CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP007558	Citrobacter freundii CFNIH1 plasmid pKEC-a3c, complete sequence	0 crisprs	csa3,RT,DEDDh	0	0	4	0
NZ_CP007557	Citrobacter freundii CFNIH1, complete genome	1 crisprs	csa3,WYL,cas3,RT,DEDDh,DinG,PD-DExK	0	1	371	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

22947 : 62563

Escherichia_phage(23.53%)

integrase,transposase

attL 22932:22991|attR 64103:65061

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
22932:22991	attL	NA	NA	NA	NA
WP_019706040.1\|22947_23784_-\|transposase	IS5-like element ISEc61 family transposase	NA	NA	NA	NA
WP_000262467.1\|24349_25144_+	APH(3')-II family aminoglycoside O-phosphotransferase	Q75ZG1	Hepacivirus	6.4e-109	74.3
WP_000349358.1\|25170_25530_+	BLMT family bleomycin binding protein	NA	NA	NA	NA
WP_019706001.1\|25692_26640_+\|transposase	IS30-like element ISAs2 family transposase	Q9MBM9	Staphylococcus_prophage	1.4e-41	35.7
WP_016809943.1\|26722_27871_+	cephalosporin-hydrolyzing class C beta-lactamase FOX-5	NA	NA	NA	NA
WP_016809945.1\|29387_30350_+	HTH-type transcriptional regulator YidZ	NA	NA	NA	NA
WP_041445713.1\|30961_31909_+\|transposase	IS30-like element ISAs2 family transposase	Q9MBM9	Staphylococcus_prophage	2.3e-41	35.7
WP_071843640.1\|32630_32834_+	type II toxin-antitoxin system YafQ family toxin	NA	NA	NA	NA
WP_001067855.1\|32867_33572_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_012561167.1\|34144_34510_-	hypothetical protein	NA	NA	NA	NA
WP_012561166.1\|34509_37746_-	conjugative relaxase	U5J9B0	Bacillus_phage	2.4e-05	27.3
WP_017787123.1\|37952_38969_-\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	2.9e-186	99.4
WP_041445714.1\|38973_40473_-	type IV secretion system DNA-binding domain-containing protein	NA	NA	NA	NA
WP_001749975.1\|40474_40891_-	hypothetical protein	NA	NA	NA	NA
WP_020319858.1\|41663_41801_+	hypothetical protein	NA	NA	NA	NA
WP_001749973.1\|41809_42526_+	StdB	NA	NA	NA	NA
WP_000414913.1\|42527_42896_+	hypothetical protein	NA	NA	NA	NA
WP_048968061.1\|43188_43422_+	hypothetical protein	NA	NA	NA	NA
WP_001749971.1\|43532_43853_-	hypothetical protein	NA	NA	NA	NA
WP_000214483.1\|43907_44087_-	hypothetical protein	NA	NA	NA	NA
WP_000932975.1\|44972_45212_-	hypothetical protein	NA	NA	NA	NA
WP_000881513.1\|45221_45626_-	hypothetical protein	NA	NA	NA	NA
WP_000447669.1\|45683_46109_-	antirestriction protein	NA	NA	NA	NA
WP_000861760.1\|46523_46964_+	translesion error-prone DNA polymerase V autoproteolytic subunit MucA	A0A1W6JNS2	Morganella_phage	1.2e-27	48.8
WP_001749980.1\|46951_48217_+	translesion error-prone DNA polymerase V subunit MucB	F1C5A5	Cronobacter_phage	2.2e-119	53.8
WP_001452808.1\|48367_49159_+	SprT-like domain-containing protein	NA	NA	NA	NA
WP_000057569.1\|49173_49515_-	hypothetical protein	NA	NA	NA	NA
WP_001749982.1\|50074_50794_+	replication initiation protein	I3WF20	Macacine_betaherpesvirus	8.6e-20	28.9
WP_001749988.1\|52750_53320_-	recombinase family protein	E5FFF9	Burkholderia_phage	5.2e-36	43.2
WP_000845048.1\|53712_54726_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
WP_004201280.1\|54881_55355_+	trimethoprim-resistant dihydrofolate reductase DfrA14	G3MBI7	Bacillus_virus	8.4e-16	28.9
WP_001144737.1\|55575_55842_+	plasmid mobilization relaxosome protein MobC	NA	NA	NA	NA
WP_001389365.1\|55984_56749_+\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7
WP_004098817.1\|57009_58224_+	type II site-specific deoxyribonuclease	E5E3X4	Burkholderia_phage	1.2e-34	42.5
WP_001288432.1\|58257_59691_-	DNA cytosine methyltransferase	E5E3X6	Burkholderia_phage	7.0e-106	50.6
WP_001749967.1\|60072_60279_-	hypothetical protein	NA	NA	NA	NA
WP_064577928.1\|60283_60772_-	restriction endonuclease	NA	NA	NA	NA
WP_001067855.1\|61021_61726_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_001173919.1\|61987_62563_+	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	5.6e-46	52.7
64103:65061	attR	NA	NA	NA	NA

DBSCAN-SWA_2

66944 : 75680

Acidithiobacillus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000268395.1\|66944_67883_+	hypothetical protein	A0A2P9HXK7	Yersinia_phage	1.5e-69	50.2
WP_000532167.1\|67882_68080_+	hypothetical protein	NA	NA	NA	NA
WP_001096362.1\|68317_68560_+	hypothetical protein	NA	NA	NA	NA
WP_001258027.1\|68562_68925_+	hypothetical protein	NA	NA	NA	NA
WP_000194038.1\|69189_69945_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	5.8e-59	51.0
WP_001274811.1\|69959_71501_-\|transposase	IS21-like element ISAs29 family transposase	K4I413	Acidithiobacillus_phage	4.4e-130	47.6
WP_001050849.1\|71745_72780_+	site-specific DNA-methyltransferase	H8ZMF1	Synechococcus_phage	1.0e-05	20.9
WP_000058870.1\|72793_73243_+	hypothetical protein	NA	NA	NA	NA
WP_000338945.1\|73224_73536_+	hypothetical protein	NA	NA	NA	NA
WP_001151304.1\|73709_74495_+	ParA family protein	A0A1X9IGI7	Lactococcus_phage	6.1e-11	26.4
WP_001207227.1\|74498_75680_+	ParB/RepB/Spo0J family partition protein	I3NLC2	Bifidobacterium_phage	2.4e-11	28.7

DBSCAN-SWA_3

143920 : 235836

Escherichia_phage(46.15%)

integrase,transposase

attL 167183:167242|attR 235883:235988

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011191341.1\|143920_145195_+\|transposase	IS4-like element ISApu2 family transposase	NA	NA	NA	NA
WP_000122923.1\|145208_146936_+	toprim domain-containing protein	A0A0P0ZFY3	Escherichia_phage	9.9e-14	32.6
WP_000268337.1\|146922_147201_+	hypothetical protein	NA	NA	NA	NA
WP_000714162.1\|147273_147513_+	permease	NA	NA	NA	NA
WP_001337692.1\|147732_148134_+	hypothetical protein	NA	NA	NA	NA
WP_000988732.1\|148247_148973_+	hypothetical protein	NA	NA	NA	NA
WP_001138073.1\|152089_155062_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	73.1
WP_001162012.1\|155064_155622_-	recombinase family protein	A0A1B0V7I5	Salmonella_phage	5.8e-48	81.3
WP_000845039.1\|155927_156941_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
WP_000381802.1\|157086_157620_+	aminoglycoside nucleotidyltransferase ANT(2'')-Ia	NA	NA	NA	NA
WP_000679427.1\|157776_158124_+	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
WP_000259032.1\|158117_158957_+	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
WP_001389365.1\|159131_159896_+\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7
WP_001067855.1\|160072_160777_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000052512.1\|161226_162702_+	ABC-F type ribosomal protection protein Msr(E)	A0A1B0RXA0	Streptococcus_phage	2.3e-160	59.0
WP_000155092.1\|162757_163642_+	Mph(E) family macrolide 2'-phosphotransferase	NA	NA	NA	NA
WP_001067855.1\|163725_164430_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_004163135.1\|164320_165280_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.7e-47	40.5
WP_000946487.1\|165381_166233_+	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.1e-11	27.2
WP_000376623.1\|166360_166861_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_004152787.1\|166843_166984_-	hypothetical protein	NA	NA	NA	NA
167183:167242	attL	NA	NA	NA	NA
WP_064735407.1\|167367_167574_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	1.8e-26	78.5
WP_001067855.1\|167620_168325_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_001553819.1\|169233_172131_-\|transposase	Tn3-like element Tn5403 family transposase	A0A1B0V7H9	Salmonella_phage	4.2e-182	37.8
WP_000509966.1\|172225_172831_+	recombinase family protein	A0A1S5Y2X8	uncultured_archaeal_virus	5.5e-20	35.3
WP_004152397.1\|173144_174464_+\|transposase	IS1182-like element ISKpn6 family transposase	Q9MBP7	Staphylococcus_prophage	1.9e-12	24.2
WP_004199234.1\|174713_175595_-	carbapenem-hydrolyzing class A beta-lactamase KPC-2	A0A1B0VBP7	Salmonella_phage	2.2e-73	52.2
WP_001067855.1\|176119_176824_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_007897923.1\|176947_178195_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_040113334.1\|178181_179948_+	hypothetical protein	NA	NA	NA	NA
WP_017384059.1\|179935_182053_+	hypothetical protein	NA	NA	NA	NA
WP_017384060.1\|182056_182485_+	hypothetical protein	NA	NA	NA	NA
WP_023314856.1\|183810_184140_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_023279877.1\|184214_185339_-	alkene reductase	NA	NA	NA	NA
WP_049866819.1\|185557_186532_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_017384065.1\|186614_187490_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_023279882.1\|187596_188448_+	DMT family transporter	NA	NA	NA	NA
WP_023279881.1\|188523_189360_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_007897903.1\|189654_190314_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_022649401.1\|191399_191726_-	four-helix bundle copper-binding protein	NA	NA	NA	NA
WP_022651297.1\|192157_193291_+	glutathione-independent formaldehyde dehydrogenase	E3SJ82	Synechococcus_phage	9.7e-10	28.8
WP_012561117.1\|194231_196883_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	5.4e-152	34.1
WP_032190484.1\|198177_198549_-	hypothetical protein	NA	NA	NA	NA
WP_001189111.1\|198857_200366_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	3.6e-44	31.8
WP_101743360.1\|201068_202049_+	NAD(P)H-quinone oxidoreductase	NA	NA	NA	NA
WP_040113343.1\|203348_204278_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	1.4e-75	53.1
WP_001118645.1\|204481_205405_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.0e-166	93.2
WP_040113342.1\|205611_206409_+	(S)-acetoin forming diacetyl reductase	Q06VL0	Trichoplusia_ni_ascovirus	5.1e-13	26.9
WP_040113332.1\|206670_207594_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	2.3e-166	92.8
WP_023205627.1\|207737_209129_-	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_040113331.1\|209964_210987_-\|transposase	IS110-like element IS5708 family transposase	NA	NA	NA	NA
WP_001067855.1\|211149_211854_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_002210516.1\|212565_213186_-	aldolase	A0A077SK32	Escherichia_phage	8.0e-115	100.0
WP_011117368.1\|213178_214444_-	four-carbon acid sugar kinase family protein	A0A077SLJ7	Escherichia_phage	4.6e-234	99.8
WP_002210514.1\|214455_215358_-	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	5.3e-160	100.0
WP_002210513.1\|215618_216380_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.9e-134	100.0
WP_011117369.1\|216400_217261_-	class A extended-spectrum beta-lactamase SHV-5	A0A077SL40	Escherichia_phage	4.4e-156	99.7
WP_001620096.1\|217558_217819_+	hypothetical protein	A0A077SK33	Escherichia_phage	1.9e-41	100.0
WP_001620097.1\|217905_218994_+	AAA family ATPase	A0A077SLJ9	Escherichia_phage	8.0e-211	100.0
WP_001067855.1\|219966_220671_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000845039.1\|220812_221826_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
WP_032488579.1\|221986_222541_+	aminoglycoside N-acetyltransferase AAC(6')-Ib3	NA	NA	NA	NA
WP_002089484.1\|222616_223081_+	aminoglycoside N-acetyltransferase AAC(3)-Ia	NA	NA	NA	NA
WP_000679427.1\|223286_223634_+	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
WP_000259031.1\|223627_224467_+	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
WP_000050481.1\|224871_226413_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_012579084.1\|226745_227402_+	quinolone resistance pentapeptide repeat protein QnrA1	NA	NA	NA	NA
WP_000259031.1\|227601_228441_+	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
WP_000376623.1\|228568_229069_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_001163403.1\|229244_230027_-	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	2.5e-33	35.0
WP_001324342.1\|230016_231540_-\|transposase	IS21-like element IS1326 family transposase	A0A2L1IVA1	Escherichia_phage	1.2e-15	24.2
WP_000344784.1\|233257_234118_-	TniB family NTP-binding protein	NA	NA	NA	NA
WP_000935451.1\|234120_235836_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
235883:235988	attR	NA	NA	NA	NA

DBSCAN-SWA_4

245391 : 254873

uncultured_Caudovirales_phage(33.33%)

integrase,transposase

attL 244134:244149|attR 257005:257020

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
244134:244149	attL	NA	NA	NA	NA
WP_000543934.1\|245391_246402_+\|integrase	tyrosine-type recombinase/integrase	A0A0K0N6I5	Gordonia_phage	3.1e-07	31.9
WP_044489169.1\|246406_247036_+	3'-5' exonuclease	A2I2Z6	Vibrio_virus	4.1e-18	43.3
WP_011787801.1\|247487_248978_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	8.6e-224	82.2
WP_011787802.1\|249012_249867_+	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	1.3e-67	48.6
WP_011787803.1\|249957_250290_+	TraR/DksA C4-type zinc finger protein	NA	NA	NA	NA
WP_011787804.1\|250407_251028_-	recombinase family protein	E5FFF9	Burkholderia_phage	1.1e-26	37.1
WP_011787805.1\|251197_251458_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_011918375.1\|251457_251769_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_011787830.1\|251792_254873_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	8.2e-51	30.6
257005:257020	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP007557

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP007557_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP007557_1

3543661-3543784

Orphan

Consensus_repeat	Method
CGACCCCCACCATGTCAAGGTGGTGCTCTAACCAACTGAGCTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP007557_1

>merge|NZ_CP007557|1|3543661-3543784|CRISPRCasFinder
CGACCCCCACCATGTCAAGGTGGTGCTCTAACCAACTGAGCTACGGACGCAATATGGTGCGTTCAATTGGACTCGAACCAACGACCCCCACCATGTCAAGGTGGTGCTCTAACCAACTGAGCTA

>NZ_CP007557|1|1|3543661-3543784|CRISPRCasFinder
CGACCCCCACCATGTCAAGGTGGTGCTCTAACCAACTGAGCTA	CGGACGCAATATGGTGCGTTCAATTGGACTCGAACCAA
CGACCCCCACCATGTCAAGGTGGTGCTCTAACCAACTGAGCTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP007557.1\|WP_038640343.1\|3547318_3548428_-\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
NZ_CP007557.1\|WP_038640341.1\|3545415_3547200_-\|diguanylate-cyclase	unknown	unknown	gnl\|CDD\|143635
NZ_CP007557.1\|WP_038640352.1\|3553266_3553662_-\|RidA-family-protein	unknown	unknown	gnl\|CDD\|223329
NZ_CP007557.1\|WP_038640349.1\|3551504_3552146_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|377981
NZ_CP007557.1\|WP_038640347.1\|3550610_3551105_-\|molybdopterin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|226429
NZ_CP007557.1\|WP_038640335.1\|3541082_3541805_-\|substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|270259
NZ_CP007557.1\|WP_038640331.1\|3538300_3539356_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238562
NZ_CP007557.1\|WP_038640329.1\|3535279_3536755_-\|PLP-dependent-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|224089
NZ_CP007557.1\|WP_038640354.1\|3553887_3554196_-\|monooxygenase	unknown	unknown	gnl\|CDD\|182975
NZ_CP007557.1\|WP_038640339.1\|3544193_3545198_-\|tryptophan--tRNA-ligase	unknown	unknown	gnl\|CDD\|183400
NZ_CP007557.1\|WP_038640355.1\|3554235_3555027_-\|PhzF-family-phenazine-biosynthesis-protein	unknown	unknown	gnl\|CDD\|223461
NZ_CP007557.1\|WP_038640345.1\|3548664_3550593_-\|phosphodiesterase	unknown	unknown	gnl\|CDD\|238923
NZ_CP007557.1\|WP_038640337.1\|3541809_3543417_-\|FAD-NAD(P)-binding-protein	unknown	unknown	gnl\|CDD\|182134
NZ_CP007557.1\|WP_038640332.1\|3539342_3540347_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP007557.1\|WP_038640351.1\|3552270_3553239_-\|threo-3-hydroxy-L-aspartate-ammonia-lyase	unknown	unknown	gnl\|CDD\|235918
NZ_CP007557.1\|WP_038640326.1\|3531575_3532049_+\|ester-cyclase	unknown	unknown	gnl\|CDD\|377824
NZ_CP007557.1\|WP_038640327.1\|3532131_3534024_+\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|379192
NZ_CP007557.1\|WP_038640333.1\|3540343_3541096_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP007557.1\|WP_038640330.1\|3536861_3538124_+\|4-aminobutyrate-transaminase	unknown	unknown	gnl\|CDD\|182078
NZ_CP007557.1\|WP_038640328.1\|3534027_3535236_+\|cytochrome-c	unknown	unknown	gnl\|CDD\|379187

Protein	Function_ID	Function_description	E-value
NZ_CP007557.1\|WP_038640343.1\|3547318_3548428_-\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	8.68683e-40
NZ_CP007557.1\|WP_038640341.1\|3545415_3547200_-\|diguanylate-cyclase	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	7.03634e-57
NZ_CP007557.1\|WP_038640352.1\|3553266_3553662_-\|RidA-family-protein	gnl\|CDD\|223329	COG0251, TdcF, Putative translation initiation inhibitor, yjgF family [Translation, ribosomal structure and biogenesis].	4.78257e-39
NZ_CP007557.1\|WP_038640349.1\|3551504_3552146_-\|transcriptional-regulator	gnl\|CDD\|377981	pfam08348, PAS_6, YheO-like PAS domain. This family contains various hypothetical bacterial proteins that are similar to the E. coli protein YheO. Their function is unknown, but are likely to be involved in signalling based on the presence of this PAS domain.	2.04032e-45
NZ_CP007557.1\|WP_038640347.1\|3550610_3551105_-\|molybdopterin-dependent-oxidoreductase	gnl\|CDD\|226429	COG3915, COG3915, Uncharacterized protein conserved in bacteria [Function unknown].	8.91164e-53
NZ_CP007557.1\|WP_038640335.1\|3541082_3541805_-\|substrate-binding-domain-containing-protein	gnl\|CDD\|270259	cd13541, PBP2_ModA_like_2, Substrate binding domain of molybdate-binding proteins;the type 2 periplasmic binding protein fold. This subfamily contains domains found in ModA proteins of putative ABC-type transporter. ModA proteins serve as initial receptors in the ABC transport of molybdate in eubacteria and archaea. Bacteria and archaea import molybdenum and tungsten from the environment in the form of the oxyanions molybdate (MoO(4) (2-)) and tungstate (WO(4) (2-)). After binding molybdate and tungstate with high affinity, they interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The ModA proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	5.37417e-84
NZ_CP007557.1\|WP_038640331.1\|3538300_3539356_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238562	cd01142, TroA_e, Periplasmic binding protein TroA_e. These proteins are predicted to function as initial receptors in the ABC metal ion uptake in eubacteria and archaea. They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.	3.49875e-82
NZ_CP007557.1\|WP_038640329.1\|3535279_3536755_-\|PLP-dependent-aminotransferase-family-protein	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	3.50666e-138
NZ_CP007557.1\|WP_038640354.1\|3553887_3554196_-\|monooxygenase	gnl\|CDD\|182975	PRK11118, PRK11118, putative monooxygenase; Provisional.	3.07741e-60
NZ_CP007557.1\|WP_038640339.1\|3544193_3545198_-\|tryptophan--tRNA-ligase	gnl\|CDD\|183400	PRK12282, PRK12282, tryptophanyl-tRNA synthetase II; Reviewed.	0
NZ_CP007557.1\|WP_038640355.1\|3554235_3555027_-\|PhzF-family-phenazine-biosynthesis-protein	gnl\|CDD\|223461	COG0384, COG0384, Predicted epimerase, PhzC/PhzF homolog [General function prediction only].	1.52249e-63
NZ_CP007557.1\|WP_038640345.1\|3548664_3550593_-\|phosphodiesterase	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	8.50185e-108
NZ_CP007557.1\|WP_038640337.1\|3541809_3543417_-\|FAD-NAD(P)-binding-protein	gnl\|CDD\|182134	PRK09897, PRK09897, FAD-NAD(P)-binding protein.	0
NZ_CP007557.1\|WP_038640332.1\|3539342_3540347_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	1.29696e-84
NZ_CP007557.1\|WP_038640351.1\|3552270_3553239_-\|threo-3-hydroxy-L-aspartate-ammonia-lyase	gnl\|CDD\|235918	PRK07048, PRK07048, threo-3-hydroxy-L-aspartate ammonia-lyase.	0
NZ_CP007557.1\|WP_038640326.1\|3531575_3532049_+\|ester-cyclase	gnl\|CDD\|377824	pfam07366, SnoaL, SnoaL-like polyketide cyclase. This family includes SnoaL a polyketide cyclase involved in nogalamycin biosynthesis. This family was formerly known as DUF1486. The proteins in this family adopt a distorted alpha-beta barrel fold. Structural data together with site-directed mutagenesis experiments have shown that SnoaL has a different mechanism to that of the classical aldolase for catalyzing intramolecular aldol condensation.	1.1173e-18
NZ_CP007557.1\|WP_038640327.1\|3532131_3534024_+\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|379192	pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-like domain.	6.53653e-07
NZ_CP007557.1\|WP_038640333.1\|3540343_3541096_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	3.03511e-81
NZ_CP007557.1\|WP_038640330.1\|3536861_3538124_+\|4-aminobutyrate-transaminase	gnl\|CDD\|182078	PRK09792, PRK09792, 4-aminobutyrate transaminase; Provisional.	0
NZ_CP007557.1\|WP_038640328.1\|3534027_3535236_+\|cytochrome-c	gnl\|CDD\|379187	pfam13442, Cytochrome_CBB3, Cytochrome C oxidase, cbb3-type, subunit III.	8.67172e-10

>NZ_CP007557.1|WP_038640337.1|3541809_3543417_-|FAD-NAD(P)-binding-protein
MNKIAIVGTGPTGIYTLLALLKHQTPLSISLYEQSNEAGVGMPYSDEENSRLMLANIASIEIPPITSSYLDWLRQQSVEHLARYGVKHASLHDRQFLPRILLGEYFRDQFLRLVDLADKQGFNITVHESCQVKDVKATTDGVVICSDHNDPEHFDLAVIATGHVWPDAQSASRTFFPSPWTGLMEAKIPACNVGILGTSLSAIDAAMAVVAQHGRFVLDDAQGVHFERNEGSQDLNILLMSRSGILPEADFYCPLPYEPLSIVTAEALEQCIADGSAGLLDRIFMLIAKEIELADPVWSKEVALSSLNADSFTDVWFAARKKHDPFRWAAANLEEVERNKREKHTVAWRYAILRLHEAVQEIVPWLDEKDRERFNNGLARVFIDNYAAIPSQSIRRLLALREAGILNIRALGQDYQLEQKEKMTVIRAQGETYKFDVFIDARGQKALKIKDLPFPSLRDQLQSTSEEIPDVGDDYTLQAPDIVRGRIALAALPWLMHDQPFVQGLTACAEIGQCVAHAISRPATRLRRRLPCYEA
>NZ_CP007557.1|WP_038640335.1|3541082_3541805_-|substrate-binding-domain-containing-protein
MSSSITLLAAGSLRPALTPLITHFTHISGIDVKVEYGPAGLLRERIEAGEPCTLFASASREHPQRLLAQHKALSTHTFCWNQLGLVTNRTGEWLDLLRNPALRIGTSTPGCDPSGDYTWAFFDKMDALETGLGQQLRERAIPLVGGRDTVRIPQGELASAWVLRQGLADLFIGYAHYAKTLRALPDVRYIAIPAEYNIQCEYQLALLEASKDALALVEFMLGNGGQEFMIAAGFIPLTDE
>NZ_CP007557.1|WP_038640333.1|3540343_3541096_+|ABC-transporter-ATP-binding-protein
MKSVALRVNRLTYGYRAPLFEPLTFSCRKGEVWAVLGRNGLGKSTLLDTLTGTLPALGGSIENAGGIGIVAQHCHLPFPYTVSDVVLMGRAQHVKLFAQPSQQDQKRAAQALEQLNIAHLGACSFGSLSGGQQQLVMIARALVTECQTLLLDEPCSALDLANQQVVLQLISDLARQQGCSVLFSTHDPLHALQIATHTLLLLPEGKWRAGATDSIVTEDNLSQAYGLPLRKVNVDHYQTPFIAPLFSIRR
>NZ_CP007557.1|WP_038640332.1|3539342_3540347_+|iron-ABC-transporter-permease
MQLSNRILPQQPLLMAAVLLLGVSSLCLGQYPLSLSEVFYHLTHYSDAAGIASQIVWTVRLPRILIALLAGGALGLCGATLQGVFHNPLVDPHIIGVTSGAAFGGTLAILLGLSPWLMMGSTFFFGLTALILVYAIATLQGLENTLVLILSGIILSGFFAALVSLIQYQADTEETLPNIVFWLLGSFATANWHKVLLLAIPVGIAATVLYQLRWRINLLSLNDKDARALGVAVVPLRRSVLVCCAFLVAAQVAVSGSIAWVGLVIPHLARLLVGVDHRRLLPCAFWLGGGFMIVVDDIARTLLPAEIPLGIITALFGAPLFAFLLIRNSRRRKQ
>NZ_CP007557.1|WP_038640331.1|3538300_3539356_+|ABC-transporter-substrate-binding-protein
MLTLRSFVLVCASFLVAFSAQAERTITDQLGRQITIPDHVDNVVVLQHQTLNILVQLNAQQDIVGVMSSWKKQLGPEFARFMPKITTLPTPGDLTSVNIESLLAIHPQVVFVANYAPAEMIQQIQNAGIPVVAISLRQDADGQQNKMNPTMADEEQVYNEGLKQGIRLIADVVGRKAQAETLIDYVFAARAKFNAPVANIPDAQKVRIYMANPDLMTYGSGKYTGLMMQHAGGLNVAAASVKGARQVALEQVLAWNPQVIFVQDRYPQVVTEIQNDPNWQGIDAVKNHRIWLMPEYAKAWGYPMPEALAIGELWMAKKLYPDAYKDVDVDAQAQDYYQRFYRVNWQSDAAK
>NZ_CP007557.1|WP_038640330.1|3536861_3538124_+|4-aminobutyrate-transaminase
MNNKNLQQRRLDATPRGVGVMCDFYAQSAENSTITDIEGNQYIDFAAGIAVLNTGHRHPRLVQAVEAQLQAFTHTAYQIVPYESYVSLAEKINAVAPIDGKRKTTFFTTGAEAVENAVKIARAHTGRPGVIAFGGGFHGRTYMTMALTGKVAPYKKGFGPFPGSVYHAPYPSELQGVSTADSLKAIERLFKADIDPTQVAAIIFEPVQGEGGFVVAPSEFVAGIRRICDEHGIVMIADEVQSGFARTGKLFAMDHYADKADLMTMAKSLAGGMPLSGVVGKAEIMDAPAPGGLGGTYAGNPLSIAAAHAVLDIIRDEQLCQRAAALGEQLRATLTDAQGWCPELAEVRGLGSMVAAEFCDAATGEPSAAVAQRVQKKALEQGLLLLTCGQYGNVIRFLYPLTIPQDQFAKALDIIKAATK
>NZ_CP007557.1|WP_038640329.1|3535279_3536755_-|PLP-dependent-aminotransferase-family-protein
MRSLAGDVIKQAFSQQTDEKLHRRLYAAICSCILEGSLKPATRMPPSRDLAGELTLSRNTVLRVYEQLQAEGYISARTSSGTFVSDSVLDNLDLRPNKEPVAVALEDHTRLSARCLELLGHASASPRQWGAFIPGVPDVQHFPHRVLKKIQDRLARRLRPAFLTYDAAGGVSELKEALADYLRTARGVRCSPDQILITEGIHQALDLVARALCNPGDNAWIEEPGYWGIKNILRINAVNFSAIPVDEQGMIPPGPTEPAPKLIFVTPSHQYPLGSVMSLSRRQQLLLRARETRSWIIEDDYDSEFRFSGQPIPSLQGLEEDTPVIYIGTFSKTLYPALRLGYVVLPKPLAAPLKKVHNDLYRGGHLLIQAALAEFIREGYYAAHIRKMRQLYSRRRQMLVELITRQLGEQYLGSFSSNAGLHMILQLPAGSDDVAIARQANAQDLLVRPLSRYYVNEEKCSGLLLGFASIEEHEMAAAFTRLATIIRENAV
>NZ_CP007557.1|WP_038640328.1|3534027_3535236_+|cytochrome-c
MRNVTVLAACLFTATVSAAETHGEYIARISDCVACHTTEGGAAMAGGKKFPTPLGDIYSTNITPDKTQGIGSYAYEDFEKAVRQGIAKDGHPLYPAMPYPSYAKLSDEDVQALYRYFMHDVTPSAQPNKENAIPWLLSARWPLHIWNWLFTDAPETAAASAKTDENAVLLKRGAYLVEGPGHCGSCHTPRGVAMNEKAYSNADPEYLSGAMIDGWYAPSLRGTGMSESELKSLLLTGKSKHAAVSGSMAEVVTQSTQYLTDEDATAIAQYLLSLKSTKPEAGRTAATTTSWSNSAEAGKVTYNRYCSTCHGLEGKGTDDNAPSLIRNPLVMVDDPTPLYRVIAYGAETPTTRGSVSFKMPAYGGMLTDSEMRDVINYVRKSWGEGNGEVSQQDLAGVKKASH
>NZ_CP007557.1|WP_038640327.1|3532131_3534024_+|NAD(P)/FAD-dependent-oxidoreductase
MAITRRDFLNGVAVTVAAGLTPLEWVRAAGKENAFIDGSYYPPALTGLRGNHPGSFEMAHAVGREHKHFDLNALPIEEEYDLVIVGGGISGLAAGCFWRQLAGQNSRILILDNHDDFGGHAKRNEFTSSGKKLLGYGGSEAFQSPAHNFSPEVQKLMETVGVSVTRLKESFDVNFYPDWQLSRGVFFDKKNFGETKIVSGDPGRAVSDDIPPDRLNGRKIEDFINDFPLSENDRKALIDLHVRPADYLPGMTIDEKTEWLDTHSYSEFLATKVGLSKMALLYFQQRSNDFFAIGIEGISCSDARACALPGMEALGLPPLDGESLADLEEPYVYHFPDGNAGLARLLVRYMLPDALPGTTMEDSVLARLHYEKLDLPENTTRLRLNSTVINAANVPDGVVVSYLRDGKMHRVRGKNTIMAGYNMLIPYLVPEMPEQQQADLKLNVKAPLVYTNVVVKNWQAFKQLGVHEFYSPAAPYSRVKLDYPVSIGGYQHPASPDDPMVIHMVYVPTYPGSNLSAREQFRLGRAYLLGTTFAAHEEMIRAQLQEMFGATGFDNQRDIAAITVNRWAHGYAYYPNSLFDDMDKMPEIIERARKPVGRIAIANSDSDWGAYAHTAIDQAWRAVNELKEMG
>NZ_CP007557.1|WP_038640326.1|3531575_3532049_+|ester-cyclase
MKTLKVAVLSLVMLSGYSLAESTSLNTVNEYMAAWNAHDASRAAQYLADDAVYYDAAAGEPITGREKAEKEVIGAFIKAVPDLTWKMIGKPVYDEDTVAFRWQFSGKNSGEWAGSPPTNNLIRFEGVSYIHVKAGKITWQGDYYDSKKLDEELKPVK
>NZ_CP007557.1|WP_038640339.1|3544193_3545198_-|tryptophan--tRNA-ligase
MNNKTIILTGDRPTGPLHLGHYVGSLRQRATLQHDYQQFILVADLQGLTDNGSTPQKIQNNIPEVLADYLAAGIDPSLTTICLQSALPALTELTALYMNIVTVARVERNPTVKNEIAQKGFARSLPVGFLVYPISQAADISAFKAEVVPVGDDQLPMIEQTNEIVHKMNSLLPAPVLSHCKALLSETSRLPGIDGNAKMSKSLGNTILLSASEETIHRAVSAMYTDPNHLKVSDPGQIDGNIVFTYLDAFHPDKIKVAEMKARYQRGGLGDRACKNELEMCLQELIAPMRERRATYIQDKGMLMAMLKKGSEQAHEVTQQTLREVKQGLGLPVF
>NZ_CP007557.1|WP_038640341.1|3545415_3547200_-|diguanylate-cyclase
MRIATITNWAYSATVCLTIASGVVMLMASNADNTERQVVEQRYKFDQLTEEVELDAWSLSDMARLYVVSKDPDALNNYRQKEASLKAVEHRLAALKDAGATGEELALLHEGLQIVDALQDEQTAALASVARGEHTQAIALLFSKTYEQELERAQDRIDHFRQLLDNRVLYAIEDATQASRTLRTASEVMVGLTALLFLFVLGFILKRRVLRPVVRLSDVVNRLASQDYAVETPSFNQIDEIGDMAQAIRIFRENGLARQRLEKERDADWGIRELLARMTQRLQGCESFADVINVAELFAPNIAPGIAGRLYILDREPWQMRCVAQWLSPEGKADAFHPDECWAVRRGQSHPPVQDEPDIACYHLPESCQRQTLCVPLIAQGEAIGLLSFQNLSEDSTSSRAYLELMAEALGLALANQRLRDALLEKALYDPLTGLRNRHHLEDTLRTQMSQAVRTQEPISCLMIDIDHFKNINDRFGHEAGDSVIKSIAAIIQRVVHDSGMAFRYGGEEFLVLLAGADEQAANSFATDIYNGVRELSLRFGVSDIGHVDVSIGVASYPQHAQSDNLLRAADVALYRAKELGRSRIVSFGMLEAS
>NZ_CP007557.1|WP_038640343.1|3547318_3548428_-|AI-2E-family-transporter
MRFNGLTKGFFIFILALVTWAFFDVLSPYFSAILWAAILTTIFNPVKNRLRSALGERNGLASLITIAIICLIVFIPLMVILSSLAIELNVVYNKLQQNDTQFPEVVTSILSYLPGWARGFLAEHNLDNVAEIQKKLSDIVLQGGQYLAGSAFLIGKGTFGFAISFGIMLYLLFFLLKDGPYLVRQILDSLPLSDFAKQHLFAKFVGVTRATVKGTAVVALVQGILGGIAFAIVDIDGSVLWGALMAFLSLVPAVGSAIVWVPAAIFLFATHQLWQGLFIVGFFVIIVGLVDNILRPLLVGKDTKMPDYLILITTLGGMEIYGINGFVIGPLIAALFITCWNLFSGRDHAGNVEGIDEAFIEEGKNPPDL
>NZ_CP007557.1|WP_038640345.1|3548664_3550593_-|phosphodiesterase
MNRILAGIIFFLFISTGYISFLVHERQQELQKLTHYTDSWSAAQMVSQYYRFESLLGLYTIDEAMNLDEVRLRLDIMLSQSDLIKEGDLGHYIASNQAHSELALKLENTLNYLDLNLEKMNRSELQAYLKKMHALDSQLGRLSSGALNKDVNSINNANLKIQTLYYIYSATSVLLIILSAILGVLIFFQNRNILRAHLQVKSLAEELQSSKEKLQIQNAKLEYDVYHDSLTDMNNRQFFWGNLNQTIEMAEKNNDSVTVMLFDLDRFKEVNDTYGHDAGDILLRQISDRLISMSHTSDTLYRLGGDEFAFLSSGLTESQAVSRAQKICDFISQPYTIYNTIINITTCVGIVISETERRSDYLYKFADLALYEAKNEGSGKIKVFRQWMLEKLQESRTLEHDMAMAIVNKEFVVYYQPIVDSFSREIYSYEALIRWVHPLKGLLSPDSFIPVAEKTGMINEMGKFVLEMACTEAASWTIPAKISVNVSPVQLSSKAFAGIVLTILKETGLPAQRLELEVTESSIFTESNTPMNTLNKLRALGVKISIDDFGTGYSSLSRLSRLAFDKIKIDKSFVHSLSTQDDALNIIKLITGMAKSLNMKAVAEGVETQEQLEKLQALGCDFAQGYLFGKPQPGIDGKIRHG
>NZ_CP007557.1|WP_038640347.1|3550610_3551105_-|molybdopterin-dependent-oxidoreductase
MRLFVMLLSLVVSTQLWAGELSKPTGKVLLTVSGNIENTNEDGKATFDTASLEKLGMVSFQTTSPWYNGRTTFTGIPLQKLMDFVGAKGTVVKVTALNDYTTVIPLNDFKKYNVILALKINGKYMQIRDKGPLFIVYPYDSISELNNQIYYSRSAWQVSRMDIE
>NZ_CP007557.1|WP_038640349.1|3551504_3552146_-|transcriptional-regulator
MPKTDNNSLLSQLDTIARGLSETFSPFCEVVVHDLKKPEHAILSIHNNLSGRKPGQPATELGLARIASPDFPSIIANYSNQFADGRPVKSTSIGIKDEDGKYVAALCLNVDMTLFRGMQSALAQFTETEDSPIKEHIDPGSNEVIRQRIDDFAAKRATTARALKPEDRKLLIQKLRKEGLLNVRKSMDTVAQHLGVSRATAYLYARQSAHMRD
>NZ_CP007557.1|WP_038640351.1|3552270_3553239_-|threo-3-hydroxy-L-aspartate-ammonia-lyase
MTDMTLPDYNDIVAAAERIANYANKTPVMTSRTVNEEFGAEVFFKCENFQRMGAFKFRGAMNALRQFTPQQRAAGVVTFSSGNHAQAIALSAKLLGIPATIIMPHDAPAAKVAATKGYGGNVVIYDRYTEDREKIGQDLAEKQGLTLIPPYDHPHVIAGQGTATKELIEEVGPLDVLFVCLGGGGLLSGSALAARHLSPDCVVYGVEPEAGNDGQQSFRSGNIVHIDTPKTIADGAQTQHLGQYTFAIIQQNVNDILTVSDTELVTAMKFIAERMKIVVEPTGCLGFAAARARKSELQGKKIGIIISGGNVDISRYGELLAG
>NZ_CP007557.1|WP_038640352.1|3553266_3553662_-|RidA-family-protein
MSPDITLNASPGSFPPAGHYSHSTTAGGFVFISGQLPVTLDGEKKADASFEEQTRLALQNVDACLAGAGISRQHLVSVRVYVTDINQWPTFNRIYGEWIGDFRPARAVAGVAELHYGFAVEIEAMALAAQA
>NZ_CP007557.1|WP_038640354.1|3553887_3554196_-|monooxygenase
MSNKLVQIHFNFHGPFGAEMSQQLVELAESINQEPGFIWKIWTENEANHEAGGIYLFQDQDSAQAYIKKHTARLKHLGVEEVFFKIFDINEPLSKINHGHIG
>NZ_CP007557.1|WP_038640355.1|3554235_3555027_-|PhzF-family-phenazine-biosynthesis-protein
MQQIDFYMVDAFSTTTFAGNAAAVCPLTDWLPDETLLKMAQQHNQSETAFFVANDNGFELRWFTTQGEINLCGHATLAAAHVIFEHLDYPDTTIHFATRFVGPLMVTRSGEWLTLDFPAWQSEPVVPPALLLEALGITEYKEVRVGRDYMVVLEDQHQVEAVRPNIHAMVPLGKMVCITAPGDGEYDFVSRFFCPGEAVAEDPVTGSAHSMLIPYWAAKLNKTEMLARQVSERGGDLRCQLADSRVYIGGQATTYLTGKVLLR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP007557_1	1.1\|3543704\|38\|NZ_CP007557\|CRISPRCasFinder	3543704-3543741	38	NZ_CP043437	Enterobacter sp. LU1 plasmid unnamed	113727-113764	3	0.921

1. spacer 1.1|3543704|38|NZ_CP007557|CRISPRCasFinder matches to NZ_CP043437 (Enterobacter sp. LU1 plasmid unnamed) position: , mismatch: 3, identity: 0.921

cggacgcaatatggtgcgttcaattggactcgaaccaa	CRISPR spacer
cagacgcagaatggtgcgttcaattggactcgaaccaa	Protospacer
*.******. ****************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 10750

Salmonella_phage(81.82%)

integrase

attL 172:184|attR 8216:8228

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
172:184	attL	NA	NA	NA	NA
WP_038632775.1\|454_1309_-	DNA adenine methylase	E5G6L8	Salmonella_phage	4.4e-148	90.5
WP_000752619.1\|1305_1533_-	TraR/DksA family transcriptional regulator	E5G6L7	Salmonella_phage	3.5e-36	98.7
WP_001244233.1\|1532_1766_-	DUF2732 family protein	E5G6L6	Salmonella_phage	1.6e-31	94.8
WP_000996720.1\|1833_2175_-	DUF5347 domain-containing protein	E5G6L5	Salmonella_phage	1.1e-54	96.5
WP_000956192.1\|2292_2589_-	DUF2724 domain-containing protein	E5G6L4	Salmonella_phage	1.9e-21	88.5
WP_000460856.1\|2596_3106_-	phage regulatory CII family protein	E5G6L3	Salmonella_phage	1.3e-83	95.3
WP_000102105.1\|3138_3381_-	Rha family transcriptional regulator	A0A1S6KZZ6	Salmonella_phage	6.8e-38	97.5
WP_000582125.1\|3500_4133_+	phage repressor protein CI	A0A1S6KZZ7	Salmonella_phage	1.3e-104	89.0
WP_000155495.1\|4134_5151_+\|integrase	site-specific integrase	E5G6L0	Salmonella_phage	2.0e-187	93.7
WP_051594477.1\|5156_6218_+	hypothetical protein	NA	NA	NA	NA
WP_038632796.1\|6748_7543_-	hypothetical protein	NA	NA	NA	NA
WP_038632799.1\|7950_8499_+	AAA family ATPase	A0A219VHB7	Ochrobactrum_phage	1.4e-22	57.0
8216:8228	attR	NA	NA	NA	NA
WP_001189111.1\|9241_10750_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	3.6e-44	31.8

DBSCAN-SWA_2

23169 : 26412

Ectocarpus_siliculosus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038632840.1\|23169_26412_-	transporter substrate-binding domain-containing protein	Q8QKV7	Ectocarpus_siliculosus_virus	6.8e-32	30.5

DBSCAN-SWA_3

37808 : 38825

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038632871.1\|37808_38825_+	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	7.2e-81	46.5

DBSCAN-SWA_4

63920 : 64634

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038632928.1\|63920_64634_+	MgtC/SapB family protein	G3MA03	Bacillus_virus	1.4e-14	37.1

DBSCAN-SWA_5

68637 : 72656

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038632940.1\|68637_69921_+	4-aminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	9.6e-30	29.3
WP_038632942.1\|70061_71462_+	GABA permease	NA	NA	NA	NA
WP_038632944.1\|71507_72194_+	DNA-binding transcriptional regulator CsiR	NA	NA	NA	NA
WP_038632949.1\|72206_72656_-	peptidoglycan-binding protein LysM	A0A090DBR9	Clostridium_phage	5.2e-07	39.5

DBSCAN-SWA_6

78273 : 83570

Lactobacillus_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038632979.1\|78273_78519_+	glutaredoxin-like protein NrdH	A0A0M7REK7	Lactobacillus_phage	2.5e-11	41.1
WP_038632982.1\|78515_78926_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A142F1R4	Bacillus_phage	1.7e-17	42.6
WP_038632984.1\|78898_81043_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	V9VI16	Lactococcus_phage	4.9e-196	48.2
WP_038632987.1\|81053_82013_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A0M4S3B4	Mycobacterium_phage	2.3e-129	69.9
WP_038632990.1\|82367_83570_+	glycine betaine/L-proline ABC transporter ATP-binding protein ProV	G3M9Y6	Bacillus_virus	1.4e-27	38.8

DBSCAN-SWA_7

96456 : 101863

Vibrio_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000906486.1\|96456_96642_-	carbon storage regulator CsrA	A0A2I7RT00	Vibrio_phage	4.9e-12	66.7
WP_038633032.1\|96880_99508_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	6.4e-81	39.0
WP_038633035.1\|99635_100136_-	recombination regulator RecX	NA	NA	NA	NA
WP_038633038.1\|100208_101273_-	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	4.0e-114	63.8
WP_003037333.1\|101365_101863_-	nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	2.6e-31	51.0

DBSCAN-SWA_8

107404 : 108370

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038633059.1\|107404_108370_+	arabinose-5-phosphate isomerase GutQ	A0A2P0VNK5	Tetraselmis_virus	3.0e-36	33.9

DBSCAN-SWA_9

115821 : 116835

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038633073.1\|115821_116835_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	1.9e-25	27.9

DBSCAN-SWA_10

136098 : 142283

Brazilian_cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038633120.1\|136098_136914_+	iron/manganese ABC transporter ATP-binding protein SitB	A0A2R8FG22	Brazilian_cedratvirus	2.0e-12	25.8
WP_038633122.1\|136916_137774_+	iron/manganese ABC transporter permease subunit SitC	NA	NA	NA	NA
WP_038633125.1\|137770_138622_+	iron/manganese ABC transporter permease subunit SitD	NA	NA	NA	NA
WP_038633127.1\|139721_142283_+	DNA mismatch repair protein MutS	E3T5Q7	Cafeteria_roenbergensis_virus	4.1e-32	21.0

DBSCAN-SWA_11

145303 : 148987

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000081498.1\|145303_146296_-	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	6.1e-32	37.6
WP_038633147.1\|146358_147486_-	murein hydrolase activator NlpD	D7RWE0	Brochothrix_phage	5.0e-06	34.6
WP_038633150.1\|147605_148232_-	protein-L-isoaspartate O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	2.0e-36	50.6
WP_038633152.1\|148225_148987_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	2.5e-57	46.7

DBSCAN-SWA_12

152118 : 154151

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038633165.1\|152118_152724_-	adenylyl-sulfate kinase	A0A2K9L4R9	Tupanvirus	1.6e-27	37.1
WP_038633168.1\|152723_154151_-	sulfate adenylyltransferase subunit CysN	A0A1V0SGC3	Hokovirus	9.7e-31	25.1

DBSCAN-SWA_13

161582 : 162254

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038633185.1\|161582_162254_-	7-carboxy-7-deazaguanine synthase QueE	A0A2I7S8X1	Vibrio_phage	3.9e-14	24.6

DBSCAN-SWA_14

165616 : 168639

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003034129.1\|165616_166915_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	1.4e-129	57.9
WP_005130912.1\|167001_168639_-	CTP synthase (glutamine hydrolyzing)	A0A1J0FA14	Only_Syngen_Nebraska_virus	3.9e-153	50.7

DBSCAN-SWA_15

172117 : 180198

Erysipelothrix_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038633202.1\|172117_173416_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	1.8e-36	28.4
WP_038633206.1\|173473_176230_+	two-component sensor histidine kinase BarA	A0A1V0SGX0	Hokovirus	4.6e-53	29.5
WP_038633208.1\|176271_177414_-	glycerate kinase	W6LM47	Streptococcus_phage	3.7e-49	40.9
WP_038633210.1\|177496_178837_-	glucarate dehydratase	NA	NA	NA	NA
WP_038633213.1\|178857_180198_-	glucarate dehydratase	Q6A202	Oenococcus_phage	6.5e-05	22.6

DBSCAN-SWA_16

184724 : 185573

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038633229.1\|184724_185573_+	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	A0A2I7SAX1	Vibrio_phage	9.4e-42	37.6

DBSCAN-SWA_17

190442 : 191198

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038633235.1\|190442_191198_+	flap endonuclease Xni	F8WQ40	Bacillus_phage	1.8e-07	30.2

DBSCAN-SWA_18

197955 : 199455

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038633254.1\|197955_199455_-	sugar ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.1e-16	27.2

DBSCAN-SWA_19

207664 : 223260

environmental_halophage(16.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038642847.1\|207664_208870_+	cysteine desulfurase CsdA	Q2XUY6	environmental_halophage	2.1e-71	36.6
WP_038633278.1\|208869_209316_+	cysteine desulfurase sulfur acceptor subunit CsdE	NA	NA	NA	NA
WP_038633280.1\|209394_210201_-\|tRNA	tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA	S4VW33	Pandoravirus	6.5e-16	33.3
WP_038633283.1\|210335_211433_-	murein transglycosylase A	NA	NA	NA	NA
WP_038633286.1\|212143_213397_-	N-acetylmuramoyl-L-alanine amidase AmiC	E5DV68	Deep-sea_thermophilic_phage	4.7e-13	28.4
WP_038633289.1\|213631_214963_+	amino-acid N-acetyltransferase	NA	NA	NA	NA
WP_038633294.1\|215007_216837_-	exodeoxyribonuclease V subunit alpha	A0A1P8DII4	Virus_Rctr197k	1.3e-03	36.0
WP_038633296.1\|216833_220379_-	exodeoxyribonuclease V subunit beta	A7KV33	Bacillus_phage	6.2e-10	20.6
WP_038633297.1\|220371_223260_-	pitrilysin	A0A1V0SJA4	Klosneuvirus	2.9e-66	25.0

DBSCAN-SWA_20

228741 : 235565

Cronobacter_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038633316.1\|228741_229536_-	thymidylate synthase	R4IFY1	Cronobacter_phage	1.1e-116	62.3
WP_038633319.1\|229542_230418_-	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_038633322.1\|230606_232853_-	phosphoenolpyruvate--protein phosphotransferase	A0A1V0SGR7	Hokovirus	3.9e-10	24.6
WP_003825602.1\|232865_233396_-	RNA pyrophosphohydrolase	NA	NA	NA	NA
WP_038633327.1\|234080_234776_+	DNA mismatch repair endonuclease MutH	NA	NA	NA	NA
WP_038633330.1\|234851_235565_+	TerC family protein	A0A0R6PEZ3	Moraxella_phage	6.9e-46	46.8

DBSCAN-SWA_21

242145 : 243156

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038633346.1\|242145_243156_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	6.2e-32	29.9

DBSCAN-SWA_22

246859 : 250298

Sodalis_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038633357.1\|246859_247747_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	1.8e-67	55.0
WP_038633360.1\|247802_249221_-	arabinose-proton symporter AraE	O13311	Aichi_virus	1.8e-24	26.9
WP_003033923.1\|249536_250298_-	2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD	Q06VL0	Trichoplusia_ni_ascovirus	2.6e-19	32.1

DBSCAN-SWA_23

265681 : 266287

Canarypox_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038633392.1\|265681_266287_-	ankyrin repeat domain-containing protein	Q6VZ28	Canarypox_virus	7.0e-07	26.9

DBSCAN-SWA_24

275373 : 275910

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038633410.1\|275373_275910_+	N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	1.5e-16	34.2

DBSCAN-SWA_25

294529 : 295264

Microcystis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038642856.1\|294529_295264_-	peptidoglycan DD-metalloendopeptidase family protein	A0A7K9	Microcystis_virus	1.1e-09	38.1

DBSCAN-SWA_26

299967 : 306057

Catovirus(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006686909.1\|299967_301485_-\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	2.3e-86	36.9
WP_100194817.1\|301494_302593_-	peptide chain release factor 2	A0A0S4KWG0	Pseudomonas_phage	1.8e-05	39.0
WP_038633470.1\|302684_304418_-	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	1.2e-59	28.3
WP_038633473.1\|304423_305137_-	bifunctional protein-disulfide isomerase/oxidoreductase DsbC	NA	NA	NA	NA
WP_038633475.1\|305160_306057_-	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	2.5e-29	27.9

DBSCAN-SWA_27

310814 : 316037

Pandoravirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038633498.1\|310814_312248_+	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	3.7e-30	26.3
WP_038633501.1\|312341_313085_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_038633504.1\|313163_316037_-	aminomethyl-transferring glycine dehydrogenase	M4QFZ1	Prochlorococcus_phage	1.3e-260	50.4

DBSCAN-SWA_28

324267 : 325500

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006686878.1\|324267_325500_-	phosphoglycerate dehydrogenase	A0A1V0SBV6	Catovirus	1.1e-102	47.9

DBSCAN-SWA_29

356187 : 359139

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006686850.1\|356187_357342_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	9.6e-130	63.7
WP_038633584.1\|357744_359139_+	galactose/proton symporter	O13311	Aichi_virus	1.1e-26	25.5

DBSCAN-SWA_30

372437 : 373523

Geobacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_129694833.1\|372437_373523_+	membrane-bound lytic murein transglycosylase MltC	A0A0H3V0Q1	Geobacillus_virus	4.5e-12	39.0

DBSCAN-SWA_31

378734 : 382367

Stx2-converting_phage(66.67%)

integrase

attL 367908:367922|attR 380556:380570

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
367908:367922	attL	NA	NA	NA	NA
WP_032170149.1\|378734_380000_+\|integrase	integrase arm-type DNA-binding domain-containing protein	Q7M297	Enterobacteria_phage	1.3e-79	39.1
WP_071888038.1\|381447_382023_+	IS66 family insertion sequence hypothetical protein	A0A0P0ZCV4	Stx2-converting_phage	1.5e-14	37.0
380556:380570	attR	NA	NA	NA	NA
WP_038633649.1\|382019_382367_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	1.2e-43	72.0

DBSCAN-SWA_32

391471 : 393377

Escherichia_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001067855.1\|391471_392176_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_051594483.1\|392209_392638_-	hypothetical protein	NA	NA	NA	NA
WP_004393997.1\|392666_393377_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.7e-31	38.3

DBSCAN-SWA_33

397473 : 399551

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006785898.1\|397473_398874_-	copper resistance membrane spanning protein PcoS	W8CYF6	Bacillus_phage	3.2e-18	26.6
WP_001188930.1\|398870_399551_-	copper response regulator transcription factor PcoR	W8CYM9	Bacillus_phage	8.7e-30	34.4

DBSCAN-SWA_34

404645 : 408108

Listeria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000287501.1\|404645_405383_+	peptidoglycan DD-metalloendopeptidase family protein	A8ATH6	Listeria_phage	1.0e-12	41.0
WP_000843494.1\|405416_405614_-	DUF2933 domain-containing protein	NA	NA	NA	NA
WP_038633697.1\|405654_408108_-	Ag(+)-translocating P-type ATPase SilP	A0A218MNH6	uncultured_virus	7.6e-84	34.9

DBSCAN-SWA_35

415281 : 419468

Bacillus_phage(66.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038633715.1\|415281_415962_+	copper/silver response regulator transcription factor SilR	W8CYM9	Bacillus_phage	7.8e-31	35.7
WP_032433718.1\|415954_417430_+	copper/silver sensor histidine kinase SilS	W8CYF6	Bacillus_phage	1.8e-27	29.7
WP_038633721.1\|417680_418112_+	silver-binding protein SilE	NA	NA	NA	NA
WP_096755719.1\|418320_419468_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.9e-146	92.2

DBSCAN-SWA_36

426211 : 427766

Yersinia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001234374.1\|426211_427030_+	DUF945 domain-containing protein	A0A2C9CX26	Yersinia_phage	1.2e-46	39.4
WP_038633754.1\|427029_427293_+	hypothetical protein	NA	NA	NA	NA
WP_038633758.1\|427289_427766_+	antirestriction protein	A0A1S5R3R9	Pseudomonas_phage	1.2e-09	31.8

DBSCAN-SWA_37

431414 : 431621

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038633780.1\|431414_431621_-	helix-turn-helix domain-containing protein	A0A2I7S995	Vibrio_phage	7.4e-17	64.2

DBSCAN-SWA_38

443293 : 445918

Cronobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038633800.1\|443293_445918_-	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	9.6e-93	31.7

DBSCAN-SWA_39

465432 : 467073

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038633848.1\|465432_467073_-	Tar ligand binding domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	7.0e-09	54.4

DBSCAN-SWA_40

475998 : 481195

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038633879.1\|475998_476826_+	2,5-didehydrogluconate reductase DkgA	A0A2H4PQR8	Staphylococcus_phage	1.0e-56	42.3
WP_038633882.1\|477014_478469_+	DASS family sodium-coupled anion symporter	NA	NA	NA	NA
WP_038633885.1\|478512_478968_+	HIT family protein	Q5YEY9	Rock_bream_iridovirus	1.1e-20	36.8
WP_003024532.1\|479023_481195_-	YgiQ family radical SAM protein	M1QSD9	Pseudomonas_phage	1.3e-103	70.4

DBSCAN-SWA_41

485301 : 488074

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038633896.1\|485301_487560_-	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	7.5e-86	35.5
WP_038633899.1\|487678_488074_-	YgiW/YdeI family stress tolerance OB fold protein	A0A1I9LJU6	Stx_converting_phage	1.8e-19	47.2

DBSCAN-SWA_42

491366 : 493259

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005123094.1\|491366_493259_-	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	6.9e-93	35.1

DBSCAN-SWA_43

497598 : 505290

Erwinia_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006688037.1\|497598_498276_+	DUF1190 family protein	A0A173GEW8	Erwinia_phage	3.7e-41	47.3
WP_038642878.1\|498281_499442_+	glutathionylspermidine synthase family protein	B2ZXR7	Ralstonia_phage	1.3e-86	43.1
WP_038633925.1\|499526_500315_-	4,5-DOPA dioxygenase extradiol	NA	NA	NA	NA
WP_038633928.1\|500462_501236_+	zinc transporter ZupT	NA	NA	NA	NA
WP_069324349.1\|501302_501479_-	hypothetical protein	NA	NA	NA	NA
WP_038633931.1\|501910_502564_-	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	8.3e-46	44.8
WP_038633935.1\|502953_503250_+	accessory factor UbiK family protein	NA	NA	NA	NA
WP_087856824.1\|503283_503490_-	cell surface composition regulator GlgS	NA	NA	NA	NA
WP_038633941.1\|503856_505290_-	bifunctional D-glycero-beta-D-manno-heptose-7-phosphate kinase/D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase HldE	A0A1B1IUK5	uncultured_Mediterranean_phage	1.7e-38	28.8

DBSCAN-SWA_44

510464 : 513836

Sinorhizobium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038633951.1\|510464_511697_+	multifunctional CCA addition/repair protein	A0A0F6YPT7	Sinorhizobium_phage	1.4e-94	49.4
WP_038633954.1\|511745_513836_-	polysaccharide degrading enzyme	A0A068LRB9	Peridroma_alphabaculovirus	1.6e-29	26.2

DBSCAN-SWA_45

525467 : 531042

Moraxella_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038633989.1\|525467_526481_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	2.2e-109	59.5
WP_001144069.1\|526717_526933_+	30S ribosomal protein S21	NA	NA	NA	NA
WP_038633998.1\|527167_528913_+	DNA primase	A0A0K1LMQ9	Caulobacter_phage	8.4e-77	38.8
WP_038634001.1\|529197_531042_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	8.4e-35	33.7

DBSCAN-SWA_46

545152 : 552290

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038634036.1\|545152_546307_-	cyclopropane fatty acyl phospholipid synthase	A0A2K9L4K8	Tupanvirus	3.6e-84	45.8
WP_038634037.1\|546373_547222_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_038634038.1\|547222_547996_-	siderophore-interacting protein	NA	NA	NA	NA
WP_038634039.1\|548235_548907_+	PadR family transcriptional regulator	NA	NA	NA	NA
WP_038634042.1\|548959_550480_-	PAS domain-containing methyl-accepting chemotaxis protein	A0A1B0V854	Salmonella_phage	6.4e-33	48.5
WP_129694873.1\|550847_552290_+	putrescine aminotransferase	A0A1V0SKB7	Klosneuvirus	2.1e-33	28.9

DBSCAN-SWA_47

557641 : 558610

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038642882.1\|557641_558610_+	TerC family protein	I7HPH5	Enterobacteria_phage	4.5e-32	31.8

DBSCAN-SWA_48

579491 : 581786

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038634104.1\|579491_581786_-	2-ketobutyrate formate-lyase/pyruvate formate-lyase	A0A2P0VNR5	Tetraselmis_virus	2.4e-156	40.7

DBSCAN-SWA_49

587609 : 588755

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038634116.1\|587609_588755_-	glycerate 2-kinase	W6LM47	Streptococcus_phage	5.9e-47	39.9

DBSCAN-SWA_50

602859 : 609543

Streptococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038634156.1\|602859_603723_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	5.6e-50	43.6
WP_038634158.1\|603786_605829_+	penicillin-binding protein activator	NA	NA	NA	NA
WP_038634160.1\|605786_606182_+	YraN family protein	NA	NA	NA	NA
WP_003024948.1\|606216_606807_+	DnaA initiator-associating protein DiaA	A0A067XQR2	Caulobacter_phage	3.2e-12	31.8
WP_003024954.1\|606816_607392_+	divisome-associated lipoprotein YraP	NA	NA	NA	NA
WP_038634162.1\|607485_608121_-	NAD(P)H-binding protein	NA	NA	NA	NA
WP_038634164.1\|608249_608768_+	type 1 glutamine amidotransferase	A0A0N7KVR4	Yellowstone_lake_phycodnavirus	2.6e-10	27.6
WP_038634166.1\|608747_609191_-	YhbP family protein	NA	NA	NA	NA
WP_038634168.1\|609243_609543_+	GIY-YIG nuclease family protein	F2NZ06	Diadromus_pulchellus_ascovirus	2.2e-14	51.2

DBSCAN-SWA_51

615326 : 617252

Chrysochromulina_ericina_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038634182.1\|615326_617252_-	ATP-dependent RNA helicase DeaD	A0A0N9Q9J4	Chrysochromulina_ericina_virus	4.6e-52	30.8

DBSCAN-SWA_52

622866 : 631665

Cafeteria_roenbergensis_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038634196.1\|622866_625557_-	translation initiation factor IF-2	E3T4N3	Cafeteria_roenbergensis_virus	3.3e-24	26.3
WP_038634199.1\|625581_627069_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_003024996.1\|627097_627550_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_038634202.1\|628168_629512_+	argininosuccinate synthase	A0A140XAJ5	Dickeya_phage	4.8e-64	93.7
WP_006687886.1\|629804_630137_-	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_051594485.1\|630351_631665_-	M23 family metallopeptidase	G9FHH0	Rhodococcus_phage	1.2e-06	33.7

DBSCAN-SWA_53

641944 : 647319

Vibrio_virus(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_077223913.1\|641944_642661_-	type IV pilus major pilin	Q8LTI3	Vibrio_virus	1.4e-14	33.0
WP_038634228.1\|643106_644444_-	phosphoglucosamine mutase	NA	NA	NA	NA
WP_038634231.1\|644436_645285_-	dihydropteroate synthase	S4VNV0	Pandoravirus	1.3e-19	31.2
WP_003025013.1\|645384_647319_-\|protease	ATP-dependent zinc metalloprotease FtsH	G8DDJ2	Micromonas_pusilla_virus	4.1e-117	43.6

DBSCAN-SWA_54

656391 : 657872

Indivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003025033.1\|656391_657363_+	octaprenyl diphosphate synthase	A0A1V0SE37	Indivirus	1.6e-08	26.2
WP_038634246.1\|657587_657872_+	DNA-binding transcriptional regulator SfsB	A0A2I7S995	Vibrio_phage	4.6e-17	65.7

DBSCAN-SWA_55

661964 : 676050

Staphylococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038634255.1\|661964_662777_-	phospholipid ABC transporter ATP-binding protein MlaF	G3M9Y6	Bacillus_virus	2.2e-19	30.7
WP_038634258.1\|662992_663970_+	calcium/sodium antiporter	NA	NA	NA	NA
WP_038634261.1\|663983_664970_+	arabinose-5-phosphate isomerase KdsD	A0A2P0VNK5	Tetraselmis_virus	4.3e-38	31.2
WP_038634264.1\|664990_665557_+	3-deoxy-manno-octulosonate-8-phosphatase KdsC	A0A140XBD6	Dickeya_phage	1.2e-53	75.6
WP_038634267.1\|665553_666129_+	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_038634270.1\|666097_666646_+	lipopolysaccharide ABC transporter substrate-binding protein LptA	NA	NA	NA	NA
WP_003025073.1\|666652_667378_+	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.2e-22	28.4
WP_038634272.1\|667424_668858_+	RNA polymerase factor sigma-54	NA	NA	NA	NA
WP_038634275.1\|668880_669168_+	ribosome hibernation promoting factor	A0A0M7QCF2	Escherichia_phage	5.5e-10	43.2
WP_038634278.1\|669250_669742_+	PTS IIA-like nitrogen regulatory protein PtsN	NA	NA	NA	NA
WP_003025085.1\|669787_670642_+	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	1.4e-05	28.4
WP_003025086.1\|670638_670911_+	PTS phosphocarrier protein NPr	NA	NA	NA	NA
WP_038634281.1\|670977_671697_-	monofunctional biosynthetic peptidoglycan transglycosylase	NA	NA	NA	NA
WP_038634284.1\|671693_672347_-	isoprenoid biosynthesis glyoxalase ElbB	NA	NA	NA	NA
WP_038634287.1\|672576_674913_-	aerobic respiration two-component sensor histidine kinase ArcB	A0A1V0SGX0	Hokovirus	9.9e-41	31.1
WP_114140335.1\|675120_676050_-	TIGR01212 family radical SAM protein	A0A2H4PQV5	Staphylococcus_phage	5.2e-17	32.8

DBSCAN-SWA_56

686898 : 688389

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038634306.1\|686898_688389_-	sialic acid transporter NanT	Q6JIH2	Burkholderia_virus	7.0e-08	23.5

DBSCAN-SWA_57

692100 : 692604

Pseudomonas_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038634317.1\|692100_692604_-\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	9.6e-26	54.8

DBSCAN-SWA_58

696503 : 697871

uncultured_Mediterranean_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038634331.1\|696503_697871_+\|protease	serine endoprotease DegQ	A0A1B1IT49	uncultured_Mediterranean_phage	1.5e-20	25.3

DBSCAN-SWA_59

715566 : 716610

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000913396.1\|715566_716610_-	rod shape-determining protein MreB	F2Y0P3	Organic_Lake_phycodnavirus	6.7e-05	22.3

DBSCAN-SWA_60

729255 : 730140

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038634402.1\|729255_730140_+	adenine-specific DNA-methyltransferase	A0A0P0CJX0	Ostreococcus_lucimarinus_virus	3.1e-27	31.1

DBSCAN-SWA_61

736736 : 740892

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038634415.1\|736736_737762_+	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	1.2e-70	39.5
WP_038634418.1\|737831_739013_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_038634420.1\|739022_740126_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_038634423.1\|740133_740892_+	amino acid ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.1e-20	31.2

DBSCAN-SWA_62

748817 : 749432

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038634432.1\|748817_749432_-	IMPACT family protein	A0A1X9I5T8	Streptococcus_phage	2.1e-19	45.7

DBSCAN-SWA_63

760417 : 763737

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038634459.1\|760417_761209_-	Sec-independent protein translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	4.7e-27	32.4
WP_038634462.1\|761211_761760_-	Sec-independent protein translocase subunit TatB	NA	NA	NA	NA
WP_003017888.1\|761763_762018_-	Sec-independent protein translocase subunit TatA	NA	NA	NA	NA
WP_038634465.1\|762096_763737_-	ubiquinone biosynthesis regulatory protein kinase UbiB	M4R0M8	Ostreococcus_lucimarinus_virus	9.7e-43	29.5

DBSCAN-SWA_64

776272 : 778102

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038634489.1\|776272_778102_-	ATP-dependent DNA helicase RecQ	A0A1V0SBK0	Catovirus	8.2e-83	38.3

DBSCAN-SWA_65

782119 : 785989

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038634502.1\|782119_784282_-	DNA helicase II	A7KV33	Bacillus_phage	3.5e-117	37.7
WP_038634504.1\|784370_785087_-	5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase YigB	NA	NA	NA	NA
WP_038634507.1\|785086_785989_-	tyrosine recombinase XerC	A0A142F1N9	Bacillus_phage	7.2e-24	29.5

DBSCAN-SWA_66

802461 : 808623

uncultured_marine_virus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038634547.1\|802461_803592_-	dTDP-4-amino-4,6-dideoxygalactose transaminase	A0A0F7LAY0	uncultured_marine_virus	1.7e-17	39.4
WP_038634550.1\|803596_804274_-	dTDP-4-amino-4,6-dideoxy-D-galactose acyltransferase	NA	NA	NA	NA
WP_038634554.1\|804251_805133_-	glucose-1-phosphate thymidylyltransferase RfbA	A0A291LA53	Escherichia_phage	1.0e-107	67.0
WP_038634557.1\|805166_806234_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	6.6e-101	53.1
WP_038634559.1\|806233_807496_-	UDP-N-acetyl-D-mannosamine dehydrogenase	M1HNJ7	Paramecium_bursaria_Chlorella_virus	7.7e-24	26.5
WP_038634562.1\|807492_808623_-	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A1V0SAG5	Catovirus	1.4e-27	27.0

DBSCAN-SWA_67

812677 : 818916

Indivirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001280776.1\|812677_813007_-	thioredoxin TrxA	A0A1V0SD63	Indivirus	4.2e-14	38.5
WP_003829013.1\|813138_814407_+	ATP-dependent RNA helicase RhlB	E3T5E1	Cafeteria_roenbergensis_virus	8.3e-42	31.2
WP_038634581.1\|814540_816022_+	guanosine-5'-triphosphate,3'-diphosphate diphosphatase	NA	NA	NA	NA
WP_038634584.1\|816059_818084_-	DNA helicase Rep	A7KV33	Bacillus_phage	8.4e-113	37.8
WP_038634587.1\|818187_818916_-	nicotinamide riboside transporter PnuC	A0A126HGA3	Vibrio_phage	7.1e-22	33.5

DBSCAN-SWA_68

830186 : 831833

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038634612.1\|830186_831833_-	acetolactate synthase 2 catalytic subunit	A0A0P0CDR3	Ostreococcus_lucimarinus_virus	1.1e-65	32.0

DBSCAN-SWA_69

845659 : 847131

Synechococcus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038634641.1\|845659_846169_+	peptide deformylase	E3SLL2	Synechococcus_phage	1.8e-19	41.9
WP_038634644.1\|846183_847131_+\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	1.7e-07	36.9

DBSCAN-SWA_70

868330 : 870325

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038634719.1\|868330_870325_+	type II secretion system secretin GspD	R9TEZ5	Vibrio_phage	2.3e-30	34.9

DBSCAN-SWA_71

882289 : 887861

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003031109.1\|882289_883474_-	elongation factor Tu	A0A2K9L516	Tupanvirus	7.5e-13	26.1
WP_038634754.1\|883543_885658_-	elongation factor G	E4ZFJ7	Streptococcus_phage	1.1e-57	26.9
WP_003023657.1\|885754_886225_-	30S ribosomal protein S7	NA	NA	NA	NA
WP_003023654.1\|886320_886695_-	30S ribosomal protein S12	NA	NA	NA	NA
WP_038634759.1\|886820_887108_-	sulfurtransferase complex subunit TusB	NA	NA	NA	NA
WP_038634761.1\|887115_887475_-	sulfurtransferase complex subunit TusC	NA	NA	NA	NA
WP_038634764.1\|887474_887861_-	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	3.3e-18	39.8

DBSCAN-SWA_72

893612 : 899030

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038634776.1\|893612_895514_+	ABC transporter ATP-binding protein	A0A2K9L0W2	Tupanvirus	3.8e-75	34.1
WP_038642912.1\|895530_896463_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_038634778.1\|896553_897450_-	malonate decarboxylase subunit epsilon	NA	NA	NA	NA
WP_038634780.1\|897446_898067_-	malonate decarboxylase holo-ACP synthase	NA	NA	NA	NA
WP_038634783.1\|898070_899030_-	AEC family transporter	A0A0U2C0Y4	Salmonella_phage	7.1e-54	91.1

DBSCAN-SWA_73

903812 : 907088

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038634794.1\|903812_905303_-	nicotinate phosphoribosyltransferase	A0A218KC49	Bacillus_phage	1.5e-143	52.2
WP_038634796.1\|905317_906178_-	ribose-phosphate pyrophosphokinase	A0A2P1CBA5	Salmonella_phage	8.1e-49	40.3
WP_038642914.1\|906368_907088_+	NUDIX hydrolase	G3MA14	Bacillus_virus	1.1e-19	27.9

DBSCAN-SWA_74

910825 : 914895

environmental_Halophage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038634805.1\|910825_912913_+	FUSC family protein	H9YQA8	environmental_Halophage	6.5e-68	89.1
WP_038634808.1\|913028_914246_-	aspartate aminotransferase family protein	NA	NA	NA	NA
WP_038634811.1\|914331_914895_-	aminodeoxychorismate synthase component 2	A0A0P0IKJ1	Acinetobacter_phage	3.2e-62	57.9

DBSCAN-SWA_75

926279 : 927116

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038634842.1\|926279_927116_-	adenine-specific DNA-methyltransferase	A0A1S6L1V5	Vibrio_phage	3.7e-67	49.1

DBSCAN-SWA_76

942380 : 946152

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038634881.1\|942380_944003_+	phosphoenolpyruvate carboxykinase (ATP)	A0A2H4PQN1	Staphylococcus_phage	5.3e-142	53.1
WP_038634884.1\|944077_945430_-	two-component system sensor histidine kinase EnvZ	W8CYF6	Bacillus_phage	1.9e-12	23.6
WP_155268633.1\|945426_946152_-	two-component system response regulator OmpR	W8CYM9	Bacillus_phage	7.8e-29	34.7

DBSCAN-SWA_77

959215 : 961609

Iris_mild_mosaic_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038634907.1\|959215_961609_-	maltodextrin phosphorylase	Q8B3H5	Iris_mild_mosaic_virus	4.7e-14	40.2

DBSCAN-SWA_78

968875 : 971323

Dickeya_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038634923.1\|968875_971323_-	glycogen phosphorylase	A0A140XAG6	Dickeya_phage	3.6e-33	82.1

DBSCAN-SWA_79

990775 : 992586

Enterococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038634968.1\|990775_991519_-	glycerophosphodiester phosphodiesterase	A0A0S2MYI4	Enterococcus_phage	5.2e-12	26.1
WP_038634970.1\|991515_992586_-	sn-glycerol-3-phosphate import ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	4.4e-20	32.0

DBSCAN-SWA_80

996903 : 998402

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087856271.1\|996903_997617_-	high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF	G9BWD6	Planktothrix_phage	1.8e-14	31.1
WP_003827578.1\|997634_998402_-	high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG	W6JKT0	Anomala_cuprea_entomopoxvirus	4.9e-13	24.5

DBSCAN-SWA_81

1004072 : 1006916

Salicola_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038634997.1\|1004072_1004927_-	RNA polymerase sigma factor RpoH	A0A248SJA5	Salicola_phage	5.4e-45	42.3
WP_038635001.1\|1005196_1006255_-	cell division protein FtsX	NA	NA	NA	NA
WP_006687468.1\|1006247_1006916_-	cell division ATP-binding protein FtsE	A0A2H4PQG7	Staphylococcus_phage	1.1e-13	27.6

DBSCAN-SWA_82

1010183 : 1014239

Dickeya_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038635015.1\|1010183_1010810_+	lysoplasmalogenase	A0A140XAH6	Dickeya_phage	1.8e-29	60.2
WP_038635018.1\|1010885_1013084_+	Zn(II)/Cd(II)/Pb(II) translocating P-type ATPase ZntA	E4ZFI9	Streptococcus_phage	7.2e-118	37.7
WP_038635021.1\|1013159_1013405_-	sulfurtransferase TusA	A0A140XB86	Dickeya_phage	4.7e-10	83.3
WP_038635023.1\|1013573_1014239_+	7-cyano-7-deazaguanine/7-aminomethyl-7- deazaguanine transporter	A0A2I7SAW6	Vibrio_phage	1.5e-58	54.9

DBSCAN-SWA_83

1021098 : 1023846

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038635043.1\|1021098_1023846_-	ribosome-associated ATPase/putative transporter RbbA	W6JKT0	Anomala_cuprea_entomopoxvirus	3.9e-20	33.0

DBSCAN-SWA_84

1037773 : 1039246

Micromonas_sp._RCC1109_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038635074.1\|1037773_1039246_+	fructuronate reductase	E5EQS6	Micromonas_sp._RCC1109_virus	4.2e-45	30.4

DBSCAN-SWA_85

1046804 : 1048847

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_051594491.1\|1046804_1048847_-	oligopeptidase A	A0A1V0SD92	Indivirus	7.1e-43	22.5

DBSCAN-SWA_86

1087557 : 1089542

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038635143.1\|1087557_1088562_-	dipeptide ABC transporter ATP binding subunit DppF	G3M9Y6	Bacillus_virus	7.3e-17	29.4
WP_038635145.1\|1088558_1089542_-	dipeptide ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.9e-14	30.7

DBSCAN-SWA_87

1099391 : 1101725

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038635166.1\|1099391_1101725_-	molybdopterin guanine dinucleotide-containing S/N-oxide reductase	A0A077SK27	Escherichia_phage	3.4e-73	30.3

DBSCAN-SWA_88

1109518 : 1109731

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000014594.1\|1109518_1109731_+	RNA chaperone/antiterminator CspA	A0A1W6JNX5	Morganella_phage	2.7e-22	72.9

DBSCAN-SWA_89

1114085 : 1115081

Escherichia_coli_O157_typing_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038642921.1\|1114085_1115081_+	acyltransferase	A0A0F6TJ51	Escherichia_coli_O157_typing_phage	6.3e-13	25.2

DBSCAN-SWA_90

1144901 : 1146749

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038635270.1\|1144901_1146749_-	selenocysteine-specific translation elongation factor	A0A2K9KZ60	Tupanvirus	6.2e-14	25.1

DBSCAN-SWA_91

1164306 : 1173667

Rhizobium_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003024152.1\|1164306_1164558_-	glutaredoxin 3	V9QKN6	Rhizobium_phage	2.2e-15	53.4
WP_003024148.1\|1164610_1165042_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_038635319.1\|1165289_1166834_+	2,3-bisphosphoglycerate-independent phosphoglycerate mutase	NA	NA	NA	NA
WP_038635322.1\|1166843_1168127_+	murein hydrolase activator EnvC	G9BW84	Planktothrix_phage	1.8e-07	34.3
WP_038635324.1\|1168130_1169057_+	divergent polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_038635327.1\|1169057_1170095_-	glycosyltransferase	A0A1V0SAH6	Catovirus	1.9e-12	32.2
WP_038635329.1\|1170288_1171314_-	L-threonine 3-dehydrogenase	R9TPW0	Vibrio_phage	2.3e-18	80.8
WP_038635332.1\|1171323_1172520_-	glycine C-acetyltransferase	V5LQ39	Emiliania_huxleyi_virus	1.7e-33	28.6
WP_003827312.1\|1172734_1173667_+	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	1.0e-36	37.1

DBSCAN-SWA_92

1176988 : 1178002

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038635340.1\|1176988_1178002_+	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	4.9e-05	33.9

DBSCAN-SWA_93

1185735 : 1190308

uncultured_Mediterranean_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003024099.1\|1185735_1186215_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	6.3e-27	43.2
WP_038635364.1\|1186263_1187073_-	bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase	F8WPX6	Bacillus_phage	2.6e-25	31.2
WP_003024094.1\|1187171_1187339_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_003024071.1\|1187359_1187596_-	50S ribosomal protein L28	NA	NA	NA	NA
WP_038635368.1\|1187814_1188480_-	DNA repair protein RadC	NA	NA	NA	NA
WP_129694987.1\|1188651_1189872_+	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	7.2e-43	34.1
WP_129694986.1\|1189852_1190308_+	dUTP diphosphatase	Q2NP83	Xanthomonas_phage	2.8e-48	60.1

DBSCAN-SWA_94

1193716 : 1264757

Salmonella_phage(15.0%)

tRNA,integrase,transposase

attL 1210582:1210595|attR 1270324:1270337

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038635384.1\|1193716_1194979_+\|integrase	site-specific integrase	A0A1W6JPG6	Morganella_phage	1.4e-171	70.7
WP_038635387.1\|1195298_1195862_+	recombinase family protein	A0A0F7LA37	Escherichia_phage	4.7e-21	36.9
WP_038642925.1\|1195929_1196931_+	ATP-binding protein	A0A0N7FZ09	Sulfolobales_virus	2.6e-06	28.9
WP_038635391.1\|1196947_1199461_+	S8 family serine peptidase	NA	NA	NA	NA
WP_071888170.1\|1199582_1199936_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_038635393.1\|1199947_1200781_-	DUF1311 domain-containing protein	J9Q6K3	Salmonella_phage	3.9e-08	35.1
WP_038635396.1\|1200803_1201388_-	hypothetical protein	NA	NA	NA	NA
WP_038635399.1\|1201622_1202000_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_155268625.1\|1202035_1202611_-	hypothetical protein	NA	NA	NA	NA
WP_071888053.1\|1202832_1203063_+	AlpA family transcriptional regulator	NA	NA	NA	NA
WP_038635401.1\|1203213_1204281_+	hypothetical protein	NA	NA	NA	NA
WP_038635404.1\|1204446_1204887_-	hypothetical protein	NA	NA	NA	NA
WP_038635407.1\|1204900_1205572_-	hypothetical protein	NA	NA	NA	NA
WP_038635410.1\|1206015_1206633_+	trimeric intracellular cation channel family protein	NA	NA	NA	NA
WP_038635413.1\|1206629_1208309_-	NAD-dependent DNA ligase LigB	F8SJM3	Pseudomonas_phage	2.7e-24	22.4
WP_038635416.1\|1208570_1209194_+	guanylate kinase	K4JYM5	Abalone_herpesvirus	1.1e-18	35.0
WP_000135058.1\|1209248_1209524_+	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_038635422.1\|1209542_1211654_+	bifunctional GTP diphosphokinase/guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase	A0A291L9W9	Bordetella_phage	4.8e-10	34.5
1210582:1210595	attL	NA	NA	NA	NA
WP_038635425.1\|1211658_1212348_+\|tRNA	tRNA (guanosine(18)-2'-O)-methyltransferase TrmH	NA	NA	NA	NA
WP_038635428.1\|1212353_1214435_+	ATP-dependent DNA helicase RecG	NA	NA	NA	NA
WP_038635431.1\|1214474_1215680_-	sodium/glutamate symporter	NA	NA	NA	NA
WP_038635433.1\|1215906_1217298_+	xanthine/proton symporter XanP	H9YQ34	environmental_Halophage	2.5e-68	95.9
WP_038635436.1\|1217419_1219126_+	AsmA family protein	NA	NA	NA	NA
WP_038635440.1\|1219164_1219842_-	D-lyxose/D-mannose family sugar isomerase	NA	NA	NA	NA
WP_006687642.1\|1219891_1220752_-	ketose-bisphosphate aldolase	NA	NA	NA	NA
WP_038635444.1\|1220832_1221684_-	class II fructose-bisphosphate aldolase family protein	NA	NA	NA	NA
WP_006687644.1\|1221695_1222787_-	PTS fructose transporter subunit IIC	NA	NA	NA	NA
WP_006687645.1\|1222813_1223134_-	PTS fructose transporter subunit IIB	NA	NA	NA	NA
WP_003024008.1\|1223153_1223624_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_038635450.1\|1223650_1225204_-	PRD domain-containing protein	NA	NA	NA	NA
WP_038635453.1\|1225525_1227844_-	alpha-xylosidase	NA	NA	NA	NA
WP_038635456.1\|1227854_1229237_-	glycoside-pentoside-hexuronide family transporter	NA	NA	NA	NA
WP_001218910.1\|1229921_1231106_+\|integrase	tyrosine-type recombinase/integrase	Q7M297	Enterobacteria_phage	2.6e-162	69.9
WP_000999850.1\|1231516_1232560_+	hypothetical protein	NA	NA	NA	NA
WP_000412404.1\|1232957_1234028_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_001329026.1\|1234289_1235591_+	MFS transporter	NA	NA	NA	NA
WP_038635468.1\|1235605_1237987_+	glycoside hydrolase family 31 protein	NA	NA	NA	NA
WP_000157061.1\|1238634_1239120_+	single-stranded DNA-binding protein	Q1MVN2	Enterobacteria_phage	4.4e-52	63.8
WP_038635474.1\|1241356_1242865_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	8.1e-44	31.6
WP_032143699.1\|1243173_1243545_+	hypothetical protein	NA	NA	NA	NA
WP_038635488.1\|1245961_1246312_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	6.2e-40	66.4
WP_038635492.1\|1246308_1246734_-	IS66 family insertion sequence hypothetical protein	Q6H9S5	Enterobacteria_phage	4.4e-48	97.9
WP_000412211.1\|1250084_1250744_+	type A-1 chloramphenicol O-acetyltransferase	G3CFL0	Escherichia_phage	8.4e-131	100.0
WP_000656305.1\|1250944_1251322_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_001138064.1\|1251388_1254355_-\|transposase	Tn3-like element TnAs3 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	73.6
WP_000147567.1\|1254357_1254918_-	recombinase family protein	A0A1B0V7I5	Salmonella_phage	4.0e-49	86.2
WP_000454193.1\|1255043_1255394_-	DUF3330 domain-containing protein	NA	NA	NA	NA
WP_000845048.1\|1255596_1256610_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
WP_000381802.1\|1256755_1257289_+	aminoglycoside nucleotidyltransferase ANT(2'')-Ia	NA	NA	NA	NA
WP_000186237.1\|1257371_1258004_+	type B-3 chloramphenicol O-acetyltransferase CatB3	A0A2R8FE91	Brazilian_cedratvirus	4.1e-26	41.2
WP_000679427.1\|1258160_1258508_+	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
WP_000259031.1\|1258501_1259341_+	sulfonamide-resistant dihydropteroate synthase Sul1	NA	NA	NA	NA
WP_079276088.1\|1259838_1261287_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_002008781.1\|1262071_1262572_+	hypothetical protein	A0A2L0UZT6	Agrobacterium_phage	2.0e-07	28.6
WP_000019304.1\|1262571_1263141_+	trimethoprim-resistant dihydrofolate reductase DfrA19	NA	NA	NA	NA
WP_048228299.1\|1263151_1263757_+	hypothetical protein	NA	NA	NA	NA
WP_000845048.1\|1263743_1264757_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
1270324:1270337	attR	NA	NA	NA	NA

DBSCAN-SWA_95

1268372 : 1270788

Yersinia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038635526.1\|1268372_1269194_+	DUF945 domain-containing protein	A0A2C9CX26	Yersinia_phage	2.5e-47	38.6
WP_000680586.1\|1269193_1269439_+	hypothetical protein	NA	NA	NA	NA
WP_080700392.1\|1269463_1270006_+	antirestriction protein	A9J566	Pseudomonas_phage	1.7e-12	30.3
WP_001186768.1\|1270021_1270498_+	RadC family protein	NA	NA	NA	NA
WP_000692306.1\|1270566_1270788_+	DUF987 domain-containing protein	A0A142F0X9	Klebsiella_phage	3.2e-10	44.4

DBSCAN-SWA_96

1274381 : 1275128

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001016257.1\|1274381_1275128_+	ATP-binding protein	U5N3V8	Enterobacteria_phage	3.5e-24	31.6

DBSCAN-SWA_97

1279631 : 1282436

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038635552.1\|1279631_1282436_-	intestinal colonization autotransporter adhesin MisL	A0A2L1IV18	Escherichia_phage	6.6e-100	48.5

DBSCAN-SWA_98

1290387 : 1295068

Mollivirus(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038635575.1\|1290387_1291164_-	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	1.6e-11	25.5
WP_038635578.1\|1291311_1292256_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	6.4e-15	26.0
WP_038635581.1\|1292281_1293184_+	DMT family transporter	NA	NA	NA	NA
WP_038635584.1\|1293210_1294029_-	lipoprotein NlpA	NA	NA	NA	NA
WP_038635587.1\|1294153_1295068_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	5.2e-70	50.0

DBSCAN-SWA_99

1306481 : 1307864

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038635623.1\|1306481_1307864_+	glycoside hydrolase family 1 protein	A0A0B5JD41	Pandoravirus	2.9e-40	27.8

DBSCAN-SWA_100

1327927 : 1332769

Micromonas_sp._RCC1109_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038635679.1\|1327927_1329616_-	acetolactate synthase large subunit	E5EQ70	Micromonas_sp._RCC1109_virus	1.2e-56	29.9
WP_003827118.1\|1329723_1329822_-	ilvB operon leader peptide IvbL	NA	NA	NA	NA
WP_003023909.1\|1330344_1330434_+	type I toxin-antitoxin system toxin TisB	NA	NA	NA	NA
WP_038635683.1\|1330557_1331391_+	EamA family transporter	NA	NA	NA	NA
WP_038635685.1\|1331584_1332769_+	multidrug efflux MFS transporter EmrD	S4TR35	Salmonella_phage	1.9e-16	24.8

DBSCAN-SWA_101

1340886 : 1341821

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005121488.1\|1340886_1341315_-	heat shock chaperone IbpB	A0A1D8KPX5	Synechococcus_phage	1.6e-13	37.3
WP_006687722.1\|1341407_1341821_-	heat shock chaperone IbpA	A0A1D7SU06	Cyanophage	1.8e-17	36.2

DBSCAN-SWA_102

1348299 : 1355668

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038635722.1\|1348299_1350714_-	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	1.8e-114	34.4
WP_038635725.1\|1350742_1351816_-	DNA replication/repair protein RecF	NA	NA	NA	NA
WP_005121477.1\|1351815_1352916_-	DNA polymerase III subunit beta	B4UTW9	Rhizobium_phage	1.1e-53	35.0
WP_003827078.1\|1352920_1354324_-	chromosomal replication initiator protein DnaA	NA	NA	NA	NA
WP_003023858.1\|1354929_1355070_+	50S ribosomal protein L34	NA	NA	NA	NA
WP_003844432.1\|1355087_1355447_+	ribonuclease P protein component	NA	NA	NA	NA
WP_003023846.1\|1355410_1355668_+	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	5.4e-17	56.7

DBSCAN-SWA_103

1362647 : 1373225

Moraxella_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038635749.1\|1362647_1363985_-	adenine permease AdeP	A0A0R6PHV4	Moraxella_phage	1.4e-63	37.6
WP_038635752.1\|1364152_1364818_+	6-phosphogluconate phosphatase	NA	NA	NA	NA
WP_038635754.1\|1364870_1365596_-	phosphate signaling complex protein PhoU	NA	NA	NA	NA
WP_003023821.1\|1365610_1366384_-	phosphate ABC transporter ATP-binding protein PstB	W8CYL7	Bacillus_phage	3.4e-14	30.6
WP_003827037.1\|1366430_1367321_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_038635761.1\|1367320_1368280_-	phosphate ABC transporter permease PstC	NA	NA	NA	NA
WP_038635764.1\|1368424_1369465_-	phosphate ABC transporter substrate-binding protein PstS	M4QHS4	Cyanophage	1.6e-46	35.8
WP_038635767.1\|1369799_1371629_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	1.4e-122	41.4
WP_038635769.1\|1371854_1373225_-	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A0N7G7I9	Chrysochromulina_ericina_virus	3.3e-36	38.0

DBSCAN-SWA_104

1385512 : 1386505

Heterosigma_akashiwo_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038635786.1\|1385512_1386505_+	aspartate--ammonia ligase	A0A1C9C5F0	Heterosigma_akashiwo_virus	1.3e-50	38.0

DBSCAN-SWA_105

1389779 : 1393773

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038635795.1\|1389779_1391648_+	low affinity potassium transporter Kup	M1I6H8	Paramecium_bursaria_Chlorella_virus	9.3e-66	30.5
WP_038635798.1\|1391840_1392260_+	D-ribose pyranase	NA	NA	NA	NA
WP_038635801.1\|1392267_1393773_+	ribose ABC transporter ATP-binding protein RbsA	A0A2K9L0W2	Tupanvirus	3.8e-17	21.5

DBSCAN-SWA_106

1409903 : 1412690

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038635834.1\|1409903_1412690_+	DNA polymerase I	A8E2B3	Enterococcus_phage	3.8e-47	30.3

DBSCAN-SWA_107

1418023 : 1419073

Ectocarpus_siliculosus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038635845.1\|1418023_1419073_-	nitrogen regulation protein NR(II)	Q8QKV7	Ectocarpus_siliculosus_virus	4.5e-09	26.1

DBSCAN-SWA_108

1431778 : 1434575

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038635871.1\|1431778_1432675_-	sulfolactaldehyde 3-reductase	D2K0C8	Staphylococcus_phage	5.1e-62	93.0
WP_038635874.1\|1432841_1433738_+	sugar kinase	NA	NA	NA	NA
WP_038635877.1\|1433771_1434575_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	8.4e-24	29.6

DBSCAN-SWA_109

1438158 : 1439067

Acanthamoeba_polyphaga_moumouvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038635890.1\|1438158_1439067_-	alpha/beta hydrolase	L7RDF8	Acanthamoeba_polyphaga_moumouvirus	1.5e-24	31.1

DBSCAN-SWA_110

1442399 : 1445450

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_137350704.1\|1442399_1445450_-	formate dehydrogenase-N subunit alpha	A0A077SK27	Escherichia_phage	6.5e-08	23.8

DBSCAN-SWA_111

1456825 : 1460604

Shigella_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096755719.1\|1456825_1457972_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.9e-146	92.2
WP_038635940.1\|1458660_1459695_-	L-rhamnose/proton symporter RhaT	NA	NA	NA	NA
WP_038635943.1\|1459983_1460604_+	superoxide dismutase [Mn]	Q56AR7	Bacillus_thuringiensis_phage	7.8e-62	57.4

DBSCAN-SWA_112

1464081 : 1466150

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038635957.1\|1464081_1465455_-	envelope stress sensor histidine kinase CpxA	W8CYF6	Bacillus_phage	5.0e-16	25.9
WP_038635960.1\|1465451_1466150_-	envelope stress response regulator transcription factor CpxR	Q6XM27	Feldmannia_irregularis_virus	2.6e-05	29.5

DBSCAN-SWA_113

1480410 : 1481256

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038635996.1\|1480410_1481256_-	aquaporin	M1HWZ0	Paramecium_bursaria_Chlorella_virus	1.2e-15	28.7

DBSCAN-SWA_114

1488551 : 1489883

Erwinia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038636017.1\|1488551_1489883_-	HslU--HslV peptidase ATPase subunit	A0A191ZC11	Erwinia_phage	5.8e-46	29.7

DBSCAN-SWA_115

1511104 : 1511767

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038636057.1\|1511104_1511767_-	fructose-6-phosphate aldolase	A0A0E3F0E2	Synechococcus_phage	2.2e-30	34.1

DBSCAN-SWA_116

1527725 : 1529564

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038636088.1\|1527725_1529564_+	TonB-dependent vitamin B12 receptor BtuB	A0A0P0I887	Acinetobacter_phage	3.1e-13	31.4

DBSCAN-SWA_117

1538128 : 1553542

uncultured_Mediterranean_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032940924.1\|1538128_1539079_-	type I pantothenate kinase	A0A1B1ISL9	uncultured_Mediterranean_phage	8.7e-28	32.0
WP_016157942.1\|1540027_1541212_+	elongation factor Tu	A0A2K9L516	Tupanvirus	7.5e-13	26.1
WP_003033128.1\|1541442_1541826_+	preprotein translocase subunit SecE	NA	NA	NA	NA
WP_003033125.1\|1541827_1542373_+	transcription termination/antitermination protein NusG	A0A291AUS6	Sinorhizobium_phage	1.1e-14	29.6
WP_038636105.1\|1542530_1542959_+	50S ribosomal protein L11	NA	NA	NA	NA
WP_006688358.1\|1542962_1543670_+	50S ribosomal protein L1	NA	NA	NA	NA
WP_005132895.1\|1543963_1544461_+	50S ribosomal protein L10	NA	NA	NA	NA
WP_000028882.1\|1544527_1544893_+	50S ribosomal protein L7/L12	NA	NA	NA	NA
WP_003033111.1\|1545213_1549242_+	DNA-directed RNA polymerase subunit beta	A0A0N9R0J7	Chrysochromulina_ericina_virus	1.6e-22	29.4
WP_038636118.1\|1549318_1553542_+	DNA-directed RNA polymerase subunit beta'	A0A2I7QNZ7	Vibrio_phage	7.7e-68	27.5

DBSCAN-SWA_118

1557186 : 1557945

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038636131.1\|1557186_1557945_-	HesA/MoeB/ThiF family protein	A0A1V0SAV8	Catovirus	2.0e-11	29.1

DBSCAN-SWA_119

1563306 : 1565070

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038636148.1\|1563306_1563987_+	deoxyribonuclease V	A0A1V0SJW5	Klosneuvirus	9.6e-21	29.2
WP_008787112.1\|1564020_1564611_+	YjaG family protein	NA	NA	NA	NA
WP_001044509.1\|1564797_1565070_+	DNA-binding protein HU-alpha	A7KV42	Bacillus_phage	5.5e-20	57.8

DBSCAN-SWA_120

1570558 : 1572148

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038636165.1\|1570558_1572148_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	3.8e-68	48.1

DBSCAN-SWA_121

1585459 : 1592190

Dickeya_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038636187.1\|1585459_1589143_+	methionine synthase	A0A140XBC7	Dickeya_phage	4.9e-26	88.5
WP_038636190.1\|1589356_1590985_+	Na/Pi cotransporter family protein	NA	NA	NA	NA
WP_032942056.1\|1591112_1591802_-	dipeptidase PepE	NA	NA	NA	NA
WP_038636193.1\|1591911_1592190_-	putative addiction module antidote protein	A0A141GEX5	Brucella_phage	3.3e-12	50.0

DBSCAN-SWA_122

1597881 : 1602534

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038636207.1\|1597881_1598580_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	3.8e-89	68.1
WP_038636209.1\|1598665_1598986_+	transcriptional regulator	A0A2H4J145	uncultured_Caudovirales_phage	2.9e-20	45.7
WP_038636211.1\|1599030_1600320_+	arsenic transporter	A0A2H4J144	uncultured_Caudovirales_phage	1.2e-168	71.1
WP_038636213.1\|1600332_1600758_+	glutaredoxin-dependent arsenate reductase	A0A2H4J8T1	uncultured_Caudovirales_phage	2.1e-50	71.4
WP_038636215.1\|1600885_1601476_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_038636216.1\|1601724_1602201_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_110496249.1\|1602360_1602534_-	hypothetical protein	A0A2H4JB52	uncultured_Caudovirales_phage	5.2e-08	51.8

DBSCAN-SWA_123

1620739 : 1621849

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038636246.1\|1620739_1621849_+	maltose/maltodextrin ABC transporter ATP-binding protein MalK	Q6GZ03	Mycoplasma_phage	6.2e-17	47.2

DBSCAN-SWA_124

1629045 : 1629654

Lactococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003031703.1\|1629045_1629654_+	repressor LexA	Q9G0C2	Lactococcus_phage	1.0e-13	38.0

DBSCAN-SWA_125

1635309 : 1644404

Escherichia_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003826610.1\|1635309_1636725_+	replicative DNA helicase	O80281	Escherichia_phage	1.8e-199	77.9
WP_038636265.1\|1636870_1637950_+	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	1.2e-28	28.5
WP_038636267.1\|1638084_1639278_+	aromatic amino acid transaminase	NA	NA	NA	NA
WP_038636269.1\|1639523_1640237_+	acid phosphatase AphA	NA	NA	NA	NA
WP_038636271.1\|1640363_1640720_+	MmcQ/YjbR family DNA-binding protein	NA	NA	NA	NA
WP_038636273.1\|1640805_1643628_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	5.2e-312	55.6
WP_003826621.1\|1643879_1644404_+	single-stranded DNA-binding protein SSB1	A0A0A0P1Q9	Enterobacteria_phage	1.1e-53	94.5

DBSCAN-SWA_126

1648366 : 1649716

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038636284.1\|1648366_1649716_+	guanine/hypoxanthine transporter GhxP	A0A0R6PHV4	Moraxella_phage	5.2e-159	71.1

DBSCAN-SWA_127

1655896 : 1657855

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038636301.1\|1655896_1657855_-	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	4.6e-92	41.3

DBSCAN-SWA_128

1675170 : 1684767

Escherichia_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038636350.1\|1675170_1676694_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.8e-11	23.9
WP_038636353.1\|1676808_1679073_+	hybrid sensor histidine kinase/response regulator	NA	NA	NA	NA
WP_038636356.1\|1679142_1679472_+	hypothetical protein	NA	NA	NA	NA
WP_038636359.1\|1679627_1679930_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A222YWE2	Escherichia_phage	2.2e-41	77.0
WP_038636361.1\|1679949_1680291_+	HigA family addiction module antidote protein	A0A222YWD7	Escherichia_phage	6.2e-45	81.8
WP_038636364.1\|1680342_1681101_-	phosphonate metabolism protein PhnP	NA	NA	NA	NA
WP_038636367.1\|1681109_1681544_-	aminoalkylphosphonate N-acetyltransferase	NA	NA	NA	NA
WP_038636371.1\|1681530_1682085_-	ribose 1,5-bisphosphokinase	NA	NA	NA	NA
WP_038636374.1\|1682087_1683224_-	alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase	NA	NA	NA	NA
WP_038636377.1\|1683220_1683901_-	phosphonate C-P lyase system protein PhnL	F2Y2R6	Organic_Lake_phycodnavirus	1.2e-07	27.7
WP_038636380.1\|1684008_1684767_-	phosphonate C-P lyase system protein PhnK	G3M9Y6	Bacillus_virus	3.0e-15	27.8

DBSCAN-SWA_129

1690348 : 1691137

Pithovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038636408.1\|1690348_1691137_-	phosphonate ABC transporter ATP-binding protein	W5SAS9	Pithovirus	5.0e-13	29.3

DBSCAN-SWA_130

1697705 : 1699208

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038636419.1\|1697705_1699208_+	glycine betaine/L-proline transporter ProP	Q6JIH2	Burkholderia_virus	1.2e-55	31.7

DBSCAN-SWA_131

1729563 : 1731547

Cronobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000027827.1\|1729563_1729857_+	co-chaperone GroES	K4F9I2	Cronobacter_phage	1.2e-12	43.3
WP_006686275.1\|1729900_1731547_+	chaperonin GroEL	A0A2I7SAK5	Vibrio_phage	1.3e-188	68.3

DBSCAN-SWA_132

1736453 : 1736987

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038636486.1\|1736453_1736987_-	lipocalin family protein	A0A1W6JNX6	Morganella_phage	7.2e-48	54.8

DBSCAN-SWA_133

1742888 : 1743866

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003830517.1\|1742888_1743866_+	elongation factor P--(R)-beta-lysine ligase	A0A2K9KZX5	Tupanvirus	8.1e-29	29.1

DBSCAN-SWA_134

1751232 : 1751778

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006686300.1\|1751232_1751778_+	oligoribonuclease	Q8B5Y0	Diachasmimorpha_longicaudata_entomopoxvirus	5.0e-28	40.4

DBSCAN-SWA_135

1755844 : 1759039

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038636515.1\|1755844_1757176_+	N-acetylmuramoyl-L-alanine amidase AmiB	A0A067ZJB6	Vibrio_phage	2.5e-17	29.6
WP_038636518.1\|1757185_1759039_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	1.7e-59	41.0

DBSCAN-SWA_136

1764493 : 1768935

Pithovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003025606.1\|1764493_1765792_+	adenylosuccinate synthase	W5S5V7	Pithovirus	2.9e-66	35.6
WP_038636528.1\|1766008_1766434_+	nitric oxide-sensing transcriptional repressor NsrR	NA	NA	NA	NA
WP_038636531.1\|1766472_1768935_+	ribonuclease R	Q0GXV6	Lactococcus_phage	2.7e-65	32.5

DBSCAN-SWA_137

1789627 : 1791199

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038636596.1\|1789627_1791199_+	Tar ligand binding domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	8.2e-15	32.9

DBSCAN-SWA_138

1806927 : 1814702

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038636623.1\|1806927_1807455_-	inorganic diphosphatase	A0A2H4J8U1	uncultured_Caudovirales_phage	3.2e-56	63.9
WP_038636626.1\|1807764_1808721_+	galactofuranose ABC transporter substrate-binding protein YtfQ	NA	NA	NA	NA
WP_038636628.1\|1808849_1810352_+	sugar ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	6.2e-12	29.9
WP_038642975.1\|1810365_1811388_+	ABC transporter permease	NA	NA	NA	NA
WP_038636631.1\|1811374_1812376_+	sugar ABC transporter permease YjfF	NA	NA	NA	NA
WP_074458528.1\|1812479_1813592_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	2.2e-14	32.7
WP_032940279.1\|1813703_1814702_-	class 1 fructose-bisphosphatase	A0A1V0SKX4	Klosneuvirus	2.8e-69	42.4

DBSCAN-SWA_139

1839908 : 1849016

Vibrio_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038636701.1\|1839908_1842431_+	type VI secretion system ATPase TssH	A0A2I7SAX5	Vibrio_phage	8.9e-80	31.6
WP_129694863.1\|1842456_1843092_+	hypothetical protein	NA	NA	NA	NA
WP_038636704.1\|1843239_1843488_+	plasmid stabilization protein	NA	NA	NA	NA
WP_038636706.1\|1843477_1843759_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A2H4JBF4	uncultured_Caudovirales_phage	5.2e-21	60.2
WP_038636709.1\|1843785_1845750_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	3.4e-42	29.4
WP_038636711.1\|1845749_1846271_+	toxin-antitoxin system YwqK family antitoxin	NA	NA	NA	NA
WP_038636713.1\|1846292_1846757_-	anaerobic ribonucleoside-triphosphate reductase-activating protein	K4F9T1	Cronobacter_phage	1.1e-52	57.7
WP_038636715.1\|1846877_1849016_-	anaerobic ribonucleoside-triphosphate reductase	A0A2I7QNQ7	Vibrio_phage	2.2e-268	64.9

DBSCAN-SWA_140

1852702 : 1856747

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038636723.1\|1852702_1853650_-	HTH-type transcriptional regulator TreR	C6ZCU4	Enterobacteria_phage	3.9e-12	21.2
WP_038636726.1\|1854038_1856747_+	magnesium-translocating P-type ATPase	M1HM40	Paramecium_bursaria_Chlorella_virus	4.5e-45	27.5

DBSCAN-SWA_141

1861018 : 1861954

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038636743.1\|1861018_1861954_-	aspartate carbamoyltransferase	M1HWF9	Paramecium_bursaria_Chlorella_virus	2.5e-51	39.2

DBSCAN-SWA_142

1872881 : 1881827

Klosneuvirus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038636776.1\|1872881_1875737_-\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	6.7e-140	36.9
WP_038636780.1\|1875736_1876180_-	DNA polymerase III subunit chi	NA	NA	NA	NA
WP_038636783.1\|1876324_1877836_-	leucyl aminopeptidase	Q6GYZ8	Mycoplasma_phage	1.0e-46	38.4
WP_038636786.1\|1878102_1879203_+	LPS export ABC transporter permease LptF	NA	NA	NA	NA
WP_038636788.1\|1879202_1880285_+	LPS export ABC transporter permease LptG	NA	NA	NA	NA
WP_038642982.1\|1880324_1881827_-	DUF853 domain-containing protein	A0A248XCZ8	Klebsiella_phage	3.0e-83	44.3

DBSCAN-SWA_143

1887004 : 1889795

Tupanvirus(50.0%)

integrase

attL 1883683:1883695|attR 1896657:1896669

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1883683:1883695	attL	NA	NA	NA	NA
WP_038636806.1\|1887004_1888024_-	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L7I1	Tupanvirus	4.2e-44	32.0
WP_038636809.1\|1888538_1889795_+\|integrase	integrase arm-type DNA-binding domain-containing protein	B7SYF8	Stenotrophomonas_phage	5.8e-80	41.4
1896657:1896669	attR	NA	NA	NA	NA

DBSCAN-SWA_144

1893947 : 1896746

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038636823.1\|1893947_1896746_-	DEAD/DEAH box helicase family protein	A0A2H4J643	uncultured_Caudovirales_phage	1.6e-45	27.8

DBSCAN-SWA_145

1910049 : 1910871

Yersinia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038636852.1\|1910049_1910871_+	DUF945 domain-containing protein	A0A2C9CX26	Yersinia_phage	1.4e-45	37.6

DBSCAN-SWA_146

1927850 : 1932270

Ostreococcus_tauri_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038636887.1\|1927850_1929326_+	fructuronate reductase	H8ZJP8	Ostreococcus_tauri_virus	6.9e-48	31.8
WP_038636895.1\|1929459_1930233_+	Uxu operon transcriptional regulator	NA	NA	NA	NA
WP_038636898.1\|1930870_1931074_+	hypothetical protein	NA	NA	NA	NA
WP_038636901.1\|1931262_1932270_+	porin	Q1MVN1	Enterobacteria_phage	1.1e-84	49.6

DBSCAN-SWA_147

1951284 : 1952946

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038636951.1\|1951284_1952946_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	6.0e-08	72.3

DBSCAN-SWA_148

1956181 : 1957204

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038636961.1\|1956181_1957204_+	zinc-binding alcohol dehydrogenase family protein	A0A2K9L7I1	Tupanvirus	1.0e-10	25.3

DBSCAN-SWA_149

1964220 : 1965282

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038636971.1\|1964220_1965282_+	SIS domain-containing protein	A0A2K9KZ81	Tupanvirus	1.0e-13	24.8

DBSCAN-SWA_150

1969422 : 1970702

Shigella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038636979.1\|1969422_1970160_-	DNA replication protein DnaC	V5UQI5	Shigella_phage	3.8e-63	50.8
WP_006686572.1\|1970162_1970702_-	primosomal protein DnaT	T1SA92	Salmonella_phage	4.9e-28	61.7

DBSCAN-SWA_151

1981925 : 1984729

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006686587.1\|1981925_1983515_+	peptide chain release factor 3	D0R0F5	Streptococcus_phage	1.2e-29	25.5
WP_038636996.1\|1983822_1984440_+	molecular chaperone OsmY	NA	NA	NA	NA
WP_003019081.1\|1984567_1984729_+	DUF1328 domain-containing protein	A0A0N7CBR2	Salmonella_phage	2.8e-11	66.0

DBSCAN-SWA_152

1990296 : 1991619

Geobacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038637008.1\|1990296_1991619_+	thymidine phosphorylase	A0A0H3UZD4	Geobacillus_virus	5.7e-78	39.3

DBSCAN-SWA_153

1998146 : 2003273

Enterococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038637017.1\|1998146_1999379_+	multifunctional transcriptional regulator/nicotinamide-nucleotide adenylyltransferase/ribosylnicotinamide kinase NadR	A0A0C5K935	Enterococcus_phage	9.1e-86	44.3
WP_038637020.1\|1999460_2001128_-	energy-dependent translational throttle protein EttA	A0A1V0SKJ1	Klosneuvirus	1.1e-41	26.6
WP_038637023.1\|2001335_2003273_+	murein transglycosylase	A0A1P8CWQ1	Bacillus_phage	1.6e-12	36.2

DBSCAN-SWA_154

2007212 : 2008637

Ectocarpus_siliculosus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038637036.1\|2007212_2008637_+	two-component system sensor histidine kinase CreC	Q8QKV7	Ectocarpus_siliculosus_virus	3.0e-08	21.4

DBSCAN-SWA_155

2019834 : 2020788

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038637054.1\|2019834_2020788_+	transaldolase	A0A0E3G6C9	Synechococcus_phage	1.7e-10	34.4

DBSCAN-SWA_156

2025202 : 2035102

Chrysochromulina_ericina_virus(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038637064.1\|2025202_2027125_+	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	1.9e-146	50.3
WP_032940353.1\|2027212_2028346_+	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	1.1e-29	34.9
WP_038637066.1\|2028554_2029721_+	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	2.0e-90	51.8
WP_038637068.1\|2029759_2030659_+	transcriptional activator NhaR	NA	NA	NA	NA
WP_038637070.1\|2030717_2030981_-	30S ribosomal protein S20	NA	NA	NA	NA
WP_071888087.1\|2031086_2031302_+	DUF2575 family protein	NA	NA	NA	NA
WP_038637072.1\|2031309_2032248_+	bifunctional riboflavin kinase/FAD synthetase	NA	NA	NA	NA
WP_038637074.1\|2032285_2035102_+\|tRNA	isoleucine--tRNA ligase	A0A2K9L9X8	Tupanvirus	2.3e-76	26.0

DBSCAN-SWA_157

2041277 : 2042426

Halovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038637089.1\|2041277_2042426_+	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	6.3e-49	33.2

DBSCAN-SWA_158

2047910 : 2053521

Hepacivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038637099.1\|2047910_2049464_-	crotonobetaine/carnitine-CoA ligase	Q75ZG1	Hepacivirus	1.5e-29	24.6
WP_038637101.1\|2049526_2050744_-	L-carnitine CoA-transferase	NA	NA	NA	NA
WP_003018898.1\|2050826_2051969_-	crotonobetainyl-CoA dehydrogenase	NA	NA	NA	NA
WP_038637104.1\|2052003_2053521_-	L-carnitine/gamma-butyrobetaine antiport BCCT transporter	A0A2I7QNT1	Vibrio_phage	1.4e-08	22.2

DBSCAN-SWA_159

2061851 : 2063270

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018873.1\|2061851_2062331_+	type 3 dihydrofolate reductase	A0A219UQN5	Bacillus_phage	3.0e-29	47.1
WP_038637114.1\|2062421_2063270_-	bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH	A0A0A0YWI7	Pseudomonas_phage	1.1e-05	45.3

DBSCAN-SWA_160

2070998 : 2076433

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038637132.1\|2070998_2073905_-	RNA polymerase-associated protein RapA	A0A1B1IUI1	uncultured_Mediterranean_phage	1.7e-21	37.9
WP_038637136.1\|2074081_2076433_-	DNA polymerase II	A0A1B2RW58	Lymphocystis_disease_virus	2.5e-15	25.1

DBSCAN-SWA_161

2083583 : 2084291

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038637159.1\|2083583_2084291_-	thiamine ABC transporter ATP-binding protein ThiQ	G3M9Y6	Bacillus_virus	2.2e-23	37.8

DBSCAN-SWA_162

2097145 : 2098870

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071888094.1\|2097145_2098870_+	acetolactate synthase 3 large subunit	E5ERI2	Ostreococcus_lucimarinus_virus	3.0e-34	25.7

DBSCAN-SWA_163

2124963 : 2126007

Chrysochromulina_ericina_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038637240.1\|2124963_2126007_+	GMP reductase	A0A0N9Q9A5	Chrysochromulina_ericina_virus	1.2e-102	55.3

DBSCAN-SWA_164

2130275 : 2130839

Sphingobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038637254.1\|2130275_2130839_+	1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD	A0A1W6DX33	Sphingobium_phage	2.8e-10	31.0

DBSCAN-SWA_165

2141907 : 2143332

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018686.1\|2141907_2143332_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	4.6e-41	26.9

DBSCAN-SWA_166

2154261 : 2162158

Escherichia_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038637298.1\|2154261_2155029_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	4.7e-32	36.6
WP_003018667.1\|2155039_2155387_-	YacC family pilotin-like protein	NA	NA	NA	NA
WP_038637303.1\|2155540_2157151_+	multicopper oxidase CueO	A0A0C6DWA2	Mamastrovirus	6.2e-18	53.2
WP_038642994.1\|2157236_2159627_-	glucose/quinate/shikimate family membrane-bound PQQ-dependent dehydrogenase	NA	NA	NA	NA
WP_042312274.1\|2159830_2160367_+	hypoxanthine phosphoribosyltransferase	A0A218MMB5	uncultured_virus	3.0e-17	33.1
WP_038637306.1\|2160460_2161123_-	carbonate dehydratase	NA	NA	NA	NA
WP_038637310.1\|2161231_2162158_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	4.1e-22	32.7

DBSCAN-SWA_167

2167626 : 2174446

Bacillus_virus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071888105.1\|2167626_2169042_-	polynucleotide adenylyltransferase PcnB	G3MAR3	Bacillus_virus	5.4e-26	35.9
WP_038637339.1\|2169092_2169989_-\|tRNA	tRNA glutamyl-Q(34) synthetase GluQRS	NA	NA	NA	NA
WP_003018625.1\|2170059_2170515_-	RNA polymerase-binding protein DksA	NA	NA	NA	NA
WP_038637342.1\|2170692_2171397_-	DNA/RNA nuclease SfsA	NA	NA	NA	NA
WP_038637344.1\|2171412_2171943_-	RNA 2',3'-cyclic phosphodiesterase	NA	NA	NA	NA
WP_071888108.1\|2171971_2174446_+	ATP-dependent helicase HrpB	A0A0U2UIE6	Niemeyer_virus	3.7e-38	30.4

DBSCAN-SWA_168

2179724 : 2180522

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038637358.1\|2179724_2180522_+	Fe3+-hydroxamate ABC transporter ATP-binding protein FhuC	G9BWD6	Planktothrix_phage	2.1e-14	27.8

DBSCAN-SWA_169

2186457 : 2186802

Lake_Baikal_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006686771.1\|2186457_2186802_+	iron-sulfur cluster insertion protein ErpA	A0A2H4N7M3	Lake_Baikal_phage	1.0e-26	50.5

DBSCAN-SWA_170

2190804 : 2192238

uncultured_Mediterranean_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005132129.1\|2190804_2192238_+\|protease	serine endoprotease DegP	A0A1B1IT49	uncultured_Mediterranean_phage	2.1e-25	29.8

DBSCAN-SWA_171

2203773 : 2204532

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032940405.1\|2203773_2204532_+	(2E,6E)-farnesyl-diphosphate-specific ditrans,polycis-undecaprenyl-diphosphate synthase	R9W0U9	Flavobacterium_phage	9.4e-25	41.5

DBSCAN-SWA_172

2213342 : 2217446

Emiliania_huxleyi_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038637421.1\|2213342_2213939_+	ribonuclease HII	V5LS49	Emiliania_huxleyi_virus	4.6e-27	40.3
WP_038637424.1\|2213963_2217446_+	DNA polymerase III subunit alpha	Q8W6C3	Saccharomonospora_phage	7.0e-208	36.8

DBSCAN-SWA_173

2229485 : 2230517

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038637459.1\|2229485_2230517_-	methionine ABC transporter ATP-binding protein MetN	G9BWD6	Planktothrix_phage	5.5e-36	40.2

DBSCAN-SWA_174

2236962 : 2237766

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038637465.1\|2236962_2237766_+	2,5-didehydrogluconate reductase DkgB	A0A1V0SDE7	Indivirus	1.3e-37	35.0

DBSCAN-SWA_175

2241812 : 2246011

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038637483.1\|2241812_2243171_-	murein transglycosylase D	A0A2H4J9N7	uncultured_Caudovirales_phage	9.9e-09	36.0
WP_038637485.1\|2243242_2243998_-	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
WP_038637488.1\|2244031_2244754_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_038637491.1\|2244750_2245218_-	ribonuclease HI	J9Q745	Salmonella_phage	1.9e-52	59.1
WP_038642996.1\|2245282_2246011_+	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	6.2e-42	41.1

DBSCAN-SWA_176

2261600 : 2264883

Caulobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016149592.1\|2261600_2262182_+	D-sedoheptulose 7-phosphate isomerase	A0A067XQR2	Caulobacter_phage	7.4e-14	30.8
WP_038637544.1\|2262293_2263061_+	class II glutamine amidotransferase	NA	NA	NA	NA
WP_038637546.1\|2263031_2263772_-	murein L,D-transpeptidase	NA	NA	NA	NA
WP_038637549.1\|2264121_2264883_+	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	7.0e-20	39.2

DBSCAN-SWA_177

2278326 : 2278722

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038637597.1\|2278326_2278722_+	adenylyltransferase/cytidyltransferase family protein	A0A1V0SGE7	Hokovirus	5.6e-29	47.8

DBSCAN-SWA_178

2282320 : 2285990

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038637608.1\|2282320_2283397_-	glycosyltransferase	A0A1V0SAH6	Catovirus	1.2e-14	38.8
WP_038637611.1\|2283428_2285990_-	glycosyltransferase	A0A1V0SAN7	Catovirus	2.3e-30	37.3

DBSCAN-SWA_179

2314261 : 2317972

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038637692.1\|2314261_2315317_-	phosphoporin PhoE	Q1MVN1	Enterobacteria_phage	3.0e-114	59.0
WP_038637695.1\|2315606_2316710_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	2.0e-60	39.6
WP_038637698.1\|2316721_2317972_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	3.4e-96	46.5

DBSCAN-SWA_180

2331644 : 2332181

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038637727.1\|2331644_2332181_-	Ail/Lom family outer membrane beta-barrel protein	A0A1B0VBR9	Salmonella_phage	6.6e-17	36.1

DBSCAN-SWA_181

2342873 : 2391577

Pseudomonas_phage(30.56%)

protease,plate,head,capsid,tail,terminase,integrase,transposase

attL 2339083:2339097|attR 2371013:2371027

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2339083:2339097	attL	NA	NA	NA	NA
WP_038637754.1\|2342873_2343602_-	helix-turn-helix domain-containing protein	A5X9F5	Aeromonas_virus	2.7e-21	37.1
WP_038637756.1\|2343800_2344064_+	helix-turn-helix domain-containing protein	F6MII4	Haemophilus_phage	8.0e-24	66.7
WP_051594504.1\|2344068_2346126_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	A0A2D1GNK9	Pseudomonas_phage	4.6e-167	47.9
WP_038637759.1\|2346137_2347031_+	AAA family ATPase	A0A2D1GNS0	Pseudomonas_phage	4.7e-100	59.8
WP_051594505.1\|2347041_2347332_+	hypothetical protein	NA	NA	NA	NA
WP_038637762.1\|2347344_2347551_+	hypothetical protein	NA	NA	NA	NA
WP_038637765.1\|2347540_2348185_+	DUF3164 family protein	A4JWM8	Burkholderia_virus	2.5e-71	61.7
WP_038637769.1\|2348186_2348420_+	ANR family transcriptional regulator	NA	NA	NA	NA
WP_032663812.1\|2348409_2348601_+	hypothetical protein	NA	NA	NA	NA
WP_038637773.1\|2348681_2349401_+	DUF2786 domain-containing protein	A0A2P9JZH4	Alteromonadaceae_phage	5.6e-27	32.9
WP_051594506.1\|2349397_2349877_+	hypothetical protein	Q5G8V2	Enterobacteria_phage	2.8e-19	43.5
WP_038637777.1\|2349873_2350134_+	DUF4752 family protein	T1S9K2	Salmonella_phage	6.9e-28	71.4
WP_155268627.1\|2350130_2350301_+	hypothetical protein	NA	NA	NA	NA
WP_038637780.1\|2350300_2350675_+	DUF4406 domain-containing protein	A0A1V0E824	Vibrio_phage	4.5e-20	50.0
WP_023063185.1\|2350667_2350883_+	hypothetical protein	NA	NA	NA	NA
WP_071884826.1\|2351060_2351276_+	hypothetical protein	A0A2D1GNS9	Pseudomonas_phage	3.1e-18	57.7
WP_038637791.1\|2351337_2351814_+	regulatory protein GemA	A0A2D1GNN4	Pseudomonas_phage	2.8e-43	62.2
WP_023311913.1\|2351758_2352193_+	hypothetical protein	A0A2D1GNW5	Pseudomonas_phage	5.2e-28	47.0
WP_038637800.1\|2352192_2352705_+	hypothetical protein	NA	NA	NA	NA
WP_038637804.1\|2352783_2353428_+	glycoside hydrolase family 19 protein	A0A248XCW5	Klebsiella_phage	4.3e-63	56.3
WP_038637807.1\|2353424_2353688_+	DUF2644 domain-containing protein	A0A2D1GNW8	Pseudomonas_phage	3.7e-13	57.3
WP_038643028.1\|2353653_2354286_+	hypothetical protein	NA	NA	NA	NA
WP_000171281.1\|2354294_2354537_+	hypothetical protein	NA	NA	NA	NA
WP_021567611.1\|2354533_2354818_+	hypothetical protein	NA	NA	NA	NA
WP_038637812.1\|2354819_2355320_+	DUF1804 family protein	L7P7L4	Pseudomonas_phage	5.2e-48	53.4
WP_038637815.1\|2355312_2355522_+	hypothetical protein	NA	NA	NA	NA
WP_038637818.1\|2355526_2357179_+\|terminase	phage terminase large subunit	H6V8N6	Pseudomonas_phage	3.4e-213	66.3
WP_038637820.1\|2357181_2358750_+	DUF935 domain-containing protein	A0A0U5KSI0	unidentified_phage	2.1e-127	44.8
WP_038637823.1\|2358736_2359996_+\|capsid	minor capsid protein	A0A0M4UTA3	Ralstonia_phage	6.7e-52	34.8
WP_038637825.1\|2359992_2360535_+	phage virion morphogenesis protein	A0A2H4J9E5	uncultured_Caudovirales_phage	4.8e-23	37.1
WP_024238605.1\|2360651_2360861_+	hypothetical protein	NA	NA	NA	NA
WP_038637831.1\|2360916_2362032_+\|protease	phage protease	A0A2D1GNS3	Pseudomonas_phage	5.5e-58	43.3
WP_032663798.1\|2362043_2362436_+	hypothetical protein	J9RWG0	Pseudomonas_phage	1.7e-22	45.0
WP_038637834.1\|2362449_2363358_+\|head	Mu-like prophage major head subunit gpT family protein	A0A2H4J778	uncultured_Caudovirales_phage	2.2e-105	63.5
WP_038637837.1\|2363357_2363765_+	hypothetical protein	NA	NA	NA	NA
WP_021567602.1\|2363768_2364197_+	DUF1320 family protein	A0A1B0T6F3	Thiobacimonas_phage	5.1e-12	35.1
WP_038637840.1\|2364196_2364856_+	DUF1834 family protein	A0A0M3LQJ7	Mannheimia_phage	3.2e-21	35.4
WP_038637843.1\|2364842_2365064_+	hypothetical protein	NA	NA	NA	NA
WP_038637846.1\|2365050_2366469_+\|tail	phage tail sheath subtilisin-like domain-containing protein	B7SDP8	Haemophilus_phage	1.0e-85	42.0
WP_023311695.1\|2366482_2366857_+	hypothetical protein	F6MIK8	Haemophilus_phage	9.6e-31	54.9
WP_038637851.1\|2366857_2367250_+	hypothetical protein	NA	NA	NA	NA
WP_038637854.1\|2367384_2369553_+\|tail	phage tail tape measure protein	A0A0M3LPB6	Mannheimia_phage	7.0e-73	35.8
WP_038637856.1\|2369549_2370881_+	DNA circularization N-terminal domain-containing protein	A0A2H4JGT4	uncultured_Caudovirales_phage	7.4e-33	26.2
WP_038637859.1\|2370864_2372082_+\|tail	tail protein	A0A2H4J9E6	uncultured_Caudovirales_phage	2.4e-75	37.9
2371013:2371027	attR	NA	NA	NA	NA
WP_038637862.1\|2372065_2372671_+\|plate	phage baseplate assembly protein	F6MIL4	Haemophilus_phage	2.0e-30	56.4
WP_038637864.1\|2372760_2373111_+	phage GP46 family protein	A0A2H4JDR8	uncultured_Caudovirales_phage	4.5e-30	60.0
WP_038637866.1\|2373110_2374178_+\|plate	baseplate J/gp47 family protein	F6MIL6	Haemophilus_phage	4.8e-67	43.3
WP_038637869.1\|2374174_2374747_+	DUF2313 domain-containing protein	F6MIL7	Haemophilus_phage	3.2e-33	42.2
WP_155268628.1\|2374746_2375862_+	hypothetical protein	A0A0U3E1R2	Pseudomonas_phage	5.1e-19	32.3
WP_038637872.1\|2375861_2376143_+	hypothetical protein	NA	NA	NA	NA
WP_080700401.1\|2376135_2376387_+\|tail	tail fiber assembly protein	A0A0F7LDZ0	Escherichia_phage	2.4e-22	68.5
WP_038637874.1\|2376553_2377108_+	recombinase family protein	K7PJT4	Enterobacteria_phage	9.4e-83	81.3
WP_038637877.1\|2377818_2378211_-	VOC family protein	NA	NA	NA	NA
WP_038637880.1\|2378242_2378497_-	Zn-finger protein	NA	NA	NA	NA
WP_038637881.1\|2378795_2379968_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_038637884.1\|2379980_2381432_-	Na+/H+ antiporter NhaC	NA	NA	NA	NA
WP_038637887.1\|2381572_2382583_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_038637888.1\|2382684_2383296_-	LysE family translocator	NA	NA	NA	NA
WP_038637891.1\|2383532_2384339_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_038637894.1\|2384455_2384905_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_038637897.1\|2385031_2386501_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_069323885.1\|2386845_2386935_-	cytochrome bd-II oxidase subunit CbdX	NA	NA	NA	NA
WP_038637900.1\|2386948_2388085_-	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_038637903.1\|2388102_2389641_-	cytochrome bd-II oxidase subunit 1	NA	NA	NA	NA
WP_038637904.1\|2389731_2390589_-	hydrogenase expression/formation protein	NA	NA	NA	NA
WP_038637907.1\|2390585_2390990_-	hydrogenase-1 operon protein HyaE	NA	NA	NA	NA
WP_038637910.1\|2390995_2391577_-\|protease	hydrogenase 1 maturation protease	NA	NA	NA	NA

DBSCAN-SWA_182

2428930 : 2436893

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038637989.1\|2428930_2430817_+	propionate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	1.8e-53	29.4
WP_038637992.1\|2430863_2431136_-	YceK/YidQ family lipoprotein	NA	NA	NA	NA
WP_038637995.1\|2431291_2432545_-	MFS transporter	NA	NA	NA	NA
WP_038637998.1\|2432602_2435680_-	beta-galactosidase	L0N6M2	Herpes_simplex_virus	0.0e+00	80.6
WP_129694859.1\|2435801_2436893_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	9.3e-159	81.5

DBSCAN-SWA_183

2463595 : 2469038

Micromonas_sp._RCC1109_virus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038638040.1\|2463595_2464546_+	acetaldehyde dehydrogenase (acetylating)	E5EQ71	Micromonas_sp._RCC1109_virus	9.6e-35	36.7
WP_038638043.1\|2464542_2465556_+	4-hydroxy-2-oxovalerate aldolase	E5EQ69	Micromonas_sp._RCC1109_virus	2.7e-43	30.8
WP_038643046.1\|2465624_2466836_+	3-(3-hydroxy-phenyl)propionate transporter MhpT	NA	NA	NA	NA
WP_038638046.1\|2466950_2467877_+	homocysteine S-methyltransferase	NA	NA	NA	NA
WP_038638049.1\|2467991_2469038_-	ferric ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.1e-34	38.2

DBSCAN-SWA_184

2477085 : 2477853

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038638074.1\|2477085_2477853_+	taurine ABC transporter ATP-binding subunit	G9BWD6	Planktothrix_phage	5.6e-25	39.1

DBSCAN-SWA_185

2494447 : 2495563

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_051594509.1\|2494447_2495563_+	diguanylate cyclase AdrA	A0A127AWB9	Bacillus_phage	9.6e-18	35.5

DBSCAN-SWA_186

2499274 : 2509101

Bacillus_phage(60.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003021479.1\|2499274_2500186_-	recombination-associated protein RdgC	S4TWL4	Salmonella_phage	2.7e-103	64.3
WP_038638141.1\|2500277_2501186_+	fructokinase	NA	NA	NA	NA
WP_038643051.1\|2501192_2502362_-	MFS transporter AraJ	NA	NA	NA	NA
WP_038638144.1\|2502526_2505676_-	exonuclease subunit SbcC	G3MAB6	Bacillus_virus	3.8e-11	26.4
WP_038638145.1\|2505672_2506875_-	exonuclease subunit SbcD	R4JGS2	Bacillus_phage	3.7e-07	37.6
WP_003021496.1\|2507065_2507755_+	phosphate response regulator transcription factor PhoB	W8CYM9	Bacillus_phage	2.0e-37	38.9
WP_038638149.1\|2507805_2509101_+	phosphate regulon sensor histidine kinase PhoR	W8CYF6	Bacillus_phage	2.2e-26	29.2

DBSCAN-SWA_187

2525419 : 2535038

uncultured_Mediterranean_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003021535.1\|2525419_2526547_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.6e-89	46.3
WP_003021544.1\|2526569_2526902_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	2.8e-10	33.0
WP_071888113.1\|2526929_2528777_+	protein translocase subunit SecD	NA	NA	NA	NA
WP_038638190.1\|2528787_2529759_+	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.4e-44	37.8
WP_038638193.1\|2529937_2530303_+	VOC family protein	NA	NA	NA	NA
WP_038638197.1\|2530326_2531019_+	YafY family transcriptional regulator	A0A1B0RXM1	Streptococcus_phage	6.6e-17	29.0
WP_003021561.1\|2531064_2531928_-	nucleoside-specific channel-forming protein Tsx	NA	NA	NA	NA
WP_038638200.1\|2532226_2532766_-	DUF3251 domain-containing protein	NA	NA	NA	NA
WP_016152032.1\|2532920_2533370_+	transcriptional regulator NrdR	NA	NA	NA	NA
WP_038638204.1\|2533373_2534477_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	1.5e-52	35.8
WP_003021575.1\|2534567_2535038_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	7.8e-30	47.4

DBSCAN-SWA_188

2546071 : 2546590

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038643054.1\|2546071_2546590_+	4Fe-4S dicluster domain-containing protein	A0A077SL61	Escherichia_phage	7.8e-31	38.3

DBSCAN-SWA_189

2562576 : 2567622

Agrobacterium_phage(25.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032939995.1\|2562576_2563200_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	4.9e-64	63.4
WP_003831013.1\|2563326_2564601_+\|protease	ATP-dependent protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.9e-131	56.4
WP_038638272.1\|2564785_2567140_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	9.4e-225	52.5
WP_003021629.1\|2567349_2567622_+	DNA-binding protein HU-beta	A7KV42	Bacillus_phage	1.5e-20	58.4

DBSCAN-SWA_190

2570846 : 2571542

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038638285.1\|2570846_2571542_-	7-cyano-7-deazaguanine synthase QueC	A0A2H4J8Q7	uncultured_Caudovirales_phage	3.2e-88	68.0

DBSCAN-SWA_191

2575951 : 2579495

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038638295.1\|2575951_2577724_+	SmdA family multidrug ABC transporter permease/ATP-binding protein	W8CYL7	Bacillus_phage	1.6e-46	30.1
WP_038638298.1\|2577716_2579495_+	SmdB family multidrug efflux ABC transporter permease/ATP-binding protein	W8CYL7	Bacillus_phage	4.1e-39	27.3

DBSCAN-SWA_192

2591630 : 2594780

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038638345.1\|2591630_2594780_-	multidrug efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	1.4e-53	23.5

DBSCAN-SWA_193

2600320 : 2611215

Sodalis_phage(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038638355.1\|2600320_2601244_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	9.2e-67	55.0
WP_006685679.1\|2601313_2601481_-	pleiotropic regulatory protein RsmS	NA	NA	NA	NA
WP_038638358.1\|2601495_2602023_-	primosomal replication protein N''	NA	NA	NA	NA
WP_038638360.1\|2602092_2602470_+	DUF454 family protein	NA	NA	NA	NA
WP_006685676.1\|2602664_2603216_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	3.2e-30	47.3
WP_038638363.1\|2603333_2605262_+	DNA polymerase III subunit gamma/tau	E7DN81	Pneumococcus_phage	3.0e-43	41.5
WP_003021764.1\|2605319_2605649_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_003021767.1\|2605648_2606254_+	recombination protein RecR	NA	NA	NA	NA
WP_038638366.1\|2606364_2608239_+	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	2.9e-115	36.7
WP_003021773.1\|2608470_2609115_+	adenylate kinase	NA	NA	NA	NA
WP_038638369.1\|2609296_2610259_+	ferrochelatase	NA	NA	NA	NA
WP_038638372.1\|2610255_2611215_-	acetyl esterase	A0A2L2DMU8	Acanthamoeba_polyphaga_mimivirus	7.7e-16	27.5

DBSCAN-SWA_194

2619396 : 2621898

uncultured_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038638391.1\|2619396_2621898_-	copper-exporting P-type ATPase CopA	A0A218MNH6	uncultured_virus	2.0e-116	38.4

DBSCAN-SWA_195

2627042 : 2627720

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038638402.1\|2627042_2627720_+	iron ABC transporter ATP-binding protein FetA	G3M9Y6	Bacillus_virus	6.8e-27	34.4

DBSCAN-SWA_196

2630870 : 2631557

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038638411.1\|2630870_2631557_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.8e-30	33.8

DBSCAN-SWA_197

2636428 : 2637445

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038638422.1\|2636428_2637445_+	virulence-associated ABC transporter ATP-binding protein SfbB	G9BWD6	Planktothrix_phage	5.1e-34	39.1

DBSCAN-SWA_198

2641879 : 2643661

Ostreococcus_tauri_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038638436.1\|2641879_2643661_+	glyoxylate carboligase	E4WLQ6	Ostreococcus_tauri_virus	1.1e-39	27.2

DBSCAN-SWA_199

2651117 : 2652266

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038638454.1\|2651117_2652266_+	glycerate 3-kinase	W6LM47	Streptococcus_phage	7.7e-47	41.4

DBSCAN-SWA_200

2663665 : 2666871

Moumouvirus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038638484.1\|2663665_2665051_+\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	1.6e-46	35.4
WP_038638488.1\|2665141_2665666_-	metal-dependent hydrolase	NA	NA	NA	NA
WP_016152124.1\|2665790_2666003_-	ribosome-associated protein YbcJ	NA	NA	NA	NA
WP_003021887.1\|2666004_2666871_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	1.2e-28	36.5

DBSCAN-SWA_201

2677034 : 2680968

Morganella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038638520.1\|2677034_2677463_-	universal stress protein UspF	A0A1W6JNV4	Morganella_phage	1.6e-26	47.9
WP_038638523.1\|2677626_2678430_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_038638526.1\|2678513_2678723_-	hypothetical protein	NA	NA	NA	NA
WP_038638528.1\|2678843_2680295_-	Cu(+)/Ag(+) sensor histidine kinase	A0A1V0SGX0	Hokovirus	7.3e-10	26.7
WP_038638530.1\|2680284_2680968_-	copper response regulator transcription factor CusR	W8CYM9	Bacillus_phage	6.0e-31	36.0

DBSCAN-SWA_202

2684306 : 2689918

Leptospira_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038638543.1\|2684306_2687450_+	CusA/CzcA family heavy metal efflux RND transporter	S5VTK5	Leptospira_phage	2.7e-57	22.2
WP_038638546.1\|2687502_2688357_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_038638549.1\|2688592_2689918_+	pyridine nucleotide-disulfide oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	1.4e-103	46.3

DBSCAN-SWA_203

2693768 : 2703107

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038638564.1\|2693768_2703107_-	autotransporter outer membrane beta-barrel domain-containing protein	A0A2L1IV18	Escherichia_phage	1.5e-10	23.4

DBSCAN-SWA_204

2708731 : 2710111

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_129695026.1\|2708731_2710111_-	MFS transporter	A0A0M3UL24	Mycobacterium_phage	6.1e-30	30.8

DBSCAN-SWA_205

2721620 : 2729709

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038638611.1\|2721620_2725511_+	enterobactin non-ribosomal peptide synthetase EntF	A0A2K9KZV5	Tupanvirus	9.3e-60	29.0
WP_038638614.1\|2725739_2726873_+	LPS O-antigen length regulator	NA	NA	NA	NA
WP_038638617.1\|2726918_2727716_-	iron-enterobactin ABC transporter ATP-binding protein	A0A1V0SJ29	Klosneuvirus	1.9e-07	22.5
WP_114140310.1\|2727712_2728702_-	iron-enterobactin ABC transporter permease	NA	NA	NA	NA
WP_038638624.1\|2728701_2729709_-	Fe(3+)-siderophore ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	4.4e-14	25.2

DBSCAN-SWA_206

2742106 : 2743932

uncultured_marine_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038638649.1\|2742106_2742724_-	ParB-like nuclease domain-containing protein	A0A0F7L444	uncultured_marine_virus	4.6e-54	54.8
WP_038638652.1\|2742708_2743932_-	phosphoadenosine phosphosulfate reductase	A0A220GKF8	Streptococcus_phage	1.2e-58	33.3

DBSCAN-SWA_207

2747050 : 2750953

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038638660.1\|2747050_2748616_+	alkyl hydroperoxide reductase subunit F	G3MA85	Bacillus_virus	3.2e-43	33.7
WP_071888118.1\|2748717_2749278_-	desulfoferrodoxin	NA	NA	NA	NA
WP_038638663.1\|2749291_2750953_-	medium-chain fatty-acid--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	2.2e-34	25.7

DBSCAN-SWA_208

2762187 : 2764322

Morganella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016152215.1\|2762187_2762616_-	universal stress protein UspG	A0A1W6JNV4	Morganella_phage	2.8e-18	39.2
WP_005120853.1\|2762804_2763215_-	nucleoside diphosphate kinase regulator	NA	NA	NA	NA
WP_038638697.1\|2763491_2764322_+	alpha/beta hydrolase	W8EHU1	Mycobacterium_phage	6.0e-17	31.2

DBSCAN-SWA_209

2778172 : 2778817

Morganella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000034825.1\|2778172_2778382_+	transcription antiterminator/RNA stability regulator CspE	A0A1W6JNX5	Morganella_phage	2.7e-22	78.1
WP_003831281.1\|2778433_2778817_-	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	3.4e-23	52.6

DBSCAN-SWA_210

2782422 : 2784871

Stx2-converting_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038638745.1\|2782422_2783634_-	D-alanyl-D-alanine carboxypeptidase DacA	B6DZZ7	Stx2-converting_phage	1.3e-100	47.9
WP_038638749.1\|2783776_2784871_-	endolytic peptidoglycan transglycosylase RlpA	F5B3X9	Synechococcus_phage	4.7e-09	53.2

DBSCAN-SWA_211

2793030 : 2798205

Staphylococcus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_110498575.1\|2793030_2795613_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	1.2e-185	42.7
WP_038638764.1\|2795848_2796331_+	zinc ribbon-containing protein	NA	NA	NA	NA
WP_038638767.1\|2796427_2797363_-	pyrimidine-specific ribonucleoside hydrolase RihA	NA	NA	NA	NA
WP_000631392.1\|2797479_2798205_-	glutamate/aspartate ABC transporter ATP binding protein GltL	G9BWD6	Planktothrix_phage	1.9e-30	38.1

DBSCAN-SWA_212

2804048 : 2805134

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087857137.1\|2804048_2805134_-	PhoH family protein	A0A0S0MVD6	Pseudomonas_phage	3.3e-47	46.6

DBSCAN-SWA_213

2809036 : 2810701

Ostreococcus_tauri_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038638793.1\|2809036_2810701_-	asparagine synthase B	A9YVS6	Ostreococcus_tauri_virus	1.6e-85	39.9

DBSCAN-SWA_214

2815343 : 2832229

Vibrio_phage(16.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038638803.1\|2815343_2817293_+	PTS N-acetyl glucosamine transporter subunit IIABC	A0A2I7SAJ6	Vibrio_phage	1.4e-08	48.6
WP_038638804.1\|2817479_2819147_+\|tRNA	glutamine--tRNA ligase	A0A222YZ70	Escherichia_phage	0.0e+00	94.4
WP_038638807.1\|2819580_2820987_+	chitoporin	NA	NA	NA	NA
WP_038638809.1\|2821036_2821369_+	hypothetical protein	NA	NA	NA	NA
WP_038638812.1\|2821413_2822709_-	MFS transporter	Q6JIH2	Burkholderia_virus	2.6e-59	34.4
WP_038638814.1\|2822762_2823902_-	tricarballylate utilization 4Fe-4S protein TcuB	NA	NA	NA	NA
WP_038638817.1\|2823888_2825292_-	FAD-dependent tricarballylate dehydrogenase TcuA	A0A2P0ZL82	Lactobacillus_phage	8.7e-08	25.8
WP_038638820.1\|2825389_2826316_-	tricarballylate utilization LysR family transcriptional regulator TcuR	NA	NA	NA	NA
WP_003022836.1\|2826443_2826890_-	ferric iron uptake transcriptional regulator	NA	NA	NA	NA
WP_110498567.1\|2826882_2826969_-	ryhB-regulated fur leader peptide	NA	NA	NA	NA
WP_006685496.1\|2827179_2827755_-	flavodoxin FldA	NA	NA	NA	NA
WP_038643079.1\|2827865_2828153_-	LexA regulated protein	NA	NA	NA	NA
WP_038638825.1\|2828281_2829055_-	esterase	A0A1J0GVH7	Mycobacterium_phage	3.4e-06	35.4
WP_038638828.1\|2829248_2829791_+	replication initiation negative regulator SeqA	NA	NA	NA	NA
WP_038638831.1\|2829815_2831456_+	alpha-D-glucose phosphate-specific phosphoglucomutase	NA	NA	NA	NA
WP_038638835.1\|2831551_2832229_-	two-component system response regulator KdpE	W8CYM9	Bacillus_phage	2.6e-26	32.0

DBSCAN-SWA_215

2835495 : 2837544

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038638844.1\|2835495_2837544_-	potassium-transporting ATPase subunit KdpB	M1HBF8	Paramecium_bursaria_Chlorella_virus	2.4e-30	24.3

DBSCAN-SWA_216

2840909 : 2844960

Hokovirus(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038638854.1\|2840909_2842328_+	deoxyribodipyrimidine photo-lyase	A0A1V0SGL1	Hokovirus	7.8e-65	33.6
WP_038638856.1\|2842489_2843428_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	2.7e-66	53.6
WP_038638859.1\|2843478_2844960_-	dipeptide permease DtpD	A0A0P0IY73	Acinetobacter_phage	6.1e-44	27.2

DBSCAN-SWA_217

2850750 : 2851542

Kaumoebavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038638879.1\|2850750_2851542_+	endonuclease VIII	A0A1V0CNR6	Kaumoebavirus	5.8e-09	30.4

DBSCAN-SWA_218

2891491 : 2895006

Vibrio_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038638959.1\|2891491_2892211_+	nicotinamide riboside transporter PnuC	A0A126HGA3	Vibrio_phage	8.9e-25	33.6
WP_038638962.1\|2892207_2893149_-	CDF family zinc transporter ZitB	A0A1V0SED0	Indivirus	4.9e-23	28.0
WP_038638965.1\|2893262_2893637_-	YbgS-like family protein	NA	NA	NA	NA
WP_038638968.1\|2893953_2895006_+	3-deoxy-7-phosphoheptulonate synthase AroG	S4W5F1	Pandoravirus	3.4e-81	49.0

DBSCAN-SWA_219

2899340 : 2905905

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038638984.1\|2899340_2900357_-	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	1.3e-77	45.1
WP_038638987.1\|2900574_2902047_-	molybdate ABC transporter ATP-binding protein ModF	A0A1M7XV31	Cedratvirus	1.0e-11	27.1
WP_038638991.1\|2902114_2902903_-	molybdenum-dependent transcriptional regulator	NA	NA	NA	NA
WP_003023026.1\|2903033_2903183_+	multidrug efflux pump-associated protein, AcrZ family	NA	NA	NA	NA
WP_038638993.1\|2903381_2904155_+	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_038638996.1\|2904154_2904844_+	molybdate ABC transporter permease subunit	NA	NA	NA	NA
WP_038638999.1\|2904846_2905905_+	molybdenum ABC transporter ATP-binding protein ModC	G9BWD6	Planktothrix_phage	2.0e-20	33.8

DBSCAN-SWA_220

2914267 : 2917707

Catovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038639024.1\|2914267_2915788_+	histidine ammonia-lyase	A0A1V0S940	Catovirus	1.1e-80	40.0
WP_038639028.1\|2915883_2916360_-	kinase inhibitor	NA	NA	NA	NA
WP_038639031.1\|2916417_2917707_-	adenosylmethionine--8-amino-7-oxononanoate transaminase	A0A1V0SKB7	Klosneuvirus	5.3e-20	28.0

DBSCAN-SWA_221

2924140 : 2925049

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038639050.1\|2924140_2925049_-	uridine diphosphate-N-acetylglucosamine-binding protein YvcK	A1IMD5	Streptococcus_phage	3.5e-26	30.7

DBSCAN-SWA_222

2934715 : 2945083

Anomala_cuprea_entomopoxvirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038639084.1\|2934715_2936452_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	5.1e-18	31.2
WP_038639088.1\|2936444_2937440_-	secretion protein HlyD	NA	NA	NA	NA
WP_038639092.1\|2937436_2938102_-	transcriptional regulator CecR	NA	NA	NA	NA
WP_038639094.1\|2938323_2939664_+	ATP-dependent RNA helicase RhlE	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	4.9e-53	34.0
WP_038639097.1\|2939760_2941911_+	ATP-dependent DNA helicase DinG	A0A127AW80	Bacillus_phage	3.7e-42	27.3
WP_038639100.1\|2941939_2942908_+	DNA-binding protein YbiB	NA	NA	NA	NA
WP_051594512.1\|2943071_2944202_+	malate/lactate/ureidoglycolate dehydrogenase	NA	NA	NA	NA
WP_006685371.1\|2944254_2944515_-	DUF1471 domain-containing protein	NA	NA	NA	NA
WP_003831562.1\|2944816_2945083_-	DksA/TraR family C4-type zinc finger protein	A0A2C9CZU7	Yersinia_phage	4.7e-16	52.3

DBSCAN-SWA_223

2948976 : 2954213

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038639112.1\|2948976_2949699_-	glutamine ABC transporter ATP-binding protein GlnQ	G9BWD6	Planktothrix_phage	2.8e-34	41.1
WP_006685364.1\|2949695_2950355_-	glutamine ABC transporter permease GlnP	NA	NA	NA	NA
WP_038639115.1\|2950491_2951238_-	glutamine ABC transporter substrate-binding protein GlnH	NA	NA	NA	NA
WP_038639118.1\|2951603_2952107_-	DNA starvation/stationary phase protection protein Dps	A0A222YYG6	Streptomyces_phage	4.2e-05	28.1
WP_038639121.1\|2952410_2953298_-	threonine/homoserine exporter RhtA	NA	NA	NA	NA
WP_003035257.1\|2953697_2954213_+	outer membrane protein OmpX	A5LH44	Enterobacteria_phage	1.9e-16	33.7

DBSCAN-SWA_224

2959281 : 2960877

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038639134.1\|2959281_2960877_+	ABC-F family ATPase	A0A2K9L0W2	Tupanvirus	1.1e-59	28.5

DBSCAN-SWA_225

2968557 : 2973794

Citrobacter_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038639151.1\|2968557_2970990_-	glycyl radical protein	A0A076YHZ7	Citrobacter_phage	2.3e-08	50.9
WP_038639154.1\|2970995_2971895_-	glycyl-radical enzyme activating protein	NA	NA	NA	NA
WP_038639157.1\|2972027_2972690_+	fructose-6-phosphate aldolase	A0A1D8KKK9	Synechococcus_phage	8.5e-22	31.3
WP_038639160.1\|2972864_2973794_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	1.1e-64	52.4

DBSCAN-SWA_226

2977932 : 2979804

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038639174.1\|2977932_2979804_+	glutathione ABC transporter ATP-binding protein GsiA	G9BWD6	Planktothrix_phage	2.8e-14	27.2

DBSCAN-SWA_227

2987437 : 2989447

Stx2-converting_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032940149.1\|2987437_2988640_+	serine-type D-Ala-D-Ala carboxypeptidase	B6DZZ7	Stx2-converting_phage	1.7e-97	47.1
WP_038639198.1\|2988688_2989447_-	DNA-binding transcriptional repressor DeoR	A0A077SK06	Escherichia_phage	2.6e-14	28.8

DBSCAN-SWA_228

3000108 : 3009552

Vibrio_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016152408.1\|3000108_3000372_-	glutaredoxin, GrxA family	A0A2I7SAE2	Vibrio_phage	5.0e-26	67.9
WP_038639228.1\|3000545_3000836_+	YbjC family protein	NA	NA	NA	NA
WP_038639231.1\|3000819_3001542_+	nitroreductase NfsA	NA	NA	NA	NA
WP_038639233.1\|3001599_3002502_+	30S ribosomal protein S6--L-glutamate ligase	A0A1D7SR78	Cyanophage	8.2e-36	34.0
WP_038639236.1\|3002592_3003069_+	YbjN domain-containing protein	NA	NA	NA	NA
WP_038639239.1\|3003502_3004615_+	spermidine/putrescine ABC transporter substrate-binding protein PotF	NA	NA	NA	NA
WP_038639242.1\|3004753_3005887_+	putrescine ABC transporter ATP-binding subunit PotG	G3M9Y6	Bacillus_virus	2.2e-30	34.9
WP_038639245.1\|3005896_3006850_+	putrescine ABC transporter permease PotH	NA	NA	NA	NA
WP_038639247.1\|3006846_3007692_+	putrescine ABC transporter permease PotI	NA	NA	NA	NA
WP_038639250.1\|3007751_3008240_+	YbjO family protein	NA	NA	NA	NA
WP_038639253.1\|3008424_3009552_+	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	A0A1X9I6F4	Streptococcus_phage	2.3e-27	27.1

DBSCAN-SWA_229

3013840 : 3030306

Bacillus_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038639270.1\|3013840_3015562_-	cysteine/glutathione ABC transporter ATP-binding protein/permease CydC	W8CYL7	Bacillus_phage	7.3e-17	24.0
WP_038639271.1\|3015562_3017329_-	cysteine/glutathione ABC transporter permease/ATP-binding protein CydD	W8CYL7	Bacillus_phage	1.6e-22	25.3
WP_003831889.1\|3017443_3018412_-	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	1.9e-62	44.3
WP_002439523.1\|3018959_3019454_+	leucine-responsive transcriptional regulator Lrp	NA	NA	NA	NA
WP_038639280.1\|3019588_3023566_+	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	2.8e-88	49.2
WP_038639282.1\|3023677_3024289_+	outer membrane lipoprotein chaperone LolA	NA	NA	NA	NA
WP_038639284.1\|3024299_3025643_+	replication-associated recombination protein RarA	G3MBE0	Bacillus_virus	1.5e-81	41.3
WP_003836908.1\|3025734_3027027_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.5e-94	46.1
WP_038639287.1\|3027233_3029678_+	dimethylsulfoxide reductase subunit A	A0A077SK27	Escherichia_phage	3.0e-221	50.6
WP_038639290.1\|3029688_3030306_+	dimethylsulfoxide reductase subunit B	A0A077SL61	Escherichia_phage	5.6e-76	59.6

DBSCAN-SWA_230

3033563 : 3036772

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003035751.1\|3033563_3034304_-	pyruvate formate lyase 1-activating protein	A0A2P0VNQ0	Tetraselmis_virus	1.0e-20	26.5
WP_006685273.1\|3034489_3036772_-	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	3.2e-161	41.8

DBSCAN-SWA_231

3040895 : 3041984

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038639304.1\|3040895_3041984_+	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	4.5e-81	46.5

DBSCAN-SWA_232

3046137 : 3050677

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003035780.1\|3046137_3046422_+	integration host factor subunit beta	A7KV42	Bacillus_phage	9.2e-10	39.1
WP_038639309.1\|3046627_3048892_+	ComEC family protein	NA	NA	NA	NA
WP_038639312.1\|3048928_3050677_+	lipid A ABC transporter ATP-binding protein/permease MsbA	W8CYL7	Bacillus_phage	1.9e-60	30.7

DBSCAN-SWA_233

3065406 : 3065955

Rhodobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003831948.1\|3065406_3065955_+	YcbK family protein	A0A0K1LKR7	Rhodobacter_phage	3.5e-05	32.6

DBSCAN-SWA_234

3069137 : 3072678

uncultured_Caudovirales_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011787801.1\|3069137_3070628_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	8.6e-224	82.2
WP_011787802.1\|3070662_3071517_+	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	1.3e-67	48.6
WP_011787803.1\|3071607_3071940_+	TraR/DksA C4-type zinc finger protein	NA	NA	NA	NA
WP_011787804.1\|3072057_3072678_-	recombinase family protein	A0A286S1P7	Klebsiella_phage	1.7e-24	37.1

DBSCAN-SWA_235

3077678 : 3084165

Bandra_megavirus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038639361.1\|3077678_3079079_-\|tRNA	asparagine--tRNA ligase	A0A2K9V902	Bandra_megavirus	2.2e-80	35.5
WP_038639364.1\|3079244_3080447_-	nicotinate phosphoribosyltransferase	NA	NA	NA	NA
WP_038639369.1\|3080713_3083326_+	aminopeptidase N	A0A0P0IY26	Acinetobacter_phage	2.4e-19	21.8
WP_038639372.1\|3083397_3084165_-	aliphatic sulfonates ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.0e-30	38.0

DBSCAN-SWA_236

3092932 : 3094840

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038639409.1\|3092932_3094840_+	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	4.6e-52	29.3

DBSCAN-SWA_237

3107413 : 3109468

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038639439.1\|3107413_3109468_+	DNA helicase IV	A7KV33	Bacillus_phage	1.4e-19	27.6

DBSCAN-SWA_238

3122711 : 3128470

Shigella_phage(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003035917.1\|3122711_3123371_-\|protease	FtsH protease modulator YccA	A0A2H4JFM9	uncultured_Caudovirales_phage	8.9e-48	55.3
WP_038639484.1\|3123640_3125269_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_038639487.1\|3125743_3127186_-	glucosyltransferase domain-containing protein	A0A192Y7W8	Salmonella_phage	8.3e-14	22.6
WP_038639491.1\|3127187_3128111_-	glycosyltransferase family 2 protein	S5FKN0	Shigella_phage	4.0e-147	81.7
WP_038639494.1\|3128107_3128470_-	GtrA family protein	U5P0S6	Shigella_phage	1.3e-32	55.0

DBSCAN-SWA_239

3132696 : 3133623

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038639512.1\|3132696_3133623_-	curved DNA-binding protein	A0A1V0SIM1	Klosneuvirus	4.2e-11	40.0

DBSCAN-SWA_240

3142546 : 3142720

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032939912.1\|3142546_3142720_+	general stress protein	Q9KX95	Enterobacteria_phage	1.4e-05	92.6

DBSCAN-SWA_241

3155496 : 3157746

Erwinia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_110498396.1\|3155496_3156405_+	phosphate starvation-inducible protein PhoH	A0A1B2ICF6	Erwinia_phage	6.9e-91	70.4
WP_038639571.1\|3156454_3156748_-	hypothetical protein	NA	NA	NA	NA
WP_038639573.1\|3157122_3157746_+	cytochrome c biogenesis heme-transporting ATPase CcmA	A0A2R8FG22	Brazilian_cedratvirus	2.7e-09	28.8

DBSCAN-SWA_242

3165098 : 3172257

Escherichia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_129695001.1\|3165098_3167618_+	trimethylamine-N-oxide reductase TorA	A0A077SK27	Escherichia_phage	2.9e-86	31.1
WP_038639605.1\|3168452_3169391_+	glyoxylate/hydroxypyruvate reductase GhrA	A0A1B1IVB5	uncultured_Mediterranean_phage	1.1e-06	29.4
WP_038639608.1\|3169477_3170215_+	phosphatase	NA	NA	NA	NA
WP_038639611.1\|3170238_3170793_+	molecular chaperone	NA	NA	NA	NA
WP_038639615.1\|3170894_3171377_+	DUF1097 domain-containing protein	NA	NA	NA	NA
WP_003036082.1\|3171423_3172257_-	curli production assembly/transport protein CsgG	M1ICK2	Pelagibacter_phage	3.0e-40	39.7

DBSCAN-SWA_243

3176438 : 3176981

Scale_drop_disease_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038639630.1\|3176438_3176981_+	O-acetyl-ADP-ribose deacetylase	A0A0K1L687	Scale_drop_disease_virus	3.2e-27	42.4

DBSCAN-SWA_244

3185283 : 3188976

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038643109.1\|3185283_3186615_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.3e-18	34.8
WP_038639648.1\|3186679_3187900_-	multidrug efflux MFS transporter MdtG	NA	NA	NA	NA
WP_038639653.1\|3188055_3188976_-	LpxL/LpxP family Kdo(2)-lipid IV(A) lauroyl/palmitoleoyl acyltransferasee	A0A1W6JP29	Morganella_phage	1.7e-57	41.6

DBSCAN-SWA_245

3193695 : 3193941

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006685106.1\|3193695_3193941_-	DNA damage-inducible protein I	K7PM44	Enterobacteria_phage	8.2e-15	50.0

DBSCAN-SWA_246

3209173 : 3210124

Brevibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038639713.1\|3209173_3210124_+	flagellar assembly peptidoglycan hydrolase FlgJ	S5M633	Brevibacillus_phage	1.3e-10	30.9

DBSCAN-SWA_247

3224716 : 3225843

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006685074.1\|3224716_3225451_+	3-oxoacyl-ACP reductase FabG	Q06VL0	Trichoplusia_ni_ascovirus	7.7e-16	34.1
WP_000103754.1\|3225606_3225843_+	acyl carrier protein	B2ZXV3	Ralstonia_phage	1.5e-10	45.2

DBSCAN-SWA_248

3229130 : 3229772

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038639762.1\|3229130_3229772_+	dTMP kinase	Q2Z0N0	Pseudomonas_phage	1.3e-27	38.2

DBSCAN-SWA_249

3233486 : 3235265

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038639771.1\|3233486_3235265_-	aminopeptidase P family protein	A0A0P0I8D7	Acinetobacter_phage	1.7e-80	33.9

DBSCAN-SWA_250

3261706 : 3261964

Erwinia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029139491.1\|3261706_3261964_+	DUF1471 domain-containing protein	A0A1B2IFR9	Erwinia_phage	3.6e-05	35.7

DBSCAN-SWA_251

3269248 : 3276888

Mycoplasma_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038639849.1\|3269248_3269950_+	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	3.2e-35	40.3
WP_038639852.1\|3269949_3271194_+	lipoprotein-releasing ABC transporter permease subunit LolE	NA	NA	NA	NA
WP_038639855.1\|3271212_3272124_+	N-acetylglucosamine kinase	NA	NA	NA	NA
WP_038639858.1\|3272139_3272961_+	NAD-dependent protein deacylase	A0A2I7S9Y2	Vibrio_phage	1.9e-23	35.6
WP_003030797.1\|3273060_3274107_-	spermidine/putrescine ABC transporter substrate-binding protein PotD	NA	NA	NA	NA
WP_006684943.1\|3274134_3274914_-	spermidine/putrescine ABC transporter permease PotC	NA	NA	NA	NA
WP_038639863.1\|3274910_3275768_-	spermidine/putrescine ABC transporter permease PotB	Q6GZ02	Mycoplasma_phage	4.3e-10	25.4
WP_038639864.1\|3275751_3276888_-	spermidine/putrescine ABC transporter ATP-binding protein PotA	Q6GZ03	Mycoplasma_phage	5.5e-29	40.1

DBSCAN-SWA_252

3282696 : 3283179

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038643118.1\|3282696_3283179_+	host specificity protein J	Q9EYE7	Enterobacteria_phage	6.6e-32	47.8

DBSCAN-SWA_253

3286303 : 3290817

Klebsiella_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038639888.1\|3286303_3286546_-	DinI family protein	Q6UAW0	Klebsiella_phage	9.9e-29	76.6
WP_038639891.1\|3286623_3287043_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	3.0e-33	55.1
WP_038639894.1\|3287044_3288313_+	Y-family DNA polymerase	I6RSM4	Salmonella_phage	2.6e-205	82.0
WP_038639897.1\|3288305_3288977_-	SOS response-associated peptidase	A0A2H4J5W2	uncultured_Caudovirales_phage	1.6e-81	60.8
WP_038639900.1\|3289446_3290817_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	6.1e-107	44.6

DBSCAN-SWA_254

3293952 : 3296239

Phage_21(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038639915.1\|3293952_3295203_+	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	9.4e-22	94.4
WP_038639917.1\|3295510_3296239_+	MerR family transcriptional regulator	Q9EYF2	Enterobacteria_phage	3.9e-44	44.8

DBSCAN-SWA_255

3304683 : 3307636

Klebsiella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038639958.1\|3304683_3304926_-	DinI family protein	Q6UAW0	Klebsiella_phage	8.4e-28	75.3
WP_038639961.1\|3305126_3305666_-	cytochrome b	A0A0U2QLA7	Escherichia_phage	2.1e-39	73.1
WP_038639964.1\|3305810_3306089_-	hypothetical protein	NA	NA	NA	NA
WP_038639967.1\|3307010_3307217_+	hypothetical protein	NA	NA	NA	NA
WP_038643122.1\|3307345_3307636_-	Bor family protein	C6ZCX3	Enterobacteria_phage	1.4e-21	52.6

DBSCAN-SWA_256

3321391 : 3322417

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640019.1\|3321391_3322417_-	sensor domain-containing diguanylate cyclase	G3MA91	Bacillus_virus	5.5e-12	26.1

DBSCAN-SWA_257

3327346 : 3330275

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640038.1\|3327346_3328837_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	6.8e-11	28.3
WP_038640041.1\|3328991_3330275_-	YeaH/YhbH family protein	A0A140HLI1	Bacillus_phage	3.2e-09	26.6

DBSCAN-SWA_258

3339372 : 3341998

Plodia_interpunctella_granulovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640069.1\|3339372_3340626_-	glycoside hydrolase family 18 protein	A0A1L5JGH0	Plodia_interpunctella_granulovirus	1.2e-24	27.1
WP_038640072.1\|3340921_3341998_+	zinc-binding dehydrogenase	A0A2P1EIJ9	Megavirus	8.1e-14	24.5

DBSCAN-SWA_259

3346281 : 3350340

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640078.1\|3346281_3347265_+	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	1.9e-06	24.4
WP_032943120.1\|3347400_3348159_+	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_038640079.1\|3348299_3349658_+	MFS transporter	NA	NA	NA	NA
WP_129694905.1\|3349695_3350340_-	bifunctional nicotinamidase/pyrazinamidase	A0A2K9L6K4	Tupanvirus	3.0e-16	36.0

DBSCAN-SWA_260

3357332 : 3359279

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640087.1\|3357332_3359279_+	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	1.2e-39	29.4

DBSCAN-SWA_261

3364302 : 3364935

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640099.1\|3364302_3364935_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	3.1e-13	32.8

DBSCAN-SWA_262

3368162 : 3369227

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016487843.1\|3368162_3369227_+	DUF1016 family protein	A0A0U2BZN7	Salmonella_phage	7.2e-23	41.0

DBSCAN-SWA_263

3373003 : 3381839

Yersinia_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003092327.1\|3373003_3373831_+	DUF945 domain-containing protein	A0A2C9CYF8	Yersinia_phage	1.6e-46	39.6
WP_006379606.1\|3373911_3375981_+	ParB N-terminal domain-containing protein	G8DH78	Emiliania_huxleyi_virus	1.3e-20	26.3
WP_016487839.1\|3376042_3376252_+	hypothetical protein	NA	NA	NA	NA
WP_001273857.1\|3377022_3377337_+	DUF736 domain-containing protein	NA	NA	NA	NA
WP_006379425.1\|3377649_3377943_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_016487838.1\|3378230_3378578_+	DUF2958 domain-containing protein	A0A1W6DX76	Sphingobium_phage	6.6e-18	46.8
WP_006379424.1\|3378920_3379691_+	DUF2285 domain-containing protein	NA	NA	NA	NA
WP_001247107.1\|3379802_3380087_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_022652188.1\|3380113_3380959_+	replication initiator protein A	NA	NA	NA	NA
WP_071536585.1\|3380973_3381204_+	hypothetical protein	NA	NA	NA	NA
WP_003092312.1\|3381200_3381839_+	AAA family ATPase	A0A2H4JGZ2	uncultured_Caudovirales_phage	3.5e-33	40.0

DBSCAN-SWA_264

3387474 : 3388263

Pithovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_028689679.1\|3387474_3388263_-	ATP-binding cassette domain-containing protein	W5SAS9	Pithovirus	1.2e-09	29.4

DBSCAN-SWA_265

3417842 : 3419063

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640138.1\|3417842_3419063_+	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	8.5e-28	28.5

DBSCAN-SWA_266

3426546 : 3427377

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640152.1\|3426546_3427377_-	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	2.0e-73	55.7

DBSCAN-SWA_267

3433526 : 3439277

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640164.1\|3433526_3435785_-	catalase HPII	A0A2K9L572	Tupanvirus	1.7e-143	48.2
WP_071600734.1\|3435977_3436241_+	cell division activator CedA	NA	NA	NA	NA
WP_006684833.1\|3436305_3437697_-	cystine/sulfocysteine:cation symporter	NA	NA	NA	NA
WP_087050648.1\|3437832_3438432_-	metal-dependent hydrolase	A0A127AVX7	Bacillus_phage	3.5e-06	34.3
WP_038640166.1\|3438515_3439277_-	2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD	Q06VL0	Trichoplusia_ni_ascovirus	2.2e-21	33.7

DBSCAN-SWA_268

3444525 : 3458282

Tupanvirus(22.22%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032939806.1\|3444525_3446454_+\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	1.1e-127	36.9
WP_048997935.1\|3446457_3447000_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	8.2e-15	32.9
WP_003030583.1\|3447096_3447294_+	50S ribosomal protein L35	NA	NA	NA	NA
WP_003030578.1\|3447348_3447705_+	50S ribosomal protein L20	NA	NA	NA	NA
WP_001386830.1\|3447829_3447874_+	pheST operon leader peptide PheM	NA	NA	NA	NA
WP_038640179.1\|3448114_3449098_+\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2K9L3A8	Tupanvirus	1.1e-33	38.5
WP_038640181.1\|3449113_3451501_+\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_003030571.1\|3451505_3451805_+	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	7.2e-13	40.0
WP_038640182.1\|3452085_3453066_+	vitamin B12 ABC transporter permease BtuC	A0A2H4IY97	uncultured_Caudovirales_phage	6.7e-15	24.8
WP_038640185.1\|3453127_3453679_+	glutathione peroxidase	NA	NA	NA	NA
WP_038640187.1\|3453678_3454428_+	vitamin B12 ABC transporter ATP-binding protein BtuD	A0A2R8FG22	Brazilian_cedratvirus	1.6e-08	28.2
WP_038640189.1\|3454505_3454970_+	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	3.5e-14	38.2
WP_038640192.1\|3455288_3456002_+	EAL domain-containing protein	NA	NA	NA	NA
WP_038640194.1\|3456063_3457506_+	YdiU family protein	A0A075BSJ0	Microcystis_phage	2.4e-53	37.1
WP_038640197.1\|3457502_3458282_-	heme ABC transporter ATP-binding protein	W5SAS9	Pithovirus	8.7e-10	27.0

DBSCAN-SWA_269

3463582 : 3470001

Pandoravirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640209.1\|3463582_3464629_-	3-deoxy-7-phosphoheptulonate synthase AroH	A0A0B5IW14	Pandoravirus	8.8e-82	47.1
WP_038640212.1\|3464755_3465589_-	posphoenolpyruvate synthetase regulatory kinase/phosphorylase PpsR	NA	NA	NA	NA
WP_038640216.1\|3465917_3468296_+	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	2.6e-169	36.1
WP_038640218.1\|3468363_3470001_-	medium-chain fatty-acid--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	5.0e-31	28.6

DBSCAN-SWA_270

3496313 : 3501404

Lake_Baikal_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640259.1\|3496313_3496682_+	Fe-S cluster assembly scaffold SufA	A0A2H4N7N5	Lake_Baikal_phage	4.3e-15	39.4
WP_038640262.1\|3496690_3498178_+	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
WP_038640264.1\|3498194_3498941_+	Fe-S cluster assembly ATPase SufC	A0A1V0SE00	Indivirus	1.7e-07	25.0
WP_038640265.1\|3498915_3500187_+	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_038640267.1\|3500183_3501404_+	cysteine desulfurase SufS	Q2XUY6	environmental_halophage	7.3e-96	43.1

DBSCAN-SWA_271

3505565 : 3512977

Escherichia_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640275.1\|3505565_3506588_+	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	2.2e-13	24.3
WP_038640276.1\|3506580_3507249_+	ABC transporter permease	NA	NA	NA	NA
WP_038640278.1\|3507270_3508083_+	methionine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_038640280.1\|3508161_3511227_-	tetrathionate reductase subunit TtrA	A0A077SK27	Escherichia_phage	1.6e-06	25.7
WP_038640283.1\|3511219_3512242_-	tetrathionate reductase subunit TtrC	NA	NA	NA	NA
WP_038640285.1\|3512242_3512977_-	tetrathionate reductase subunit TtrB	A0A077SL61	Escherichia_phage	4.2e-22	37.4

DBSCAN-SWA_272

3519860 : 3524407

Escherichia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_051594516.1\|3519860_3520529_+	4Fe-4S dicluster domain-containing protein	A0A077SL61	Escherichia_phage	1.4e-24	39.1
WP_038640300.1\|3520525_3521311_+	thiosulfate reductase cytochrome B subunit	NA	NA	NA	NA
WP_038640302.1\|3521314_3522127_+	hypothetical protein	A0A077K9W7	Edwardsiella_phage	1.0e-05	33.8
WP_038640304.1\|3522136_3522814_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_038640306.1\|3522803_3523589_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_038640309.1\|3523588_3524407_-	amino acid ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	2.3e-13	25.8

DBSCAN-SWA_273

3535279 : 3541096

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640329.1\|3535279_3536755_-	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	2.2e-17	25.1
WP_038640330.1\|3536861_3538124_+	4-aminobutyrate transaminase	A0A1V0SKB7	Klosneuvirus	6.8e-20	25.2
WP_038640331.1\|3538300_3539356_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_038640332.1\|3539342_3540347_+	iron ABC transporter permease	NA	NA	NA	NA
WP_038640333.1\|3540343_3541096_+	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	1.8e-07	30.8

DBSCAN-SWA_274

3545415 : 3547200

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640341.1\|3545415_3547200_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	4.0e-18	33.3

DBSCAN-SWA_275

3555161 : 3566202

Bodo_saltans_virus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640357.1\|3555161_3555860_+	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	8.7e-09	32.1
WP_038640359.1\|3555898_3557272_-	multidrug efflux MATE transporter MdtK	NA	NA	NA	NA
WP_038640361.1\|3557489_3558131_+	riboflavin synthase	A0A2I2L4R9	Orpheovirus	1.5e-23	37.3
WP_038640363.1\|3558178_3559327_-	cyclopropane fatty acyl phospholipid synthase	A0A2K9L4K8	Tupanvirus	9.3e-85	45.1
WP_038640365.1\|3559617_3560823_-	Bcr/CflA family multidrug efflux MFS transporter	NA	NA	NA	NA
WP_038640367.1\|3560936_3561869_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_038640368.1\|3561865_3562891_-	HTH-type transcriptional repressor PurR	C6ZCU4	Enterobacteria_phage	1.4e-31	31.3
WP_003029209.1\|3563188_3563278_+	stress response protein YnhF	NA	NA	NA	NA
WP_038640370.1\|3563453_3564623_+	MFS transporter	NA	NA	NA	NA
WP_003029205.1\|3564662_3565244_-	superoxide dismutase [Fe]	Q56AR7	Bacillus_thuringiensis_phage	3.4e-43	46.0
WP_038640372.1\|3565371_3566202_-	C40 family peptidase	A0A2H5BM69	Streptomyces_phage	2.4e-18	41.6

DBSCAN-SWA_276

3571304 : 3571829

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640384.1\|3571304_3571829_+	superoxide dismutase [Cu-Zn] SodC2	Q9MC02	Salmonella_phage	4.2e-48	57.7

DBSCAN-SWA_277

3578746 : 3580021

Cronobacter_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640399.1\|3578746_3580021_+\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	8.5e-87	42.6

DBSCAN-SWA_278

3610624 : 3611926

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640455.1\|3610624_3611926_-	two-component system sensor histidine kinase RstB	W8CYF6	Bacillus_phage	1.3e-13	23.8

DBSCAN-SWA_279

3631346 : 3633547

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640487.1\|3631346_3632069_+	response regulator transcription factor	W8CYM9	Bacillus_phage	8.6e-36	36.6
WP_038640489.1\|3632065_3633547_+	HAMP domain-containing histidine kinase	A0A1V0SGX0	Hokovirus	1.2e-12	28.4

DBSCAN-SWA_280

3640128 : 3653107

Escherichia_phage(37.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640503.1\|3640128_3640743_-	Tat proofreading chaperone DmsD	A0A077SLS7	Escherichia_phage	3.3e-28	38.1
WP_038640505.1\|3640785_3641640_-	dimethyl sulfoxide reductase anchor subunit family protein	NA	NA	NA	NA
WP_038640507.1\|3641641_3642259_-	dimethylsulfoxide reductase subunit B	A0A077SL61	Escherichia_phage	1.2e-75	59.1
WP_038640509.1\|3642269_3644708_-	dimethyl sulfoxide reductase subunit A	A0A077SK27	Escherichia_phage	1.3e-213	48.4
WP_129694949.1\|3644861_3645170_-	DUF1161 domain-containing protein	NA	NA	NA	NA
WP_038643159.1\|3645273_3645984_+	YnfC family lipoprotein	NA	NA	NA	NA
WP_038640513.1\|3645990_3646551_-	spermidine N1-acetyltransferase	NA	NA	NA	NA
WP_038640515.1\|3646588_3646930_-	DUF1283 family protein	NA	NA	NA	NA
WP_038640517.1\|3647082_3647409_+	YnfA family protein	A0A218MNG8	uncultured_virus	1.7e-23	53.9
WP_003832907.1\|3647516_3648731_+	starvation-sensing protein RspA	Q6A202	Oenococcus_phage	7.4e-48	29.2
WP_038640519.1\|3648744_3649764_+	Zn-dependent oxidoreductase	NA	NA	NA	NA
WP_038640521.1\|3649817_3651197_+	MHS family MFS transporter	Q6JIH2	Burkholderia_virus	3.9e-29	26.8
WP_038640524.1\|3651361_3652828_+	mannitol dehydrogenase family protein	H8ZJP8	Ostreococcus_tauri_virus	4.2e-45	30.2
WP_038640526.1\|3652903_3653107_-	putative selenium delivery protein YdfZ	J9Q802	Salmonella_phage	2.2e-13	55.2

DBSCAN-SWA_281

3657164 : 3658091

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640534.1\|3657164_3658091_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	7.2e-19	35.9

DBSCAN-SWA_282

3662918 : 3667413

Cedratvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640542.1\|3662918_3663716_+	urea ABC transporter ATP-binding protein UrtD	A0A1M7XV31	Cedratvirus	5.2e-10	25.2
WP_038640544.1\|3663725_3664424_+	urea ABC transporter ATP-binding subunit UrtE	A0A2H4PQG7	Staphylococcus_phage	1.7e-12	25.7
WP_038640546.1\|3664464_3665652_-	efflux MFS transporter YdeE	NA	NA	NA	NA
WP_038643162.1\|3665850_3666750_+	O-acetylserine/cysteine exporter	NA	NA	NA	NA
WP_038640548.1\|3666783_3667002_-	multiple antibiotic resistance protein MarB	NA	NA	NA	NA
WP_003032424.1\|3667029_3667413_-	MDR efflux pump AcrAB transcriptional activator MarA	D0R0F8	Streptococcus_phage	3.6e-09	32.3

DBSCAN-SWA_283

3679278 : 3683234

Staphylococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640576.1\|3679278_3680439_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.3e-38	36.1
WP_038640578.1\|3680536_3680719_+	hypothetical protein	NA	NA	NA	NA
WP_038640580.1\|3680924_3683234_+	N-acetylmuramidase family protein	A0A142IF03	Pseudomonas_phage	2.0e-25	38.9

DBSCAN-SWA_284

3689831 : 3691775

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640594.1\|3689831_3691775_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.1e-08	30.3

DBSCAN-SWA_285

3697662 : 3699583

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640607.1\|3697662_3698649_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.2e-17	30.8
WP_038640609.1\|3698641_3699583_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.2e-13	28.6

DBSCAN-SWA_286

3710456 : 3712843

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640634.1\|3710456_3712172_+	ABC-F family ATP-binding cassette domain-containing protein	A0A1B0RXA0	Streptococcus_phage	1.9e-36	25.4
WP_038640636.1\|3712243_3712843_-	inorganic diphosphatase	A0A1B1ISK6	uncultured_Mediterranean_phage	1.5e-22	39.9

DBSCAN-SWA_287

3719192 : 3720272

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640648.1\|3719192_3720272_+	porin OmpD	Q1MVN1	Enterobacteria_phage	1.3e-149	74.0

DBSCAN-SWA_288

3728400 : 3729945

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640659.1\|3728400_3729945_+	nitrate reductase subunit beta	A0A077SL61	Escherichia_phage	1.1e-19	39.5

DBSCAN-SWA_289

3733468 : 3735445

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640669.1\|3733468_3735445_+	MBL fold metallo-hydrolase	A0A2P0VMX1	Tetraselmis_virus	3.6e-161	45.6

DBSCAN-SWA_290

3738523 : 3739297

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640679.1\|3738523_3739297_-	amino acid ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.0e-18	30.6

DBSCAN-SWA_291

3745648 : 3747190

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640691.1\|3745648_3747190_+	methyl-accepting chemotaxis protein	A0A1B0V854	Salmonella_phage	2.0e-34	54.3

DBSCAN-SWA_292

3750636 : 3752757

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640698.1\|3750636_3752757_+	TonB-dependent receptor	A0A1B0VCF0	Salmonella_phage	3.2e-139	67.6

DBSCAN-SWA_293

3765594 : 3766722

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640722.1\|3765594_3766722_+	multidrug effflux MFS transporter	S4TR35	Salmonella_phage	4.4e-10	22.9

DBSCAN-SWA_294

3770104 : 3774531

Mycoplasma_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640730.1\|3770104_3771121_-	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	2.5e-25	58.9
WP_038640732.1\|3771137_3772283_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_038640734.1\|3772612_3774022_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_087856629.1\|3774114_3774531_-	type II toxin-antitoxin system HicB family antitoxin	F1C593	Cronobacter_phage	3.1e-30	55.6

DBSCAN-SWA_295

3777973 : 3782675

Phage_TP(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640746.1\|3777973_3779935_-	U32 family peptidase	Q6DW11	Phage_TP	2.1e-23	27.8
WP_038640748.1\|3780014_3780551_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_038640751.1\|3780656_3781823_+	benzoate/H(+) symporter BenE family transporter	NA	NA	NA	NA
WP_038640753.1\|3781805_3782675_-	AraC family transcriptional regulator	A0A291LAM3	Bordetella_phage	9.4e-13	46.1

DBSCAN-SWA_296

3793764 : 3796741

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640777.1\|3793764_3795453_-	Tar ligand binding domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	5.9e-19	30.9
WP_038640779.1\|3795622_3796741_-	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	3.6e-33	29.6

DBSCAN-SWA_297

3802936 : 3805386

Salmonella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640793.1\|3802936_3804202_-	Y-family DNA polymerase	I6RSM4	Salmonella_phage	1.3e-183	73.5
WP_038640795.1\|3804204_3804624_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	1.8e-33	57.7
WP_038640797.1\|3804855_3805386_-	cytochrome b561	A0A0U2QLA7	Escherichia_phage	4.1e-19	44.9

DBSCAN-SWA_298

3809180 : 3813083

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640805.1\|3809180_3813083_-	ATP-dependent RNA helicase HrpA	A0A1V0SIV3	Klosneuvirus	2.6e-54	29.7

DBSCAN-SWA_299

3818050 : 3819040

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640813.1\|3818050_3819040_+	2-hydroxyacid dehydrogenase	M1HMI7	Paramecium_bursaria_Chlorella_virus	8.6e-71	43.1

DBSCAN-SWA_300

3824017 : 3834562

Enterobacteria_phage(14.29%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640818.1\|3824017_3825148_+	porin OmpC	Q1MVN1	Enterobacteria_phage	2.2e-115	58.2
WP_069324961.1\|3825294_3825507_+	KTSC domain-containing protein	NA	NA	NA	NA
WP_006684401.1\|3825588_3826023_+	universal stress protein UspF	A0A1W6JNV4	Morganella_phage	7.2e-30	52.1
WP_038640822.1\|3826220_3827156_+\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	2.4e-139	93.4
WP_038640824.1\|3827204_3828578_-	ATP-dependent RNA helicase DbpA	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.9e-52	31.7
WP_071888136.1\|3828606_3828789_-	hypothetical protein	NA	NA	NA	NA
WP_038640826.1\|3829063_3830047_-	zinc transporter ZntB	NA	NA	NA	NA
WP_038643181.1\|3830201_3831311_-	chemoreceptor protein	A0A2H4J162	uncultured_Caudovirales_phage	4.3e-10	21.7
WP_038640831.1\|3832024_3833257_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.2e-16	37.2
WP_038640833.1\|3833269_3833833_-	DNA endonuclease SmrA	NA	NA	NA	NA
WP_038640835.1\|3834046_3834562_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	1.6e-23	54.5

DBSCAN-SWA_301

3838233 : 3843616

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640844.1\|3838233_3839286_-	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L7I1	Tupanvirus	9.2e-87	46.7
WP_038640846.1\|3839315_3839945_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_038640848.1\|3840116_3840500_-	VOC family protein	NA	NA	NA	NA
WP_038640850.1\|3840617_3841388_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	4.6e-19	28.7
WP_038640852.1\|3841414_3841684_-	Rho-binding antiterminator	NA	NA	NA	NA
WP_038640854.1\|3841750_3841981_-	thioredoxin	NA	NA	NA	NA
WP_038640857.1\|3842097_3842661_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_038640858.1\|3842746_3843616_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	2.7e-52	43.2

DBSCAN-SWA_302

3858801 : 3861294

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080700409.1\|3858801_3861294_-	lysozyme	M1HAV4	Paramecium_bursaria_Chlorella_virus	3.6e-33	30.7

DBSCAN-SWA_303

3868358 : 3869441

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640897.1\|3868358_3869441_-	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	4.0e-13	28.3

DBSCAN-SWA_304

3883756 : 3886851

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640922.1\|3883756_3884665_-	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	7.4e-77	53.0
WP_071888139.1\|3884841_3885420_-	2-oxo-tetronate isomerase	NA	NA	NA	NA
WP_038640925.1\|3885367_3885814_-	DUF421 domain-containing protein	NA	NA	NA	NA
WP_038640927.1\|3885823_3886327_-	hypothetical protein	NA	NA	NA	NA
WP_038640929.1\|3886458_3886851_+	YdeI family stress tolerance OB fold protein	A0A1I9LJU6	Stx_converting_phage	2.4e-08	34.4

DBSCAN-SWA_305

3890662 : 3892463

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003020556.1\|3890662_3891655_+	peptide ABC transporter ATP-binding protein SapD	G9BWD6	Planktothrix_phage	4.7e-08	24.7
WP_038640937.1\|3891656_3892463_+	peptide ABC transporter ATP-binding protein SapF	G3M9Y6	Bacillus_virus	1.3e-13	27.4

DBSCAN-SWA_306

3895868 : 3897803

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038640943.1\|3895868_3897803_+	exoribonuclease II	A0A2H4UVB7	Bodo_saltans_virus	1.2e-07	23.9

DBSCAN-SWA_307

3905594 : 3906278

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_072276918.1\|3905594_3906278_+	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.2e-42	48.4

DBSCAN-SWA_308

3911122 : 3988658

Escherichia_phage(29.82%)

coat,protease,tail,terminase,holin,integrase,transposase

attL 3904672:3904687|attR 3986169:3986184

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3904672:3904687	attL	NA	NA	NA	NA
WP_038640964.1\|3911122_3913720_-	type I DNA topoisomerase	A0A2K9L1Q2	Tupanvirus	1.6e-87	35.0
WP_003020616.1\|3914118_3914370_+	YciN family protein	NA	NA	NA	NA
WP_038640966.1\|3914478_3915525_-\|protease	protease SohB	NA	NA	NA	NA
WP_038640968.1\|3915747_3916509_+	YciK family oxidoreductase	A0A0N9R355	Chrysochromulina_ericina_virus	2.6e-06	23.9
WP_038640970.1\|3916505_3917096_+	cob(I)yrinic acid a,c-diamide adenosyltransferase	NA	NA	NA	NA
WP_038640972.1\|3917179_3918055_-	23S rRNA pseudouridine(2605) synthase RluB	NA	NA	NA	NA
WP_038640974.1\|3918155_3918776_-	threonylcarbamoyl-AMP synthase	NA	NA	NA	NA
WP_129694998.1\|3918772_3919663_-	5'-3' exoribonuclease	NA	NA	NA	NA
WP_012905981.1\|3919786_3919831_+	trp operon leader peptide	NA	NA	NA	NA
WP_038640978.1\|3919925_3921488_+	anthranilate synthase component 1	NA	NA	NA	NA
WP_038640980.1\|3921487_3923083_+	bifunctional anthranilate synthase glutamate amidotransferase component TrpG/anthranilate phosphoribosyltransferase TrpD	A0A0N7IRD9	Acinetobacter_phage	1.1e-51	39.3
WP_038643199.1\|3923086_3924445_+	bifunctional indole-3-glycerol-phosphate synthase TrpC/phosphoribosylanthranilate isomerase TrpF	A0A0P0IR83	Acinetobacter_phage	5.9e-38	40.7
WP_038640982.1\|3924455_3925649_+	tryptophan synthase subunit beta	NA	NA	NA	NA
WP_038640984.1\|3925648_3926455_+	tryptophan synthase subunit alpha	NA	NA	NA	NA
WP_038640986.1\|3926487_3927960_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.4e-16	30.4
WP_038640988.1\|3928144_3928417_-	hypothetical protein	NA	NA	NA	NA
WP_038643201.1\|3929120_3930701_+	phosphoethanolamine transferase	NA	NA	NA	NA
WP_038640990.1\|3930766_3931405_-	outer membrane protein OmpW	NA	NA	NA	NA
WP_038640992.1\|3931803_3932547_+	UPF0259 family protein	NA	NA	NA	NA
WP_038640994.1\|3932600_3933140_+	septation protein A	NA	NA	NA	NA
WP_038640996.1\|3933304_3933706_+	acyl-CoA thioester hydrolase YciA	NA	NA	NA	NA
WP_038643203.1\|3933793_3934510_-	TonB system transport protein TonB	NA	NA	NA	NA
WP_006684292.1\|3934734_3935031_+	YciI family protein	NA	NA	NA	NA
WP_038640998.1\|3935846_3937115_-	Y-family DNA polymerase	I6RSM4	Salmonella_phage	3.4e-205	81.8
WP_038641000.1\|3937116_3937536_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	6.7e-33	54.3
WP_038641002.1\|3937613_3937856_+	DinI family protein	Q6UAW0	Klebsiella_phage	1.3e-28	75.3
WP_038641004.1\|3937994_3939416_-	hypothetical protein	A0A1V0E5M2	Salmonella_phage	1.0e-109	49.2
WP_038641006.1\|3939425_3940370_-	hypothetical protein	H6WRW5	Salmonella_phage	1.2e-117	65.5
WP_038641008.1\|3940372_3943606_-	host specificity protein J	G8C7R4	Escherichia_phage	0.0e+00	70.8
WP_038641010.1\|3943661_3944261_-\|tail	tail assembly protein	G8C7R3	Escherichia_phage	2.5e-97	92.0
WP_038641012.1\|3944248_3944980_-	C40 family peptidase	G8C7R2	Escherichia_phage	3.4e-141	91.8
WP_038641014.1\|3944992_3945766_-\|tail	phage minor tail protein L	G8C7R1	Escherichia_phage	3.6e-133	89.0
WP_038641016.1\|3945774_3946125_-\|tail	phage tail protein	G8C7R0	Escherichia_phage	8.9e-55	92.2
WP_038641018.1\|3946289_3946532_+	hypothetical protein	NA	NA	NA	NA
WP_129695011.1\|3946722_3947106_-	hypothetical protein	A0A286S1N7	Klebsiella_phage	7.1e-21	43.4
WP_114070829.1\|3947180_3948941_-\|tail	phage tail tape measure protein	G8C7Q6	Escherichia_phage	1.1e-89	62.5
WP_019076573.1\|3950311_3950599_-	DUF1799 domain-containing protein	I6PD79	Cronobacter_phage	2.7e-17	60.0
WP_038641024.1\|3950616_3950955_-	hypothetical protein	G8C7Q5	Escherichia_phage	6.8e-52	90.2
WP_038641026.1\|3950996_3951929_-	immunoglobulin domain-containing protein	G8C7Q3	Escherichia_phage	3.1e-155	91.3
WP_038641028.1\|3951975_3952425_-	DUF4128 domain-containing protein	G8C7Q2	Escherichia_phage	6.3e-61	76.5
WP_038641030.1\|3952414_3953014_-	hypothetical protein	G8C7Q1	Escherichia_phage	1.9e-97	87.4
WP_038641032.1\|3953016_3953370_-	hypothetical protein	G8C7Q0	Escherichia_phage	3.9e-50	84.6
WP_038641034.1\|3953371_3953854_-	hypothetical protein	G8C7P9	Escherichia_phage	3.7e-75	84.4
WP_038641038.1\|3954273_3955413_-\|coat	coat protein	G8C7P7	Escherichia_phage	1.1e-173	83.8
WP_016156687.1\|3955430_3956183_-	hypothetical protein	G8C7P6	Escherichia_phage	1.5e-123	92.0
WP_038641040.1\|3956503_3957610_-	phage Mu F like family protein	G8C7P5	Escherichia_phage	1.9e-188	90.5
WP_038641042.1\|3957611_3959012_-	DUF4055 domain-containing protein	G8C7P4	Escherichia_phage	1.1e-252	93.8
WP_038641044.1\|3959016_3960321_-\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	7.5e-147	60.0
WP_038641046.1\|3960298_3961294_-\|terminase	terminase small subunit	I6X6R5	Burkholderia_virus	6.7e-39	40.2
WP_096755719.1\|3961666_3962813_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.9e-146	92.2
WP_038641048.1\|3962829_3963258_-	hypothetical protein	NA	NA	NA	NA
WP_038641050.1\|3963344_3963863_-	DUF2514 domain-containing protein	A0A291LBG9	Klebsiella_phage	5.8e-10	50.0
WP_038641052.1\|3963859_3964408_-	lysozyme	K7PM52	Enterobacteria_phage	6.4e-100	95.6
WP_001568784.1\|3964379_3964658_-\|holin	holin	K7PGZ9	Enterobacteria_phage	5.1e-45	97.8
WP_038641055.1\|3965059_3965749_-	antiterminator	I6PDF8	Cronobacter_phage	1.8e-67	57.1
WP_129694979.1\|3965745_3965877_-	YlcG family protein	K7PHH3	Enterobacteria_phage	1.1e-10	93.9
WP_129694980.1\|3965873_3966494_-	recombination protein NinG	A0A0M4RU10	Salmonella_phage	1.2e-46	65.7
WP_038641057.1\|3966478_3966898_-	hypothetical protein	NA	NA	NA	NA
WP_038641061.1\|3967105_3967705_-	DUF1367 family protein	K7PKS6	Enterobacteria_phage	6.5e-106	95.0
WP_001568777.1\|3967739_3967988_-	hypothetical protein	K7PHG9	Enterobacteria_phage	8.0e-42	98.8
WP_038641063.1\|3968105_3968339_-	DinI-like family protein	K7PM44	Enterobacteria_phage	2.8e-36	96.1
WP_038641067.1\|3968700_3969483_-	hypothetical protein	NA	NA	NA	NA
WP_155268629.1\|3969638_3969791_-	hypothetical protein	NA	NA	NA	NA
WP_038641069.1\|3969787_3970063_-	hypothetical protein	A0A077KAZ4	Edwardsiella_phage	1.4e-34	87.1
WP_038641071.1\|3970179_3970398_-	hypothetical protein	NA	NA	NA	NA
WP_038641073.1\|3970394_3970886_-	hypothetical protein	NA	NA	NA	NA
WP_038641075.1\|3971424_3971736_-	hypothetical protein	NA	NA	NA	NA
WP_038641077.1\|3971754_3972504_-	ATP-binding protein	S4TNF5	Salmonella_phage	1.3e-122	86.7
WP_016156235.1\|3972506_3973454_-	hypothetical protein	G9L6A8	Escherichia_phage	3.8e-23	30.7
WP_038641079.1\|3973621_3974161_-	toxin YdaT domain-containing protein	K7PJT7	Enterobacteria_phage	2.0e-90	95.0
WP_038641081.1\|3974163_3974397_-	helix-turn-helix domain-containing protein	A0A0M4QX15	Salmonella_phage	1.2e-34	90.9
WP_038641083.1\|3974500_3974887_+	helix-turn-helix domain-containing protein	A0A0M4R5D1	Salmonella_phage	9.8e-55	87.3
WP_016066196.1\|3975787_3976234_+	helix-turn-helix transcriptional regulator	K7PKS0	Enterobacteria_phage	9.6e-78	100.0
WP_129694981.1\|3976281_3976632_+	hypothetical protein	K7PHF7	Enterobacteria_phage	7.0e-60	99.1
WP_032238386.1\|3976666_3976861_-	hypothetical protein	NA	NA	NA	NA
WP_016156718.1\|3977237_3977444_+	hypothetical protein	K7P6H3	Enterobacteria_phage	1.6e-32	98.5
WP_038641087.1\|3977756_3980564_+	PD-(D/E)XK nuclease-like domain-containing protein	H6WRX1	Salmonella_phage	0.0e+00	68.3
WP_038641089.1\|3980578_3981619_+	recombinase RecT	K7PKR8	Enterobacteria_phage	4.5e-155	75.9
WP_019076930.1\|3981657_3981900_+	DUF4060 family protein	K7PHF4	Enterobacteria_phage	1.9e-32	88.6
WP_016156725.1\|3981945_3982146_+	hypothetical protein	K7PM28	Enterobacteria_phage	5.5e-25	81.0
WP_038641093.1\|3982138_3983332_-\|integrase	site-specific integrase	K7PGY1	Enterobacteria_phage	6.7e-203	84.1
WP_087856120.1\|3983586_3983760_-	YciY family protein	NA	NA	NA	NA
WP_038641094.1\|3983902_3985363_+	cardiolipin synthase	NA	NA	NA	NA
WP_003020691.1\|3985397_3985727_+	YciU family protein	NA	NA	NA	NA
WP_038641095.1\|3985760_3986597_-	ion transporter	A0A1B0Y2S3	Lactobacillus_phage	2.3e-08	41.2
3986169:3986184	attR	NA	NA	NA	NA
WP_006684288.1\|3986643_3987648_-	murein tripeptide/oligopeptide ABC transporter ATP binding protein OppF	G3M9Y6	Bacillus_virus	6.8e-15	30.7
WP_038641097.1\|3987644_3988658_-	murein tripeptide/oligopeptide ABC transporter ATP binding protein OppD	G9BWD6	Planktothrix_phage	4.5e-14	29.4

DBSCAN-SWA_309

3997205 : 4007615

Pectobacterium_bacteriophage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038641106.1\|3997205_3997823_-	thymidine kinase	A0A0A0Q2F0	Pectobacterium_bacteriophage	1.9e-52	52.7
WP_003020723.1\|3998453_3998867_+	DNA-binding transcriptional regulator H-NS	NA	NA	NA	NA
WP_038641107.1\|3999005_3999914_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.8e-59	47.5
WP_038641109.1\|4000118_4001132_-	two-component system response regulator RssB	NA	NA	NA	NA
WP_038641111.1\|4001221_4002133_-	patatin-like phospholipase RssA	NA	NA	NA	NA
WP_038641113.1\|4002244_4002700_+	YchJ family protein	NA	NA	NA	NA
WP_006684274.1\|4002755_4003598_+	formyltetrahydrofolate deformylase	M4QRX9	Synechococcus_phage	9.8e-15	48.8
WP_038641116.1\|4004692_4005370_-	respiratory nitrate reductase subunit gamma	NA	NA	NA	NA
WP_008784959.1\|4005369_4006080_-	nitrate reductase molybdenum cofactor assembly chaperone	NA	NA	NA	NA
WP_038641118.1\|4006076_4007615_-	nitrate reductase subunit beta	A0A077SL61	Escherichia_phage	1.8e-19	40.5

DBSCAN-SWA_310

4019461 : 4019692

Mythimna_unipuncta_granulovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038641135.1\|4019461_4019692_-	putative cation transport regulator ChaB	A0A1S5YE01	Mythimna_unipuncta_granulovirus	2.7e-07	45.3

DBSCAN-SWA_311

4024265 : 4028273

Cafeteria_roenbergensis_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038641145.1\|4024265_4025120_-	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	2.4e-45	38.8
WP_006684256.1\|4025155_4025965_-	tetratricopeptide repeat-containing protein	NA	NA	NA	NA
WP_038641147.1\|4025968_4026361_-	SirB family protein	NA	NA	NA	NA
WP_038641149.1\|4026357_4027191_-	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_038641152.1\|4027190_4028273_-	peptide chain release factor 1	W8EDB3	Pseudomonas_phage	4.3e-07	38.8

DBSCAN-SWA_312

4031518 : 4037215

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001518537.1\|4031518_4032466_+	ribose-phosphate diphosphokinase	A0A2K9L2G2	Tupanvirus	8.6e-44	37.8
WP_071888142.1\|4032590_4034273_+	C4-dicarboxylic acid transporter DauA	A0A2H4J153	uncultured_Caudovirales_phage	6.3e-21	22.4
WP_038641161.1\|4034350_4035814_-	aspartate aminotransferase family protein	NA	NA	NA	NA
WP_038641163.1\|4035829_4037215_-	diaminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	7.4e-28	26.2

DBSCAN-SWA_313

4045272 : 4046004

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038641185.1\|4045272_4046004_+	MerR family transcriptional regulator	Q9EYF2	Enterobacteria_phage	4.2e-54	49.2

DBSCAN-SWA_314

4078668 : 4079954

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038641234.1\|4078668_4079031_+	GtrA family protein	B9UDL8	Salmonella_phage	1.1e-52	89.2
WP_038641236.1\|4079027_4079954_+	glycosyltransferase family 2 protein	B9UDL7	Salmonella_phage	5.7e-157	92.4

DBSCAN-SWA_315

4090581 : 4144031

Escherichia_phage(21.43%)

tRNA,protease,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_123261005.1\|4090581_4092267_-	long-chain-fatty-acid--CoA ligase FadD	A0A2H4PQM9	Staphylococcus_phage	2.2e-34	25.1
WP_038641259.1\|4092471_4093056_-	Slp family lipoprotein	NA	NA	NA	NA
WP_038641261.1\|4093151_4093847_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_038641263.1\|4093905_4095816_-	ATP-dependent DNA helicase	A0A127AW80	Bacillus_phage	1.6e-92	33.1
WP_038641265.1\|4095956_4096301_+	RidA family protein	NA	NA	NA	NA
WP_003020986.1\|4096307_4096487_-	YoaH family protein	NA	NA	NA	NA
WP_038641267.1\|4096570_4097932_+	aminodeoxychorismate synthase component 1	S4VNU7	Pandoravirus	4.4e-41	41.0
WP_038641269.1\|4097935_4098514_+	CoA pyrophosphatase	NA	NA	NA	NA
WP_038641271.1\|4098697_4100062_+	L-serine ammonia-lyase	NA	NA	NA	NA
WP_038641273.1\|4100192_4101794_+	EAL domain-containing protein	NA	NA	NA	NA
WP_038641275.1\|4101800_4103360_-	CNNM family cation transport protein YoaE	A0A0R6PEZ3	Moraxella_phage	5.1e-41	45.4
WP_005122176.1\|4103819_4104782_+	PTS mannose transporter subunit IIAB	NA	NA	NA	NA
WP_005122174.1\|4104840_4105641_+	PTS mannose/fructose/sorbose transporter subunit IIC	NA	NA	NA	NA
WP_006684184.1\|4105653_4106505_+	PTS mannose transporter subunit IID	NA	NA	NA	NA
WP_038641277.1\|4106565_4107024_+	DUF986 domain-containing protein	NA	NA	NA	NA
WP_038641279.1\|4107456_4108023_+	manganese efflux pump MntP	NA	NA	NA	NA
WP_038641281.1\|4108019_4108829_-	23S rRNA (guanine(745)-N(1))-methyltransferase	NA	NA	NA	NA
WP_038641283.1\|4108892_4110638_-	peptidoglycan glycosyltransferase FtsI	NA	NA	NA	NA
WP_001062678.1\|4110857_4111067_-	transcription antiterminator/RNA stability regulator CspE	A0A1W6JNX5	Morganella_phage	1.6e-22	78.1
WP_006684179.1\|4111079_4111223_-	YobF family protein	NA	NA	NA	NA
WP_038641288.1\|4111858_4112143_-	YebO family protein	NA	NA	NA	NA
WP_038641290.1\|4112217_4112361_-	PhoP/PhoQ regulator MgrB	NA	NA	NA	NA
WP_038641292.1\|4112525_4112765_+	membrane protein	NA	NA	NA	NA
WP_038641294.1\|4112879_4113671_-	DNA-binding transcriptional regulator KdgR	NA	NA	NA	NA
WP_038641296.1\|4113845_4115219_+	MFS transporter	NA	NA	NA	NA
WP_003034964.1\|4115265_4116147_-\|protease	protease HtpX	NA	NA	NA	NA
WP_038641299.1\|4116339_4118388_-	carboxy terminal-processing peptidase	A0A0R6PIZ1	Moraxella_phage	2.0e-85	33.4
WP_003833781.1\|4118407_4119094_-	RNA chaperone ProQ	NA	NA	NA	NA
WP_038641301.1\|4119190_4119688_-	GAF domain-containing protein	NA	NA	NA	NA
WP_038641303.1\|4119816_4121100_+	membrane integrity lipid transport subunit YebS	NA	NA	NA	NA
WP_038641305.1\|4121068_4123702_+	PqiB family protein	NA	NA	NA	NA
WP_071888146.1\|4123781_4125203_+	16S rRNA (cytosine(1407)-C(5))-methyltransferase RsmF	NA	NA	NA	NA
WP_003034943.1\|4125300_4125540_+	DUF1480 family protein	NA	NA	NA	NA
WP_032939629.1\|4125642_4125834_+	YebW family protein	NA	NA	NA	NA
WP_038641307.1\|4125834_4126476_-	protein-serine/threonine phosphatase	Q71TJ1	Escherichia_phage	3.3e-55	49.8
WP_038641309.1\|4126549_4127830_-	hypothetical protein	NA	NA	NA	NA
WP_080700410.1\|4128691_4129582_-	EAL domain-containing protein	NA	NA	NA	NA
WP_080700411.1\|4131327_4131441_+	DinI-like family protein	S4TND2	Salmonella_phage	3.6e-10	81.1
WP_038641313.1\|4131721_4132021_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_038641316.1\|4132711_4133323_+	hypothetical protein	NA	NA	NA	NA
WP_038641317.1\|4133376_4133664_+	hypothetical protein	NA	NA	NA	NA
WP_038641319.1\|4133951_4134683_+	HNH endonuclease	NA	NA	NA	NA
WP_038641321.1\|4135596_4136181_-	DUF4376 domain-containing protein	Q7BQC6	Enterobacteria_phage	1.8e-47	47.4
WP_071888147.1\|4136192_4138160_-\|tail	prophage tail fiber N-terminal domain-containing protein	A0A2D1UII2	Escherichia_phage	5.4e-24	57.0
WP_071888148.1\|4141730_4142351_-\|tail	tail assembly protein	A0A2R9YJH6	Escherichia_phage	2.8e-67	72.8
WP_038641323.1\|4142248_4142983_-\|tail	phage tail protein	K7PLW1	Enterobacteria_phage	1.8e-113	76.1
WP_038641325.1\|4142994_4143690_-\|tail	phage minor tail protein L	Q687F1	Enterobacteria_phage	3.5e-95	72.3
WP_038641327.1\|4143698_4144031_-\|tail	phage tail protein	A0A0P0ZDL9	Stx2-converting_phage	9.1e-41	67.9

DBSCAN-SWA_316

4147333 : 4188780

Klebsiella_phage(34.15%)

head,tail,capsid,terminase,holin,integrase,portal,transposase

attL 4159615:4159629|attR 4190131:4190145

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038643231.1\|4147333_4147564_-	hypothetical protein	Q6UAW9	Klebsiella_phage	2.9e-22	63.2
WP_038641329.1\|4147584_4147947_-\|tail	phage tail protein	Q6UAW8	Klebsiella_phage	4.8e-27	56.8
WP_038641331.1\|4148008_4148491_-\|tail	major tail shaft subunit	Q6UAX0	Klebsiella_phage	1.0e-61	80.6
WP_038641333.1\|4148524_4148926_-	HK97 gp10 family phage protein	Q6UAX1	Klebsiella_phage	1.5e-58	88.0
WP_038641335.1\|4148922_4149312_-	hypothetical protein	Q6UAX2	Klebsiella_phage	8.7e-43	64.5
WP_003832373.1\|4149280_4149631_-\|head	phage head closure protein	Q6UAX3	Klebsiella_phage	2.4e-44	75.7
WP_003832371.1\|4149627_4149945_-\|head,tail	phage gp6-like head-tail connector protein	Q6UAX4	Klebsiella_phage	2.8e-39	79.6
WP_038641337.1\|4149925_4150303_-	hypothetical protein	Q6UAX5	Klebsiella_phage	3.2e-18	59.5
WP_051594524.1\|4150360_4151677_-\|capsid	phage major capsid protein	Q6UAX6	Klebsiella_phage	1.7e-207	87.1
WP_038641339.1\|4151750_4152671_-	S49 family peptidase	Q6UAX7	Klebsiella_phage	2.1e-132	79.1
WP_038641341.1\|4152708_4153968_-\|portal	phage portal protein	Q6UAX8	Klebsiella_phage	3.2e-219	88.6
WP_038641344.1\|4154140_4155862_-\|terminase	terminase large subunit	Q7Y413	Yersinia_phage	1.2e-192	58.6
WP_038641346.1\|4155861_4156296_-\|terminase	phage terminase small subunit P27 family	A0A1J0GV10	Halomonas_phage	1.2e-29	61.1
WP_003841965.1\|4156528_4157044_+	hypothetical protein	A0A077K9U2	Edwardsiella_phage	1.4e-32	48.2
WP_003841963.1\|4157179_4157542_-	HNH endonuclease	Q6UAS2	Klebsiella_phage	1.3e-56	85.8
WP_003841960.1\|4157811_4157985_-	addiction module toxin, GnsA/GnsB family	NA	NA	NA	NA
WP_032941334.1\|4158191_4158422_-	hypothetical protein	NA	NA	NA	NA
WP_072144007.1\|4158495_4158684_-	cold-shock protein	NA	NA	NA	NA
WP_003841958.1\|4158694_4158907_-	cold shock protein CspG	A0A1W6JNX5	Morganella_phage	2.1e-22	74.3
WP_050499177.1\|4159282_4159828_-	DUF2514 domain-containing protein	A0A291LBG9	Klebsiella_phage	1.0e-12	46.2
4159615:4159629	attL	NA	NA	NA	NA
WP_038641350.1\|4159806_4160355_-	lysozyme	K7PM52	Enterobacteria_phage	1.4e-99	95.1
WP_003832349.1\|4160326_4160605_-\|holin	holin	K7P6H9	Enterobacteria_phage	3.9e-45	100.0
WP_038641352.1\|4160758_4160947_-	hypothetical protein	NA	NA	NA	NA
WP_080685918.1\|4161049_4161466_+	FlxA-like family protein	NA	NA	NA	NA
WP_038641354.1\|4162220_4162835_-	hypothetical protein	H9C175	Pectobacterium_phage	1.3e-85	76.9
WP_038641355.1\|4162848_4163889_-	DUF968 domain-containing protein	A0A291AWV9	Escherichia_phage	3.0e-98	50.9
WP_038641357.1\|4163885_4164245_-	RusA family crossover junction endodeoxyribonuclease	G8C7V6	Escherichia_phage	1.4e-42	65.3
WP_038641358.1\|4164247_4164448_-	hypothetical protein	H6WRY8	Salmonella_phage	1.2e-16	60.0
WP_071681812.1\|4164577_4164823_-	hypothetical protein	H6WRY6	Salmonella_phage	2.9e-20	63.0
WP_038641360.1\|4164868_4165102_-	DinI family protein	K7PM44	Enterobacteria_phage	3.7e-33	87.0
WP_038641362.1\|4165388_4166480_-	permease	NA	NA	NA	NA
WP_038641364.1\|4166580_4166877_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_038641366.1\|4166944_4167370_-	glutaredoxin-dependent arsenate reductase	A0A2H4J8T1	uncultured_Caudovirales_phage	4.3e-51	70.7
WP_038641369.1\|4167382_4168672_-	arsenite efflux transporter membrane subunit ArsB	A0A2H4J144	uncultured_Caudovirales_phage	9.6e-171	73.8
WP_038641371.1\|4168718_4170470_-	arsenite efflux transporter ATPase subunit ArsA	NA	NA	NA	NA
WP_038641374.1\|4170487_4170850_-	arsenite efflux transporter metallochaperone ArsD	NA	NA	NA	NA
WP_038641375.1\|4170897_4171251_-	As(III)-sensing metalloregulatory transcriptional repressor ArsR	A0A2H4J145	uncultured_Caudovirales_phage	4.8e-24	51.9
WP_127785720.1\|4171374_4171920_-	replication protein	A0A0U2JGJ0	Escherichia_phage	1.2e-66	76.8
WP_127785709.1\|4171831_4172947_-	hypothetical protein	A0A0U2RT81	Escherichia_phage	2.3e-48	54.0
WP_038643237.1\|4172995_4173550_-	hypothetical protein	NA	NA	NA	NA
WP_003832309.1\|4173553_4173766_-	helix-turn-helix transcriptional regulator	A0A077K9X2	Edwardsiella_phage	3.8e-16	59.7
WP_003832307.1\|4173871_4174252_+	helix-turn-helix domain-containing protein	K7PH71	Enterobacterial_phage	6.5e-19	66.7
WP_071681809.1\|4174627_4174942_-	hypothetical protein	NA	NA	NA	NA
WP_155268630.1\|4175081_4176229_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	9.5e-146	91.9
WP_038643238.1\|4176459_4176786_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_038641383.1\|4176927_4180185_+	PD-(D/E)XK nuclease-like domain-containing protein	K7P6V4	Enterobacteria_phage	3.9e-293	58.8
WP_038641385.1\|4180196_4181282_+	recombinase RecT	K7PKR8	Enterobacteria_phage	1.9e-124	63.6
WP_038641387.1\|4181321_4181564_+	DUF4060 family protein	K7PHF4	Enterobacteria_phage	1.5e-32	88.6
WP_071888150.1\|4181628_4181901_+	excisionase	A0A2H4J5E1	uncultured_Caudovirales_phage	2.5e-28	63.3
WP_038641389.1\|4181869_4182955_+\|integrase	phage integrase Arm DNA-binding domain-containing protein	A0A2H4IYC8	uncultured_Caudovirales_phage	3.1e-146	68.1
WP_038641391.1\|4183291_4183630_-	YebY family protein	NA	NA	NA	NA
WP_038641393.1\|4183650_4184523_-	copper homeostasis membrane protein CopD	NA	NA	NA	NA
WP_038641395.1\|4184526_4184901_-	CopC domain-containing protein YobA	NA	NA	NA	NA
WP_038641397.1\|4185044_4185275_+	DNA polymerase III subunit theta	H9C187	Pectobacterium_phage	1.3e-14	58.8
WP_038641399.1\|4185381_4186038_+	carbon-nitrogen hydrolase family protein	NA	NA	NA	NA
WP_038641401.1\|4186060_4186723_+	exodeoxyribonuclease X	Q6UAU3	Klebsiella_phage	3.5e-07	39.3
WP_129694994.1\|4186704_4188780_-	oligopeptidase B	F2Y2Z7	Organic_Lake_phycodnavirus	2.2e-31	36.3
4190131:4190145	attR	NA	NA	NA	NA

DBSCAN-SWA_317

4194487 : 4195963

Cyanophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003034896.1\|4194487_4195963_-	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	8.3e-78	37.1

DBSCAN-SWA_318

4199894 : 4206101

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_050764953.1\|4199894_4201214_-	murein DD-endopeptidase MepM	A8ATH6	Listeria_phage	1.5e-14	36.8
WP_038643243.1\|4201229_4202174_-	zinc ABC transporter substrate-binding protein ZnuA	NA	NA	NA	NA
WP_038641425.1\|4202252_4203008_+	zinc ABC transporter ATP-binding protein ZnuC	G3M9Y6	Bacillus_virus	4.2e-17	29.4
WP_038641426.1\|4203004_4203790_+	zinc ABC transporter permease subunit ZnuB	NA	NA	NA	NA
WP_005120696.1\|4203868_4204879_-	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	1.6e-08	25.4
WP_038641428.1\|4204887_4205499_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_003034867.1\|4205579_4206101_-	crossover junction endodeoxyribonuclease RuvC	G3MA90	Bacillus_virus	2.6e-10	35.1

DBSCAN-SWA_319

4209954 : 4216492

Escherichia_coli_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038641436.1\|4209954_4210773_+	DUF72 domain-containing protein	Q859D1	Escherichia_coli_phage	2.2e-56	81.1
WP_038641437.1\|4210824_4211220_+	MAPEG family protein	NA	NA	NA	NA
WP_038641439.1\|4211260_4212004_+	carboxy-S-adenosyl-L-methionine synthase CmoA	F5B419	Synechococcus_phage	2.0e-24	30.0
WP_038641441.1\|4212000_4212969_+\|tRNA	tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB	NA	NA	NA	NA
WP_038641443.1\|4213204_4213951_-	copper homeostasis protein CutC	NA	NA	NA	NA
WP_038641445.1\|4213953_4214520_-	VOC family protein	NA	NA	NA	NA
WP_038641447.1\|4214758_4216492_+\|tRNA	arginine--tRNA ligase	A0A2K9L6Z2	Tupanvirus	1.2e-86	33.9

DBSCAN-SWA_320

4231409 : 4237062

Bacillus_thuringiensis_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038641468.1\|4231409_4231799_-	chemotaxis response regulator CheY	Q56AR1	Bacillus_thuringiensis_phage	2.6e-07	32.2
WP_038641470.1\|4231817_4232867_-	chemotaxis response regulator protein-glutamate methylesterase	Q56AR1	Bacillus_thuringiensis_phage	1.8e-05	32.0
WP_038641472.1\|4232863_4233736_-	protein-glutamate O-methyltransferase CheR	NA	NA	NA	NA
WP_038641474.1\|4233755_4235357_-	methyl-accepting chemotaxis protein IV	A0A2H4J162	uncultured_Caudovirales_phage	5.6e-11	41.7
WP_038641476.1\|4235400_4237062_-	methyl-accepting chemotaxis protein II	A0A2H4J162	uncultured_Caudovirales_phage	3.4e-11	36.8

DBSCAN-SWA_321

4248860 : 4250375

Cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038641495.1\|4248860_4250375_-	arabinose ABC transporter ATP binding protein AraG	A0A285PWH2	Cedratvirus	2.8e-12	29.2

DBSCAN-SWA_322

4262028 : 4263054

Wolbachia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038641524.1\|4262028_4263054_+	patatin-like phospholipase family protein	A0A1B2LRS3	Wolbachia_phage	1.3e-42	33.7

DBSCAN-SWA_323

4270175 : 4270928

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003030477.1\|4270175_4270928_-	L-cystine ABC transporter ATP-binding protein YecC	G3M9Y6	Bacillus_virus	6.4e-26	34.4

DBSCAN-SWA_324

4283330 : 4284434

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038641565.1\|4283330_4284434_+	acyltransferase	A0A2H4JA46	uncultured_Caudovirales_phage	6.8e-24	31.2

DBSCAN-SWA_325

4300581 : 4304844

Burkholderia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038641598.1\|4300581_4301049_-	very short patch repair endonuclease	E5E3X5	Burkholderia_phage	5.7e-33	47.6
WP_038641600.1\|4301029_4302460_-	DNA cytosine methyltransferase	E5E3X6	Burkholderia_phage	3.3e-103	55.2
WP_038641602.1\|4302536_4303229_-	phosphohydrolase	S4W232	Pandoravirus	2.0e-05	27.6
WP_038641605.1\|4303668_4304844_+	porin OmpC	Q1MVN1	Enterobacteria_phage	1.2e-108	56.9

DBSCAN-SWA_326

4312759 : 4313443

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038641624.1\|4312759_4313443_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.1e-27	33.7

DBSCAN-SWA_327

4318411 : 4319227

Amsacta_moorei_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038641638.1\|4318411_4319227_-	energy-coupling factor ABC transporter ATP-binding protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	1.9e-07	24.2

DBSCAN-SWA_328

4353163 : 4355818

Stx2-converting_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038641705.1\|4353163_4354336_-	serine-type D-Ala-D-Ala carboxypeptidase DacD	B6DZZ7	Stx2-converting_phage	4.1e-197	86.7
WP_038641707.1\|4354475_4355243_-	thiosulfate reductase cytochrome B subunit	NA	NA	NA	NA
WP_038641709.1\|4355239_4355818_-	thiosulfate reductase electron transport protein PhsB	A0A077SL61	Escherichia_phage	4.8e-21	38.0

DBSCAN-SWA_329

4363774 : 4364674

Cellulophaga_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038641718.1\|4363774_4364674_+	ATP phosphoribosyltransferase	A0A0F7Q4B0	Cellulophaga_phage	4.8e-12	97.4

DBSCAN-SWA_330

4372271 : 4376106

uncultured_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038641739.1\|4372271_4373276_+	NAD-dependent epimerase	A0A218MKE7	uncultured_virus	9.5e-17	30.3
WP_038641741.1\|4373335_4374502_-	UDP-glucose 6-dehydrogenase	M1I798	Paramecium_bursaria_Chlorella_virus	3.0e-115	55.5
WP_038641743.1\|4374699_4376106_-	NADP-dependent phosphogluconate dehydrogenase	M4QQM4	Ostreococcus_lucimarinus_virus	1.8e-37	28.5

DBSCAN-SWA_331

4384036 : 4387708

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038641757.1\|4384036_4384930_-	GalU regulator GalF	A0A127AW70	Bacillus_phage	2.8e-44	40.4
WP_038641758.1\|4385169_4386165_-	SDR family oxidoreductase	A0A0K1L6Z1	Scale_drop_disease_virus	1.5e-09	28.5
WP_038641760.1\|4386313_4387708_-	colanic acid biosynthesis protein WcaM	A0A291LBB9	Klebsiella_phage	6.1e-22	35.4

DBSCAN-SWA_332

4393169 : 4399901

Bacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038641770.1\|4393169_4394540_-	colanic acid biosynthesis phosphomannomutase CpsG	A0A127AWJ1	Bacillus_phage	7.1e-31	26.9
WP_038641772.1\|4394670_4396107_-	mannose-1-phosphate guanyltransferase	A0A1V0SH58	Hokovirus	1.5e-52	31.6
WP_038641774.1\|4396106_4397333_-	colanic acid biosynthesis fucosyltransferase WcaI	NA	NA	NA	NA
WP_038641775.1\|4397329_4397809_-	GDP-mannose mannosyl hydrolase	NA	NA	NA	NA
WP_038641777.1\|4397811_4398777_-	GDP-L-fucose synthase	M1I5W5	Acanthocystis_turfacea_Chlorella_virus	5.8e-88	50.9
WP_038641779.1\|4398779_4399901_-	GDP-mannose 4,6-dehydratase	M4QRT5	Synechococcus_phage	1.2e-132	64.9

DBSCAN-SWA_333

4403647 : 4414289

Streptococcus_virus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038641791.1\|4403647_4404136_-	colanic acid biosynthesis acetyltransferase WcaB	A0A191KBJ5	Streptococcus_virus	4.6e-09	41.0
WP_038641793.1\|4404138_4404981_-	colanic acid biosynthesis glycosyltransferase WcaA	NA	NA	NA	NA
WP_038641796.1\|4405058_4407221_-	tyrosine-protein kinase Wzc	A0A1X9I5D6	Streptococcus_phage	1.9e-17	30.3
WP_038641798.1\|4407217_4407667_-	low molecular weight protein-tyrosine-phosphatase Wzb	NA	NA	NA	NA
WP_038641800.1\|4407672_4408812_-	polysaccharide export protein	NA	NA	NA	NA
WP_038641804.1\|4409467_4411051_+	TerC family protein	A0A0R6PEZ3	Moraxella_phage	8.2e-39	45.8
WP_038641805.1\|4411095_4412949_-	outer membrane assembly protein AsmA	NA	NA	NA	NA
WP_003834269.1\|4412974_4413556_-	dCTP deaminase	I4AZP2	Saccharomonospora_phage	4.2e-33	43.2
WP_003036776.1\|4413647_4414289_-	uridine kinase	A0A1V0SAA3	Catovirus	2.2e-35	38.3

DBSCAN-SWA_334

4425069 : 4433202

Bacillus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038641823.1\|4425069_4428150_+	multidrug efflux RND transporter permease subunit MdtC	S5VTK5	Leptospira_phage	3.8e-64	22.7
WP_038641826.1\|4428146_4429553_+	MFS transporter	NA	NA	NA	NA
WP_038641829.1\|4429552_4430956_+	two-component system sensor histidine kinase BaeS	W8CYF6	Bacillus_phage	1.7e-32	29.6
WP_038641831.1\|4430952_4431675_+	two-component system response regulator BaeR	W8CYM9	Bacillus_phage	9.2e-30	32.7
WP_006683890.1\|4431840_4433202_+\|tRNA	tRNA 5-hydroxyuridine modification protein YegQ	Q6DW11	Phage_TP	2.8e-205	93.4

DBSCAN-SWA_335

4437097 : 4442294

Agrobacterium_phage(25.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038641840.1\|4437097_4439374_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	4.8e-165	42.1
WP_006683877.1\|4439404_4439725_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	3.5e-13	45.7
WP_003036813.1\|4440048_4440273_+	cold shock-like protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	3.6e-17	62.7
WP_038641842.1\|4440347_4442294_-	macrolide ABC transporter ATP-binding protein/permease MacB	G9BWD6	Planktothrix_phage	3.7e-41	42.2

DBSCAN-SWA_336

4451719 : 4453438

Yellowstone_lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038641866.1\|4451719_4453438_+	ubiquinone-dependent pyruvate dehydrogenase	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	1.8e-31	24.4

DBSCAN-SWA_337

4457024 : 4460911

Roseobacter_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038641877.1\|4457024_4457855_-	N-acetylmuramoyl-L-alanine amidase	A0A1B0UZW5	Roseobacter_phage	1.8e-08	30.1
WP_001160725.1\|4457851_4458175_-	heavy metal-binding domain-containing protein	NA	NA	NA	NA
WP_071888153.1\|4458380_4458569_-	cold-shock protein	NA	NA	NA	NA
WP_038641884.1\|4458579_4458792_-	cold-shock protein	A0A1W6JNX5	Morganella_phage	1.6e-22	74.3
WP_038641886.1\|4459313_4459829_+	lipoprotein	NA	NA	NA	NA
WP_003027295.1\|4460182_4460911_+	arginine ABC transporter ATP-binding protein ArtP	G9BWD6	Planktothrix_phage	1.1e-27	36.0

DBSCAN-SWA_338

4464090 : 4468595

Catovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038641896.1\|4464090_4464990_+	lipid kinase YegS	A0A1V0SBJ0	Catovirus	1.8e-11	27.8
WP_038641899.1\|4465011_4466064_-	class I fructose-bisphosphate aldolase	NA	NA	NA	NA
WP_038641902.1\|4466316_4467594_+	MFS transporter	NA	NA	NA	NA
WP_038641905.1\|4467590_4468595_+	ADP-ribosylglycohydrolase family protein	A0A1S6UB21	Serratia_phage	6.4e-13	27.0

DBSCAN-SWA_339

4484098 : 4492518

Enterobacteria_phage(66.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038641933.1\|4484098_4486132_+\|tRNA	methionine--tRNA ligase	A0A1V0SDF2	Indivirus	1.2e-53	27.6
WP_038641935.1\|4486337_4486796_+	YehR family lipoprotein	Q9EYF5	Enterobacteria_phage	1.3e-50	68.6
WP_038643254.1\|4486840_4487311_-	DUF1456 family protein	Q9EYF4	Enterobacteria_phage	1.4e-63	77.6
WP_038641937.1\|4487357_4488077_-	two-component system response regulator BtsR	NA	NA	NA	NA
WP_038641939.1\|4488073_4489759_-	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	3.5e-282	91.8
WP_038641940.1\|4489984_4490716_+	HTH-type transcriptional regulator MlrA	Q9EYF2	Enterobacteria_phage	1.2e-104	92.0
WP_003027354.1\|4490767_4490875_+	protein YohO	NA	NA	NA	NA
WP_038641942.1\|4490855_4491587_-	ABC transporter permease	NA	NA	NA	NA
WP_038641944.1\|4491570_4492518_-	ABC transporter ATP-binding protein	F2Y1V5	Organic_Lake_phycodnavirus	1.2e-08	26.1

DBSCAN-SWA_340

4503223 : 4503958

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038641960.1\|4503223_4503958_+	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	3.0e-52	44.4

DBSCAN-SWA_341

4518371 : 4519892

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005129207.1\|4518371_4519892_-	galactose/methyl galactoside ABC transporter ATP-binding protein MglA	F2Y2R6	Organic_Lake_phycodnavirus	3.4e-10	32.8

DBSCAN-SWA_342

4523595 : 4527686

Cellulophaga_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003027410.1\|4523595_4524264_-	GTP cyclohydrolase I FolE	M1Q6X8	Cellulophaga_phage	4.1e-56	56.8
WP_038641997.1\|4524585_4525422_+	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_038641998.1\|4525700_4527686_+	ligand-gated channel protein	A0A0P0I887	Acinetobacter_phage	4.5e-10	32.6

DBSCAN-SWA_343

4532461 : 4533319

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038642007.1\|4532461_4533319_+	deoxyribonuclease IV	A0A1V0SBL9	Catovirus	9.9e-23	32.8

DBSCAN-SWA_344

4556211 : 4560515

Ostreococcus_tauri_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038642042.1\|4556211_4557678_+	mannitol dehydrogenase family protein	H8ZJP8	Ostreococcus_tauri_virus	9.9e-39	30.5
WP_038642044.1\|4557797_4558784_+	GTP-binding protein	NA	NA	NA	NA
WP_038642046.1\|4558818_4559532_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_003027474.1\|4559945_4560515_+	bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase	S5MM68	Bacillus_phage	2.3e-12	37.6

DBSCAN-SWA_345

4566279 : 4643172

Salmonella_phage(35.19%)

protease,head,tail,capsid,terminase,holin,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038642057.1\|4566279_4567869_+	microcin C ABC transporter ATP-binding protein YejF	G9BWD6	Planktothrix_phage	8.8e-17	31.5
WP_029139605.1\|4567872_4568217_-	hypothetical protein	NA	NA	NA	NA
WP_038642060.1\|4568551_4569742_-	Bcr/CflA family multidrug efflux MFS transporter	S4TR35	Salmonella_phage	1.4e-19	22.9
WP_038642062.1\|4569757_4570465_-	16S rRNA pseudouridine(516) synthase RsuA	NA	NA	NA	NA
WP_038643260.1\|4570616_4572377_+	DEAD/DEAH box helicase	M4Q3N1	Vibrio_phage	2.1e-99	41.6
WP_006683755.1\|4572501_4572786_+	50S ribosomal protein L25	NA	NA	NA	NA
WP_006683753.1\|4572904_4573912_-	nucleoid-associated protein YejK	A0A1V0E8C0	Vibrio_phage	5.0e-82	47.3
WP_003027506.1\|4574046_4574274_+	YejL family protein	NA	NA	NA	NA
WP_038642064.1\|4574305_4576066_+	DUF3413 domain-containing protein	NA	NA	NA	NA
WP_038642066.1\|4576492_4577164_+	SOS response-associated peptidase	A0A2H4J5W2	uncultured_Caudovirales_phage	4.5e-79	59.9
WP_038642069.1\|4577156_4578425_-	Y-family DNA polymerase	I6RSM4	Salmonella_phage	3.4e-205	81.5
WP_038642071.1\|4578426_4578846_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	1.8e-33	55.1
WP_038642073.1\|4578923_4579166_+	DinI family protein	Q6UAW0	Klebsiella_phage	4.4e-29	76.6
WP_038642075.1\|4579304_4580747_-	hypothetical protein	A0A1V0E5M2	Salmonella_phage	2.6e-108	48.2
WP_038642077.1\|4580756_4581701_-	hypothetical protein	H6WRW5	Salmonella_phage	1.8e-118	66.1
WP_038642079.1\|4581709_4584430_-	DUF1983 domain-containing protein	S4TTF5	Salmonella_phage	0.0e+00	96.0
WP_038642081.1\|4584429_4584828_-	hypothetical protein	S4TR39	Salmonella_phage	7.2e-69	92.4
WP_038642083.1\|4584834_4585419_-	hypothetical protein	S4TND4	Salmonella_phage	6.0e-104	96.4
WP_038642085.1\|4585418_4586012_-	hypothetical protein	S4TSP7	Salmonella_phage	1.0e-106	94.9
WP_038642087.1\|4586174_4586426_+	hypothetical protein	NA	NA	NA	NA
WP_155268631.1\|4586397_4586544_-	hypothetical protein	NA	NA	NA	NA
WP_038643263.1\|4586584_4589875_-\|tail	phage tail tape measure protein	K7PKG1	Enterobacteria_phage	0.0e+00	70.8
WP_038642089.1\|4589920_4590100_-	hypothetical protein	K7PH36	Enterobacterial_phage	6.2e-20	84.7
WP_038642091.1\|4590158_4590449_-	DUF4035 domain-containing protein	S4TND7	Salmonella_phage	1.8e-40	89.6
WP_038642092.1\|4590460_4590832_-\|tail	phage tail protein	S4TSQ0	Salmonella_phage	7.2e-55	86.0
WP_038642094.1\|4590859_4591564_-\|tail	tail protein	K7PHL2	Enterobacterial_phage	5.7e-93	74.4
WP_038642096.1\|4591621_4591969_-	DUF3168 domain-containing protein	A0A220NRP0	Escherichia_phage	3.4e-46	77.4
WP_038642098.1\|4591965_4592415_-	HK97 gp10 family phage protein	S4TR46	Salmonella_phage	6.5e-66	85.9
WP_038642100.1\|4592411_4592750_-\|head	phage head closure protein	A0A2H4JHK5	uncultured_Caudovirales_phage	2.3e-39	69.6
WP_038642103.1\|4592759_4593080_-\|head,tail	phage gp6-like head-tail connector protein	A0A1W6JNZ5	Morganella_phage	2.8e-23	53.9
WP_038642105.1\|4593158_4594376_-\|capsid	phage major capsid protein	A0A1W6JP20	Morganella_phage	5.9e-170	75.3
WP_038642107.1\|4594385_4594985_-\|head,protease	HK97 family phage prohead protease	Q8SBH9	Shigella_phage	2.9e-90	82.5
WP_038642109.1\|4594977_4596204_-\|portal	phage portal protein	Q8SBI0	Shigella_phage	9.0e-211	86.5
WP_038642113.1\|4596351_4598109_-\|terminase	terminase large subunit	A0A1B5FP96	Escherichia_phage	0.0e+00	90.5
WP_003841734.1\|4598108_4598606_-\|terminase	phage terminase small subunit P27 family	K7PHI2	Enterobacteria_phage	9.7e-63	73.9
WP_038642116.1\|4598762_4599113_-	HNH endonuclease	A0A1B5FP94	Escherichia_phage	3.9e-50	79.1
WP_038642119.1\|4599100_4599316_-	hypothetical protein	NA	NA	NA	NA
WP_051594528.1\|4599492_4600038_+	hypothetical protein	NA	NA	NA	NA
WP_038642123.1\|4600260_4600530_-	hypothetical protein	G8C7W1	Escherichia_phage	1.5e-22	72.4
WP_038642125.1\|4600537_4601155_-	glycoside hydrolase family 19 protein	Q8HA86	Salmonella_phage	2.2e-80	71.2
WP_038642127.1\|4601154_4601436_-\|holin	phage holin family protein	K7PKN9	Enterobacterial_phage	6.5e-40	89.2
WP_008323296.1\|4601422_4601818_-\|holin	phage holin family protein	K7PHB9	Enterobacterial_phage	2.6e-50	81.7
WP_038642131.1\|4601907_4602504_-	hypothetical protein	NA	NA	NA	NA
WP_038642133.1\|4602609_4603188_-	DUF1133 family protein	A0A0U2S606	Escherichia_phage	2.1e-45	53.9
WP_038642135.1\|4603202_4604192_-	DUF968 domain-containing protein	A0A291AWV9	Escherichia_phage	7.7e-144	71.7
WP_001704138.1\|4604188_4604872_-	phage regulatory protein/antirepressor Ant	G0ZND1	Cronobacter_phage	3.0e-62	60.0
WP_003034741.1\|4604885_4605272_-	RusA family crossover junction endodeoxyribonuclease	A0A192Y8N5	Salmonella_phage	4.1e-61	89.1
WP_038642139.1\|4605268_4606147_-	phage N-6-adenine-methyltransferase	Q8HA94	Salmonella_phage	1.1e-130	75.6
WP_038642141.1\|4606143_4607001_-	conserved phage C-terminal domain-containing protein	A0A1C9IHW0	Salmonella_phage	9.8e-63	95.1
WP_003034732.1\|4606990_4607170_-	DUF4222 domain-containing protein	S5M7S5	Escherichia_phage	3.0e-14	73.1
WP_038642145.1\|4607342_4607894_-	hypothetical protein	A0A1C9II13	Salmonella_phage	1.0e-65	67.8
WP_003826141.1\|4607904_4608132_-	cell division protein	NA	NA	NA	NA
WP_003826139.1\|4608234_4608861_+	LexA family transcriptional regulator	K7PM82	Enterobacteria_phage	4.2e-47	49.3
WP_038642148.1\|4609454_4609826_+	hypothetical protein	Q8HAA1	Salmonella_phage	7.2e-55	87.0
WP_038642150.1\|4609882_4610710_+	DUF2303 family protein	Q8HAA2	Salmonella_phage	5.6e-148	96.0
WP_038642152.1\|4610838_4611378_+	hypothetical protein	A0A192Y8M4	Salmonella_phage	5.2e-78	79.3
WP_038642154.1\|4611538_4611793_+	hypothetical protein	NA	NA	NA	NA
WP_038642156.1\|4611789_4612134_+	hypothetical protein	NA	NA	NA	NA
WP_038642158.1\|4612126_4612570_+	hypothetical protein	A0A088CE95	Shigella_phage	1.9e-14	41.6
WP_038642160.1\|4612571_4613135_+	3'-5' exoribonuclease	K7PLW7	Enterobacteria_phage	1.2e-88	80.4
WP_001096408.1\|4613185_4613395_+	hypothetical protein	NA	NA	NA	NA
WP_038642163.1\|4613397_4614579_+	recombinase	A0A2H4J1K3	uncultured_Caudovirales_phage	1.0e-30	30.0
WP_051594529.1\|4614705_4615770_-	RelA/SpoT domain-containing protein	NA	NA	NA	NA
WP_071888156.1\|4616484_4616718_-	hypothetical protein	NA	NA	NA	NA
WP_051594530.1\|4616868_4617429_+	hypothetical protein	NA	NA	NA	NA
WP_071888157.1\|4617425_4617770_+	hypothetical protein	NA	NA	NA	NA
WP_038642167.1\|4617772_4618270_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_038642169.1\|4618764_4619412_+	nitrate/nitrite response regulator protein NarP	NA	NA	NA	NA
WP_038642171.1\|4619513_4620563_-	cytochrome c-type biogenesis protein CcmH	NA	NA	NA	NA
WP_003834613.1\|4620559_4621117_-	thiol:disulfide interchange protein DsbE	NA	NA	NA	NA
WP_038642174.1\|4621113_4623069_-	heme lyase CcmF/NrfE family subunit	NA	NA	NA	NA
WP_038642175.1\|4623065_4623545_-	cytochrome c maturation protein CcmE	NA	NA	NA	NA
WP_005129320.1\|4623541_4623754_-	heme exporter protein CcmD	NA	NA	NA	NA
WP_038642178.1\|4623750_4624488_-	heme ABC transporter permease	NA	NA	NA	NA
WP_038642180.1\|4624563_4625223_-	heme exporter protein CcmB	NA	NA	NA	NA
WP_038642182.1\|4625219_4625840_-	cytochrome c biogenesis heme-transporting ATPase CcmA	G3M9Y6	Bacillus_virus	1.8e-10	23.9
WP_003027548.1\|4625860_4626463_-	cytochrome c-type protein NapC	NA	NA	NA	NA
WP_038642185.1\|4626472_4626922_-	nitrate reductase cytochrome c-type subunit	NA	NA	NA	NA
WP_038642187.1\|4626918_4627782_-	quinol dehydrogenase ferredoxin subunit NapH	NA	NA	NA	NA
WP_038642189.1\|4627768_4628464_-	ferredoxin-type protein NapG	NA	NA	NA	NA
WP_038642191.1\|4628470_4630957_-	nitrate reductase catalytic subunit NapA	NA	NA	NA	NA
WP_038642193.1\|4630953_4631217_-	chaperone NapD	NA	NA	NA	NA
WP_038642195.1\|4631206_4631698_-	ferredoxin-type protein NapF	NA	NA	NA	NA
WP_038643271.1\|4632111_4632609_+\|protease	serine protease inhibitor ecotin	NA	NA	NA	NA
WP_038642197.1\|4632702_4634364_-	malate dehydrogenase (quinone)	NA	NA	NA	NA
WP_038642199.1\|4634641_4635886_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	8.3e-79	49.0
WP_038642202.1\|4635848_4637285_-	magnesium transporter	NA	NA	NA	NA
WP_038642204.1\|4637390_4639034_-	multidrug ABC transporter permease/ATP-binding protein	W8CYL7	Bacillus_phage	1.3e-10	23.6
WP_038642206.1\|4639109_4639760_-	DNA oxidative demethylase AlkB	A0A2K9L3R7	Tupanvirus	2.9e-06	34.3
WP_038642208.1\|4639759_4640824_-	bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada	A0A0G2Y1B6	Acanthamoeba_polyphaga_mimivirus	7.0e-18	52.2
WP_038642210.1\|4640903_4641956_-	FAD:protein FMN transferase ApbE	NA	NA	NA	NA
WP_038642212.1\|4642071_4643172_-	porin OmpC	Q1MVN1	Enterobacteria_phage	1.7e-115	59.7

DBSCAN-SWA_346

4647337 : 4653573

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038642216.1\|4647337_4650184_-	two-component system sensor histidine kinase RcsC	A0A1V0SGX0	Hokovirus	9.2e-41	25.2
WP_038643273.1\|4650352_4652191_+	two-component system sensor histidine kinase AtoS	NA	NA	NA	NA
WP_038642218.1\|4652187_4653573_+	acetoacetate metabolism transcriptional regulator AtoC	B5LWN0	Feldmannia_species_virus	6.8e-05	32.3

DBSCAN-SWA_347

4657660 : 4668748

Pseudomonas_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038642228.1\|4657660_4660297_-	DNA topoisomerase (ATP-hydrolyzing) subunit A	G3M9Z5	Bacillus_virus	1.8e-91	30.7
WP_038642230.1\|4660455_4661184_+	bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG	NA	NA	NA	NA
WP_038642232.1\|4661604_4663890_+	ribonucleoside-diphosphate reductase subunit alpha	I3UMG3	Colwellia_phage	2.5e-286	64.4
WP_038642234.1\|4664001_4665132_+	ribonucleotide-diphosphate reductase subunit beta	G9IAA3	Pseudomonas_phage	2.1e-174	78.9
WP_038642236.1\|4665131_4665386_+	ferredoxin-like diferric-tyrosyl radical cofactor maintenance protein YfaE	G9IAA2	Pseudomonas_phage	2.4e-25	76.1
WP_038642238.1\|4665389_4666580_-	MFS transporter	NA	NA	NA	NA
WP_038642240.1\|4666741_4667620_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_038642242.1\|4667680_4668748_-	glycerophosphodiester phosphodiesterase	A0A220BYK6	Staphylococcus_phage	2.3e-08	50.9

DBSCAN-SWA_348

4678447 : 4682552

Tupanvirus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038642258.1\|4678447_4679587_+	UDP-4-amino-4-deoxy-L-arabinose aminotransferase	A0A2K9L470	Tupanvirus	3.6e-28	28.2
WP_038642260.1\|4679589_4680573_+	undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	A8CG95	Salmonella_phage	1.7e-34	32.5
WP_038642262.1\|4680569_4682552_+	bifunctional UDP-4-amino-4-deoxy-L-arabinose formyltransferase/UDP-glucuronic acid oxidase ArnA	A0A2K9KZK0	Tupanvirus	6.3e-20	25.6

DBSCAN-SWA_349

4695221 : 4696226

Bacillus_thuringiensis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038642291.1\|4695221_4696226_+	chemotaxis protein CheV	Q56AR1	Bacillus_thuringiensis_phage	5.4e-28	26.1

DBSCAN-SWA_350

4716833 : 4717433

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038642306.1\|4716833_4717433_+	5'-deoxynucleotidase	A0A2L0V156	Salmonella_phage	5.3e-07	38.6

DBSCAN-SWA_351

4731219 : 4731993

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038642330.1\|4731219_4731993_-	histidine ABC transporter ATP-binding protein HisP	M1I0T9	Acanthocystis_turfacea_Chlorella_virus	1.1e-07	27.7

DBSCAN-SWA_352

4736348 : 4737866

Mollivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005129677.1\|4736348_4737866_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.1e-88	44.0

DBSCAN-SWA_353

4744426 : 4745563

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038642351.1\|4744426_4745563_-	4-phosphoerythronate dehydrogenase PdxB	A0A2R8FDS8	Brazilian_cedratvirus	1.0e-19	26.9

DBSCAN-SWA_354

4754710 : 4755796

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038642369.1\|4754710_4755796_-	chorismate synthase	A0A291AU41	Pandoravirus	7.7e-89	47.3

DBSCAN-SWA_355

4764941 : 4765874

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_110498802.1\|4764941_4765874_+	formate/nitrite transporter family protein	E7DYY8	Enterobacteria_phage	4.8e-148	91.8

DBSCAN-SWA_356

4772786 : 4774685

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038642405.1\|4772786_4774685_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.4e-13	26.2

DBSCAN-SWA_357

4782744 : 4783665

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038642416.1\|4782744_4783665_+	kdo(2)-lipid IV(A) palmitoleoyltransferase	A0A1W6JP29	Morganella_phage	3.5e-74	53.1

DBSCAN-SWA_358

4788139 : 4788874

Clostridioides_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038642424.1\|4788139_4788874_+	two-component system response regulator YpdB	A0A2R2ZGH8	Clostridioides_phage	1.6e-13	25.8

DBSCAN-SWA_359

4812904 : 4822777

Lactobacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038642466.1\|4812904_4813831_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.8e-07	25.2
WP_038642468.1\|4813920_4814919_+	bile acid:sodium symporter	NA	NA	NA	NA
WP_032944144.1\|4814915_4815134_-	DUF3820 family protein	NA	NA	NA	NA
WP_038642470.1\|4815135_4817151_-	NAD-dependent DNA ligase LigA	A0A0K2QQN8	Ralstonia_phage	1.7e-150	43.7
WP_038642472.1\|4817222_4818236_-	cell division protein ZipA	NA	NA	NA	NA
WP_069324501.1\|4818466_4819228_+	sulfate transporter CysZ	NA	NA	NA	NA
WP_038642476.1\|4819391_4820363_+	cysteine synthase A	A0A1X9I5F1	Streptococcus_phage	3.3e-75	51.0
WP_002913505.1\|4820746_4821004_+	phosphocarrier protein Hpr	NA	NA	NA	NA
WP_003038080.1\|4821049_4822777_+	phosphoenolpyruvate-protein phosphotransferase PtsI	A0A1V0SGR7	Hokovirus	7.4e-17	31.1

DBSCAN-SWA_360

4826678 : 4834675

Streptococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038642491.1\|4826678_4827590_-	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	7.7e-58	41.8
WP_038642493.1\|4827657_4828755_-	sulfate/thiosulfate ABC transporter ATP-binding protein CysA	G9BWD6	Planktothrix_phage	6.3e-30	38.9
WP_038642495.1\|4828744_4829620_-	sulfate/thiosulfate ABC transporter permease CysW	NA	NA	NA	NA
WP_038642497.1\|4829619_4830453_-	sulfate/thiosulfate ABC transporter permease CysT	NA	NA	NA	NA
WP_038642500.1\|4830453_4831470_-	sulfate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_038642502.1\|4831627_4832419_-	SDR family oxidoreductase UcpA	Q06VL0	Trichoplusia_ni_ascovirus	8.9e-18	30.6
WP_071888161.1\|4832536_4834675_-	peptidase domain-containing ABC transporter	F2Y2R6	Organic_Lake_phycodnavirus	3.1e-17	26.6

DBSCAN-SWA_361

4856992 : 4860563

Pandoravirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038642506.1\|4856992_4857892_-	porphyrinogen peroxidase	S4VVJ7	Pandoravirus	1.5e-24	32.4
WP_038642508.1\|4857985_4858561_-	RpoE-regulated lipoprotein	NA	NA	NA	NA
WP_038642510.1\|4858620_4859070_-	DUF2919 domain-containing protein	NA	NA	NA	NA
WP_006683546.1\|4859056_4859482_-	GNAT family acetyltransferase	NA	NA	NA	NA
WP_038642512.1\|4859693_4860563_+	N-acetylmuramoyl-L-alanine amidase AmiA	A0A0N9SGH1	Paenibacillus_phage	1.5e-18	33.3

DBSCAN-SWA_362

4896303 : 4897017

Cyanophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038642562.1\|4896303_4897017_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A127KMU1	Cyanophage	2.0e-37	35.7

DBSCAN-SWA_363

4906837 : 4912435

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038642578.1\|4906837_4908127_-	uracil permease	Q9KX94	Enterobacteria_phage	1.5e-62	36.2
WP_038642580.1\|4908223_4908850_-	uracil phosphoribosyltransferase	NA	NA	NA	NA
WP_038642582.1\|4909033_4910464_-	6-phospho-beta-glucosidase	NA	NA	NA	NA
WP_038642584.1\|4910759_4911797_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SE90	Cyanophage	8.2e-72	42.4
WP_038642586.1\|4911793_4912435_+	phosphoribosylglycinamide formyltransferase	E3SNR5	Prochlorococcus_phage	3.4e-28	40.0

DBSCAN-SWA_364

4918824 : 4919028

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071888163.1\|4918824_4919028_+	DUF2633 family protein	G9L6F2	Escherichia_phage	2.9e-18	74.6

DBSCAN-SWA_365

4923880 : 4928774

Klosneuvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038642597.1\|4923880_4925347_-	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	1.7e-86	38.3
WP_038642599.1\|4925507_4926881_+	exodeoxyribonuclease VII large subunit	A0A2H4UVM9	Bodo_saltans_virus	3.4e-41	34.9
WP_038642601.1\|4926877_4927093_-	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_038642603.1\|4927232_4928774_-	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	2.4e-160	57.2

DBSCAN-SWA_366

4937717 : 4938149

Powai_lake_megavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003037710.1\|4937717_4938149_-	nucleoside-diphosphate kinase	A0A167REB2	Powai_lake_megavirus	5.3e-17	37.1

DBSCAN-SWA_367

4947955 : 4954277

Mycoplasma_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038642620.1\|4947955_4949239_-	aminopeptidase PepB	Q6GYZ8	Mycoplasma_phage	4.5e-35	36.0
WP_038642622.1\|4949300_4949501_-	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_003037690.1\|4949512_4949848_-	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_038642624.1\|4949849_4951700_-	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	6.5e-104	42.1
WP_038642626.1\|4951715_4952231_-	co-chaperone HscB	NA	NA	NA	NA
WP_038642628.1\|4952305_4952629_-	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	7.0e-22	47.7
WP_002913991.1\|4952649_4953036_-	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	2.7e-52	77.3
WP_038642631.1\|4953062_4954277_-	cysteine desulfurase	A0A1X7C038	Faustovirus	1.6e-34	32.6

DBSCAN-SWA_368

4959926 : 4961435

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038642640.1\|4959926_4961435_+	sugar ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-15	27.9

DBSCAN-SWA_369

4981020 : 4992309

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032939458.1\|4981020_4982274_-	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	3.0e-100	53.4
WP_038642674.1\|4982600_4983791_+	NO-inducible flavohemoprotein	NA	NA	NA	NA
WP_000717694.1\|4983892_4984231_-	nitrogen regulatory protein P-II	NA	NA	NA	NA
WP_038642678.1\|4984291_4985629_-	two-component system response regulator GlrR	W8CYM9	Bacillus_phage	1.4e-10	34.1
WP_038642680.1\|4985625_4986369_-	two-component system QseEF-associated lipoprotein QseG	NA	NA	NA	NA
WP_123261017.1\|4986391_4987822_-	two component system sensor histidine kinase QseE/GlrK	W8CYF6	Bacillus_phage	1.8e-13	26.1
WP_038642684.1\|4988421_4992309_-	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	1.5e-129	58.9

DBSCAN-SWA_370

4998640 : 5005402

uncultured_Mediterranean_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038642696.1\|4998640_4998901_+	YfhL family 4Fe-4S dicluster ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	1.1e-17	52.3
WP_038642698.1\|4998897_4999278_-	holo-ACP synthase	NA	NA	NA	NA
WP_003838383.1\|4999277_5000009_-	pyridoxine 5'-phosphate synthase	NA	NA	NA	NA
WP_038642700.1\|5000020_5000749_-	DNA repair protein RecO	NA	NA	NA	NA
WP_038642702.1\|5000760_5001666_-	GTPase Era	NA	NA	NA	NA
WP_003037579.1\|5001662_5002343_-	ribonuclease III	A0A2K9L5P0	Tupanvirus	1.6e-20	31.8
WP_038642704.1\|5002612_5003587_-	signal peptidase I	NA	NA	NA	NA
WP_038642706.1\|5003602_5005402_-	elongation factor 4	E4ZFJ7	Streptococcus_phage	1.4e-23	25.1

DBSCAN-SWA_371

5010379 : 5098662

Salmonella_phage(68.29%)

tRNA,lysis,plate,head,tail,capsid,terminase,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038642716.1\|5010379_5011117_-\|tRNA	tRNA(1)(Val) (adenine(37)-N(6))-methyltransferase TrmN	NA	NA	NA	NA
WP_038642718.1\|5011249_5012578_+	ATP-dependent RNA helicase SrmB	E3T5E1	Cafeteria_roenbergensis_virus	3.9e-42	29.6
WP_114140338.1\|5012596_5013493_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_038642722.1\|5013595_5014183_+	cysteine/O-acetylserine transporter	NA	NA	NA	NA
WP_005121223.1\|5014261_5014645_-	autonomous glycyl radical cofactor GrcA	A0A1W5N098	Cronobacter_phage	3.6e-33	70.9
WP_038642724.1\|5014962_5015652_+	uracil-DNA glycosylase	A0A077BCN4	Equid_alphaherpesvirus	2.1e-55	52.1
WP_038642726.1\|5015685_5016765_-\|tRNA	tRNA/rRNA methyltransferase	NA	NA	NA	NA
WP_003037559.1\|5016972_5017392_+	thioredoxin TrxC	A0A0K2FIM3	Achromobacter_phage	8.3e-15	36.5
WP_038642728.1\|5017461_5018160_+	DTW domain-containing protein	NA	NA	NA	NA
WP_038642730.1\|5018196_5020857_+	protein lysine acetyltransferase	NA	NA	NA	NA
WP_038642732.1\|5020971_5022327_+	CDP-diacylglycerol--serine O-phosphatidyltransferase	NA	NA	NA	NA
WP_038643310.1\|5022370_5022694_+	YfiM family lipoprotein	NA	NA	NA	NA
WP_038642734.1\|5022690_5023989_-	MFS transporter	Q6JIH2	Burkholderia_virus	6.9e-44	31.6
WP_038642736.1\|5029684_5032258_-	ATP-dependent chaperone ClpB	H6X3M6	Enterobacteria_phage	9.0e-128	35.3
WP_038642738.1\|5032387_5033119_-	polyphenol oxidase	NA	NA	NA	NA
WP_038642740.1\|5033115_5034096_-	23S rRNA pseudouridine(1911/1915/1917) synthase RluD	NA	NA	NA	NA
WP_005130417.1\|5034227_5034965_+	outer membrane protein assembly factor BamD	NA	NA	NA	NA
WP_003031244.1\|5035235_5035574_+	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
WP_100250063.1\|5035677_5035725_+	pheA operon leader peptide PheL	NA	NA	NA	NA
WP_038642743.1\|5035824_5036985_+	bifunctional chorismate mutase/prephenate dehydratase	NA	NA	NA	NA
WP_038642745.1\|5037027_5038149_-	bifunctional chorismate mutase/prephenate dehydrogenase	NA	NA	NA	NA
WP_038642747.1\|5038159_5039230_-	3-deoxy-7-phosphoheptulonate synthase AroF	A0A0F6R6T6	Escherichia_coli_O157_typing_phage	9.0e-90	51.4
WP_038642749.1\|5039445_5039820_+	DUF2799 domain-containing protein	NA	NA	NA	NA
WP_038642751.1\|5039978_5040497_+	YfiR family protein	NA	NA	NA	NA
WP_038642753.1\|5040489_5041713_+	diguanylate cyclase DgcN	A0A2K8I9Y5	Pseudomonas_phage	2.2e-07	38.7
WP_038642755.1\|5041725_5042208_+	OmpA family protein	NA	NA	NA	NA
WP_006687325.1\|5042347_5042695_-	50S ribosomal protein L19	NA	NA	NA	NA
WP_003031232.1\|5042734_5043502_-\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_003031230.1\|5043546_5044095_-	ribosome maturation factor RimM	NA	NA	NA	NA
WP_003031228.1\|5044113_5044362_-	30S ribosomal protein S16	NA	NA	NA	NA
WP_006687321.1\|5044613_5045975_-	signal recognition particle protein	NA	NA	NA	NA
WP_038643312.1\|5046141_5046933_+	inner membrane protein YpjD	NA	NA	NA	NA
WP_038642758.1\|5046951_5048241_+	HlyC/CorC family transporter	NA	NA	NA	NA
WP_038642760.1\|5048290_5048884_-	nucleotide exchange factor GrpE	NA	NA	NA	NA
WP_038642764.1\|5049006_5049885_+	NAD(+) kinase	NA	NA	NA	NA
WP_038642766.1\|5049970_5051632_+	DNA repair protein RecN	NA	NA	NA	NA
WP_003826401.1\|5051781_5052126_+	outer membrane protein assembly factor BamE	NA	NA	NA	NA
WP_038642768.1\|5052176_5052473_-	RnfH family protein	NA	NA	NA	NA
WP_071888166.1\|5052456_5052912_-	type II toxin-antitoxin system toxin RatA	NA	NA	NA	NA
WP_038643314.1\|5053054_5053537_+	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	2.6e-28	46.8
WP_038642772.1\|5054104_5065348_+	BapA prefix-like domain-containing protein	NA	NA	NA	NA
WP_038642774.1\|5065419_5066829_+	TolC family outer membrane protein	NA	NA	NA	NA
WP_038642776.1\|5066825_5069012_+	type I secretion system permease/ATPase	F2Y302	Organic_Lake_phycodnavirus	9.3e-17	30.7
WP_129694947.1\|5069019_5070183_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_000391794.1\|5070742_5071225_+	hypothetical protein	Q19UP0	Mannheimia_phage	1.6e-17	34.3
WP_000980501.1\|5071251_5071470_-	ogr/Delta-like zinc finger family protein	Q53ZE7	Salmonella_virus	7.5e-28	77.8
WP_001011796.1\|5071538_5072639_-	phage late control D family protein	A0A1S6KZZ5	Salmonella_phage	3.4e-177	88.5
WP_000980413.1\|5072635_5073121_-\|tail	phage tail protein	E5G6Q2	Salmonella_phage	6.3e-67	80.6
WP_038642785.1\|5073117_5076195_-\|tail	phage tail tape measure protein	E5G6Q1	Salmonella_phage	0.0e+00	63.1
WP_000763311.1\|5076187_5076307_-\|tail	GpE family phage tail protein	E5G6Q0	Salmonella_phage	2.8e-13	87.2
WP_001281010.1\|5076321_5076624_-\|tail	phage tail assembly protein	A0A1S6KZZ9	Salmonella_phage	1.7e-38	88.0
WP_001207660.1\|5076678_5077194_-\|tail	phage major tail tube protein	A0A1S6L002	Salmonella_phage	2.1e-89	95.3
WP_000046120.1\|5077203_5078376_-\|tail	phage tail sheath protein	A0A1S6KZY7	Salmonella_phage	2.1e-204	90.3
WP_000905010.1\|5078518_5079085_-	recombinase family protein	A0A0F7LA37	Escherichia_phage	3.8e-87	86.8
WP_080700418.1\|5079543_5080020_+\|tail	tail fiber assembly protein	A0A0M4S6V4	Salmonella_phage	1.8e-26	78.9
WP_038642791.1\|5080244_5080526_-	hypothetical protein	NA	NA	NA	NA
WP_001086836.1\|5081982_5082588_-\|tail	phage tail protein I	A0A1S6L000	Salmonella_phage	1.5e-110	92.5
WP_000268280.1\|5082580_5083489_-\|plate	baseplate assembly protein	A0A1S6KZY6	Salmonella_phage	7.8e-143	90.4
WP_000177590.1\|5083475_5083835_-	GPW/gp25 family protein	A0A1S6KZZ4	Salmonella_phage	9.5e-52	86.6
WP_000993775.1\|5083831_5084410_-\|plate	phage baseplate assembly protein V	A0A1S6KZX7	Salmonella_phage	4.2e-94	87.0
WP_000829141.1\|5084478_5084925_-	phage virion morphogenesis protein	A0A1S6L001	Salmonella_phage	1.5e-62	84.9
WP_001039935.1\|5084917_5085349_-\|tail	phage tail protein	E5G6N3	Salmonella_phage	6.4e-71	92.3
WP_038642802.1\|5085444_5085873_-\|lysis	LysB family phage lysis regulatory protein	E5G6N2	Salmonella_phage	2.4e-46	75.9
WP_000727855.1\|5085869_5086247_-	hypothetical protein	A0A1S6KZZ2	Salmonella_phage	6.7e-16	40.0
WP_001341072.1\|5086248_5086722_-	lysozyme	E5G6N1	Salmonella_phage	3.7e-80	91.0
WP_000171568.1\|5086741_5086957_-	hypothetical protein	E5G6N0	Salmonella_phage	1.8e-26	80.3
WP_038642808.1\|5086960_5087164_-\|tail	tail protein X	E5G6M9	Salmonella_phage	2.3e-31	91.0
WP_000673530.1\|5087163_5087628_-\|head	head completion/stabilization protein	A0A1S6KZW8	Salmonella_phage	1.9e-76	89.0
WP_038642812.1\|5087723_5088374_-\|terminase	terminase endonuclease subunit	E5G6M7	Salmonella_phage	4.3e-111	95.8
WP_000742498.1\|5088377_5089436_-\|capsid	phage major capsid protein, P2 family	E5G6M6	Salmonella_phage	2.9e-181	93.4
WP_000216903.1\|5089452_5090286_-\|capsid	GPO family capsid scaffolding protein	A0A1S6KZW9	Salmonella_phage	2.4e-122	90.6
WP_001098422.1\|5090428_5092195_+\|terminase	terminase ATPase subunit family protein	A0A1S6KZW3	Salmonella_phage	0.0e+00	99.5
WP_038642819.1\|5092194_5093229_+\|portal	phage portal protein	A0A1S6KZW5	Salmonella_phage	2.0e-171	87.3
WP_001513676.1\|5093265_5094300_-	DUF4062 domain-containing protein	NA	NA	NA	NA
WP_038642823.1\|5094512_5095295_-	hypothetical protein	NA	NA	NA	NA
WP_001292590.1\|5095298_5095499_-	hypothetical protein	NA	NA	NA	NA
WP_001397660.1\|5095718_5095952_-	DinI family protein	A0A1S6L014	Salmonella_phage	2.0e-31	89.6
WP_001154444.1\|5095963_5096152_-	hypothetical protein	A0A1S6L006	Salmonella_phage	2.7e-26	100.0
WP_038642826.1\|5096310_5098662_-	replication endonuclease	E5G6L9	Salmonella_phage	0.0e+00	91.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP007558

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP007557

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection