP009369.1|WP_000996321.1|5119390_5120428_-|transcriptional-regulator
MAILQGLALLLVVLCLFTLFSYRAPYGMKAMGALANAAIASFLIEAFHRYIGGEMFHNDFLQSVGEASGSMSGVAAAILVALAIGVSPVYAVLIGIATSGFGILPGFFAGYVCAFVVKFLEKKLPAGVEFLAILFIAAPISRGMAMLMDPLVNATLGKIGSMISVATTESPIIMGIMLGGLITVISTSPLSSMALTAMLGLTGLPMAIGSLAVAASAPMNFIFFKRLKICSKKDTIAVAIEPLTQADVVSANPIPIYATNFVGGALAGIITSLFQLVNNAPGTASPIPGLLVLFGFNDVVKVTIAAVLCGIVTTIVGYIGSILFRKYPIRSADEIRGIPSEEKVA
>NZ_CP009369.1|WP_000779938.1|5120662_5121025_+|YxeA-family-protein
MKLVIKVLVVFAIILGGTAYYLNTKTEGVHAFVDNFFSNKEIQDYYAVIDKGEKKDGEYLYTFKGYTEDGKLQVVKRMMNRELHTGAFIKIYAKGMQGKGWAEIPKESIPQKALEKIEKP
>NZ_CP009369.1|WP_001980643.1|5121050_5122037_-|LD-carboxypeptidase
MLPTKLKKGDEIRVISPSCSLSIVSIENRNFAIKRLTDLGFHVTFSTHADEIDRFASSSISSRVQDLHEAFRDPNVKAILTTLGGYNSNGLLKHLDYHLIRENPKFFCGYSDITALNNAIYTKTGLVTYSGPHFSSFGMEKGLEYTTDYFLKCLTSNETIEVLPSETWSDDSWYIDQENREFIKNEGYISIHEGEATGDIIGGNMSTLNLLQGTPYMPNLKDKILFLEEDSLTGKATLKTFDRYLHSLMQQQDFEHVKGIVIGKMQKGAECTIEDMQEMIASKAELAHIPIIANASFGHTTPIFTFPIGGRAQIISSKEKTSITIVTH
>NZ_CP009369.1|WP_000414868.1|5122239_5122677_+|DUF1934-domain-containing-protein
MEKQLAGLPVHVHFVTEIREGARKETVAFEANGQYYVKGQGTYVTFQEPNEQGEVKTIIKIQDEQVLIMRSGAVSMRQTHVKGEWTTGTYTSELGTFALQTKTDNVLFKWSDEKKKGQLFLTYALLLSEQEAGRYTITLNLKEAK
>NZ_CP009369.1|WP_001086456.1|5122676_5124347_+|arginine--tRNA-ligase
MNSLEQVKGLIKEEIQAAVLKAELATEEQIPNVVLESPKDKTNGDFSTNMAMQLARVAKKAPRMIAEELVANFDKAKASIEKIEIAGPGFINFYMDNSYLTDLIPTIVNAGEAYGETNTGKGEKVQVEFVSANPTGDLHLGHARGAAVGDTLCNLLAKAGYDVSREYYINDAGNQIHNLALSVEARYMQALGLEKEMPEDGYHGADIIGIGKRLAEEFGDRYAKADEKESYEFYREYGLKYELAKLQKDLESFRVKFDVWFSETSLYKNGKIDQALAVLKERDEIFEEDGATWFRSMTYGDDKNRVLIKNDGSYTYLTPDIAYHRDKLERGFDKLINIWGADHHGYIPRMKAAIQALGYDKETLEVEIIQMVQLYQNGEKMKMSKRTGKAVTLRELMEEVGVDAMRYFFAMRSGDSHLDFDMDLAVSKSNENPVYYAQYAHARVCSILRQGEELGLATGGDVNYKLVTSEKEVELLKKLGEFPAVVADAAQKRLPHRITNYAFELAATLHSFYNAEKVLNQDNLELSKARYELMKAVRTTLQNALAIVGVSAPEKM
>NZ_CP009369.1|WP_001980638.1|5124566_5125100_+|RNA-polymerase-sigma-factor
MEEKVEELIDIYKQQIYSLCYKLAKTKEDAEDIFQETWIKVFSSRHQLSYVENYKKWITTICVRTFYDFYRKKKRWKDRVLDLFHKEDGGEIEHADDVNISEEFIQKVEAEMIREVIQLLNEKYKTVLVLYYYEQYSYKEMSEILNIPIGTVKYRLNYAKKQMREHLEGFVYEGRQI
>NZ_CP009369.1|WP_000656673.1|5125080_5125395_+|hypothetical-protein
MKEDKFDQKIKSSLAEEMIPSEELINNTKQGMRNARKLEKRWVVFIHAIWMIVLTVTLEQFVSHLEHKISVIITIVIMMHLYIPIYVVIQSFLKKEYKLHDRVR
>NZ_CP009369.1|WP_033691422.1|5125378_5126050_+|ECF-type-sigma-factor-negative-effector
MIEFANPFVVFEIAGITMFLAFIALLVCVASWVYTDAKTRGISKWWSVVAIILPFFIGVLLYMIRRSNKKIEGEHTMNAMKKQKITLVVIFASAMFVLLSGFAFVQTLDDMWRAGDIYLESEQQGETSYEAKFSSWDIAGKDIELEYAKDTEVTFFYETDAKRGNLCFSLYERQGEGIRELKEICESKTGTFKATLKANEKYVFSISGLMVKDGFVKVNWETK
>NZ_CP009369.1|WP_001980635.1|5126075_5126450_-|hypothetical-protein
MKKMILAGALTLAGITGATAFIPETKAAAATQEQSFTKFYSLQTGSSSEQEPVFLQKGQELTIQPNSKTPSYSVYDSNHNLIGRYSDGYGRIFTAKTDGNMYVQFHAPYVYYSPVSFSVTYTIR
>NZ_CP009369.1|WP_042515832.1|5128289_5136704_+|Cna-B-type-domain-containing-protein
MYLKRITSIFSIIMIFMFTIGQSLLPIVANAQELNTAGIVDSFKIDKTDLYVGQRTKVTVNFSEKDGLKLKPGDTLTLTLPPELKGLNTEFLLDDYGTCKVTAGTVVCTFNDKVSTHQNIKGYLNFFIEAANVGTDEKKEIETNFGTNVDKQSVTITGPSSGGGTDPGKPPFFYKTGDMNSGKSDEVRWFLNINLAKEELSRDIVVTDNLQEGQTLNKDSFYIIVDDHIGRRSLTLQELEKQGYGTITFTGDKSFKVVLNKDKARLASFSIGYTSTITEAGKKQDFFKNDYTIDYQVLNGEPVTESGTHPVENMTAGGGAEGNVTPRGTLKIVKHIEGDEEKVIPNVSFKLYKEPNEQVGDVYTTDEKGIIEIPNLQPGKYYVKEVSAPDYIDFDPQAKVNFEVKSDAVNGVKLLIPNKVKTTSIAGTKTWKDDNEKDRPSSIKVDLLQNGKVLDTKEVTAADGWKYKFDNLTVYDANGVAYKYEVKEQPIDGYTTEVNGYDITNTKVVQTTKVEGTKTWKDGNAEGRPTMIKVDLLQNGKVIATQEVSEATGWKYEFKDLAINDADGKAYKYEVKEQAVDGYESKVNGYDITNTKVGKTSVAGTKTWKGGTEEEHKAIKVDLLQNGTVIATQEVSKETGWKYEFKDLVAFDENGKAYKYEVKEQPVDGYESKVNGYDITNTKVGKTSVAGTKTWNDNNASDRPKTIKVDLVQKDNSQAQKETVIATQEVSEATGWKYEFKDLAAYDENGVAYKYEVKEQAVPGYESKVNGYDITNTKVGETKVEGTKTWKDDNAKDRPEMIKVDLLQNGTVIATQEVSKATGWKYEFKDLAAYDAEGKAYKYEVKEQAVPGYESKVNGTDITNIKVGETKVEGTKTWKDDNATNRPSTIKVDLLQNGKVVDTKEVTAETNWKYTFEKLQAYDANGVAYKYEVKEQPVAGYKSEVKGYDITNTKVAELTVEGTKTWNDNNATDRPSSIKVDLLQNGKVVDTKEVTAATNWKYTFEKLQAYDANGVAYKYEVKEQPVAGYQSDVHGYDITNTKVGETKVEGTKTWNDNNATDRPSSIKVDLLQNGKVVDTKEVTAETNWKYTFEKLQAYDANGVAYKYEVKEQAVPGYESKVNGTDITNTKVGETKVEGTKTWNDNNTTDRPSTIKVDLLQNGKVVDTKEVTAATNWKYTFEKLQAYDTNGVAYKYEVKEQAVPGYESKVNGYDITNTKVGETKVEGTKTWKDDNAKDRPEMIKVDLLQNGTVIATQEVSKATGWKYEFKDLAAYDAEGKAYKYEVKEQAVPGYESKVNGTDITNIKVGETKVEGTKTWKDDNATNRPSTIKVDLLQNGKVVDTKEVSEATGWKYEFKDLAAYDENGVAYKYEVKEQAVPGYESKVNGYDITNTKVGETKVEGTKTWKDDNAKDRPEMIKVDLLQNGKVVDTKEVTAATEWKYTFEKLQAYDTNGVAYKYEVKEQPISGYESKVSGTDITNTKVGKTKVEGTKTWKDGNATDRPTMIKVDLLQNGNVIQTHDVLAVMGWKYIFADLEAYDAEGKAYEYEVKEQPVPGYESKVSGTDITNTKVGQTKVEGTKTWKDDNATDRPEMIKVDLLQNGTVIATQEVSKATGWKYEFKDLVAYDENGVAYKYEVKEQVVPGYESKVNGYDITNTKVGETKVEGTKTWKDDNAKDRPEMIKVDLLQNGKVVDTKEVTAETNWKYTFEKLQAYDANGVAYKYEVKEQAIPGYESKVNGTDITNIKVGKTKVEGTKTWKDDNATDRPEMIKVDLLQNGTVIATQEVSKATDWKYEFKDLAAYDANGVAYKYEVKEQAVPGYESKVNGTDITNTKVGETKVEGTKTWNDNNATDRPSSIKVDLLQNGKVVDTKEVTAATNWKYTFEKLQAYDTNGVAYKYEVKEQAVPGYESKVNGTDITNTKVGKTKVEGTKTWKDDNAKDRPEMIKVDLLQNGTVIATQEVSEATGWKYEFKDLAAYDAEGKAYKYEVKEQTVPGYESKVSGTDITNTKVGETKVEGTKTWNDNNATDRPSTIKVDLLQNGKVVDTKEVTVETNWKYTFEKLQAYDAEGKAYKYEVKEQAVPGYESKVNGTDITNTKVGETKVEGTKTWKDDNAKDRPEMIKVDLLQNGKVVDTKEVTAATEWKYTFEKLQAYDTNGVAYKYEVKEQPIAGYKSEVKGTDIANTKVGETKVEGTKTWNDNNATDRPSSIKVDLLQNGKVVDTKEVTAETNWKYTFEKLQAYDAEGKAYKYEVKEQPVAGYESKVSGTDITNTKVGKTKVEGTKTWKDDNAKDRPEMIKVDLLQNGTVIATQEVSKATGWKYEFKDLAAYDENGVAYKYEVKEQAVPGYESKVSGTDITNTKVGKTKVEGTKTWNDGNATDRPTMIKVDLLQNGNVIQTQDVLAVMGWKYIFADLEAYDAEGKAYEYTVKEQPVAGYESKVSGTDITNTKIGKTKVEGTKTWKDDNATDRPEMIKVDLLQNGTVIATQEVSKATGWKYEFKDLAAYDTNGVAYKYEVKEQPIAGYKSEVKGTDIANTKVGETKVEGTKTWNDNNATDRPSSIKVDLLQNGKVVDTKEVTAETNWKYTFEKLQAYDAEGKAYKYEVKEQPVAGYESKVSGTDITNTKVGKTKVEGTKTWKDDNATDRPEMIKVDLLQNGKVVDTKEVTAETNWKYTFEKLQAYDANGVAYKYEVKEQPVAGYKSEVKGYDITNTKIKDKPNVDPKDPSTDPKDPSTDPKDPSTDPKNPNTNTGSNSDSKVPSTTENDKPTLLPNTGGTSAGMSSILGGMVLFLLGGILFARQRIK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP009369_2	2.1\|5119248\|32\|NZ_CP009369\|CRISPRCasFinder	5119248-5119279	32	MK554696	Fusobacterium phage Fnu1, complete genome	62757-62788	7	0.781

1. spacer 2.1|5119248|32|NZ_CP009369|CRISPRCasFinder matches to MK554696 (Fusobacterium phage Fnu1, complete genome) position: , mismatch: 7, identity: 0.781

cgagtta--cggtcgatatatttaaaaaatcgcc	CRISPR spacer
--ggttattcggtctatatatttaaaaattcgta	Protospacer
  .****  ***** ************* ***.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

621238 : 628919

uncultured_Caudovirales_phage(16.67%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033691318.1\|621238_622222_+	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	2.1e-16	26.2
WP_000403735.1\|622211_622982_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.2e-13	26.1
WP_033691316.1\|623014_623779_+	class B sortase	NA	NA	NA	NA
WP_000587814.1\|623844_624168_-	heme oxygenase	NA	NA	NA	NA
WP_001255958.1\|624464_625664_+	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	6.1e-71	41.2
WP_001014310.1\|625703_625898_-	YwbE family protein	NA	NA	NA	NA
WP_033691311.1\|626240_626933_+	response regulator transcription factor	B5LWA6	Feldmannia_species_virus	1.4e-06	28.8
WP_033691309.1\|626934_627870_+	HAMP domain-containing histidine kinase	Q8QNA2	Ectocarpus_siliculosus_virus	8.6e-12	25.9
WP_042514645.1\|627995_628919_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	6.9e-46	43.5

DBSCAN-SWA_2

2317652 : 2326832

Geobacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000540642.1\|2317652_2318459_+	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	2.1e-107	68.9
WP_001981065.1\|2318523_2318736_-	DUF3006 domain-containing protein	Q0H256	Geobacillus_phage	1.9e-12	52.9
WP_042514998.1\|2318738_2320124_-	MBL fold metallo-hydrolase	Q0H255	Geobacillus_phage	6.0e-78	59.9
WP_001981059.1\|2320553_2320970_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000648514.1\|2320972_2321326_+	MmcQ/YjbR family DNA-binding protein	NA	NA	NA	NA
WP_033691753.1\|2321347_2322055_+	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	6.7e-17	27.0
WP_002194813.1\|2322120_2322507_+	DUF2809 domain-containing protein	NA	NA	NA	NA
WP_042514999.1\|2322528_2323032_+	DNA topology modulation protein	A0A097BYE2	Leuconostoc_phage	4.3e-42	45.5
WP_042515000.1\|2323177_2323858_+	SUMF1/EgtB/PvdO family nonheme iron enzyme	A0A075BUR2	Microcystis_phage	4.6e-31	38.7
WP_042515001.1\|2323913_2325107_+	glycosyl transferase family 1	Q0IKX4	Leucania_separata_nucleopolyhedrovirus	3.1e-06	26.2
WP_042515002.1\|2325464_2326832_+	chitin-binding protein	A0A0K1Y848	Apis_mellifera_filamentous_virus	4.3e-20	38.1

DBSCAN-SWA_3

2645778 : 2673688

Bacillus_phage(84.21%)

terminase,tail,holin,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042515162.1\|2645778_2647242_-	recombinase family protein	A0A288WFZ3	Bacillus_phage	5.6e-143	54.8
WP_042515163.1\|2647658_2648315_-	phosphoribulokinase	A0A2L2DM46	Acanthamoeba_polyphaga_mimivirus	1.1e-05	25.6
WP_042515164.1\|2648516_2649137_-	phage protein	H0USY2	Bacillus_phage	2.0e-94	79.8
WP_042515165.1\|2649078_2650269_-	cell division protein FtsK	A0A288WFS1	Bacillus_phage	2.0e-146	64.9
WP_029438305.1\|2650384_2650567_-	hypothetical protein	Q2I8E2	Bacillus_phage	1.5e-21	88.3
WP_042515166.1\|2650563_2650866_-	hypothetical protein	A0A288WG38	Bacillus_phage	4.0e-27	56.1
WP_042515167.1\|2650865_2651132_-	hypothetical protein	NA	NA	NA	NA
WP_042515169.1\|2651317_2651518_+	helix-turn-helix transcriptional regulator	Q2I8E4	Bacillus_phage	1.4e-12	54.5
WP_144402511.1\|2652160_2652283_-	DUF3961 domain-containing protein	Q3HKZ4	Bacillus_phage	2.8e-08	59.5
WP_033694537.1\|2652463_2652703_+	helix-turn-helix transcriptional regulator	A0A288WFZ7	Bacillus_phage	2.0e-21	67.1
WP_042515170.1\|2652779_2653106_+	hypothetical protein	A0A0S2GLG3	Bacillus_phage	9.6e-19	47.2
WP_042515171.1\|2653164_2653359_-	hypothetical protein	NA	NA	NA	NA
WP_042515173.1\|2653355_2654039_-	hypothetical protein	NA	NA	NA	NA
WP_052495882.1\|2654093_2654747_-	hypothetical protein	NA	NA	NA	NA
WP_042515174.1\|2654916_2655615_-	N-acetylmuramoyl-L-alanine amidase	Q2I8E6	Bacillus_phage	3.3e-125	92.7
WP_042515175.1\|2655631_2655862_-\|holin	phage holin	A0A0S2MVE8	Bacillus_phage	3.8e-30	86.8
WP_042515177.1\|2655876_2656161_-	hypothetical protein	NA	NA	NA	NA
WP_042515178.1\|2656255_2656531_-	hypothetical protein	A0A1B1P7E8	Bacillus_phage	1.9e-31	72.9
WP_080333990.1\|2656551_2658930_-	hypothetical protein	Q2I8E8	Bacillus_phage	6.3e-184	36.7
WP_042515180.1\|2658926_2660438_-\|tail	phage tail protein	A0A1B1P7W7	Bacillus_phage	2.5e-162	58.2
WP_042515948.1\|2660450_2664239_-\|tail	phage tail tape measure protein	A6M961	Geobacillus_virus	2.9e-42	40.8
WP_042515181.1\|2664275_2664530_-	hypothetical protein	NA	NA	NA	NA
WP_042512732.1\|2664619_2664997_-	hypothetical protein	NA	NA	NA	NA
WP_158319630.1\|2665056_2665233_-	hypothetical protein	NA	NA	NA	NA
WP_042515182.1\|2665274_2665790_-\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_042515183.1\|2665803_2666211_-	hypothetical protein	NA	NA	NA	NA
WP_042515184.1\|2666213_2666573_-	hypothetical protein	NA	NA	NA	NA
WP_042515185.1\|2666572_2666947_-	hypothetical protein	NA	NA	NA	NA
WP_042515186.1\|2666950_2667757_-	hypothetical protein	NA	NA	NA	NA
WP_042515187.1\|2667761_2668103_-	hypothetical protein	NA	NA	NA	NA
WP_042515188.1\|2668132_2668357_-	hypothetical protein	NA	NA	NA	NA
WP_042515189.1\|2668406_2669531_-	DUF5309 family protein	NA	NA	NA	NA
WP_042515190.1\|2669593_2670379_-	scaffolding protein	Q4ZC70	Staphylococcus_virus	4.1e-07	38.2
WP_042515191.1\|2670437_2671955_-\|portal	phage portal protein	A0A142F1L7	Bacillus_phage	4.7e-68	30.4
WP_042515192.1\|2671972_2673688_-\|terminase	phage terminase large subunit	A0A142F1L6	Bacillus_phage	1.2e-149	52.7

DBSCAN-SWA_4

3090979 : 3105402

Bacillus_phage(60.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001258498.1\|3090979_3091852_-	aminoglycoside 6-adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	4.0e-64	42.9
WP_042515313.1\|3091984_3092656_-	O-methyltransferase	W8CYT3	Bacillus_phage	2.6e-63	90.5
WP_000818985.1\|3092803_3093523_-	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
WP_001979959.1\|3094016_3094934_+	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	1.4e-43	44.1
WP_042515314.1\|3094930_3095683_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_001979955.1\|3095695_3096427_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_001979953.1\|3096449_3096800_+	YxeA family protein	NA	NA	NA	NA
WP_001979951.1\|3097150_3097864_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.2e-37	39.9
WP_001979949.1\|3097864_3099277_+	HAMP domain-containing histidine kinase	A0A1V0SGX0	Hokovirus	7.1e-10	26.2
WP_033691618.1\|3099355_3100444_-	HAMP domain-containing sensor histidine kinase	W8CYF6	Bacillus_phage	2.5e-172	89.8
WP_139254152.1\|3100440_3101145_-	response regulator	W8CYM9	Bacillus_phage	6.5e-121	92.7
WP_042515315.1\|3101206_3102967_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.2e-270	96.9
WP_001194292.1\|3103206_3103971_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_000755549.1\|3104133_3105402_-	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	7.6e-11	32.0

DBSCAN-SWA_5

4673390 : 4681763

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001979846.1\|4673390_4673978_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	7.7e-27	35.8
WP_001262445.1\|4673974_4675015_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	3.2e-68	45.9
WP_000879025.1\|4675117_4676533_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	3.3e-55	35.4
WP_000055574.1\|4676517_4678737_-	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	4.4e-163	41.3
WP_001979839.1\|4678720_4679404_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_000278820.1\|4679400_4679655_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_001170542.1\|4679647_4680367_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	5.2e-49	44.3
WP_000625683.1\|4680455_4681763_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	6.4e-21	25.3

DBSCAN-SWA_6

4724754 : 4732703

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033692601.1\|4724754_4726260_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	4.1e-32	31.1
WP_001975561.1\|4726243_4726945_-	response regulator transcription factor	W8CYM9	Bacillus_phage	9.5e-40	36.9
WP_000833097.1\|4727090_4728416_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	9.2e-44	29.4
WP_144402518.1\|4728799_4730338_-	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	2.6e-21	31.2
WP_001975554.1\|4730745_4732380_-	chaperonin GroEL	A0A219YK78	uncultured_virus	4.5e-157	58.0
WP_000917306.1\|4732418_4732703_-	co-chaperone GroES	A0A221S3C8	uncultured_virus	1.2e-20	53.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP009368

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

242829 : 314208

Bacillus_phage(41.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042514373.1\|242829_243951_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	3.4e-172	80.4
WP_042514374.1\|245284_248566_-	VaFE repeat-containing surface-anchored protein	NA	NA	NA	NA
WP_042514375.1\|249783_250434_+	YIP1 family protein	NA	NA	NA	NA
WP_042514376.1\|250672_251032_+	hypothetical protein	NA	NA	NA	NA
WP_042514377.1\|251343_252279_-	DUF3994 domain-containing protein	NA	NA	NA	NA
WP_042514378.1\|252450_252936_-	hypothetical protein	NA	NA	NA	NA
WP_042514380.1\|252969_253359_-	hypothetical protein	NA	NA	NA	NA
WP_042514381.1\|254154_255408_-	hypothetical protein	NA	NA	NA	NA
WP_042514382.1\|256555_257524_+	hypothetical protein	NA	NA	NA	NA
WP_042514383.1\|257739_258828_-	AAA domain-containing protein	A0A2C9CXH0	Yersinia_phage	3.9e-08	34.6
WP_052495856.1\|258824_259595_-	hypothetical protein	NA	NA	NA	NA
WP_042514384.1\|260165_261287_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	6.4e-163	76.9
WP_042514385.1\|261528_262887_-	VWA domain-containing protein	NA	NA	NA	NA
WP_158319626.1\|262931_263072_-	hypothetical protein	NA	NA	NA	NA
WP_042514386.1\|264062_265316_-	MFS transporter	NA	NA	NA	NA
WP_080333927.1\|265322_266834_-	hypothetical protein	NA	NA	NA	NA
WP_042514388.1\|266806_269221_-	hypothetical protein	NA	NA	NA	NA
WP_042514389.1\|269234_270053_-	hypothetical protein	NA	NA	NA	NA
WP_042514390.1\|273028_274654_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	2.0e-48	36.2
WP_080333929.1\|274702_277435_-	restriction endonuclease	NA	NA	NA	NA
WP_042514391.1\|277766_277994_-	hypothetical protein	NA	NA	NA	NA
WP_042514392.1\|278154_278736_-	hypothetical protein	NA	NA	NA	NA
WP_042514393.1\|278960_279506_-	hypothetical protein	NA	NA	NA	NA
WP_000834892.1\|279811_280093_-	hypothetical protein	NA	NA	NA	NA
WP_042514395.1\|281176_281968_-	5-deoxy-glucuronate isomerase	NA	NA	NA	NA
WP_042514396.1\|282072_282918_-	class II aldolase	NA	NA	NA	NA
WP_042514397.1\|283046_283943_-	myo-inosose-2 dehydratase	NA	NA	NA	NA
WP_042514398.1\|284065_286000_-	3D-(3,5/4)-trihydroxycyclohexane-1,2-dione acylhydrolase (decyclizing)	NA	NA	NA	NA
WP_042514399.1\|286154_287618_-	CoA-acylating methylmalonate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_042514400.1\|287695_288694_-	5-dehydro-2-deoxygluconokinase	NA	NA	NA	NA
WP_042514401.1\|288797_289823_-	inositol 2-dehydrogenase	NA	NA	NA	NA
WP_042514402.1\|290316_291597_+	MFS transporter	NA	NA	NA	NA
WP_042514403.1\|291684_292686_-	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	3.4e-22	28.2
WP_042514404.1\|293606_294326_+	S-layer homology domain-containing protein	NA	NA	NA	NA
WP_000651404.1\|295580_296390_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_042514405.1\|297156_297558_+\|transposase	IS200/IS605 family transposase	Q332K6	Clostridium_botulinum_C_phage	1.5e-50	71.2
WP_042514406.1\|297563_298643_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0A8WI33	Clostridium_phage	2.9e-19	33.5
WP_042514407.1\|299110_299308_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_042514408.1\|299459_299819_+	helix-turn-helix transcriptional regulator	A0A0A8WFJ2	Clostridium_phage	3.2e-15	50.6
WP_042514409.1\|300468_300921_-	DNA repair protein	A0A1B2LRS6	Wolbachia_phage	1.0e-10	43.4
WP_042514410.1\|301343_302561_-	ATP-dependent helicase	NA	NA	NA	NA
WP_042514411.1\|304067_304295_-	hypothetical protein	NA	NA	NA	NA
WP_042514412.1\|304661_305243_-	PRK06770 family protein	NA	NA	NA	NA
WP_042514413.1\|305493_307476_-	hypothetical protein	NA	NA	NA	NA
WP_042514414.1\|307465_308113_-	hypothetical protein	NA	NA	NA	NA
WP_042514415.1\|308117_309587_-	hypothetical protein	NA	NA	NA	NA
WP_042514416.1\|309868_310084_+	hypothetical protein	NA	NA	NA	NA
WP_042514417.1\|310129_310369_-	hypothetical protein	NA	NA	NA	NA
WP_052495857.1\|311315_312062_-	hypothetical protein	NA	NA	NA	NA
WP_042514419.1\|312167_312353_+	hypothetical protein	NA	NA	NA	NA
WP_144402502.1\|313196_313511_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.8e-38	76.0
WP_158319627.1\|313495_313660_-	hypothetical protein	A0A1B1P773	Bacillus_phage	3.8e-08	55.3
WP_042514420.1\|313686_314208_-\|transposase	IS3 family transposase	A0A1B1P776	Bacillus_phage	5.8e-34	49.1

DBSCAN-SWA_2

355007 : 364354

Bacillus_phage(85.71%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042514447.1\|355007_356822_-	acetyltransferase	B5WZU0	Pseudomonas_phage	1.8e-42	35.1
WP_042514507.1\|357844_358420_-	hypothetical protein	W8CZ47	Bacillus_phage	9.7e-83	75.5
WP_042514448.1\|358442_359609_-	DNA translocase FtsK	W8CYG2	Bacillus_phage	2.7e-180	79.4
WP_042514449.1\|359624_359945_-	hypothetical protein	A0A0S2GLK1	Bacillus_phage	1.2e-29	62.3
WP_042514450.1\|360234_360456_+	helix-turn-helix transcriptional regulator	A0A0S2GLH4	Bacillus_phage	3.2e-10	43.8
WP_042514451.1\|360851_361649_-	LysM peptidoglycan-binding domain-containing protein	A0A141HRV8	Bacillus_phage	2.0e-30	39.8
WP_042514452.1\|362065_362731_-	response regulator transcription factor	NA	NA	NA	NA
WP_042514453.1\|362730_363885_-	sensor histidine kinase	NA	NA	NA	NA
WP_042514454.1\|364081_364354_-	HU family DNA-binding protein	A7KV42	Bacillus_phage	1.4e-26	73.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP009369

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP009368

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection