CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_022873	Bacillus thuringiensis YBT-1518, complete sequence	10 crisprs	RT,cas3,csa3,WYL,DinG,DEDDh,c2c9_V-U4,cas14j	5	30	16	1
NC_022876	Bacillus thuringiensis YBT-1518 plasmid pBMB0231, complete sequence	0 crisprs	Cas14u_CAS-V,cas14j	0	0	7	0
NC_022875	Bacillus thuringiensis YBT-1518 plasmid pBMB0230, complete sequence	0 crisprs	RT,csa3	0	0	5	0
NC_022874	Bacillus thuringiensis YBT-1518 plasmid pBMB0229, complete sequence	0 crisprs	csa3	0	0	1	0
NC_022877	Bacillus thuringiensis YBT-1518 plasmid pBMB0232, complete sequence	0 crisprs	csa3,RT	0	0	1	0
NC_020124	Bacillus thuringiensis YBT-1518 plasmid pBMB0228, complete sequence	0 crisprs	NA	0	0	0	0
NC_022882	Bacillus thuringiensis YBT-1518 plasmid pBMB0233, complete sequence	1 crisprs	cas14j,RT,Cas14u_CAS-V	4	4	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_022873_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_022873_1

1339998-1340113

Orphan

Consensus_repeat	Method
GGTTTAAATACGTTAAATAGCAAAACAGGTGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_022873_1

>merge|NC_022873|1|1339998-1340113|CRISPRCasFinder
GGTTTAAATACGTTAAATAGCAAAACAGGTGAGATGCAGACGGGTATAGGGAAATTGCAAGATGGCTCCGGAAAAGTAACAGGCGGTTTAAATACGTTAAATAGCAAAACGGGTGA

>NC_022873|1|1|1339998-1340113|CRISPRCasFinder
GGTTTAAATACGTTAAATAGCAAAACAGGTGA	GATGCAGACGGGTATAGGGAAATTGCAAGATGGCTCCGGAAAAGTAACAGGC
GGTTTAAATACGTTAAATAGCAAAACGGGTGA

Protein	Signature genes	Signature genes Name	Protein_function
NC_022873.1\|WP_023521392.1\|1345138_1345873_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293802
NC_022873.1\|WP_000567010.1\|1344806_1344935_-\|YhfH-family-protein	unknown	unknown	gnl\|CDD\|379490
NC_022873.1\|WP_023521393.1\|1345882_1346872_+\|lipoate--protein-ligase	unknown	unknown	gnl\|CDD\|161920
NC_022873.1\|WP_023521391.1\|1343049_1343559_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NC_022873.1\|WP_003269765.1\|1349301_1349478_+\|hypothetical-protein	unknown	unknown	unknown
NC_022873.1\|WP_000726775.1\|1326050_1326986_+\|ferrochelatase	unknown	unknown	gnl\|CDD\|183526
NC_022873.1\|WP_023521388.1\|1332930_1333776_-\|hypothetical-protein	unknown	unknown	unknown
NC_022873.1\|WP_001068221.1\|1342562_1342916_-\|PH-domain-containing-protein	unknown	unknown	gnl\|CDD\|379617
NC_022873.1\|WP_000103709.1\|1343753_1344767_+\|LacI-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224525
NC_022873.1\|WP_023521394.1\|1347601_1349134_+\|fatty-acid--CoA-ligase-family-protein	unknown	unknown	gnl\|CDD\|236072
NC_022873.1\|WP_023521387.1\|1332576_1332876_+\|hypothetical-protein	unknown	unknown	unknown
NC_022873.1\|WP_023521386.1\|1330077_1332444_+\|chitobiase/beta-hexosaminidase-C-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|225249
NC_022873.1\|WP_000184503.1\|1334005_1334407_+\|BlaI/MecI/CopY-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|367747
NC_022873.1\|WP_023520826.1\|1337710_1338985_+\|group-II-intron-reverse-transcriptase/maturase	RT	pfam00078_RT_CAS-I:CAS-III	gnl\|CDD\|275209
NC_022873.1\|WP_023521389.1\|1336618_1337191_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NC_022873.1\|WP_015055096.1\|1334409_1336347_+\|M56-family-metallopeptidase	unknown	unknown	gnl\|CDD\|310280
NC_022873.1\|WP_014481972.1\|1342014_1342227_+\|hypothetical-protein	unknown	unknown	unknown
NC_022873.1\|WP_000140289.1\|1342230_1342536_+\|DUF2087-domain-containing-protein	unknown	unknown	gnl\|CDD\|226378
NC_022873.1\|WP_023521384.1\|1327005_1328427_+\|protoporphyrinogen-oxidase	unknown	unknown	gnl\|CDD\|237009
NC_022873.1\|WP_023521385.1\|1328483_1329836_-\|DUF4026-domain-containing-protein	unknown	unknown	gnl\|CDD\|338635

Protein	Function_ID	Function_description	E-value
NC_022873.1\|WP_023521392.1\|1345138_1345873_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293802	cd07716, RNaseZ_short-form-like_MBL-fold, uncharacterized bacterial subgroup of Ribonuclease Z, short form; MBL-fold metallo-hydrolase domain. The tRNA maturase RNase Z (also known as tRNase Z or 3' tRNase) catalyzes the endonucleolytic removal of the 3' extension of the majority of tRNA precursors. Two forms of RNase Z exist in eukaryotes, one long (ELAC2) and one short form (ELAC1), the former may have resulted from a duplication of the shorter enzyme. Only the short form exists in bacteria. Members of this bacterial subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	1.18593e-83
NC_022873.1\|WP_000567010.1\|1344806_1344935_-\|YhfH-family-protein	gnl\|CDD\|379490	pfam14149, YhfH, YhfH-like protein. The YhfH-like protein family includes the B. subtilis YhfH protein, which is functionally uncharacterized. Its expression is repressed by the Spx paralogue MgsR, which regulates genes involved in stress response. This family of proteins is found in bacteria. Proteins in this family are typically between 42 and 53 amino acids in length.	3.52581e-13
NC_022873.1\|WP_023521393.1\|1345882_1346872_+\|lipoate--protein-ligase	gnl\|CDD\|161920	TIGR00545, Probable_lipoate-protein_ligase_A, lipoyltransferase and lipoate-protein ligase. One member of this group of proteins is bovine lipoyltransferase, which transfers the lipoyl group from lipoyl-AMP to the specific Lys of lipoate-dependent enzymes. However, it does not first activate lipoic acid with ATP to create lipoyl-AMP and pyrophosphate. Another member of this group, lipoate-protein ligase A from E. coli, catalyzes both the activation and the transfer of lipoate. Homology between the two is full-length, except for the bovine mitochondrial targeting signal, but is strongest toward the N-terminus. [Protein fate, Protein modification and repair].	2.66586e-138
NC_022873.1\|WP_000726775.1\|1326050_1326986_+\|ferrochelatase	gnl\|CDD\|183526	PRK12435, PRK12435, ferrochelatase; Provisional.	0
NC_022873.1\|WP_001068221.1\|1342562_1342916_-\|PH-domain-containing-protein	gnl\|CDD\|379617	pfam14470, bPH_3, Bacterial PH domain. Proteins in this family are distantly related to PH domains.	1.32494e-19
NC_022873.1\|WP_000103709.1\|1343753_1344767_+\|LacI-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|224525	COG1609, PurR, Transcriptional regulators [Transcription].	1.94599e-114
NC_022873.1\|WP_023521394.1\|1347601_1349134_+\|fatty-acid--CoA-ligase-family-protein	gnl\|CDD\|236072	PRK07656, PRK07656, long-chain-fatty-acid--CoA ligase; Validated.	0
NC_022873.1\|WP_023521391.1\|1343049_1343559_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	8.22719e-14
NC_022873.1\|WP_023521389.1\|1336618_1337191_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.39024e-14
NC_022873.1\|WP_023520826.1\|1337710_1338985_+\|group-II-intron-reverse-transcriptase/maturase	gnl\|CDD\|275209	TIGR04416, hypothetical_protein, group II intron reverse transcriptase/maturase. Members of this protein family are multifunctional proteins encoded in most examples of bacterial group II introns. These group II introns are mobile selfish genetic elements, often with multiple highly identical copies per genome. Member proteins have an N-terminal reverse transcriptase (RNA-directed DNA polymerase) domain (pfam00078) followed by an RNA-binding maturase domain (pfam08388). Some members of this family may have an additional C-terminal DNA endonuclease domain that this model does not cover. A region of the group II intron ribozyme structure should be detectable nearby on the genome by Rfam model RF00029. [Mobile and extrachromosomal element functions, Other].	8.95356e-177
NC_022873.1\|WP_023521386.1\|1330077_1332444_+\|chitobiase/beta-hexosaminidase-C-terminal-domain-containing-protein	gnl\|CDD\|225249	COG2374, COG2374, Predicted extracellular nuclease [General function prediction only].	4.52438e-73
NC_022873.1\|WP_015055096.1\|1334409_1336347_+\|M56-family-metallopeptidase	gnl\|CDD\|310280	pfam05569, Peptidase_M56, BlaR1 peptidase M56. Production of beta-Lactamase and penicillin-binding protein 2a (which mediate staphylococcal resistance to beta-lactam antibiotics) is regulated by a signal-transducing integral membrane protein and a transcriptional repressor. The signal transducer is a fusion protein with penicillin-binding and zinc metalloprotease domains. The signal for protein expression is transmitted by site-specific proteolytic cleavage of both the transducer, which auto-activates, and the repressor, which is inactivated, unblocking gene transcription. homologs to this peptidase domain, which corresponds to Merops family M56, are also found in a number of other bacterial genome sequences.	5.09104e-49
NC_022873.1\|WP_000184503.1\|1334005_1334407_+\|BlaI/MecI/CopY-family-transcriptional-regulator	gnl\|CDD\|367747	pfam03965, Penicillinase_R, Penicillinase repressor. The penicillinase repressor negatively regulates expression of the penicillinase gene. The N-terminal region of this protein is involved in operator recognition, while the C-terminal is responsible for dimerization of the protein.	6.07643e-46
NC_022873.1\|WP_023521384.1\|1327005_1328427_+\|protoporphyrinogen-oxidase	gnl\|CDD\|237009	PRK11883, PRK11883, protoporphyrinogen oxidase; Reviewed.	0
NC_022873.1\|WP_000140289.1\|1342230_1342536_+\|DUF2087-domain-containing-protein	gnl\|CDD\|226378	COG3860, COG3860, Uncharacterized protein conserved in bacteria [Function unknown].	4.32398e-24
NC_022873.1\|WP_023521385.1\|1328483_1329836_-\|DUF4026-domain-containing-protein	gnl\|CDD\|338635	pfam13218, DUF4026, Protein of unknown function (DUF4026). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 450 amino acids in length. The family is found in association with pfam10077.	8.1879e-177

>NC_022873.1|WP_023520826.1|1337710_1338985_+|group-II-intron-reverse-transcriptase/maturase
MELLETILSNQNMNEAYLRVYKNKGASGVDGVTVDELKQYLKENKDELRQRIRTRKYQPQAALRVEIPKENGKMRKLGIPTVVDRVVQQAIHQILSPIFEKQFSEFSYGFRPKRSCEMAIVKSLEFLNAGYEWIVDIDLERFFDTVHHDKLMRIISNTISDGDVISLIRKYLVSGVMVNGKYEETSVGTPQGGNLSPLLSNIMLNELDKELESRELQFVRYADDALIFVKSEKAASRVMKSIVRFIEKNLGLIVNTEKSKISRPEDLKFLGFGYYYNSKDERYQTKPHPISVQKLQRKLRQLTKRNWSVPLDYRILKLKQVIFGWVNYFRITNMKGVMKQVDKKLRSRIRVIIWKQWKIPKKQIKSLVQLGIPEEEAKGLTYCRKGYRYIGLSKVVQRAMSNQRLKKRGVPSSLERYLKVRTAI
>NC_022873.1|WP_023521389.1|1336618_1337191_+|TetR/AcrR-family-transcriptional-regulator
MAIDRKRSIIEAATKSFSAFGYKATTMDQVAKLANVGKGTIYTFFKNKEELFGEIISNLITEMKQVAENAIRSDVSFFENVHRALYSILEFRKEHQLMIKLIQEERDMGTKEVQEVMQQVDVEIVSVIQSYLKIAIEKGEISKCDPEITAFIMLRLYVSLIFDWEKNHEPLEKEKIAELFELYLLKGLSD
>NC_022873.1|WP_015055096.1|1334409_1336347_+|M56-family-metallopeptidase
MIDTLINVYLPHFFDWLIETSLMASILVGFILCIKVLFRNKLTPRWQYMLWIVLMIRLLLPWSPDSSYSIYSLLSYSSSVSEVIPKNMPATENIVNIESDRKVELESNPKMVTKTSEPEVEVSSEKQTTFSLYKLALYVWLAGVIILAAITFLTNRRLYSYIKKQPDITDEQVITVFDRCKQSMKVKKAVSLRLAGKIASPTVFSFFRPKVLLSKKHMKVLNEQQLQYVFYHELAHIKRKDVAVNWIMYSLILLNWFNPILWYAYFCMREDQELACDAYALTFIDKEEQIAYGHTIITLLEHYSYQVPSLANLSRNKRTLKRRIVMIKKFQKKSYRLSLLGIIAIAAIAGGFLLNAKITEGDERQEEKVVEKKQSKAAFEKAIETVLGTPENASREWGMSIKSYKRDTDFLYLAEKNFTKEEFEQYVQLFKEAKEIHKKAMVNKKVPENYDRDTKEFKRERLNKADQERLASIEKKLVPLSERVEKSLTYTIEEAKEHVPYQIKQPTYIPEGYELKREWADSYFGRDVELVVKSEYTNGKYGFTIYQSRIYAGGNKDPLHYMMPGEENLESYNLDGKGMVYNKSSHGEDKLKGLKMFVPEQGKNSEYQVVIVNDIFTRDTKIYEEIIDDELTKKEMEKILISMSK
>NC_022873.1|WP_000184503.1|1334005_1334407_+|BlaI/MecI/CopY-family-transcriptional-regulator
MTNQLPKISEAELEIMKVLWSNSPQTANEIIEELEDAMDWKPKTIRTLINRLVQKEAVSYHQDKGRMYAYYPLVSQDNYLQVETKSLLKRFCGAAFKPLLVNFLKEEKLSSEDINELKRILDEKTEENKRKDR
>NC_022873.1|WP_023521388.1|1332930_1333776_-|hypothetical-protein
MMRALRLNIKQAFCNRVSLIIMFSGFVLICIYHYYYVIRYLGDAANGPISTDIKWIGFRGNEMDVYLLLMPVIASLPFSTSYNSDKSDGFKPFVSKEISLFSYSVTKYIVTFCCGGLLYTFPFILSLLFCKLTIPDGVPTAGSGIINDNGMFANLYETSPITYIAVYIGINFLFAGLMALLGLAASAWSQKDYMALLFPFATTSIPYVLLNTVLPTIGGAPIHLYDPRQPLHGMSPYILTIQCTFFLLVSLIMYIQGVKRDRKKYRRRLQRRERCRKAFQV
>NC_022873.1|WP_023521387.1|1332576_1332876_+|hypothetical-protein
MQLQINGKLMNQLAIFFSTIVMLQFVADVTGLTSNLDITYNLINITASYITFSLAVIFTLIGARRELSKYAIVSLCLVVAIKAIYFVAVVILWGLAGTP
>NC_022873.1|WP_023521386.1|1330077_1332444_+|chitobiase/beta-hexosaminidase-C-terminal-domain-containing-protein
MAVKKLLSVFLSFLLLLSFTGTLAQAEETASMSVEKAIQVFKQQGKTKGIVEGYIVGYTQSSSKYTKDPAKFDDTNVAIADSPNETNPDKIMPVQLPKGDVRTAVNVKDHPENIGKKVSLTGTLELYFSNPGLKSVTAYKFQGEGQNRVSDVVASPNGGEVAKGTAVTLTTNTEGATIYYTLDGSNPTNKSVRYNGQIVMNENSVVKAIAEKEGLTSSAISTFSFIIVNNEQVRIHDIQGKSHISPYNGKKVNNVEGVVTALDKNGFYIEDNQPDNDPATSEGIYVYKKDANVAVGDLIQVDGVVEEYVGPGYAERFETDLTTTEIKASRVAVIAKNQTLPAPIVLGENGVKIPDQIIDNDAFGLFDPNEDAIDFYESIEGMRVTMPTPKIITPQKNGNLYVTVKNGGDKIVTQYGTPLLDENQLNPERLSVKVPRDYVAKVGDTFTGDITGVVGYDYGSFRISPITELPAVVDGGFKQVGANIQPRLDKLTVATYNIENFSANKKETTDEKVKALAYSIKYNLKMPDIIGVEEMQDNNGSINDGTTDASLSAKRIIDAVLEIRGPKYEYVEIAPNNNQDGGAPGANIRVGFFYNPSRVKLATVPKLLDKNVVRIGDENPLFESTRKPLAAEFTFQGQNIVVVANHLNSKLGDATPFGKVQPLVLKSEDKRIQLAQEVNHFVQGIQKKNTNAPVVVLGDMNDFEFSKPLKALEGTILKDMLNTVPKENRYTYIHEGNAQVLDHILVTNNIASHTIVDPVHLNSNIMKEHGRVSDHDPVLAQIDLKKAS
>NC_022873.1|WP_023521385.1|1328483_1329836_-|DUF4026-domain-containing-protein
MEVQTETYRAAMNGTLERHFSDMIAVIPTRITIEQLKQRLETIATKVDELKIVYSDETSLIVELHMGETVIPYELHIDEANDPEEYKMYNRQDSTIVDRNFEDAAFGTEIFTRTLFVGDVLDCFFQQLQFLWNLAPDLLFVIDSSAAMKVISRSYIEYHVENELLPDIPDLYVIHSVYEDDKDGEPTQYWFHTHGLLRAGVTEIELIIPNRISSYYGIGDLFQTFANNSVENGQVPMNEPIVIAHSQQGSIHTVAVPWEKGLSYIGHKTSMDQLSSIEDEEVKLQPIDAQNTFLGGMDARDEYHQSPSVLLFKFNTSEEYIESFFKEHEEATGLMFYKTNSETDRMAYNAKNTFGYFSNIFHIEQSNEDFRFLAKFGVSYEEGKSEHMWFEMQNITEDFIQGILINEPYFIEDMSEGNSYHLDFDNLTEWVIYAGDAVIKPNTLYMFIGE
>NC_022873.1|WP_023521384.1|1327005_1328427_+|protoporphyrinogen-oxidase
MRKKVVIVGGGITGLTAMYNLQKNIHEKNLPIDTLLIEASGKLGGKIQTVRKDGFTIERGPDSFLARKESAARLVKELGLGDELVNNQAGQSFILVNNRLHKMPNGSVMGIPTQITPFLFSGLFSPIGKLRAGFDLLMPRSKPVSDQSLGQFFRHRLGNEVVENLIEPLLSGIYAGDIDEMSLMSTFPQMYQIEQKHRSISLGMRTLAPKEEKAEPKKGMFQTVKTGLESIVKSLEAKMHEGTIIKGTRIEKIAKQGDGYTITLSNGKEIEADAIVVATSHKVLPSMFAQYKQFRFFRNIPSTSVANVALAFQKSAIQRDINGTGFVVSRNSDYTITACTWTHKKWPHTTPEGKTLLRCYVGRAGDEAVVEQTEEELVQLVLEDLRKTMDITEDPEFTIVSRWKEAMPQYTVGHNERMKKLTTFMEKELPGIYLAGSSYAGAGLPDCINQGEEASKRVLSHLEKVIDAELIAQ
>NC_022873.1|WP_000726775.1|1326050_1326986_+|ferrochelatase
MKKKIGLLVMAYGTPYKEEDIERYYTHIRRGRKPSPEMLEDLTERYRAIGGISPLATITLEQAKKLEKRLNEVQDEVEYHMYLGLKHIEPFIEDAVKDMHNDGIQDAIALVLAPHYSTFSVKSYVGRAQEEAEKLGNLTIHGIDSWYKEPKFIQYWVDAVKGIYNGMSDAEREKAVLIVSAHSLPEKIIAMGDPYPDQLNETADYIARGAEVANYAVGWQSAGNTPDPWIGPDVQDLTRELNEKHGYTSFVYAPVGFVAEHLEVLYDNDFECKVVTDEIGAKYYRPEMPNASDAFIDCLTDVVLKKKESVL
>NC_022873.1|WP_014481972.1|1342014_1342227_+|hypothetical-protein
MMRGNLTYYFIVNPLIIFLVYALSPILFDKEVYTSMKDAFGILTFYYVLMGGYYFIDILSEKIKKKSDGG
>NC_022873.1|WP_000140289.1|1342230_1342536_+|DUF2087-domain-containing-protein
MTESEMKFRDTTIRNFFDKEDRLKSIPGQKKKKLVLLEHLISKLNAENQYTEKEINTFIKQYHDDFCTIRREFIVQGFMDREDNMYRINGREVWTKWEELK
>NC_022873.1|WP_001068221.1|1342562_1342916_-|PH-domain-containing-protein
MNPILTAAKQLLHKEEKILSTLKCSLTGYMITHKVPYPGMLLATNRRLLFFSQYKNTFIAEFDYEKILSIETKRRIFDKKIIFYYEDEYITLGYITSSNVEAFIDLLQRNSKTSTGL
>NC_022873.1|WP_023521391.1|1343049_1343559_+|GNAT-family-N-acetyltransferase
MIRLAKKADAEAIMNIRKEIILSESTTKFFIVSPKKLPNDIDVEREKIRKSNEKGNLYIVYEVDYKVVGFLLFNRYELERLQHAGTMGMGIKEAYCNQGIGTKLIEFLISWAKGQKGLEKICLGVVSVNDRAIKVYKRMGFVEEGRQRKQIKYEDGSYGDDVLMGFYIE
>NC_022873.1|WP_000103709.1|1343753_1344767_+|LacI-family-DNA-binding-transcriptional-regulator
MSTIEDVAKLAGLSRTTVSRVINNHPYVSDEKKKRVQLAMKHLGFVPNSAARRLRKQKTETIAVLVPRITNPFFSRFIEAIEIAASEHKYKLIICQTRYLPEKEMEYLQLLSTKQVDGIILCSLENPWEDVEPYLQHGPIVLCNEYIEEANIPTVKFDHAQGAYIAAKHVLDQGYRNLIFCRGNETKLVSQQRKMGFLRAITEKSRQVEAIDFLENAFSWEDGKRIFHEVLKDKKNPTAILAGGDEVAAGIISEAKHHNWSIPDDLAVIGFDNQILSQITEPGITTIEQPIDEMARKVVDLMMDKIHTKNYRKKELYEFELELLVKGSTMKDKMLLA
>NC_022873.1|WP_000567010.1|1344806_1344935_-|YhfH-family-protein
MIDQPMEFFRNLPTKTCAHCGKEIDEQHEAYHNKCDDCVHEE
>NC_022873.1|WP_023521392.1|1345138_1345873_+|MBL-fold-metallo-hydrolase
MKMTVVGFWGGFPEAGEATSGYLFVHDGFRLLVDCGSGVLAQLQKYITPSHIDAVVLSHYHHDHVADIGVLQYARLIMSATTRQLPELPIYGHTFDENGFHSLTHEPHTKGIAYNPEETLQVGPFSISFLKTVHPVTCFAMRITAGDDAVVYSADSSYIPEFIPFTKDADLFICECNMYAHQEAAKAGHMNSTEVASIAKDANVKELLLTHLPHTGNPSDLVTEAKQIFSGHITLAHSGYVWNS
>NC_022873.1|WP_023521393.1|1345882_1346872_+|lipoate--protein-ligase
MLFIDNKGITDPRINLAIEEYCVKNLDINETYLLFYINEPSIIIGKNQNTVEEINADYVKEKGIHVVRRLSGGGAVYHDLGNLNFSFITKDDGDSFSNFKKFTDPVTKALSKLGVNAELSGRNDILAEGRKISGNAQFSTKGRMFSHGTLLFDSEIDHVVSALKVKMDKIQSKGIKSIRSRVANITEFLNEEMTTEEFRQLLLETIFEGETEIPTYELTENDWKEIHKLSEERYQNWDWNYGKSPKFNLQHSHRFPVGQVDVRLEVKKGTVTECKIYGDFFGSLDVHDIEERLTGVQFDKDAFTAALEGVDIARYFGNITTEDFLHLFF
>NC_022873.1|WP_023521394.1|1347601_1349134_+|fatty-acid--CoA-ligase-family-protein
MNLVQSLAETAKKKGDKPAYIFMDQSVSYDQLNKMVTRFSGNLAEMGIGKGDNVALVVGNSPHFLVGLYGTMKAGATVIPVNPIYTADEMHYILQNGDVKTIIVLDVLLPVIQSLTTRLPSLKNIIICETSSDFNHTETEKMKTFTSFVGAGDLQYEGPELDEEDVAVILYTSGTTGKPKGAMLTHKNLYSNANDVASYLQFTADDRVVAALPMFHVFCLTVAVNAPIVNGATILMLPKFSPKEVFRICRTYEPTIFAGVPTMYNYLYLFEEASAEDVKTLRLCISGGASMPVALLQNFEKRFNVIVSEGYGLSEASPVTCFNPLDRPRKPGSIGTNIWHVENKIVNELGEEVPVGAVGELIVRGPNVMKGYYNAPEDTAATLKDGWLYTGDLAKMDEEGYFYIVDRKKDIVLVGGYNVYPREVEEVLYTHESVAEVVVIGVPDENLGEAVRAYVVLKQTNVTEEELMHYCTLHLAKYKVPKSIEFLIELPKNTTGKLLRRALREKAMQV
>NC_022873.1|WP_003269765.1|1349301_1349478_+|hypothetical-protein
MNSENDKNGNFNQNGVMNRESMATVLVNAYKLEWNENSKLPKEFADLKNHWAQRMPIF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_022873_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_022873_2

3528808-3528880

Orphan

Consensus_repeat	Method
TTTATTCTCATTATTGATAATGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_022873_2

>merge|NC_022873|2|3528808-3528880|CRISPRCasFinder
TTTATTCTCATTATTGATAATGATAAAACATAAACGAATGAATTGCAAACTTTATTCTCATTATTTATAATGA

>NC_022873|2|2|3528808-3528880|CRISPRCasFinder
TTTATTCTCATTATTGATAATGA	TAAAACATAAACGAATGAATTGCAAAC
TTTATTCTCATTATTTATAATGA

Protein	Signature genes	Signature genes Name	Protein_function
NC_022873.1\|WP_000166303.1\|3520940_3521141_-\|NETI-motif-containing-protein	unknown	unknown	gnl\|CDD\|379439
NC_022873.1\|WP_023522502.1\|3528912_3529458_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|235811
NC_022873.1\|WP_000062798.1\|3521124_3522321_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341030
NC_022873.1\|WP_023522500.1\|3527651_3528551_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224054
NC_022873.1\|WP_043924685.1\|3535905_3537567_-\|energy-coupling-factor-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213193
NC_022873.1\|WP_023522497.1\|3523814_3524231_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NC_022873.1\|WP_001190320.1\|3524246_3525446_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341042
NC_022873.1\|WP_023522501.1\|3528547_3528787_-\|PLDc-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|379161
NC_022873.1\|WP_000779946.1\|3534325_3535048_-\|YwiC-like-family-protein	unknown	unknown	gnl\|CDD\|379525
NC_022873.1\|WP_023522495.1\|3522434_3522662_-\|hypothetical-protein	unknown	unknown	unknown
NC_022873.1\|WP_023522504.1\|3530538_3531885_+\|short-chain-fatty-acid-transporter	unknown	unknown	gnl\|CDD\|224942
NC_022873.1\|WP_023522507.1\|3535231_3535933_-\|ECF-transporter-S-component	unknown	unknown	gnl\|CDD\|377783
NC_022873.1\|WP_023522499.1\|3526860_3527649_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372253
NC_022873.1\|WP_023522503.1\|3529708_3530191_-\|hypothetical-protein	unknown	unknown	unknown
NC_022873.1\|WP_023522498.1\|3525546_3526806_+\|serine-hydrolase	unknown	unknown	gnl\|CDD\|224594
NC_022873.1\|WP_023522496.1\|3522728_3523625_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NC_022873.1\|WP_000271534.1\|3532879_3533263_-\|SWIM-zinc-finger-family-protein	unknown	unknown	gnl\|CDD\|227059
NC_022873.1\|WP_043924684.1\|3531925_3532279_-\|group-specific-protein	unknown	unknown	unknown
NC_022873.1\|WP_023522505.1\|3532275_3532851_-\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|376808
NC_022873.1\|WP_000171478.1\|3533522_3533780_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_022873.1\|WP_000166303.1\|3520940_3521141_-\|NETI-motif-containing-protein	gnl\|CDD\|379439	pfam14044, NETI, NETI protein. This family includes the B. subtilis YebG protein, which is functionally uncharacterized. This is not a homolog of E. coli YebG, which belongs to pfam07130. This family of proteins is found in bacteria. Proteins in this family are typically between 42 and 66 amino acids in length and contain a conserved NETI motif.	2.7816e-26
NC_022873.1\|WP_023522502.1\|3528912_3529458_+\|transcriptional-regulator	gnl\|CDD\|235811	PRK06474, PRK06474, hypothetical protein; Provisional.	2.6151e-91
NC_022873.1\|WP_000062798.1\|3521124_3522321_-\|MFS-transporter	gnl\|CDD\|341030	cd17477, MFS_YcaD_like, YcaD and similar transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli MFS-type transporter YcaD, Bacillus subtilis MFS-type transporter YfkF, and similar proteins. They are uncharacterized transporters belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.08255e-74
NC_022873.1\|WP_023522500.1\|3527651_3528551_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	3.02575e-88
NC_022873.1\|WP_043924685.1\|3535905_3537567_-\|energy-coupling-factor-ABC-transporter-ATP-binding-protein	gnl\|CDD\|213193	cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system. Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.	4.95978e-94
NC_022873.1\|WP_023522497.1\|3523814_3524231_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	5.70111e-19
NC_022873.1\|WP_001190320.1\|3524246_3525446_+\|MFS-transporter	gnl\|CDD\|341042	cd17489, MFS_YfcJ_like, Escherichia coli YfcJ, YhhS, and similar transporters of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli membrane proteins, YfcJ and YhhS, Bacillus subtilis uncharacterized MFS-type transporter YwoG, and similar proteins. YfcJ and YhhS are putative arabinose efflux transporters. YhhS has been implicated glyphosate resistance. YfcJ-like arabinose efflux transporters belong to the bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.11413e-105
NC_022873.1\|WP_023522501.1\|3528547_3528787_-\|PLDc-N-terminal-domain-containing-protein	gnl\|CDD\|379161	pfam13396, PLDc_N, Phospholipase_D-nuclease N-terminal. This family is often found at the very N-terminus of proteins from the phospholipase_D-nuclease family, PLDc, pfam00614. However, a large number of members are full-length within this family.	7.76415e-06
NC_022873.1\|WP_000779946.1\|3534325_3535048_-\|YwiC-like-family-protein	gnl\|CDD\|379525	pfam14256, YwiC, YwiC-like protein. The YwiC-like protein family includes the B. subtilis YwiC protein, which is functionally uncharacterized. This domain family is found in bacteria, and is approximately 130 amino acids in length. There is a single completely conserved residue G that may be functionally important.	1.07566e-44
NC_022873.1\|WP_023522504.1\|3530538_3531885_+\|short-chain-fatty-acid-transporter	gnl\|CDD\|224942	COG2031, AtoE, Short chain fatty acids transporter [Lipid metabolism].	9.23031e-173
NC_022873.1\|WP_023522507.1\|3535231_3535933_-\|ECF-transporter-S-component	gnl\|CDD\|377783	pfam07155, ECF-ribofla_trS, ECF-type riboflavin transporter, S component. This family is the substrate-binding component (S component) of the energy coupling-factor (ECF)-type riboflavin transporter. It is a transmembrane protein which binds riboflavin, and is responsible for riboflavin-uptake by cells.	2.64534e-05
NC_022873.1\|WP_023522499.1\|3526860_3527649_-\|hypothetical-protein	gnl\|CDD\|372253	pfam12679, ABC2_membrane_2, ABC-2 family transporter protein. This family is related to the ABC-2 membrane transporter family.	0.000227015
NC_022873.1\|WP_023522498.1\|3525546_3526806_+\|serine-hydrolase	gnl\|CDD\|224594	COG1680, AmpC, Beta-lactamase class C and other penicillin binding proteins [Defense mechanisms].	8.80742e-35
NC_022873.1\|WP_023522496.1\|3522728_3523625_-\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	1.04071e-42
NC_022873.1\|WP_000271534.1\|3532879_3533263_-\|SWIM-zinc-finger-family-protein	gnl\|CDD\|227059	COG4715, COG4715, Uncharacterized conserved protein [Function unknown].	4.47077e-09
NC_022873.1\|WP_023522505.1\|3532275_3532851_-\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|376808	pfam02525, Flavodoxin_2, Flavodoxin-like fold. This family consists of a domain with a flavodoxin-like fold. The family includes bacterial and eukaryotic NAD(P)H dehydrogenase (quinone) EC:1.6.99.2. These enzymes catalyze the NAD(P)H-dependent two-electron reductions of quinones and protect cells against damage by free radicals and reactive oxygen species. This enzyme uses a FAD co-factor. The equation for this reaction is:- NAD(P)H + acceptor <=> NAD(P)(+) + reduced acceptor. This enzyme is also involved in the bioactivation of prodrugs used in chemotherapy. The family also includes acyl carrier protein phosphodiesterase EC:3.1.4.14. This enzyme converts holo-ACP to apo-ACP by hydrolytic cleavage of the phosphopantetheine residue from ACP. This family is related to pfam03358 and pfam00258.	2.29826e-47

>NC_022873.1|WP_023522501.1|3528547_3528787_-|PLDc-N-terminal-domain-containing-protein
MQLHYGLNDLKDIDIMAFLSIILPVIAVGALLVLIAFIDLYRHRKTRKNVLVWTLIILFVNILGPILYFVIGRKDREKL
>NC_022873.1|WP_023522500.1|3527651_3528551_-|ABC-transporter-ATP-binding-protein
MKLEIKNVTKSFKGKIAVNNFSMELQAGECVGLIGPNGAGKSTLIKVISDITNPTAGEVLLNGIKISKMKSEIGYLPQYPNFFHWMTARETLTFMGQLSGLKKEELSKSIPKMLEKVGLKEEENAKVSTFSGGMKQRLGIAQALLHKPSLIVMDEPVSALDPIGRREVLNLIKEIKKDTTILLSTHILSDAEEICERFVIIKDGTKIEDTTITELLHRNRENKLIIEITAKDQNWIEVVKKLPYVKNVEVVGLKIKVKVESIEINKNMLLQNALEHKVDIVKFKMSNDTLEEIFLKLVV
>NC_022873.1|WP_023522499.1|3526860_3527649_-|hypothetical-protein
MNNSMVLIKKEYVQMLRDFKIIWLPIVFIFLGATQPIVTHYLPSILEALGGGQGITIDLSMAAQKGGEVLASTLGSQFDQLGLMILVISMMGAIQTDKANGMLAFILTRPVTVTSYVGGKIVSNYLMVAFSVTIGYVASYLYVNFLFTAVPFAHLITGLLFYLIWVLFIVSFTTMISAIFHSQGIIALISIVFLLACRVIVGLNPIMDQLNPAGMSKYAMETLVTGEVNSNAIINGLLTIVWILLTLFVTYYWIANKKFHYE
>NC_022873.1|WP_023522498.1|3525546_3526806_+|serine-hydrolase
MKLKKSPLLLLILTFIFVITGLGFTYFKQNKTTPSKHNVTKENWLNDPYLRWSYTHMKEFTLVNDVKNNPDQIAHFLSALQNLDDFAVERRFGNTTPLKKLLDDNKTDAFVVVHNGQLVYERYFNRYKQNEPHGMASLAKVFTGAIIQSLSEEKRIDLEKTADTYIKELKNTPFGKATLQQLMDMQVSAEYPTHGYEQPGLENQDAQLYLASNILPRGKNYGGPMKIYDMLREVEETAPPGSSFSYNNGSTETLAWIIRTITGKSLAENVSERIWSQIGMEENAYYVTDETKVEQASAGLNATARDMARFGQLLLNNGEYNGKQILPSSITEDIKNVQEGELAIAPGASISYHNQWWIPHNEQGAFEVLGSYGQTLYIDPKTNMVIVHFSSNATPSNEIHSVYSNMYIDIAHHLEKLPQ
>NC_022873.1|WP_001190320.1|3524246_3525446_+|MFS-transporter
MQSEKLWTKDFLGTCFSSLFLFLTFYMLMTTLPVYVIDGLKGKPEEIGLVATVFLISSVLCRPFTGKWLDDLGRKKILFISLSLFLAATVMYFGAQSLFLLLALRFLHGIGFGMATTATGTIVTDVAPAHRRGEALAYFGVFMSLPMVIGPFLGLTIISHFSFTVLFIVCSVFSLLAFLLGLLVDIPHEAPVSKQKREKMKWKDLIEPSSIPIALTGFVLAFSYSGILSFIPIYAKELGLSEIASYFFIVYALVVVISRPFTGKIFDRFGENVLVYPAIIIFTIGMFILSQAQTSFWFLGAGMLIGLGYGTLIPSFQTIAISAAPNHRRGSATATYFSFFDSGIGFGSFILGIVAAKSSYHNMYFIAAIIVAFTLLLYYGLHGRKQKFKKQPTDGKISA
>NC_022873.1|WP_023522497.1|3523814_3524231_+|MarR-family-transcriptional-regulator
MDEKQHFFHIVSQTSRKFTKKFNERVSPTGLFSAQWAVIFRINQTGSCTQTELCQYLNVESPTMTRTLTRMETMGWIIRTEGKDRREKLISLSETAIKMIPVWQEEVDTFEEKTLEGINENDLHQAFQVLQQIIKNLD
>NC_022873.1|WP_023522496.1|3522728_3523625_-|alpha/beta-hydrolase
MIKPATMEFVSLSNGETIAYQEVGRRNTDILVLIHGNMTSSQHWDLVIEKLQDQYHIYALDLRGFGQSTYNQSIDSLQDFADDVKLFIDELKLEKFSLMGWSMGGGVAMQFTANHPTFVEKLILVESVGMKGYPIFKKDTNGQPIVSSLVKTKEEIAQDPVQIAPVLDAIKNMNKLYYRTVWNLLIYTHNQPEPDRYEKYLDDMLTQRNFVDVNYALITFNISDEHNGVVEGSKQIHHIKAPTLVIQGDRDYVVPQVVGEELAKHLPNAELKVLEDCGHSPFIDCLDVFIKHVEDWLE
>NC_022873.1|WP_023522495.1|3522434_3522662_-|hypothetical-protein
MHHPFLIVHSPYNHHVYTKMMIAPLYMQVSPVVVPLQIQQPPIVHSHHYLYETAFYKHPYFKQFHNNVKAQVWEG
>NC_022873.1|WP_000062798.1|3521124_3522321_-|MFS-transporter
MSMRFTFWIMVGIVAISGLSQGMLLPAIAMIFEQEGVSSSINGIHATALYIGILVISPFLEKPMQRFGMKPIIVIGGFLVIISLFFFTQTFSFWVWFILRFLVGVGDHMLHVGTQTWITTTSDPSKIGRQVSIYGVFFGIGFAVGPYLASTVQYGLATPFIISTILCLIGWLLLLPTKNAFPAQDEREVKSESSFSRYKQVVGLGWIALLGPLAYGVLEAMLNSNLPVYALRKGWSVSDVSFLLPAFAVGGIITQIPLGILSDKYGRDRILTWTFSISTGIFLLAAVFDQYYWIVFACMLLAGMVIGSCFSLGLGFMTDLLPRHLLPAGNILSGIAFSLGSIMGPVLGGVFIEKIQYTSFFIAVMIIMGILAMLYMVYMKNQFASRKIESRLGHDKTT
>NC_022873.1|WP_000166303.1|3520940_3521141_-|NETI-motif-containing-protein
MTKQPNKKKFEVLENETITDCLARMEQEGYAPSRRMEEPIFHEVKKDGKTVVEPCGRKIVFEGKLK
>NC_022873.1|WP_023522502.1|3528912_3529458_+|transcriptional-regulator
MSNKVEILMHPVRMKICQVLMRNKDDGLTPLEMVKIIKNVPQATLYRQLQTMVDSGIVHVIKEKKVKSVSEKYYAINEEDAKIEGSEWKGLSDDEKLNYISYYQLSLMTQYQSYLKKLEEQNSQEDTATFSVVELKLDEEHFGKFQNELNELMIKYYNSQSKDDEIETPVRTVAITIIPET
>NC_022873.1|WP_023522503.1|3529708_3530191_-|hypothetical-protein
MIKSFYLLKPKMFTGDIYYKVFITGDCIYFIKIGGQFHSRHAYKKQLPGISELLFLFWFKKIEKKQLNLETEIDAKIHTGDVHELLQLKNNFSIEINIIEEVLLNKRGTFHTGFNDNGTISFMLKNGQKIKFIIPEETLFLSIEEIFDQYEQIIFVREVF
>NC_022873.1|WP_023522504.1|3530538_3531885_+|short-chain-fatty-acid-transporter
MFRSFTNGCVALVQRFLPEPFILSCLLTVFVICFGMFATHQTPVEMINHWGNGIWGLLAFSMQMALVLVTGSALANAPLIKKGLTKAARLPKTNGQGIIAISIVSLLGAYINWGFGIVVSVLYAKEVARQLEGLDYRLAIASSYSGFLIWHAGLSASIPLTLATGGETLIKTTAGSIKEAIPITETLFSPYALVPVIIFLVTMPLINKAMHPDEKHTITVDPSVFHEEAAAQEVEKNTFAEKMENSIIITLCVGLLGLIYIFNYFYTKGFNLTLDIVIFMLLIAGLIFHRTPIQYIRTFSDSTKSASGILLQFPFYAGIMGMMIGANSEGLSLGGAISNFFISISNESTFPLFTFLSAGIVNIFVPSGGGQWAVQAPIMIPAGAELGVPAAKTAMAIAWGDAWTNLIQPFWALPALAIAGLGARDIMGFCVVNLLYAGFIISLCFLFI
>NC_022873.1|WP_043924684.1|3531925_3532279_-|group-specific-protein
MNEVDRIINCCQYDNELFRKYITCLLQLEKCSDTFQQIQIELRNDYLIRGICEREVDEVVRGSKEYETYFLPKALQWNFLREHPHLIGKICEDFFAFESLHLTDIEWKTVINCMGNK
>NC_022873.1|WP_023522505.1|3532275_3532851_-|NAD(P)H-dependent-oxidoreductase
MNVLIIYAHPNPSSFNGAILEHVQKGLQETNHSVTLLDLYKEQFDPVLVFNEEKKRRDLINEEETAQYRKLVEEADTLLFIYPIWWWGMPAILKGFIDRIFVAGFAYKYEGALPKGLLQGKKTWVINTLDSPLWYVALLYRSADWIMMKRGVLRFCGIRDIKRSVFQSVKTSKVSKREIWLLQIEEKARTL
>NC_022873.1|WP_000271534.1|3532879_3533263_-|SWIM-zinc-finger-family-protein
MYAYLLKDITKWIPKYVVDKGYEYYEDGHVEDVEIQDNKVFAFVTGNAGNYEVVIDLEDFSKSSCECPYENYCKHMAAVVYDIQGAGESAVKEKLKDLEKEELLTVLNRLLQSSKNVQIVEKLLKKG
>NC_022873.1|WP_000171478.1|3533522_3533780_-|hypothetical-protein
MTLEKYVKLRSTVYEYMIEQDKPISLLDIQEHIVSHHEGKFTKKMLHQFYLSRLLDELKLDGKITLADEYLYTEKGVFYKARKGS
>NC_022873.1|WP_000779946.1|3534325_3535048_-|YwiC-like-family-protein
MKLVIPKQHGAWAMLAIPFLLSVILGKPTIYHIPLFIAWFFIYLATYPFLMYIKQKRKKEYLHASIVYFIIAFVFGMISLLYEWRILLFVIVMIPLFIVNMHYARQKNERALLNDICAIIVFCVGGLISYYFSMKQIDHTALFIALISFLYFLGSTFYVKTMIREKNNPKYRFISWGYHILLTIIVFAINPWCSLIFIPSVIRAIILYGKKISIIKVGVLEIVNSVYFLIITAIIMKYAI
>NC_022873.1|WP_023522507.1|3535231_3535933_-|ECF-transporter-S-component
MSKRYVAFIICIFAVIIGTLLFTTLIMDGYYMLSSLFLLVVIMLPFYIRFERKAFVSREIVLVAVLAAIAAVSRVPFSILPSVQPTSFVIIVSAIVFGSEAGFMIGATAAIVSNIFLGQGPWTPWQMFSWGMIGFIAGLLRNTFLMKKLWGRLLYGLFVGFLFGWIMNFWGLLGFIREATWETVISYYIASFYFDLSHAISNVVFLLLFSTSWITILTRFKKKYGILDKHNIA
>NC_022873.1|WP_043924685.1|3535905_3537567_-|energy-coupling-factor-ABC-transporter-ATP-binding-protein
MVMVAHAEINNLSFVYADENEKALQHISLSVQKGEFIALAGGSGSGKTTLLKHFKKELLPIGKRTGDTYYDGTLLENVPDLLSAQEIGMVFQNPENQLVMDTVIQELAFSLENIGLPSHIIQKRIAELISFLGFQDLLHQSVHTLSGGQKQLVNLAAVLVMQPKLLLLDEPTAQLDPIAAKEFLGLLKRINEELGITIVLSEHRLDEVIPLATRVICMNNGRIVYDGSPKAVVANMWEVEKFRPFIPQIPRLFLEWNVRDIPFTVREAQMKMNNFSAISYVNEPIAQSEKQEVILSAEHISFQYEKNSPLILRDLSVSIEKGKWVALVGKNGTGKSTLLTILAGLQKARRGKVKWNGKVIHKIDSKERFKSIGYVSQHPYYHFTFDTVWDEVYERARELYGEQGKEIAEDTLKQFWLYSLKERHPHDCSGGEQQLLALCTTLLSKPTLLLLDEPTKGLDPWKKERVGELFRELQKEGTTIVMATHDIEFAAKYVDRCMMLFDGAVIMNDAPKEFFSGNFFYTTSINRFIRKELPYALTWEDVYEACPNDMLHS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_022873_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_022873_3

3583799-3583870

Orphan

Consensus_repeat	Method
ACCTTCTGCACCTGTTGGACCAGTTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_022873_3

>merge|NC_022873|3|3583799-3583870|CRISPRCasFinder
TCCTTGTGCTCCTGTTGGACCGATAATTCCTTGCACTCCTTGAGAACCTTGGGCACCTTGTGTACCTGTCAA

>NC_022873|3|3|3583799-3583870|CRISPRCasFinder
TCCTTGTGCTCCTGTTGGACCGATAA	TTCCTTGCACTCCTTGAGA
ACCTTGGGCACCTTGTGTACCTGTCAA

Protein	Signature genes	Signature genes Name	Protein_function
NC_022873.1\|WP_023522539.1\|3585622_3586537_-\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|276809
NC_022873.1\|WP_023522536.1\|3580398_3582897_-\|collagen-like-triple-helix-repeat-containing-protein	unknown	unknown	gnl\|CDD\|375999
NC_022873.1\|WP_023522535.1\|3579442_3579904_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379326
NC_022873.1\|WP_000402258.1\|3588863_3590192_-\|HlyC/CorC-family-transporter	unknown	unknown	gnl\|CDD\|224173
NC_022873.1\|WP_000845630.1\|3574449_3575013_-\|maltose-O-acetyltransferase	unknown	unknown	gnl\|CDD\|182235
NC_022873.1\|WP_000945243.1\|3580181_3580325_+\|hypothetical-protein	unknown	unknown	unknown
NC_022873.1\|WP_023522543.1\|3590980_3591754_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|372681
NC_022873.1\|WP_023522545.1\|3592638_3593694_+\|CDP-glucose-4,6-dehydratase	unknown	unknown	gnl\|CDD\|274236
NC_022873.1\|WP_023522534.1\|3576612_3577770_+\|1-deoxy-D-xylulose-5-phosphate-reductoisomerase	unknown	unknown	gnl\|CDD\|237107
NC_022873.1\|WP_000539730.1\|3578984_3579233_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	unknown	unknown	gnl\|CDD\|225170
NC_022873.1\|WP_000285635.1\|3590311_3590719_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133406
NC_022873.1\|WP_023522544.1\|3591869_3592637_+\|glucose-1-phosphate-cytidylyltransferase	unknown	unknown	gnl\|CDD\|131672
NC_022873.1\|WP_000938438.1\|3587650_3588199_-\|DUF2179-domain-containing-protein	unknown	unknown	gnl\|CDD\|235234
NC_022873.1\|WP_000003038.1\|3569997_3571026_-\|ROK-family-protein	unknown	unknown	gnl\|CDD\|224851
NC_022873.1\|WP_023522540.1\|3586836_3587214_+\|hypothetical-protein	unknown	unknown	unknown
NC_022873.1\|WP_000687573.1\|3569555_3569936_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319905
NC_022873.1\|WP_000411478.1\|3577799_3578921_-\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
NC_022873.1\|WP_023522542.1\|3588397_3588811_-\|ATP-synthase-subunit-I	unknown	unknown	gnl\|CDD\|377159
NC_022873.1\|WP_023522533.1\|3575223_3576222_-\|tryptophan--tRNA-ligase	unknown	unknown	gnl\|CDD\|183592
NC_022873.1\|WP_023522541.1\|3587290_3587530_+\|DUF3923-family-protein	unknown	unknown	gnl\|CDD\|289806

Protein	Function_ID	Function_description	E-value
NC_022873.1\|WP_023522539.1\|3585622_3586537_-\|tetratricopeptide-repeat-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	3.09775e-14
NC_022873.1\|WP_023522536.1\|3580398_3582897_-\|collagen-like-triple-helix-repeat-containing-protein	gnl\|CDD\|375999	pfam18573, BclA_C, BclA C-terminal domain. This is the C-terminal domain of BclA (Bacillus collagen-like protein of anthracis) which is expressed on spores of Bacillus species. Trimers of the C-terminal domain (CTD) form the tips of the spore's hair-like nap and are the immunodominant target of vertebrate antibodies and drive trimerization. Structure analysis indicate the C-terminal region of the peptide folding into an all-beta structure with a jelly-fold topology, similar to the first human complement C1q, a member of the tumor necrosis factor (TNF)-like family. The C-terminal globular domain has been shown to be located on the exterior of the exosporium, and therefore is critical in determining the immunogenicity of the spore in a mammalian host.	8.37841e-08
NC_022873.1\|WP_023522535.1\|3579442_3579904_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379326	pfam13673, Acetyltransf_10, Acetyltransferase (GNAT) domain. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.19703e-12
NC_022873.1\|WP_000402258.1\|3588863_3590192_-\|HlyC/CorC-family-transporter	gnl\|CDD\|224173	COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only].	1.44362e-160
NC_022873.1\|WP_000845630.1\|3574449_3575013_-\|maltose-O-acetyltransferase	gnl\|CDD\|182235	PRK10092, PRK10092, maltose O-acetyltransferase; Provisional.	8.14217e-101
NC_022873.1\|WP_023522543.1\|3590980_3591754_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|372681	pfam13704, Glyco_tranf_2_4, Glycosyl transferase family 2. Members of this family of prokaryotic proteins include putative glucosyltransferases,.	1.43653e-09
NC_022873.1\|WP_023522545.1\|3592638_3593694_+\|CDP-glucose-4,6-dehydratase	gnl\|CDD\|274236	TIGR02622, CDP-glucose_46-dehydratase, CDP-glucose 4,6-dehydratase. Members of this protein family are CDP-glucose 4,6-dehydratase from a variety of Gram-negative and Gram-positive bacteria. Members typically are encoded next to a gene that encodes a glucose-1-phosphate cytidylyltransferase, which produces the substrate, CDP-D-glucose, used by this enzyme to produce CDP-4-keto-6-deoxyglucose. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	0
NC_022873.1\|WP_023522534.1\|3576612_3577770_+\|1-deoxy-D-xylulose-5-phosphate-reductoisomerase	gnl\|CDD\|237107	PRK12464, PRK12464, 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional.	0
NC_022873.1\|WP_000539730.1\|3578984_3579233_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	gnl\|CDD\|225170	COG2261, COG2261, Predicted membrane protein [Function unknown].	5.47241e-09
NC_022873.1\|WP_000285635.1\|3590311_3590719_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133406	cd04779, HTH_MerR-like_sg4, Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily. Putative helix-turn-helix (HTH) MerR-like transcription regulators (subgroup 4). Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	3.12673e-60
NC_022873.1\|WP_023522544.1\|3591869_3592637_+\|glucose-1-phosphate-cytidylyltransferase	gnl\|CDD\|131672	TIGR02623, Glucose-1-phosphate_cytidylyltransferase, glucose-1-phosphate cytidylyltransferase. Members of this family are the enzyme glucose-1-phosphate cytidylyltransferase, also called CDP-glucose pyrophosphorylase, the product of the rfbF gene. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	0
NC_022873.1\|WP_000938438.1\|3587650_3588199_-\|DUF2179-domain-containing-protein	gnl\|CDD\|235234	PRK04164, PRK04164, hypothetical protein; Provisional.	6.88941e-83
NC_022873.1\|WP_000003038.1\|3569997_3571026_-\|ROK-family-protein	gnl\|CDD\|224851	COG1940, NagC, Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism].	1.03706e-21
NC_022873.1\|WP_023522541.1\|3587290_3587530_+\|DUF3923-family-protein	gnl\|CDD\|289806	pfam13061, DUF3923, Protein of unknown function (DUF3923). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 80 amino acids in length.	2.30015e-12
NC_022873.1\|WP_000687573.1\|3569555_3569936_-\|VOC-family-protein	gnl\|CDD\|319905	cd07241, VOC_BsYyaH, vicinal oxygen chelate (VOC) family protein similar to Bacillus subtilis YyaH. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	1.46545e-64
NC_022873.1\|WP_000411478.1\|3577799_3578921_-\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	8.99178e-58
NC_022873.1\|WP_023522542.1\|3588397_3588811_-\|ATP-synthase-subunit-I	gnl\|CDD\|377159	pfam03899, ATP-synt_I, ATP synthase I chain. The atp operon of alkaliphilic Bacillus pseudofirmus OF4, as in most prokaryotes, contains the eight structural genes for the F-ATPase (ATP synthase), which are preceded by an atpI gene that encodes a membrane protein with 2 TMSs. A tenth gene, atpZ, has been found in this operon, which is upstream of and overlapping with atpI. AtpI is a Ca2+/Mg2+ transporter.	3.03215e-07
NC_022873.1\|WP_023522533.1\|3575223_3576222_-\|tryptophan--tRNA-ligase	gnl\|CDD\|183592	PRK12556, PRK12556, tryptophanyl-tRNA synthetase; Provisional.	0

>NC_022873.1|WP_023522536.1|3580398_3582897_-|collagen-like-triple-helix-repeat-containing-protein
MKNQDKCSKFQAPIPFPPPGITGPTGPTGALGGPTGPQGIQGVQGPIGPTGPQGIQGVQGVQGENGPTGPTGLTGPQGSQGNQGPMGERGPQGIQGVQGIQGERGPTGPTGIQGIQGIPGPIGPTGPTGIQGIQGMQGEIGLTGPTGIQGIQGVQGENGPTGPTGNTGIQGVQGNLGSSGLQGVTGIQGIQGPIGPTGPTGSQGIQGEQGPIGPQGETGVQGLQGPQGEMGQVGPTGSQGIQGVQGEIGPTGPTGLQGDPGPTGPTGATGITGPTGSATGPTGATGPTGPPGGPTGPTGPAGSPGGPTGPTGATGATGATGATGATGIQGVQGIQGPTGATGLTGLQGVQGPMGATGPTGDQGIQGPQGIQGVTGPTGPQGLQGIQGPLGPTGPSGPQGVQGAQGPIGPTGPQGIQGIQGEQGVRGATGPTGLQGLQGIQGPSGPTGPQGVQGVQGPSGITGPTGPQGIQGIQGPQGSIGPTGPQGIQGVQGPQGPTGHSGATGPQGIQGIQGPIGPTGPQGIQGIQGVQGPQGPTGPTGPQGLQGITGQSGATGPTGATGPTGETGPQGPQGIQGPQGATGPTGATGEAGVTGPQGIQGIQGPQGITGPTGATGPTGETGPQGLQGIQGPQGITGPTGVTGQTGLTGATGPTGIQGIQGITGATGGTGVTGPTGATGPTGLTGATGSSAISTGGGYFFSTSTSTIAANTNIPINSGSTVYGTGVSLTSATTVTVATPGIYLVSYYFQGDANGGNETVSVRLLLNGTQLTGSFIQNVTTSTVVIEPAISNTLLVNVTSANSTLILQNGPLGVGHVTTIAGAITASLNVVRIL
>NC_022873.1|WP_000945243.1|3580181_3580325_+|hypothetical-protein
MLRLSDHAIKMMEQRLRIEKQRTYQANKVVDNLHHKYFFQHIFQPKR
>NC_022873.1|WP_023522535.1|3579442_3579904_+|GNAT-family-N-acetyltransferase
MILKLNSTSFEVATSILQVQIPAYKIEADYLNSTAIPRLYDTVNDIQNCVETFYGYFSENKLVGFISFVQEEKLIDIHRLVVSPDFFQKGIATKLLIYIFNMFPSSMTYIVQTGKANTPAITLYKKHGFITVADTILPDGMILTQLKKTEYTK
>NC_022873.1|WP_000539730.1|3578984_3579233_-|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein
MGWIITLIVGAIIGAIASSITGKNFPGGMFGNIIAGLLGASLGGRLFGSFGPSFGGIHVVPALLGAIVLIFIVSFVVKAAKK
>NC_022873.1|WP_000411478.1|3577799_3578921_-|AI-2E-family-transporter
MEKINIRKRDKLRKFFREQNYLAVLLGFALLFINILLLTKISFVFTPFIVFLKTIFFPVLLAGVLFYILHPFVSLLEKKGVSRIVSIASIYLIVIGLFVFLVLTVIPIIKDQIDALIDNLPYFGHEIERAARRFGESNLLGKIQENLNIDVANIVKDYTVDFTKSLSSVTGNVTGFLSTITEVVLTFVMVPFILFYLLKDGEQLPNHFLKFISEQRQPAAMRILDDMHYAISSYIRGQIIVSLFIGIMLLIGYLIIGIKYAVLLAILAMIVNIVPYVGPIIAITPALIIAFIDSPGMVLKVIIVMMVVQLAEGKFISPQVMGKKLDIHPITIIFIILTAGNLFGIMGIILAIPGYAILKVLVTHGYRFVKLNT
>NC_022873.1|WP_023522534.1|3576612_3577770_+|1-deoxy-D-xylulose-5-phosphate-reductoisomerase
MVKYISILGSTGSIGTSALDVVSAHPEHFKIVGLTANYNIDLLEQQIKTFQPRIVSVATKDLADTLRTRISANTKITYGTDGLIAVATHPDSNLVLSSVVGVSGLLPTIEALKAKNDIAIANKETLVAAGHIVTELAKQNGCRLIPVDSEHSAIFQCLNGENNKEIEKLIVTASGGAFRDKTREEMQTLQAKDALKHPNWLMGAKLTIDSATLMNKGFEVMEARWLFDIPYEKIDVMIHKESIIHSLVEFIDGSVMAQLGAPDMRMPIQYAFHYPTRLPSSYEKLNLLEIGSLHFEKPDLEKFPCLQYAYECGKIGGTTPAVLNAANEIANALYLKNEIAFFDIEKTIYKTVEAHHNVKDPSLDAILEADQWARQYANELLIKKS
>NC_022873.1|WP_023522533.1|3575223_3576222_-|tryptophan--tRNA-ligase
MSEKIMLTGIKPTGYPHLGNYIGAIKPALQMSKNNEGKALYFIADYHALNAVHDPEKFSSYTKEVAATWLSLGLGEDVIFYRQTEVPEILELAWILACLTPKGLMNRAHAYKAKVEQNKEAGLEVDAGVNMGLYTYPILMAADILLFQATHVPVGKDQIQHIEIARDIATYFNHTFGTTFTLPEYVIQEEGAILPGLDGRKMSKSYGNVIPLFAEQAKLRKLIFKIKTDSSLPNGPKELEILFTIYKEFATEDEVQSLREKYETGIGWGDVKKELFRVVDRELAGPREKYAMYMNEPNLLYEALEKGAERARKIAKVNLVEIKKRIGFERGR
>NC_022873.1|WP_000845630.1|3574449_3575013_-|maltose-O-acetyltransferase
MKTEKEKMVAGEMYIADDEELVADRVEAKRLTRLYNEAMETGDERRFTLLNQLLGSSTDGKAQINPDFRCDYGYNIHVGKSFFANFNCVILDVCEVRIGDNCMFAPGVHIYTATHPLHPVERNSGKEYGKPVKIGNNVWVGGGAIINPGISIGDNVVIASGAVVTKDVPNNVVVGGNPAKVIKTIDL
>NC_022873.1|WP_000003038.1|3569997_3571026_-|ROK-family-protein
MSEQFVTQKSIKETILRGIRTALLERGSATKVELSNTLEISFPTISKFIEKMKQDGEVTLAGLDDSSGGRRAKRYEYNPEYMLGLAIFLEKNETNYTIFNCLGEVKEQGSTSSALIDTGLSVLTEHIESLIATFPKISSISIGVPGAVDNGRIFYIPGYEKFQNFNLKSHLEELFSIPVVIENDMNAAVLGYHKNTGNNENSSLVYLYSGQNGPGAGIMVNGDVVRGSTFFSGEISFVPQYDNKNFLQALRSEDSNNPEEYNIDAITRLIATCIAIINPHGFIFCDDEVNQIVIDQIVKSCPQYIPAEHIPKITVSNWKEDYLYGLKSLGLDLMITRTNKEN
>NC_022873.1|WP_000687573.1|3569555_3569936_-|VOC-family-protein
MKIEHVAIWVNDLERMRDFYKQYFGGEENSLYHNPKKQFESYFITFEGGARLELMKQVGIDEKVQTQTIGYAHIAFSVDSKEKVNELTNTLREAGYSVLNGPRTTGDGYYESVVSDPEGNQIEITI
>NC_022873.1|WP_023522539.1|3585622_3586537_-|tetratricopeptide-repeat-protein
MNINEKAIEMFEQNKYEEAMELFQQAVHESRDVQSLNNLAWMYFYEEENDDKALELIREVVKLNPSSYFPYNILGDIYMKQEKWTEAKEALQKSISIQPSDEAYHNVAVAHYNLGELEKASEFFLRVAGDSDYIMYSYVKCLIDLERTTEAKDKLDTFNRESDNFLGEINVADLYVELNCYKEAIEWFEKGYKECWKSPNWISRFVYALYKTNNFSRINEVIRESIEAKTAEIKDVENEEVEDNWTEKDKKELIEEYTEANNDYKTMIERIKSGYVPGLEFETDFIGGCYLFGCKRHNHLEYEQ
>NC_022873.1|WP_023522540.1|3586836_3587214_+|hypothetical-protein
MKRKLLVLLFTGIILSGCSTIAENSLETGNGSMALLTPTITTKDNELEIKTEGIDENKVTFIYVANKKVLEQKLKNGESYKLNIKDIEHAHRTDYKPKVQLLQTKDDNDDGEIVTFKQVRYTVKN
>NC_022873.1|WP_023522541.1|3587290_3587530_+|DUF3923-family-protein
MKRRWISWWIGNIFWIIVFGIWAAIIWLRDVDGAGVIQTPEIKSISLIVLLIAFIIPVFFQIIWLIINLRMSKKNNYTI
>NC_022873.1|WP_000938438.1|3587650_3588199_-|DUF2179-domain-containing-protein
MLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAGVGLLEGAIYIVSLGIVFQDLSNWMNIVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGINSIRYRLDIVAKRSREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDEHAS
>NC_022873.1|WP_023522542.1|3588397_3588811_-|ATP-synthase-subunit-I
MIQEALRVYRLQLYVIFSGLLLMWTITPFGKQVTGFGIGLAVSAYCLWLLARRVEKLGKSIVMKEKAPGLGVLNRFAAAILGAIIMYEIEHEMEMWAFGTGILGGHFLMIANLAYANIQLVKEEEKQREHASKNIEL
>NC_022873.1|WP_000402258.1|3588863_3590192_-|HlyC/CorC-family-transporter
MEIFNLVMVAILIAFTGFFVAAEFAIVKIRSSRIDQLVAEGKRGALAAKKVTTNLDEYLSACQLGITVTAMGLGWLGEPTIEKLLHPLFEKWNLNPSISSVLTFGLAFMIMTYLHVVVGELAPKTMAIQKAERVTLLLAGPLMMFYKVMYPFIWVLNGSARVITGLFGLKPASEHEVAHTEEELRLILSDSYESGEINQAEYKYVNNIFEFDNRIAKEIMVPRTEIVGFYLEDSVEEHMKVIQNERYTRYPIFGEDKDDIIGMVNVKDFFIRYMTEDQKDLSSIRSYMRPIIEVMETTPIHDLLLQMQKKRIPMAVLYDEYGGTAGIVTLEDILEEIVGEIRDEYDEDEAPPIQHVNEQHIIVDGKVLISEVKDLFGLHIEEDDVDTIGGWIMMQNHEIEEGQHVEAEGYEFKVLEKDAYQIKRVEIRKMEQEQEEEKAATV
>NC_022873.1|WP_000285635.1|3590311_3590719_-|MerR-family-transcriptional-regulator
MYRIGQLALMAHVSKRTIDYYTNLGILKAERSQSNYRYYDETAFETLQFIEKCKEMHMPLCEIKEKIEEKKKLLGINEHVSKQVNEVTDHIHQLEVELTELKPLLDGLTDSQREKISKSLSGQTTALIQTLALLL
>NC_022873.1|WP_023522543.1|3590980_3591754_+|glycosyltransferase-family-2-protein
MKKTIISHFYNEEYLLPWWLMHHTKIFDHGILINRGSTDRSVEICKLLAPHWEVRNSRFLEFDPTNTDIEVMEIEREVSGWKIVLNTTEFFCCNNTEEFFSSLHTLGQNMYAIRMILMIDNHNYNYSKPRYSIPLVEQRYHGVFPYNPSLGCAWRFIHTHLDGAYLPGRHHSRHGYIIYDYPSFILKFYFSPWNEQSKARKLQITPTLSKRGIQMGLQTHYGQSPEVLDIRFLELSNLTQDLRHNPEYQELFPKFKP
>NC_022873.1|WP_023522544.1|3591869_3592637_+|glucose-1-phosphate-cytidylyltransferase
MKAVILAGGYGTRIGEETHLKPKPMIEIGTKPILWHIMSLYSHYGITEFIICLGYKGYAIKEFFLNYNLHMSDFTIQLSDNTITSHSHRVEPWKVTLIDTGVNTETGGRVKKIQNYVGDEPFCLTYGDGLSNVNIKELITFHKKHGKMATVTAVQPPGRFGSLILDKQSVTSFQEKPLGDGGWVNGGFFVLNPEVFNYISGDKSVFETDTLVQLVNKNELAAYQHSGFWHPMDTLRDKNKLVELWESNNAPWKVW
>NC_022873.1|WP_023522545.1|3592638_3593694_+|CDP-glucose-4,6-dehydratase
MASSSFWNKKKVFITGHTGFKGSWLTLFLSSLGAEVVGFSSHPPSIPNIFEQGNVAKECTTMKGDITDYHSLCHAMKQHKPDIIFHLAAQPIVTASYKNPIDTFKTNVLGTVHVLEAAKSVESVRAIINVTSDKCYENDGSGDGAFVENDRLGGFDPYSASKACAELVTTSYHKSFFHTNTTSLASVRAGNVIGGGDWAEDRLFPDIIRAYLHNHTLCIRNKYAIRPWQHVLDPLHGYILLAEKLWNDAKYAETWNFGPINEPSRTVNDVIQSVMKLWNKRLTIHSPSTKTPYESPILTLNSTKAVNKLDWTPKLSTDDSITWTVDWYKKYASGENIESFTRQQIDAFKNL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_022873_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_022873_6

3584591-3584670

Orphan

Consensus_repeat	Method
ACCTTCTGCACCTGTTGGACCAGTTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_022873_6

>merge|NC_022873|6|3584591-3584670|CRISPRCasFinder
GCCTTGTAAACCTATTGCACCTGTTATCCCCTTTATTCCACTTATCCCTTGAGCACCTTGTATTCCAGTAGAACCAGTTG

>NC_022873|6|6|3584591-3584670|CRISPRCasFinder
GCCTTGTAAACCTATTGCACCTGTTA	TCCCCTTTATTCCACTTATCCCTTGAGC
ACCTTGTATTCCAGTAGAACCAGTTG

Protein	Signature genes	Signature genes Name	Protein_function
NC_022873.1\|WP_023522539.1\|3585622_3586537_-\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|276809
NC_022873.1\|WP_023522536.1\|3580398_3582897_-\|collagen-like-triple-helix-repeat-containing-protein	unknown	unknown	gnl\|CDD\|375999
NC_022873.1\|WP_023522535.1\|3579442_3579904_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379326
NC_022873.1\|WP_000402258.1\|3588863_3590192_-\|HlyC/CorC-family-transporter	unknown	unknown	gnl\|CDD\|224173
NC_022873.1\|WP_000845630.1\|3574449_3575013_-\|maltose-O-acetyltransferase	unknown	unknown	gnl\|CDD\|182235
NC_022873.1\|WP_000945243.1\|3580181_3580325_+\|hypothetical-protein	unknown	unknown	unknown
NC_022873.1\|WP_023522543.1\|3590980_3591754_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|372681
NC_022873.1\|WP_023522545.1\|3592638_3593694_+\|CDP-glucose-4,6-dehydratase	unknown	unknown	gnl\|CDD\|274236
NC_022873.1\|WP_023522534.1\|3576612_3577770_+\|1-deoxy-D-xylulose-5-phosphate-reductoisomerase	unknown	unknown	gnl\|CDD\|237107
NC_022873.1\|WP_000539730.1\|3578984_3579233_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	unknown	unknown	gnl\|CDD\|225170
NC_022873.1\|WP_000285635.1\|3590311_3590719_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133406
NC_022873.1\|WP_023522544.1\|3591869_3592637_+\|glucose-1-phosphate-cytidylyltransferase	unknown	unknown	gnl\|CDD\|131672
NC_022873.1\|WP_000938438.1\|3587650_3588199_-\|DUF2179-domain-containing-protein	unknown	unknown	gnl\|CDD\|235234
NC_022873.1\|WP_000003038.1\|3569997_3571026_-\|ROK-family-protein	unknown	unknown	gnl\|CDD\|224851
NC_022873.1\|WP_023522540.1\|3586836_3587214_+\|hypothetical-protein	unknown	unknown	unknown
NC_022873.1\|WP_000687573.1\|3569555_3569936_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319905
NC_022873.1\|WP_000411478.1\|3577799_3578921_-\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
NC_022873.1\|WP_023522542.1\|3588397_3588811_-\|ATP-synthase-subunit-I	unknown	unknown	gnl\|CDD\|377159
NC_022873.1\|WP_023522533.1\|3575223_3576222_-\|tryptophan--tRNA-ligase	unknown	unknown	gnl\|CDD\|183592
NC_022873.1\|WP_023522541.1\|3587290_3587530_+\|DUF3923-family-protein	unknown	unknown	gnl\|CDD\|289806

Protein	Function_ID	Function_description	E-value
NC_022873.1\|WP_023522539.1\|3585622_3586537_-\|tetratricopeptide-repeat-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	3.09775e-14
NC_022873.1\|WP_023522536.1\|3580398_3582897_-\|collagen-like-triple-helix-repeat-containing-protein	gnl\|CDD\|375999	pfam18573, BclA_C, BclA C-terminal domain. This is the C-terminal domain of BclA (Bacillus collagen-like protein of anthracis) which is expressed on spores of Bacillus species. Trimers of the C-terminal domain (CTD) form the tips of the spore's hair-like nap and are the immunodominant target of vertebrate antibodies and drive trimerization. Structure analysis indicate the C-terminal region of the peptide folding into an all-beta structure with a jelly-fold topology, similar to the first human complement C1q, a member of the tumor necrosis factor (TNF)-like family. The C-terminal globular domain has been shown to be located on the exterior of the exosporium, and therefore is critical in determining the immunogenicity of the spore in a mammalian host.	8.37841e-08
NC_022873.1\|WP_023522535.1\|3579442_3579904_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379326	pfam13673, Acetyltransf_10, Acetyltransferase (GNAT) domain. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.19703e-12
NC_022873.1\|WP_000402258.1\|3588863_3590192_-\|HlyC/CorC-family-transporter	gnl\|CDD\|224173	COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only].	1.44362e-160
NC_022873.1\|WP_000845630.1\|3574449_3575013_-\|maltose-O-acetyltransferase	gnl\|CDD\|182235	PRK10092, PRK10092, maltose O-acetyltransferase; Provisional.	8.14217e-101
NC_022873.1\|WP_023522543.1\|3590980_3591754_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|372681	pfam13704, Glyco_tranf_2_4, Glycosyl transferase family 2. Members of this family of prokaryotic proteins include putative glucosyltransferases,.	1.43653e-09
NC_022873.1\|WP_023522545.1\|3592638_3593694_+\|CDP-glucose-4,6-dehydratase	gnl\|CDD\|274236	TIGR02622, CDP-glucose_46-dehydratase, CDP-glucose 4,6-dehydratase. Members of this protein family are CDP-glucose 4,6-dehydratase from a variety of Gram-negative and Gram-positive bacteria. Members typically are encoded next to a gene that encodes a glucose-1-phosphate cytidylyltransferase, which produces the substrate, CDP-D-glucose, used by this enzyme to produce CDP-4-keto-6-deoxyglucose. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	0
NC_022873.1\|WP_023522534.1\|3576612_3577770_+\|1-deoxy-D-xylulose-5-phosphate-reductoisomerase	gnl\|CDD\|237107	PRK12464, PRK12464, 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional.	0
NC_022873.1\|WP_000539730.1\|3578984_3579233_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	gnl\|CDD\|225170	COG2261, COG2261, Predicted membrane protein [Function unknown].	5.47241e-09
NC_022873.1\|WP_000285635.1\|3590311_3590719_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133406	cd04779, HTH_MerR-like_sg4, Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily. Putative helix-turn-helix (HTH) MerR-like transcription regulators (subgroup 4). Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	3.12673e-60
NC_022873.1\|WP_023522544.1\|3591869_3592637_+\|glucose-1-phosphate-cytidylyltransferase	gnl\|CDD\|131672	TIGR02623, Glucose-1-phosphate_cytidylyltransferase, glucose-1-phosphate cytidylyltransferase. Members of this family are the enzyme glucose-1-phosphate cytidylyltransferase, also called CDP-glucose pyrophosphorylase, the product of the rfbF gene. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	0
NC_022873.1\|WP_000938438.1\|3587650_3588199_-\|DUF2179-domain-containing-protein	gnl\|CDD\|235234	PRK04164, PRK04164, hypothetical protein; Provisional.	6.88941e-83
NC_022873.1\|WP_000003038.1\|3569997_3571026_-\|ROK-family-protein	gnl\|CDD\|224851	COG1940, NagC, Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism].	1.03706e-21
NC_022873.1\|WP_023522541.1\|3587290_3587530_+\|DUF3923-family-protein	gnl\|CDD\|289806	pfam13061, DUF3923, Protein of unknown function (DUF3923). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 80 amino acids in length.	2.30015e-12
NC_022873.1\|WP_000687573.1\|3569555_3569936_-\|VOC-family-protein	gnl\|CDD\|319905	cd07241, VOC_BsYyaH, vicinal oxygen chelate (VOC) family protein similar to Bacillus subtilis YyaH. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	1.46545e-64
NC_022873.1\|WP_000411478.1\|3577799_3578921_-\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	8.99178e-58
NC_022873.1\|WP_023522542.1\|3588397_3588811_-\|ATP-synthase-subunit-I	gnl\|CDD\|377159	pfam03899, ATP-synt_I, ATP synthase I chain. The atp operon of alkaliphilic Bacillus pseudofirmus OF4, as in most prokaryotes, contains the eight structural genes for the F-ATPase (ATP synthase), which are preceded by an atpI gene that encodes a membrane protein with 2 TMSs. A tenth gene, atpZ, has been found in this operon, which is upstream of and overlapping with atpI. AtpI is a Ca2+/Mg2+ transporter.	3.03215e-07
NC_022873.1\|WP_023522533.1\|3575223_3576222_-\|tryptophan--tRNA-ligase	gnl\|CDD\|183592	PRK12556, PRK12556, tryptophanyl-tRNA synthetase; Provisional.	0

>NC_022873.1|WP_023522536.1|3580398_3582897_-|collagen-like-triple-helix-repeat-containing-protein
MKNQDKCSKFQAPIPFPPPGITGPTGPTGALGGPTGPQGIQGVQGPIGPTGPQGIQGVQGVQGENGPTGPTGLTGPQGSQGNQGPMGERGPQGIQGVQGIQGERGPTGPTGIQGIQGIPGPIGPTGPTGIQGIQGMQGEIGLTGPTGIQGIQGVQGENGPTGPTGNTGIQGVQGNLGSSGLQGVTGIQGIQGPIGPTGPTGSQGIQGEQGPIGPQGETGVQGLQGPQGEMGQVGPTGSQGIQGVQGEIGPTGPTGLQGDPGPTGPTGATGITGPTGSATGPTGATGPTGPPGGPTGPTGPAGSPGGPTGPTGATGATGATGATGATGIQGVQGIQGPTGATGLTGLQGVQGPMGATGPTGDQGIQGPQGIQGVTGPTGPQGLQGIQGPLGPTGPSGPQGVQGAQGPIGPTGPQGIQGIQGEQGVRGATGPTGLQGLQGIQGPSGPTGPQGVQGVQGPSGITGPTGPQGIQGIQGPQGSIGPTGPQGIQGVQGPQGPTGHSGATGPQGIQGIQGPIGPTGPQGIQGIQGVQGPQGPTGPTGPQGLQGITGQSGATGPTGATGPTGETGPQGPQGIQGPQGATGPTGATGEAGVTGPQGIQGIQGPQGITGPTGATGPTGETGPQGLQGIQGPQGITGPTGVTGQTGLTGATGPTGIQGIQGITGATGGTGVTGPTGATGPTGLTGATGSSAISTGGGYFFSTSTSTIAANTNIPINSGSTVYGTGVSLTSATTVTVATPGIYLVSYYFQGDANGGNETVSVRLLLNGTQLTGSFIQNVTTSTVVIEPAISNTLLVNVTSANSTLILQNGPLGVGHVTTIAGAITASLNVVRIL
>NC_022873.1|WP_000945243.1|3580181_3580325_+|hypothetical-protein
MLRLSDHAIKMMEQRLRIEKQRTYQANKVVDNLHHKYFFQHIFQPKR
>NC_022873.1|WP_023522535.1|3579442_3579904_+|GNAT-family-N-acetyltransferase
MILKLNSTSFEVATSILQVQIPAYKIEADYLNSTAIPRLYDTVNDIQNCVETFYGYFSENKLVGFISFVQEEKLIDIHRLVVSPDFFQKGIATKLLIYIFNMFPSSMTYIVQTGKANTPAITLYKKHGFITVADTILPDGMILTQLKKTEYTK
>NC_022873.1|WP_000539730.1|3578984_3579233_-|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein
MGWIITLIVGAIIGAIASSITGKNFPGGMFGNIIAGLLGASLGGRLFGSFGPSFGGIHVVPALLGAIVLIFIVSFVVKAAKK
>NC_022873.1|WP_000411478.1|3577799_3578921_-|AI-2E-family-transporter
MEKINIRKRDKLRKFFREQNYLAVLLGFALLFINILLLTKISFVFTPFIVFLKTIFFPVLLAGVLFYILHPFVSLLEKKGVSRIVSIASIYLIVIGLFVFLVLTVIPIIKDQIDALIDNLPYFGHEIERAARRFGESNLLGKIQENLNIDVANIVKDYTVDFTKSLSSVTGNVTGFLSTITEVVLTFVMVPFILFYLLKDGEQLPNHFLKFISEQRQPAAMRILDDMHYAISSYIRGQIIVSLFIGIMLLIGYLIIGIKYAVLLAILAMIVNIVPYVGPIIAITPALIIAFIDSPGMVLKVIIVMMVVQLAEGKFISPQVMGKKLDIHPITIIFIILTAGNLFGIMGIILAIPGYAILKVLVTHGYRFVKLNT
>NC_022873.1|WP_023522534.1|3576612_3577770_+|1-deoxy-D-xylulose-5-phosphate-reductoisomerase
MVKYISILGSTGSIGTSALDVVSAHPEHFKIVGLTANYNIDLLEQQIKTFQPRIVSVATKDLADTLRTRISANTKITYGTDGLIAVATHPDSNLVLSSVVGVSGLLPTIEALKAKNDIAIANKETLVAAGHIVTELAKQNGCRLIPVDSEHSAIFQCLNGENNKEIEKLIVTASGGAFRDKTREEMQTLQAKDALKHPNWLMGAKLTIDSATLMNKGFEVMEARWLFDIPYEKIDVMIHKESIIHSLVEFIDGSVMAQLGAPDMRMPIQYAFHYPTRLPSSYEKLNLLEIGSLHFEKPDLEKFPCLQYAYECGKIGGTTPAVLNAANEIANALYLKNEIAFFDIEKTIYKTVEAHHNVKDPSLDAILEADQWARQYANELLIKKS
>NC_022873.1|WP_023522533.1|3575223_3576222_-|tryptophan--tRNA-ligase
MSEKIMLTGIKPTGYPHLGNYIGAIKPALQMSKNNEGKALYFIADYHALNAVHDPEKFSSYTKEVAATWLSLGLGEDVIFYRQTEVPEILELAWILACLTPKGLMNRAHAYKAKVEQNKEAGLEVDAGVNMGLYTYPILMAADILLFQATHVPVGKDQIQHIEIARDIATYFNHTFGTTFTLPEYVIQEEGAILPGLDGRKMSKSYGNVIPLFAEQAKLRKLIFKIKTDSSLPNGPKELEILFTIYKEFATEDEVQSLREKYETGIGWGDVKKELFRVVDRELAGPREKYAMYMNEPNLLYEALEKGAERARKIAKVNLVEIKKRIGFERGR
>NC_022873.1|WP_000845630.1|3574449_3575013_-|maltose-O-acetyltransferase
MKTEKEKMVAGEMYIADDEELVADRVEAKRLTRLYNEAMETGDERRFTLLNQLLGSSTDGKAQINPDFRCDYGYNIHVGKSFFANFNCVILDVCEVRIGDNCMFAPGVHIYTATHPLHPVERNSGKEYGKPVKIGNNVWVGGGAIINPGISIGDNVVIASGAVVTKDVPNNVVVGGNPAKVIKTIDL
>NC_022873.1|WP_000003038.1|3569997_3571026_-|ROK-family-protein
MSEQFVTQKSIKETILRGIRTALLERGSATKVELSNTLEISFPTISKFIEKMKQDGEVTLAGLDDSSGGRRAKRYEYNPEYMLGLAIFLEKNETNYTIFNCLGEVKEQGSTSSALIDTGLSVLTEHIESLIATFPKISSISIGVPGAVDNGRIFYIPGYEKFQNFNLKSHLEELFSIPVVIENDMNAAVLGYHKNTGNNENSSLVYLYSGQNGPGAGIMVNGDVVRGSTFFSGEISFVPQYDNKNFLQALRSEDSNNPEEYNIDAITRLIATCIAIINPHGFIFCDDEVNQIVIDQIVKSCPQYIPAEHIPKITVSNWKEDYLYGLKSLGLDLMITRTNKEN
>NC_022873.1|WP_000687573.1|3569555_3569936_-|VOC-family-protein
MKIEHVAIWVNDLERMRDFYKQYFGGEENSLYHNPKKQFESYFITFEGGARLELMKQVGIDEKVQTQTIGYAHIAFSVDSKEKVNELTNTLREAGYSVLNGPRTTGDGYYESVVSDPEGNQIEITI
>NC_022873.1|WP_023522539.1|3585622_3586537_-|tetratricopeptide-repeat-protein
MNINEKAIEMFEQNKYEEAMELFQQAVHESRDVQSLNNLAWMYFYEEENDDKALELIREVVKLNPSSYFPYNILGDIYMKQEKWTEAKEALQKSISIQPSDEAYHNVAVAHYNLGELEKASEFFLRVAGDSDYIMYSYVKCLIDLERTTEAKDKLDTFNRESDNFLGEINVADLYVELNCYKEAIEWFEKGYKECWKSPNWISRFVYALYKTNNFSRINEVIRESIEAKTAEIKDVENEEVEDNWTEKDKKELIEEYTEANNDYKTMIERIKSGYVPGLEFETDFIGGCYLFGCKRHNHLEYEQ
>NC_022873.1|WP_023522540.1|3586836_3587214_+|hypothetical-protein
MKRKLLVLLFTGIILSGCSTIAENSLETGNGSMALLTPTITTKDNELEIKTEGIDENKVTFIYVANKKVLEQKLKNGESYKLNIKDIEHAHRTDYKPKVQLLQTKDDNDDGEIVTFKQVRYTVKN
>NC_022873.1|WP_023522541.1|3587290_3587530_+|DUF3923-family-protein
MKRRWISWWIGNIFWIIVFGIWAAIIWLRDVDGAGVIQTPEIKSISLIVLLIAFIIPVFFQIIWLIINLRMSKKNNYTI
>NC_022873.1|WP_000938438.1|3587650_3588199_-|DUF2179-domain-containing-protein
MLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAGVGLLEGAIYIVSLGIVFQDLSNWMNIVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGINSIRYRLDIVAKRSREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDEHAS
>NC_022873.1|WP_023522542.1|3588397_3588811_-|ATP-synthase-subunit-I
MIQEALRVYRLQLYVIFSGLLLMWTITPFGKQVTGFGIGLAVSAYCLWLLARRVEKLGKSIVMKEKAPGLGVLNRFAAAILGAIIMYEIEHEMEMWAFGTGILGGHFLMIANLAYANIQLVKEEEKQREHASKNIEL
>NC_022873.1|WP_000402258.1|3588863_3590192_-|HlyC/CorC-family-transporter
MEIFNLVMVAILIAFTGFFVAAEFAIVKIRSSRIDQLVAEGKRGALAAKKVTTNLDEYLSACQLGITVTAMGLGWLGEPTIEKLLHPLFEKWNLNPSISSVLTFGLAFMIMTYLHVVVGELAPKTMAIQKAERVTLLLAGPLMMFYKVMYPFIWVLNGSARVITGLFGLKPASEHEVAHTEEELRLILSDSYESGEINQAEYKYVNNIFEFDNRIAKEIMVPRTEIVGFYLEDSVEEHMKVIQNERYTRYPIFGEDKDDIIGMVNVKDFFIRYMTEDQKDLSSIRSYMRPIIEVMETTPIHDLLLQMQKKRIPMAVLYDEYGGTAGIVTLEDILEEIVGEIRDEYDEDEAPPIQHVNEQHIIVDGKVLISEVKDLFGLHIEEDDVDTIGGWIMMQNHEIEEGQHVEAEGYEFKVLEKDAYQIKRVEIRKMEQEQEEEKAATV
>NC_022873.1|WP_000285635.1|3590311_3590719_-|MerR-family-transcriptional-regulator
MYRIGQLALMAHVSKRTIDYYTNLGILKAERSQSNYRYYDETAFETLQFIEKCKEMHMPLCEIKEKIEEKKKLLGINEHVSKQVNEVTDHIHQLEVELTELKPLLDGLTDSQREKISKSLSGQTTALIQTLALLL
>NC_022873.1|WP_023522543.1|3590980_3591754_+|glycosyltransferase-family-2-protein
MKKTIISHFYNEEYLLPWWLMHHTKIFDHGILINRGSTDRSVEICKLLAPHWEVRNSRFLEFDPTNTDIEVMEIEREVSGWKIVLNTTEFFCCNNTEEFFSSLHTLGQNMYAIRMILMIDNHNYNYSKPRYSIPLVEQRYHGVFPYNPSLGCAWRFIHTHLDGAYLPGRHHSRHGYIIYDYPSFILKFYFSPWNEQSKARKLQITPTLSKRGIQMGLQTHYGQSPEVLDIRFLELSNLTQDLRHNPEYQELFPKFKP
>NC_022873.1|WP_023522544.1|3591869_3592637_+|glucose-1-phosphate-cytidylyltransferase
MKAVILAGGYGTRIGEETHLKPKPMIEIGTKPILWHIMSLYSHYGITEFIICLGYKGYAIKEFFLNYNLHMSDFTIQLSDNTITSHSHRVEPWKVTLIDTGVNTETGGRVKKIQNYVGDEPFCLTYGDGLSNVNIKELITFHKKHGKMATVTAVQPPGRFGSLILDKQSVTSFQEKPLGDGGWVNGGFFVLNPEVFNYISGDKSVFETDTLVQLVNKNELAAYQHSGFWHPMDTLRDKNKLVELWESNNAPWKVW
>NC_022873.1|WP_023522545.1|3592638_3593694_+|CDP-glucose-4,6-dehydratase
MASSSFWNKKKVFITGHTGFKGSWLTLFLSSLGAEVVGFSSHPPSIPNIFEQGNVAKECTTMKGDITDYHSLCHAMKQHKPDIIFHLAAQPIVTASYKNPIDTFKTNVLGTVHVLEAAKSVESVRAIINVTSDKCYENDGSGDGAFVENDRLGGFDPYSASKACAELVTTSYHKSFFHTNTTSLASVRAGNVIGGGDWAEDRLFPDIIRAYLHNHTLCIRNKYAIRPWQHVLDPLHGYILLAEKLWNDAKYAETWNFGPINEPSRTVNDVIQSVMKLWNKRLTIHSPSTKTPYESPILTLNSTKAVNKLDWTPKLSTDDSITWTVDWYKKYASGENIESFTRQQIDAFKNL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_022873_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_022873_4

3584069-3584203

Orphan

Consensus_repeat	Method
ACCTTCTGCACCTGTTGGACCAGTTA	CRISPRCasFinder

2 spacers

The CRISPR arrays of NC_022873_4

>merge|NC_022873|4|3584069-3584203|CRISPRCasFinder
TCCTTGTGCACCCGTTGGACCTATTACACCTTGAATACCTTGAATACCTTTAGGACCTTCTGCACCTGTTGGACCAGTTACTCCCAGCGGACCTTGTATTCCCTGAGAACCTTCTGCACCTGTTGGACCTGTTAT

>NC_022873|4|4|3584069-3584203|CRISPRCasFinder
TCCTTGTGCACCCGTTGGACCTATTA	CACCTTGAATACCTTGAAT
ACCTTTAGGACCTTCTGCACCTGTTG	GACCAGTTACTCCCAGCGGACCTTGTATTCCCTGAGA
ACCTTCTGCACCTGTTGGACCTGTTAT

Protein	Signature genes	Signature genes Name	Protein_function
NC_022873.1\|WP_023522539.1\|3585622_3586537_-\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|276809
NC_022873.1\|WP_023522536.1\|3580398_3582897_-\|collagen-like-triple-helix-repeat-containing-protein	unknown	unknown	gnl\|CDD\|375999
NC_022873.1\|WP_023522535.1\|3579442_3579904_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379326
NC_022873.1\|WP_000402258.1\|3588863_3590192_-\|HlyC/CorC-family-transporter	unknown	unknown	gnl\|CDD\|224173
NC_022873.1\|WP_000845630.1\|3574449_3575013_-\|maltose-O-acetyltransferase	unknown	unknown	gnl\|CDD\|182235
NC_022873.1\|WP_000945243.1\|3580181_3580325_+\|hypothetical-protein	unknown	unknown	unknown
NC_022873.1\|WP_023522543.1\|3590980_3591754_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|372681
NC_022873.1\|WP_023522545.1\|3592638_3593694_+\|CDP-glucose-4,6-dehydratase	unknown	unknown	gnl\|CDD\|274236
NC_022873.1\|WP_023522534.1\|3576612_3577770_+\|1-deoxy-D-xylulose-5-phosphate-reductoisomerase	unknown	unknown	gnl\|CDD\|237107
NC_022873.1\|WP_000539730.1\|3578984_3579233_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	unknown	unknown	gnl\|CDD\|225170
NC_022873.1\|WP_000285635.1\|3590311_3590719_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133406
NC_022873.1\|WP_023522544.1\|3591869_3592637_+\|glucose-1-phosphate-cytidylyltransferase	unknown	unknown	gnl\|CDD\|131672
NC_022873.1\|WP_000938438.1\|3587650_3588199_-\|DUF2179-domain-containing-protein	unknown	unknown	gnl\|CDD\|235234
NC_022873.1\|WP_000003038.1\|3569997_3571026_-\|ROK-family-protein	unknown	unknown	gnl\|CDD\|224851
NC_022873.1\|WP_023522540.1\|3586836_3587214_+\|hypothetical-protein	unknown	unknown	unknown
NC_022873.1\|WP_000687573.1\|3569555_3569936_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319905
NC_022873.1\|WP_000411478.1\|3577799_3578921_-\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
NC_022873.1\|WP_023522542.1\|3588397_3588811_-\|ATP-synthase-subunit-I	unknown	unknown	gnl\|CDD\|377159
NC_022873.1\|WP_023522533.1\|3575223_3576222_-\|tryptophan--tRNA-ligase	unknown	unknown	gnl\|CDD\|183592
NC_022873.1\|WP_023522541.1\|3587290_3587530_+\|DUF3923-family-protein	unknown	unknown	gnl\|CDD\|289806

Protein	Function_ID	Function_description	E-value
NC_022873.1\|WP_023522539.1\|3585622_3586537_-\|tetratricopeptide-repeat-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	3.09775e-14
NC_022873.1\|WP_023522536.1\|3580398_3582897_-\|collagen-like-triple-helix-repeat-containing-protein	gnl\|CDD\|375999	pfam18573, BclA_C, BclA C-terminal domain. This is the C-terminal domain of BclA (Bacillus collagen-like protein of anthracis) which is expressed on spores of Bacillus species. Trimers of the C-terminal domain (CTD) form the tips of the spore's hair-like nap and are the immunodominant target of vertebrate antibodies and drive trimerization. Structure analysis indicate the C-terminal region of the peptide folding into an all-beta structure with a jelly-fold topology, similar to the first human complement C1q, a member of the tumor necrosis factor (TNF)-like family. The C-terminal globular domain has been shown to be located on the exterior of the exosporium, and therefore is critical in determining the immunogenicity of the spore in a mammalian host.	8.37841e-08
NC_022873.1\|WP_023522535.1\|3579442_3579904_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379326	pfam13673, Acetyltransf_10, Acetyltransferase (GNAT) domain. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.19703e-12
NC_022873.1\|WP_000402258.1\|3588863_3590192_-\|HlyC/CorC-family-transporter	gnl\|CDD\|224173	COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only].	1.44362e-160
NC_022873.1\|WP_000845630.1\|3574449_3575013_-\|maltose-O-acetyltransferase	gnl\|CDD\|182235	PRK10092, PRK10092, maltose O-acetyltransferase; Provisional.	8.14217e-101
NC_022873.1\|WP_023522543.1\|3590980_3591754_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|372681	pfam13704, Glyco_tranf_2_4, Glycosyl transferase family 2. Members of this family of prokaryotic proteins include putative glucosyltransferases,.	1.43653e-09
NC_022873.1\|WP_023522545.1\|3592638_3593694_+\|CDP-glucose-4,6-dehydratase	gnl\|CDD\|274236	TIGR02622, CDP-glucose_46-dehydratase, CDP-glucose 4,6-dehydratase. Members of this protein family are CDP-glucose 4,6-dehydratase from a variety of Gram-negative and Gram-positive bacteria. Members typically are encoded next to a gene that encodes a glucose-1-phosphate cytidylyltransferase, which produces the substrate, CDP-D-glucose, used by this enzyme to produce CDP-4-keto-6-deoxyglucose. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	0
NC_022873.1\|WP_023522534.1\|3576612_3577770_+\|1-deoxy-D-xylulose-5-phosphate-reductoisomerase	gnl\|CDD\|237107	PRK12464, PRK12464, 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional.	0
NC_022873.1\|WP_000539730.1\|3578984_3579233_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	gnl\|CDD\|225170	COG2261, COG2261, Predicted membrane protein [Function unknown].	5.47241e-09
NC_022873.1\|WP_000285635.1\|3590311_3590719_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133406	cd04779, HTH_MerR-like_sg4, Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily. Putative helix-turn-helix (HTH) MerR-like transcription regulators (subgroup 4). Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	3.12673e-60
NC_022873.1\|WP_023522544.1\|3591869_3592637_+\|glucose-1-phosphate-cytidylyltransferase	gnl\|CDD\|131672	TIGR02623, Glucose-1-phosphate_cytidylyltransferase, glucose-1-phosphate cytidylyltransferase. Members of this family are the enzyme glucose-1-phosphate cytidylyltransferase, also called CDP-glucose pyrophosphorylase, the product of the rfbF gene. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	0
NC_022873.1\|WP_000938438.1\|3587650_3588199_-\|DUF2179-domain-containing-protein	gnl\|CDD\|235234	PRK04164, PRK04164, hypothetical protein; Provisional.	6.88941e-83
NC_022873.1\|WP_000003038.1\|3569997_3571026_-\|ROK-family-protein	gnl\|CDD\|224851	COG1940, NagC, Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism].	1.03706e-21
NC_022873.1\|WP_023522541.1\|3587290_3587530_+\|DUF3923-family-protein	gnl\|CDD\|289806	pfam13061, DUF3923, Protein of unknown function (DUF3923). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 80 amino acids in length.	2.30015e-12
NC_022873.1\|WP_000687573.1\|3569555_3569936_-\|VOC-family-protein	gnl\|CDD\|319905	cd07241, VOC_BsYyaH, vicinal oxygen chelate (VOC) family protein similar to Bacillus subtilis YyaH. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	1.46545e-64
NC_022873.1\|WP_000411478.1\|3577799_3578921_-\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	8.99178e-58
NC_022873.1\|WP_023522542.1\|3588397_3588811_-\|ATP-synthase-subunit-I	gnl\|CDD\|377159	pfam03899, ATP-synt_I, ATP synthase I chain. The atp operon of alkaliphilic Bacillus pseudofirmus OF4, as in most prokaryotes, contains the eight structural genes for the F-ATPase (ATP synthase), which are preceded by an atpI gene that encodes a membrane protein with 2 TMSs. A tenth gene, atpZ, has been found in this operon, which is upstream of and overlapping with atpI. AtpI is a Ca2+/Mg2+ transporter.	3.03215e-07
NC_022873.1\|WP_023522533.1\|3575223_3576222_-\|tryptophan--tRNA-ligase	gnl\|CDD\|183592	PRK12556, PRK12556, tryptophanyl-tRNA synthetase; Provisional.	0

>NC_022873.1|WP_023522536.1|3580398_3582897_-|collagen-like-triple-helix-repeat-containing-protein
MKNQDKCSKFQAPIPFPPPGITGPTGPTGALGGPTGPQGIQGVQGPIGPTGPQGIQGVQGVQGENGPTGPTGLTGPQGSQGNQGPMGERGPQGIQGVQGIQGERGPTGPTGIQGIQGIPGPIGPTGPTGIQGIQGMQGEIGLTGPTGIQGIQGVQGENGPTGPTGNTGIQGVQGNLGSSGLQGVTGIQGIQGPIGPTGPTGSQGIQGEQGPIGPQGETGVQGLQGPQGEMGQVGPTGSQGIQGVQGEIGPTGPTGLQGDPGPTGPTGATGITGPTGSATGPTGATGPTGPPGGPTGPTGPAGSPGGPTGPTGATGATGATGATGATGIQGVQGIQGPTGATGLTGLQGVQGPMGATGPTGDQGIQGPQGIQGVTGPTGPQGLQGIQGPLGPTGPSGPQGVQGAQGPIGPTGPQGIQGIQGEQGVRGATGPTGLQGLQGIQGPSGPTGPQGVQGVQGPSGITGPTGPQGIQGIQGPQGSIGPTGPQGIQGVQGPQGPTGHSGATGPQGIQGIQGPIGPTGPQGIQGIQGVQGPQGPTGPTGPQGLQGITGQSGATGPTGATGPTGETGPQGPQGIQGPQGATGPTGATGEAGVTGPQGIQGIQGPQGITGPTGATGPTGETGPQGLQGIQGPQGITGPTGVTGQTGLTGATGPTGIQGIQGITGATGGTGVTGPTGATGPTGLTGATGSSAISTGGGYFFSTSTSTIAANTNIPINSGSTVYGTGVSLTSATTVTVATPGIYLVSYYFQGDANGGNETVSVRLLLNGTQLTGSFIQNVTTSTVVIEPAISNTLLVNVTSANSTLILQNGPLGVGHVTTIAGAITASLNVVRIL
>NC_022873.1|WP_000945243.1|3580181_3580325_+|hypothetical-protein
MLRLSDHAIKMMEQRLRIEKQRTYQANKVVDNLHHKYFFQHIFQPKR
>NC_022873.1|WP_023522535.1|3579442_3579904_+|GNAT-family-N-acetyltransferase
MILKLNSTSFEVATSILQVQIPAYKIEADYLNSTAIPRLYDTVNDIQNCVETFYGYFSENKLVGFISFVQEEKLIDIHRLVVSPDFFQKGIATKLLIYIFNMFPSSMTYIVQTGKANTPAITLYKKHGFITVADTILPDGMILTQLKKTEYTK
>NC_022873.1|WP_000539730.1|3578984_3579233_-|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein
MGWIITLIVGAIIGAIASSITGKNFPGGMFGNIIAGLLGASLGGRLFGSFGPSFGGIHVVPALLGAIVLIFIVSFVVKAAKK
>NC_022873.1|WP_000411478.1|3577799_3578921_-|AI-2E-family-transporter
MEKINIRKRDKLRKFFREQNYLAVLLGFALLFINILLLTKISFVFTPFIVFLKTIFFPVLLAGVLFYILHPFVSLLEKKGVSRIVSIASIYLIVIGLFVFLVLTVIPIIKDQIDALIDNLPYFGHEIERAARRFGESNLLGKIQENLNIDVANIVKDYTVDFTKSLSSVTGNVTGFLSTITEVVLTFVMVPFILFYLLKDGEQLPNHFLKFISEQRQPAAMRILDDMHYAISSYIRGQIIVSLFIGIMLLIGYLIIGIKYAVLLAILAMIVNIVPYVGPIIAITPALIIAFIDSPGMVLKVIIVMMVVQLAEGKFISPQVMGKKLDIHPITIIFIILTAGNLFGIMGIILAIPGYAILKVLVTHGYRFVKLNT
>NC_022873.1|WP_023522534.1|3576612_3577770_+|1-deoxy-D-xylulose-5-phosphate-reductoisomerase
MVKYISILGSTGSIGTSALDVVSAHPEHFKIVGLTANYNIDLLEQQIKTFQPRIVSVATKDLADTLRTRISANTKITYGTDGLIAVATHPDSNLVLSSVVGVSGLLPTIEALKAKNDIAIANKETLVAAGHIVTELAKQNGCRLIPVDSEHSAIFQCLNGENNKEIEKLIVTASGGAFRDKTREEMQTLQAKDALKHPNWLMGAKLTIDSATLMNKGFEVMEARWLFDIPYEKIDVMIHKESIIHSLVEFIDGSVMAQLGAPDMRMPIQYAFHYPTRLPSSYEKLNLLEIGSLHFEKPDLEKFPCLQYAYECGKIGGTTPAVLNAANEIANALYLKNEIAFFDIEKTIYKTVEAHHNVKDPSLDAILEADQWARQYANELLIKKS
>NC_022873.1|WP_023522533.1|3575223_3576222_-|tryptophan--tRNA-ligase
MSEKIMLTGIKPTGYPHLGNYIGAIKPALQMSKNNEGKALYFIADYHALNAVHDPEKFSSYTKEVAATWLSLGLGEDVIFYRQTEVPEILELAWILACLTPKGLMNRAHAYKAKVEQNKEAGLEVDAGVNMGLYTYPILMAADILLFQATHVPVGKDQIQHIEIARDIATYFNHTFGTTFTLPEYVIQEEGAILPGLDGRKMSKSYGNVIPLFAEQAKLRKLIFKIKTDSSLPNGPKELEILFTIYKEFATEDEVQSLREKYETGIGWGDVKKELFRVVDRELAGPREKYAMYMNEPNLLYEALEKGAERARKIAKVNLVEIKKRIGFERGR
>NC_022873.1|WP_000845630.1|3574449_3575013_-|maltose-O-acetyltransferase
MKTEKEKMVAGEMYIADDEELVADRVEAKRLTRLYNEAMETGDERRFTLLNQLLGSSTDGKAQINPDFRCDYGYNIHVGKSFFANFNCVILDVCEVRIGDNCMFAPGVHIYTATHPLHPVERNSGKEYGKPVKIGNNVWVGGGAIINPGISIGDNVVIASGAVVTKDVPNNVVVGGNPAKVIKTIDL
>NC_022873.1|WP_000003038.1|3569997_3571026_-|ROK-family-protein
MSEQFVTQKSIKETILRGIRTALLERGSATKVELSNTLEISFPTISKFIEKMKQDGEVTLAGLDDSSGGRRAKRYEYNPEYMLGLAIFLEKNETNYTIFNCLGEVKEQGSTSSALIDTGLSVLTEHIESLIATFPKISSISIGVPGAVDNGRIFYIPGYEKFQNFNLKSHLEELFSIPVVIENDMNAAVLGYHKNTGNNENSSLVYLYSGQNGPGAGIMVNGDVVRGSTFFSGEISFVPQYDNKNFLQALRSEDSNNPEEYNIDAITRLIATCIAIINPHGFIFCDDEVNQIVIDQIVKSCPQYIPAEHIPKITVSNWKEDYLYGLKSLGLDLMITRTNKEN
>NC_022873.1|WP_000687573.1|3569555_3569936_-|VOC-family-protein
MKIEHVAIWVNDLERMRDFYKQYFGGEENSLYHNPKKQFESYFITFEGGARLELMKQVGIDEKVQTQTIGYAHIAFSVDSKEKVNELTNTLREAGYSVLNGPRTTGDGYYESVVSDPEGNQIEITI
>NC_022873.1|WP_023522539.1|3585622_3586537_-|tetratricopeptide-repeat-protein
MNINEKAIEMFEQNKYEEAMELFQQAVHESRDVQSLNNLAWMYFYEEENDDKALELIREVVKLNPSSYFPYNILGDIYMKQEKWTEAKEALQKSISIQPSDEAYHNVAVAHYNLGELEKASEFFLRVAGDSDYIMYSYVKCLIDLERTTEAKDKLDTFNRESDNFLGEINVADLYVELNCYKEAIEWFEKGYKECWKSPNWISRFVYALYKTNNFSRINEVIRESIEAKTAEIKDVENEEVEDNWTEKDKKELIEEYTEANNDYKTMIERIKSGYVPGLEFETDFIGGCYLFGCKRHNHLEYEQ
>NC_022873.1|WP_023522540.1|3586836_3587214_+|hypothetical-protein
MKRKLLVLLFTGIILSGCSTIAENSLETGNGSMALLTPTITTKDNELEIKTEGIDENKVTFIYVANKKVLEQKLKNGESYKLNIKDIEHAHRTDYKPKVQLLQTKDDNDDGEIVTFKQVRYTVKN
>NC_022873.1|WP_023522541.1|3587290_3587530_+|DUF3923-family-protein
MKRRWISWWIGNIFWIIVFGIWAAIIWLRDVDGAGVIQTPEIKSISLIVLLIAFIIPVFFQIIWLIINLRMSKKNNYTI
>NC_022873.1|WP_000938438.1|3587650_3588199_-|DUF2179-domain-containing-protein
MLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAGVGLLEGAIYIVSLGIVFQDLSNWMNIVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGINSIRYRLDIVAKRSREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDEHAS
>NC_022873.1|WP_023522542.1|3588397_3588811_-|ATP-synthase-subunit-I
MIQEALRVYRLQLYVIFSGLLLMWTITPFGKQVTGFGIGLAVSAYCLWLLARRVEKLGKSIVMKEKAPGLGVLNRFAAAILGAIIMYEIEHEMEMWAFGTGILGGHFLMIANLAYANIQLVKEEEKQREHASKNIEL
>NC_022873.1|WP_000402258.1|3588863_3590192_-|HlyC/CorC-family-transporter
MEIFNLVMVAILIAFTGFFVAAEFAIVKIRSSRIDQLVAEGKRGALAAKKVTTNLDEYLSACQLGITVTAMGLGWLGEPTIEKLLHPLFEKWNLNPSISSVLTFGLAFMIMTYLHVVVGELAPKTMAIQKAERVTLLLAGPLMMFYKVMYPFIWVLNGSARVITGLFGLKPASEHEVAHTEEELRLILSDSYESGEINQAEYKYVNNIFEFDNRIAKEIMVPRTEIVGFYLEDSVEEHMKVIQNERYTRYPIFGEDKDDIIGMVNVKDFFIRYMTEDQKDLSSIRSYMRPIIEVMETTPIHDLLLQMQKKRIPMAVLYDEYGGTAGIVTLEDILEEIVGEIRDEYDEDEAPPIQHVNEQHIIVDGKVLISEVKDLFGLHIEEDDVDTIGGWIMMQNHEIEEGQHVEAEGYEFKVLEKDAYQIKRVEIRKMEQEQEEEKAATV
>NC_022873.1|WP_000285635.1|3590311_3590719_-|MerR-family-transcriptional-regulator
MYRIGQLALMAHVSKRTIDYYTNLGILKAERSQSNYRYYDETAFETLQFIEKCKEMHMPLCEIKEKIEEKKKLLGINEHVSKQVNEVTDHIHQLEVELTELKPLLDGLTDSQREKISKSLSGQTTALIQTLALLL
>NC_022873.1|WP_023522543.1|3590980_3591754_+|glycosyltransferase-family-2-protein
MKKTIISHFYNEEYLLPWWLMHHTKIFDHGILINRGSTDRSVEICKLLAPHWEVRNSRFLEFDPTNTDIEVMEIEREVSGWKIVLNTTEFFCCNNTEEFFSSLHTLGQNMYAIRMILMIDNHNYNYSKPRYSIPLVEQRYHGVFPYNPSLGCAWRFIHTHLDGAYLPGRHHSRHGYIIYDYPSFILKFYFSPWNEQSKARKLQITPTLSKRGIQMGLQTHYGQSPEVLDIRFLELSNLTQDLRHNPEYQELFPKFKP
>NC_022873.1|WP_023522544.1|3591869_3592637_+|glucose-1-phosphate-cytidylyltransferase
MKAVILAGGYGTRIGEETHLKPKPMIEIGTKPILWHIMSLYSHYGITEFIICLGYKGYAIKEFFLNYNLHMSDFTIQLSDNTITSHSHRVEPWKVTLIDTGVNTETGGRVKKIQNYVGDEPFCLTYGDGLSNVNIKELITFHKKHGKMATVTAVQPPGRFGSLILDKQSVTSFQEKPLGDGGWVNGGFFVLNPEVFNYISGDKSVFETDTLVQLVNKNELAAYQHSGFWHPMDTLRDKNKLVELWESNNAPWKVW
>NC_022873.1|WP_023522545.1|3592638_3593694_+|CDP-glucose-4,6-dehydratase
MASSSFWNKKKVFITGHTGFKGSWLTLFLSSLGAEVVGFSSHPPSIPNIFEQGNVAKECTTMKGDITDYHSLCHAMKQHKPDIIFHLAAQPIVTASYKNPIDTFKTNVLGTVHVLEAAKSVESVRAIINVTSDKCYENDGSGDGAFVENDRLGGFDPYSASKACAELVTTSYHKSFFHTNTTSLASVRAGNVIGGGDWAEDRLFPDIIRAYLHNHTLCIRNKYAIRPWQHVLDPLHGYILLAEKLWNDAKYAETWNFGPINEPSRTVNDVIQSVMKLWNKRLTIHSPSTKTPYESPILTLNSTKAVNKLDWTPKLSTDDSITWTVDWYKKYASGENIESFTRQQIDAFKNL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_022873_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_022873_5

3584285-3584422

Orphan

Consensus_repeat	Method
ACCTTCTGCACCTGTTGGACCAGTTA	CRISPRCasFinder

2 spacers

The CRISPR arrays of NC_022873_5

>merge|NC_022873|5|3584285-3584422|CRISPRCasFinder
ACCTTGATGACCTGTTGGACCTGTTATACCTTGCACTCCTTGCGCTCCAATTGATCCTATCCCTCCGCTTACACCTGTTGAACCAGTCGCTCCCGTTGGACCTGGTGGACCTCCTGGTGGACCTGATGGACCAGTCAC

>NC_022873|5|5|3584285-3584422|CRISPRCasFinder
ACCTTGATGACCTGTTGGACCTGTTA	TACCTTGCACTCCTTGCGCTCCAATTGATCCTATCCC
TCCGCTTACACCTGTTGAACCAGTCG	CTCCCGTTGGACCTGGTGGACC
TCCTGGTGGACCTGATGGACCAGTCAC

Protein	Signature genes	Signature genes Name	Protein_function
NC_022873.1\|WP_023522539.1\|3585622_3586537_-\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|276809
NC_022873.1\|WP_023522536.1\|3580398_3582897_-\|collagen-like-triple-helix-repeat-containing-protein	unknown	unknown	gnl\|CDD\|375999
NC_022873.1\|WP_023522535.1\|3579442_3579904_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379326
NC_022873.1\|WP_000402258.1\|3588863_3590192_-\|HlyC/CorC-family-transporter	unknown	unknown	gnl\|CDD\|224173
NC_022873.1\|WP_000845630.1\|3574449_3575013_-\|maltose-O-acetyltransferase	unknown	unknown	gnl\|CDD\|182235
NC_022873.1\|WP_000945243.1\|3580181_3580325_+\|hypothetical-protein	unknown	unknown	unknown
NC_022873.1\|WP_023522543.1\|3590980_3591754_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|372681
NC_022873.1\|WP_023522545.1\|3592638_3593694_+\|CDP-glucose-4,6-dehydratase	unknown	unknown	gnl\|CDD\|274236
NC_022873.1\|WP_023522534.1\|3576612_3577770_+\|1-deoxy-D-xylulose-5-phosphate-reductoisomerase	unknown	unknown	gnl\|CDD\|237107
NC_022873.1\|WP_000539730.1\|3578984_3579233_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	unknown	unknown	gnl\|CDD\|225170
NC_022873.1\|WP_000285635.1\|3590311_3590719_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133406
NC_022873.1\|WP_023522544.1\|3591869_3592637_+\|glucose-1-phosphate-cytidylyltransferase	unknown	unknown	gnl\|CDD\|131672
NC_022873.1\|WP_000938438.1\|3587650_3588199_-\|DUF2179-domain-containing-protein	unknown	unknown	gnl\|CDD\|235234
NC_022873.1\|WP_000003038.1\|3569997_3571026_-\|ROK-family-protein	unknown	unknown	gnl\|CDD\|224851
NC_022873.1\|WP_023522540.1\|3586836_3587214_+\|hypothetical-protein	unknown	unknown	unknown
NC_022873.1\|WP_000687573.1\|3569555_3569936_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319905
NC_022873.1\|WP_000411478.1\|3577799_3578921_-\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
NC_022873.1\|WP_023522542.1\|3588397_3588811_-\|ATP-synthase-subunit-I	unknown	unknown	gnl\|CDD\|377159
NC_022873.1\|WP_023522533.1\|3575223_3576222_-\|tryptophan--tRNA-ligase	unknown	unknown	gnl\|CDD\|183592
NC_022873.1\|WP_023522541.1\|3587290_3587530_+\|DUF3923-family-protein	unknown	unknown	gnl\|CDD\|289806

Protein	Function_ID	Function_description	E-value
NC_022873.1\|WP_023522539.1\|3585622_3586537_-\|tetratricopeptide-repeat-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	3.09775e-14
NC_022873.1\|WP_023522536.1\|3580398_3582897_-\|collagen-like-triple-helix-repeat-containing-protein	gnl\|CDD\|375999	pfam18573, BclA_C, BclA C-terminal domain. This is the C-terminal domain of BclA (Bacillus collagen-like protein of anthracis) which is expressed on spores of Bacillus species. Trimers of the C-terminal domain (CTD) form the tips of the spore's hair-like nap and are the immunodominant target of vertebrate antibodies and drive trimerization. Structure analysis indicate the C-terminal region of the peptide folding into an all-beta structure with a jelly-fold topology, similar to the first human complement C1q, a member of the tumor necrosis factor (TNF)-like family. The C-terminal globular domain has been shown to be located on the exterior of the exosporium, and therefore is critical in determining the immunogenicity of the spore in a mammalian host.	8.37841e-08
NC_022873.1\|WP_023522535.1\|3579442_3579904_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379326	pfam13673, Acetyltransf_10, Acetyltransferase (GNAT) domain. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.19703e-12
NC_022873.1\|WP_000402258.1\|3588863_3590192_-\|HlyC/CorC-family-transporter	gnl\|CDD\|224173	COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only].	1.44362e-160
NC_022873.1\|WP_000845630.1\|3574449_3575013_-\|maltose-O-acetyltransferase	gnl\|CDD\|182235	PRK10092, PRK10092, maltose O-acetyltransferase; Provisional.	8.14217e-101
NC_022873.1\|WP_023522543.1\|3590980_3591754_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|372681	pfam13704, Glyco_tranf_2_4, Glycosyl transferase family 2. Members of this family of prokaryotic proteins include putative glucosyltransferases,.	1.43653e-09
NC_022873.1\|WP_023522545.1\|3592638_3593694_+\|CDP-glucose-4,6-dehydratase	gnl\|CDD\|274236	TIGR02622, CDP-glucose_46-dehydratase, CDP-glucose 4,6-dehydratase. Members of this protein family are CDP-glucose 4,6-dehydratase from a variety of Gram-negative and Gram-positive bacteria. Members typically are encoded next to a gene that encodes a glucose-1-phosphate cytidylyltransferase, which produces the substrate, CDP-D-glucose, used by this enzyme to produce CDP-4-keto-6-deoxyglucose. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	0
NC_022873.1\|WP_023522534.1\|3576612_3577770_+\|1-deoxy-D-xylulose-5-phosphate-reductoisomerase	gnl\|CDD\|237107	PRK12464, PRK12464, 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional.	0
NC_022873.1\|WP_000539730.1\|3578984_3579233_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	gnl\|CDD\|225170	COG2261, COG2261, Predicted membrane protein [Function unknown].	5.47241e-09
NC_022873.1\|WP_000285635.1\|3590311_3590719_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133406	cd04779, HTH_MerR-like_sg4, Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily. Putative helix-turn-helix (HTH) MerR-like transcription regulators (subgroup 4). Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	3.12673e-60
NC_022873.1\|WP_023522544.1\|3591869_3592637_+\|glucose-1-phosphate-cytidylyltransferase	gnl\|CDD\|131672	TIGR02623, Glucose-1-phosphate_cytidylyltransferase, glucose-1-phosphate cytidylyltransferase. Members of this family are the enzyme glucose-1-phosphate cytidylyltransferase, also called CDP-glucose pyrophosphorylase, the product of the rfbF gene. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	0
NC_022873.1\|WP_000938438.1\|3587650_3588199_-\|DUF2179-domain-containing-protein	gnl\|CDD\|235234	PRK04164, PRK04164, hypothetical protein; Provisional.	6.88941e-83
NC_022873.1\|WP_000003038.1\|3569997_3571026_-\|ROK-family-protein	gnl\|CDD\|224851	COG1940, NagC, Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism].	1.03706e-21
NC_022873.1\|WP_023522541.1\|3587290_3587530_+\|DUF3923-family-protein	gnl\|CDD\|289806	pfam13061, DUF3923, Protein of unknown function (DUF3923). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 80 amino acids in length.	2.30015e-12
NC_022873.1\|WP_000687573.1\|3569555_3569936_-\|VOC-family-protein	gnl\|CDD\|319905	cd07241, VOC_BsYyaH, vicinal oxygen chelate (VOC) family protein similar to Bacillus subtilis YyaH. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	1.46545e-64
NC_022873.1\|WP_000411478.1\|3577799_3578921_-\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	8.99178e-58
NC_022873.1\|WP_023522542.1\|3588397_3588811_-\|ATP-synthase-subunit-I	gnl\|CDD\|377159	pfam03899, ATP-synt_I, ATP synthase I chain. The atp operon of alkaliphilic Bacillus pseudofirmus OF4, as in most prokaryotes, contains the eight structural genes for the F-ATPase (ATP synthase), which are preceded by an atpI gene that encodes a membrane protein with 2 TMSs. A tenth gene, atpZ, has been found in this operon, which is upstream of and overlapping with atpI. AtpI is a Ca2+/Mg2+ transporter.	3.03215e-07
NC_022873.1\|WP_023522533.1\|3575223_3576222_-\|tryptophan--tRNA-ligase	gnl\|CDD\|183592	PRK12556, PRK12556, tryptophanyl-tRNA synthetase; Provisional.	0

>NC_022873.1|WP_023522536.1|3580398_3582897_-|collagen-like-triple-helix-repeat-containing-protein
MKNQDKCSKFQAPIPFPPPGITGPTGPTGALGGPTGPQGIQGVQGPIGPTGPQGIQGVQGVQGENGPTGPTGLTGPQGSQGNQGPMGERGPQGIQGVQGIQGERGPTGPTGIQGIQGIPGPIGPTGPTGIQGIQGMQGEIGLTGPTGIQGIQGVQGENGPTGPTGNTGIQGVQGNLGSSGLQGVTGIQGIQGPIGPTGPTGSQGIQGEQGPIGPQGETGVQGLQGPQGEMGQVGPTGSQGIQGVQGEIGPTGPTGLQGDPGPTGPTGATGITGPTGSATGPTGATGPTGPPGGPTGPTGPAGSPGGPTGPTGATGATGATGATGATGIQGVQGIQGPTGATGLTGLQGVQGPMGATGPTGDQGIQGPQGIQGVTGPTGPQGLQGIQGPLGPTGPSGPQGVQGAQGPIGPTGPQGIQGIQGEQGVRGATGPTGLQGLQGIQGPSGPTGPQGVQGVQGPSGITGPTGPQGIQGIQGPQGSIGPTGPQGIQGVQGPQGPTGHSGATGPQGIQGIQGPIGPTGPQGIQGIQGVQGPQGPTGPTGPQGLQGITGQSGATGPTGATGPTGETGPQGPQGIQGPQGATGPTGATGEAGVTGPQGIQGIQGPQGITGPTGATGPTGETGPQGLQGIQGPQGITGPTGVTGQTGLTGATGPTGIQGIQGITGATGGTGVTGPTGATGPTGLTGATGSSAISTGGGYFFSTSTSTIAANTNIPINSGSTVYGTGVSLTSATTVTVATPGIYLVSYYFQGDANGGNETVSVRLLLNGTQLTGSFIQNVTTSTVVIEPAISNTLLVNVTSANSTLILQNGPLGVGHVTTIAGAITASLNVVRIL
>NC_022873.1|WP_000945243.1|3580181_3580325_+|hypothetical-protein
MLRLSDHAIKMMEQRLRIEKQRTYQANKVVDNLHHKYFFQHIFQPKR
>NC_022873.1|WP_023522535.1|3579442_3579904_+|GNAT-family-N-acetyltransferase
MILKLNSTSFEVATSILQVQIPAYKIEADYLNSTAIPRLYDTVNDIQNCVETFYGYFSENKLVGFISFVQEEKLIDIHRLVVSPDFFQKGIATKLLIYIFNMFPSSMTYIVQTGKANTPAITLYKKHGFITVADTILPDGMILTQLKKTEYTK
>NC_022873.1|WP_000539730.1|3578984_3579233_-|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein
MGWIITLIVGAIIGAIASSITGKNFPGGMFGNIIAGLLGASLGGRLFGSFGPSFGGIHVVPALLGAIVLIFIVSFVVKAAKK
>NC_022873.1|WP_000411478.1|3577799_3578921_-|AI-2E-family-transporter
MEKINIRKRDKLRKFFREQNYLAVLLGFALLFINILLLTKISFVFTPFIVFLKTIFFPVLLAGVLFYILHPFVSLLEKKGVSRIVSIASIYLIVIGLFVFLVLTVIPIIKDQIDALIDNLPYFGHEIERAARRFGESNLLGKIQENLNIDVANIVKDYTVDFTKSLSSVTGNVTGFLSTITEVVLTFVMVPFILFYLLKDGEQLPNHFLKFISEQRQPAAMRILDDMHYAISSYIRGQIIVSLFIGIMLLIGYLIIGIKYAVLLAILAMIVNIVPYVGPIIAITPALIIAFIDSPGMVLKVIIVMMVVQLAEGKFISPQVMGKKLDIHPITIIFIILTAGNLFGIMGIILAIPGYAILKVLVTHGYRFVKLNT
>NC_022873.1|WP_023522534.1|3576612_3577770_+|1-deoxy-D-xylulose-5-phosphate-reductoisomerase
MVKYISILGSTGSIGTSALDVVSAHPEHFKIVGLTANYNIDLLEQQIKTFQPRIVSVATKDLADTLRTRISANTKITYGTDGLIAVATHPDSNLVLSSVVGVSGLLPTIEALKAKNDIAIANKETLVAAGHIVTELAKQNGCRLIPVDSEHSAIFQCLNGENNKEIEKLIVTASGGAFRDKTREEMQTLQAKDALKHPNWLMGAKLTIDSATLMNKGFEVMEARWLFDIPYEKIDVMIHKESIIHSLVEFIDGSVMAQLGAPDMRMPIQYAFHYPTRLPSSYEKLNLLEIGSLHFEKPDLEKFPCLQYAYECGKIGGTTPAVLNAANEIANALYLKNEIAFFDIEKTIYKTVEAHHNVKDPSLDAILEADQWARQYANELLIKKS
>NC_022873.1|WP_023522533.1|3575223_3576222_-|tryptophan--tRNA-ligase
MSEKIMLTGIKPTGYPHLGNYIGAIKPALQMSKNNEGKALYFIADYHALNAVHDPEKFSSYTKEVAATWLSLGLGEDVIFYRQTEVPEILELAWILACLTPKGLMNRAHAYKAKVEQNKEAGLEVDAGVNMGLYTYPILMAADILLFQATHVPVGKDQIQHIEIARDIATYFNHTFGTTFTLPEYVIQEEGAILPGLDGRKMSKSYGNVIPLFAEQAKLRKLIFKIKTDSSLPNGPKELEILFTIYKEFATEDEVQSLREKYETGIGWGDVKKELFRVVDRELAGPREKYAMYMNEPNLLYEALEKGAERARKIAKVNLVEIKKRIGFERGR
>NC_022873.1|WP_000845630.1|3574449_3575013_-|maltose-O-acetyltransferase
MKTEKEKMVAGEMYIADDEELVADRVEAKRLTRLYNEAMETGDERRFTLLNQLLGSSTDGKAQINPDFRCDYGYNIHVGKSFFANFNCVILDVCEVRIGDNCMFAPGVHIYTATHPLHPVERNSGKEYGKPVKIGNNVWVGGGAIINPGISIGDNVVIASGAVVTKDVPNNVVVGGNPAKVIKTIDL
>NC_022873.1|WP_000003038.1|3569997_3571026_-|ROK-family-protein
MSEQFVTQKSIKETILRGIRTALLERGSATKVELSNTLEISFPTISKFIEKMKQDGEVTLAGLDDSSGGRRAKRYEYNPEYMLGLAIFLEKNETNYTIFNCLGEVKEQGSTSSALIDTGLSVLTEHIESLIATFPKISSISIGVPGAVDNGRIFYIPGYEKFQNFNLKSHLEELFSIPVVIENDMNAAVLGYHKNTGNNENSSLVYLYSGQNGPGAGIMVNGDVVRGSTFFSGEISFVPQYDNKNFLQALRSEDSNNPEEYNIDAITRLIATCIAIINPHGFIFCDDEVNQIVIDQIVKSCPQYIPAEHIPKITVSNWKEDYLYGLKSLGLDLMITRTNKEN
>NC_022873.1|WP_000687573.1|3569555_3569936_-|VOC-family-protein
MKIEHVAIWVNDLERMRDFYKQYFGGEENSLYHNPKKQFESYFITFEGGARLELMKQVGIDEKVQTQTIGYAHIAFSVDSKEKVNELTNTLREAGYSVLNGPRTTGDGYYESVVSDPEGNQIEITI
>NC_022873.1|WP_023522539.1|3585622_3586537_-|tetratricopeptide-repeat-protein
MNINEKAIEMFEQNKYEEAMELFQQAVHESRDVQSLNNLAWMYFYEEENDDKALELIREVVKLNPSSYFPYNILGDIYMKQEKWTEAKEALQKSISIQPSDEAYHNVAVAHYNLGELEKASEFFLRVAGDSDYIMYSYVKCLIDLERTTEAKDKLDTFNRESDNFLGEINVADLYVELNCYKEAIEWFEKGYKECWKSPNWISRFVYALYKTNNFSRINEVIRESIEAKTAEIKDVENEEVEDNWTEKDKKELIEEYTEANNDYKTMIERIKSGYVPGLEFETDFIGGCYLFGCKRHNHLEYEQ
>NC_022873.1|WP_023522540.1|3586836_3587214_+|hypothetical-protein
MKRKLLVLLFTGIILSGCSTIAENSLETGNGSMALLTPTITTKDNELEIKTEGIDENKVTFIYVANKKVLEQKLKNGESYKLNIKDIEHAHRTDYKPKVQLLQTKDDNDDGEIVTFKQVRYTVKN
>NC_022873.1|WP_023522541.1|3587290_3587530_+|DUF3923-family-protein
MKRRWISWWIGNIFWIIVFGIWAAIIWLRDVDGAGVIQTPEIKSISLIVLLIAFIIPVFFQIIWLIINLRMSKKNNYTI
>NC_022873.1|WP_000938438.1|3587650_3588199_-|DUF2179-domain-containing-protein
MLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAGVGLLEGAIYIVSLGIVFQDLSNWMNIVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGINSIRYRLDIVAKRSREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDEHAS
>NC_022873.1|WP_023522542.1|3588397_3588811_-|ATP-synthase-subunit-I
MIQEALRVYRLQLYVIFSGLLLMWTITPFGKQVTGFGIGLAVSAYCLWLLARRVEKLGKSIVMKEKAPGLGVLNRFAAAILGAIIMYEIEHEMEMWAFGTGILGGHFLMIANLAYANIQLVKEEEKQREHASKNIEL
>NC_022873.1|WP_000402258.1|3588863_3590192_-|HlyC/CorC-family-transporter
MEIFNLVMVAILIAFTGFFVAAEFAIVKIRSSRIDQLVAEGKRGALAAKKVTTNLDEYLSACQLGITVTAMGLGWLGEPTIEKLLHPLFEKWNLNPSISSVLTFGLAFMIMTYLHVVVGELAPKTMAIQKAERVTLLLAGPLMMFYKVMYPFIWVLNGSARVITGLFGLKPASEHEVAHTEEELRLILSDSYESGEINQAEYKYVNNIFEFDNRIAKEIMVPRTEIVGFYLEDSVEEHMKVIQNERYTRYPIFGEDKDDIIGMVNVKDFFIRYMTEDQKDLSSIRSYMRPIIEVMETTPIHDLLLQMQKKRIPMAVLYDEYGGTAGIVTLEDILEEIVGEIRDEYDEDEAPPIQHVNEQHIIVDGKVLISEVKDLFGLHIEEDDVDTIGGWIMMQNHEIEEGQHVEAEGYEFKVLEKDAYQIKRVEIRKMEQEQEEEKAATV
>NC_022873.1|WP_000285635.1|3590311_3590719_-|MerR-family-transcriptional-regulator
MYRIGQLALMAHVSKRTIDYYTNLGILKAERSQSNYRYYDETAFETLQFIEKCKEMHMPLCEIKEKIEEKKKLLGINEHVSKQVNEVTDHIHQLEVELTELKPLLDGLTDSQREKISKSLSGQTTALIQTLALLL
>NC_022873.1|WP_023522543.1|3590980_3591754_+|glycosyltransferase-family-2-protein
MKKTIISHFYNEEYLLPWWLMHHTKIFDHGILINRGSTDRSVEICKLLAPHWEVRNSRFLEFDPTNTDIEVMEIEREVSGWKIVLNTTEFFCCNNTEEFFSSLHTLGQNMYAIRMILMIDNHNYNYSKPRYSIPLVEQRYHGVFPYNPSLGCAWRFIHTHLDGAYLPGRHHSRHGYIIYDYPSFILKFYFSPWNEQSKARKLQITPTLSKRGIQMGLQTHYGQSPEVLDIRFLELSNLTQDLRHNPEYQELFPKFKP
>NC_022873.1|WP_023522544.1|3591869_3592637_+|glucose-1-phosphate-cytidylyltransferase
MKAVILAGGYGTRIGEETHLKPKPMIEIGTKPILWHIMSLYSHYGITEFIICLGYKGYAIKEFFLNYNLHMSDFTIQLSDNTITSHSHRVEPWKVTLIDTGVNTETGGRVKKIQNYVGDEPFCLTYGDGLSNVNIKELITFHKKHGKMATVTAVQPPGRFGSLILDKQSVTSFQEKPLGDGGWVNGGFFVLNPEVFNYISGDKSVFETDTLVQLVNKNELAAYQHSGFWHPMDTLRDKNKLVELWESNNAPWKVW
>NC_022873.1|WP_023522545.1|3592638_3593694_+|CDP-glucose-4,6-dehydratase
MASSSFWNKKKVFITGHTGFKGSWLTLFLSSLGAEVVGFSSHPPSIPNIFEQGNVAKECTTMKGDITDYHSLCHAMKQHKPDIIFHLAAQPIVTASYKNPIDTFKTNVLGTVHVLEAAKSVESVRAIINVTSDKCYENDGSGDGAFVENDRLGGFDPYSASKACAELVTTSYHKSFFHTNTTSLASVRAGNVIGGGDWAEDRLFPDIIRAYLHNHTLCIRNKYAIRPWQHVLDPLHGYILLAEKLWNDAKYAETWNFGPINEPSRTVNDVIQSVMKLWNKRLTIHSPSTKTPYESPILTLNSTKAVNKLDWTPKLSTDDSITWTVDWYKKYASGENIESFTRQQIDAFKNL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_022873_7

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_022873_7

4026874-4027872

Orphan

Consensus_repeat	Method
AGGTAACACGGGNGCTAC	CRT

23 spacers

The CRISPR arrays of NC_022873_7

>merge|NC_022873|7|4026874-4027872|CRT
AGGTAACACGGGCGCTACTGGCGCTACCGGTGCCACTGGACCTCGAGGTAACACGGGCGCTACTGGCGCTACCGGACCTCAAGGTAACACGGGCGCTACTGGCGCTACCGGTGCCACTGGACCTCGAGGTAACACGGGCGCTACTGGCGCTACCGGACCTCAAGGTAACACGGGTGCTACCGGCGCTACCGGTGCCACTGGACCTCGAGGTAACACGGGCGCTACTGGCGCTACCGGACCTCAAGGTAACACGGGCGCTACTGGCGCTACCGGTGCCACTGGACCTCGAGGTAACACGGGCGCTACTGGCGCTACCGGACCTCAAGGTAACACGGGCGCTACTGGCGCTACCGGTGCCACTGGACCTCGAGGTAACACGGGCGCTACCGGTGCCACTGGACCTCGAGGTAACACGGGCGCTACCGGCGCTACTGGACCTCAAGGTAACACGGGCGCTACTGGCGCTACCGGTGCCACTGGACCTCGAGGTAACACGGGCGCTACCGGCGCTACTGGACCTCAAGGTAACACGGGCGCTACTGGCGCTACCGGTGCCACTGGACCTCGAGGTAACACGGGTGCTACTGGCGCTACTGGACCTCAGGGTGTTCAAGGTAACACAGGTGCTACTGGTGCTACCGGCGCTACTGGACCTCAAGGTGCTCAAGGTAACACAGGTGCTACTGGACCTCAAGGCGTTCAAGGTAACACAGGTGCTACTGGTGCTACCGGACCTCAAGGTGCTCAAGGTAACACAGGTGCTACTGGTGCTACTGGCGCTACTGGACCTCAAGGCGTTCAAGGTAACACGGGTGCTACCGGACCTCAAGGCATTCAAGGACCAACAGGTGCTACCGGCGCTACTGGACCTCAAGGCGTTCAAGGTAACACGGGTGCTACCGGACCTCAAGGCATTCAAGGACCAACAGGTGCTACCGGCGCTACTGGTATAGGAGTTACTGGACCTACTGGACCTTCTGGTGGACCTACCGGACCTAC

>NC_022873|7|1|4026874-4027872|CRT
AGGTAACACGGGCGCTAC	TGGCGCTACCGGTGCCACTGGACCTCG
AGGTAACACGGGCGCTAC	TGGCGCTACCGGACCTCA
AGGTAACACGGGCGCTAC	TGGCGCTACCGGTGCCACTGGACCTCG
AGGTAACACGGGCGCTAC	TGGCGCTACCGGACCTCA
AGGTAACACGGGTGCTAC	CGGCGCTACCGGTGCCACTGGACCTCG
AGGTAACACGGGCGCTAC	TGGCGCTACCGGACCTCA
AGGTAACACGGGCGCTAC	TGGCGCTACCGGTGCCACTGGACCTCG
AGGTAACACGGGCGCTAC	TGGCGCTACCGGACCTCA
AGGTAACACGGGCGCTAC	TGGCGCTACCGGTGCCACTGGACCTCG
AGGTAACACGGGCGCTAC	CGGTGCCACTGGACCTCG
AGGTAACACGGGCGCTAC	CGGCGCTACTGGACCTCA
AGGTAACACGGGCGCTAC	TGGCGCTACCGGTGCCACTGGACCTCG
AGGTAACACGGGCGCTAC	CGGCGCTACTGGACCTCA
AGGTAACACGGGCGCTAC	TGGCGCTACCGGTGCCACTGGACCTCG
AGGTAACACGGGTGCTAC	TGGCGCTACTGGACCTCAGGGTGTTCA
AGGTAACACAGGTGCTAC	TGGTGCTACCGGCGCTACTGGACCTCAAGGTGCTCA
AGGTAACACAGGTGCTAC	TGGACCTCAAGGCGTTCA
AGGTAACACAGGTGCTAC	TGGTGCTACCGGACCTCAAGGTGCTCA
AGGTAACACAGGTGCTAC	TGGTGCTACTGGCGCTACTGGACCTCAAGGCGTTCA
AGGTAACACGGGTGCTAC	CGGACCTCAAGGCATTCA
AGGACCAACAGGTGCTAC	CGGCGCTACTGGACCTCAAGGCGTTCA
AGGTAACACGGGTGCTAC	CGGACCTCAAGGCATTCA
AGGACCAACAGGTGCTAC	CGGCGCTACTGGTATAGGAGTTACTGGACCTACTGGACCTTCTGG
TGGACCTACCGGACCTAC

Protein	Signature genes	Signature genes Name	Protein_function
NC_022873.1\|WP_000814431.1\|4029745_4029991_+\|hypothetical-protein	unknown	unknown	unknown
NC_022873.1\|WP_023522799.1\|4031335_4033192_-\|PTS-fructose-transporter-subunit-IIABC	unknown	unknown	gnl\|CDD\|236740
NC_022873.1\|WP_000813896.1\|4028365_4028590_-\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|179001
NC_022873.1\|WP_023522793.1\|4019962_4020352_-\|transcriptional-repressor-GlnR	unknown	unknown	gnl\|CDD\|133380
NC_022873.1\|WP_000312267.1\|4023157_4023781_+\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NC_022873.1\|WP_000504953.1\|4028611_4029565_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
NC_022873.1\|WP_023522800.1\|4033205_4034117_-\|1-phosphofructokinase	unknown	unknown	gnl\|CDD\|238570
NC_022873.1\|WP_023522796.1\|4025270_4026236_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|227308
NC_022873.1\|WP_000957288.1\|4034113_4034866_-\|DeoR/GlpR-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268
NC_022873.1\|WP_000228315.1\|4036304_4036847_-\|DUF420-domain-containing-protein	unknown	unknown	gnl\|CDD\|225204
NC_022873.1\|WP_023522795.1\|4024049_4025006_-\|stage-V-sporulation-protein-K	unknown	unknown	gnl\|CDD\|163057
NC_022873.1\|WP_023522798.1\|4030053_4030986_-\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|226112
NC_022873.1\|WP_043924696.1\|4021790_4023065_-\|GTPase-HflX	unknown	unknown	gnl\|CDD\|274455
NC_022873.1\|WP_001179068.1\|4035025_4036189_-\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341466
NC_022873.1\|WP_000181505.1\|4023880_4024018_+\|hypothetical-protein	unknown	unknown	unknown
NC_022873.1\|WP_000092763.1\|4018579_4019914_-\|type-I-glutamate--ammonia-ligase	unknown	unknown	gnl\|CDD\|273198
NC_022873.1\|WP_000460282.1\|4020526_4021798_-\|methionine-gamma-lyase-family-protein	unknown	unknown	gnl\|CDD\|311036
NC_022873.1\|WP_023522792.1\|4017735_4018059_-\|PadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224609
NC_022873.1\|WP_023522791.1\|4017200_4017743_-\|DUF1700-domain-containing-protein	unknown	unknown	gnl\|CDD\|285278
NC_022873.1\|WP_000393491.1\|4037165_4037477_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_022873.1\|WP_001179068.1\|4035025_4036189_-\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341466	cd08187, BDH, Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. The butanol dehydrogenase (BDH) is involved in the final step of the butanol formation pathway in anaerobic micro-organism. Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. Activity in the reverse direction is 50-fold lower than that in the forward direction. The NADH-BDH has higher activity with longer chained aldehydes and is inhibited by metabolites containing an adenine moiety. This protein family belongs to the so-called iron-containing alcohol dehydrogenase superfamily. Since members of this superfamily use different divalent ions, preferentially iron or zinc, it has been suggested to be renamed to family III metal-dependent polyol dehydrogenases. This family also includes E. coli YqhD enzyme, an NADP-dependent dehydrogenase whose activity measurements with several alcohols demonstrate preference for alcohols longer than C3. The active site of YqhD contains a Zn metal, and a modified NADPH cofactor bearing OH groups on the saturated C5 and C6 atoms, possibly due to oxygen stress on the enzyme, which would functionally work under anaerobic conditions.	0
NC_022873.1\|WP_023522799.1\|4031335_4033192_-\|PTS-fructose-transporter-subunit-IIABC	gnl\|CDD\|236740	PRK10712, PRK10712, PTS system fructose-specific transporter subunits IIBC; Provisional.	6.10222e-143
NC_022873.1\|WP_000813896.1\|4028365_4028590_-\|RNA-chaperone-Hfq	gnl\|CDD\|179001	PRK00395, hfq, RNA-binding protein Hfq; Provisional.	3.4363e-41
NC_022873.1\|WP_023522793.1\|4019962_4020352_-\|transcriptional-repressor-GlnR	gnl\|CDD\|133380	cd01105, HTH_GlnR-like, Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators. Helix-turn-helix (HTH) transcription regulator GlnR and related proteins, N-terminal domain. The GlnR and TnrA (also known as ScgR) proteins have been shown to regulate expression of glutamine synthetase as well as several genes involved in nitrogen metabolism. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	1.11611e-23
NC_022873.1\|WP_000460282.1\|4020526_4021798_-\|methionine-gamma-lyase-family-protein	gnl\|CDD\|311036	pfam06838, Met_gamma_lyase, Methionine gamma-lyase. This is a putative pyridoxal 5'-phosphate-dependent methionine gamma-lyase enzyme involved in methionine catabolism.	0
NC_022873.1\|WP_000504953.1\|4028611_4029565_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	1.35751e-163
NC_022873.1\|WP_023522800.1\|4033205_4034117_-\|1-phosphofructokinase	gnl\|CDD\|238570	cd01164, FruK_PfkB_like, 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases. FruK plays an important role in the predominant pathway for fructose utilisation.This group also contains tagatose-6-phophate kinase, an enzyme of the tagatose 6-phosphate pathway, which responsible for breakdown of the galactose moiety during lactose metabolism by bacteria such as L. lactis.	3.71729e-143
NC_022873.1\|WP_023522796.1\|4025270_4026236_+\|site-specific-integrase	gnl\|CDD\|227308	COG4974, XerD, Site-specific recombinase XerD [DNA replication, recombination, and repair].	5.97738e-13
NC_022873.1\|WP_000957288.1\|4034113_4034866_-\|DeoR/GlpR-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	2.43302e-81
NC_022873.1\|WP_000228315.1\|4036304_4036847_-\|DUF420-domain-containing-protein	gnl\|CDD\|225204	COG2322, COG2322, Predicted membrane protein [Function unknown].	9.14687e-57
NC_022873.1\|WP_023522795.1\|4024049_4025006_-\|stage-V-sporulation-protein-K	gnl\|CDD\|163057	TIGR02881, Stage_V_sporulation_protein_K, stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group. [Cellular processes, Sporulation and germination].	1.83023e-156
NC_022873.1\|WP_023522798.1\|4030053_4030986_-\|SH3-domain-containing-protein	gnl\|CDD\|226112	COG3584, COG3584, Uncharacterized protein conserved in bacteria [Function unknown].	9.44524e-37
NC_022873.1\|WP_043924696.1\|4021790_4023065_-\|GTPase-HflX	gnl\|CDD\|274455	TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). [Unknown function, General].	0
NC_022873.1\|WP_000092763.1\|4018579_4019914_-\|type-I-glutamate--ammonia-ligase	gnl\|CDD\|273198	TIGR00653, Glutamine_synthetase, glutamine synthetase, type I. Alternate name: glutamate--ammonia ligase. This model represents the dodecameric form, which can be subdivided into 1-alpha and 1-beta forms. The phylogeny of the 1-alpha and 1-beta forms appears polyphyletic. E. coli, Synechocystis PCC6803, Aquifex aeolicus, and the crenarcheon Sulfolobus acidocaldarius have form 1-beta, while Bacillus subtilis, Thermotoga maritima, and various euryarchaea has form 1-alpha. The 1-beta dodecamer from the crenarcheon Sulfolobus acidocaldarius differs from that in E. coli in that it is not regulated by adenylylation. [Amino acid biosynthesis, Glutamate family].	0
NC_022873.1\|WP_000312267.1\|4023157_4023781_+\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	1.8015e-60
NC_022873.1\|WP_023522792.1\|4017735_4018059_-\|PadR-family-transcriptional-regulator	gnl\|CDD\|224609	COG1695, COG1695, Predicted transcriptional regulators [Transcription].	2.76968e-24
NC_022873.1\|WP_023522791.1\|4017200_4017743_-\|DUF1700-domain-containing-protein	gnl\|CDD\|285278	pfam08006, DUF1700, Protein of unknown function (DUF1700). This family contains many hypothetical bacterial proteins and putative membrane proteins.	6.5772e-80

>NC_022873.1|WP_023522796.1|4025270_4026236_+|site-specific-integrase
METTEFHDTIQAFSIFLLNKGRKPSTIKRYVYDVEDFGHWLEKNKKLPSSNIWATLCTKDYEDYFSDLKTNRHYSEKTMHRVFTVLNRMHHFLNIPNPLKNMEISIQPDRTLRNEDFISPDEEKRLKYIVTSLEGLSEKQLPVRPLLMDRNIAILNLLIDYGLSLQELTALTMHHVHFETNTLSITATAGVERTIALAKEDKKQLYNYYKSIPEPVRPKYHSDDSLFVAFDFNRGTYRWVYENDAPKALTEIAIQKMIRLEVARANLRKGISGQHFRNTYILNLIKKETPESEIIKLAGFKSKISLKRYYQYAENRKNALL
>NC_022873.1|WP_023522795.1|4024049_4025006_-|stage-V-sporulation-protein-K
MEQSMRKKNNNQINIVLNHRKKISLPAAENKTVISNETTIKHEMLQRIEEEMGKLVGMDDIKKIIKEIYAWIYVNKKRHEKGLKSEKQVLHMLFKGNPGTGKTTVARMIGKLLFEMNILSKGHLVEAERADLVGEYIGHTAQKTRDLIKKAMGGILFIDEAYSLARGGEKDFGKEAIDTLVKHMEDKQHGFVLILAGYSREMNHFLSLNPGLQSRFPFIIEFADYSVNQLLEIGKRMYEDREYQLSKEAEWKFRDHLHAVKYSSQITSFSNGRYVRNIVEKSIRTQAMRLLQEDTYDKNDLIGISSMDLMLEEETHST
>NC_022873.1|WP_000181505.1|4023880_4024018_+|hypothetical-protein
MTNHVNKGAQKSSVNQFGHDPNSAHEKSAKMERFHKAHQEKAKKE
>NC_022873.1|WP_000312267.1|4023157_4023781_+|trimeric-intracellular-cation-channel-family-protein
MAWEIFSIIGTIAFALSGAIVAMEEDYDIFGVYILGMATAFGGGALRNLLIGYPIVAFWQQDMLFQIALLSMTIIFLFPNKLIRHWKKWENITDAIGLSAFAVQGALYAQKLNLPISATIVAAVLTGIGGGIIRDLLARRKPLVLRAEVYAFWTILAGFLIGAQIIVSDWALYILFILIVCFRMVSIHYKWHLPHRRIETKERSMHK
>NC_022873.1|WP_043924696.1|4021790_4023065_-|GTPase-HflX
MEEKEKVILVGCQLPQDDDEKFMHSMKELASLAKTARAEVLVSTTQKRPKFHPATYIGKGKLEELTMLTEELEPDVIIFNNELTPSQIRNLSSVLDARVIDRTQLILDIFAQRAKSREGKLQVELAQLQYTMPRLMGQGLSLSRLGGGIGTRGPGETKLETDRRHIRSRIDEIKKQLAVVVEHRKRYRERRKDNKVFQISLIGYTNAGKSTLFNRLTEANTFEENLLFATLDPTTRKMPLPSGYTVLLTDTVGFIQDLPTSLIAAFRSTLEEAGEADVILHVVDSADPNYIGHEKTVKRLLSELEINHIPIITLYNKKDELHQNFIPFPKSDFLMTSAFEESDLLRIKEAIEMKMKKEMDRYRVEIPPSEGKLLTLLKTETLLAKMEFLEDKFVYDCAGYIFTHSSLNVQLKRFLVEEGENKNV
>NC_022873.1|WP_000460282.1|4020526_4021798_-|methionine-gamma-lyase-family-protein
MFDRLKNGEKIAPIVKEVENQITEVHKRADEVIESNQFRVLESFRKHKISDSHFIPTTGYGYDDIGRDTLEKVYADVFGAEAGLVRPQIISGTHAISTALFGILRPGDELLYITGKPYDTLEEIVGVRGKGVGSFKEYNIGYNAVPLTEGGLVDFEAVAAAIHSNTKMIGIQRSKGYATRPSFTISQIKEMIAFVKEIKPDVVVFVDNCYGEFIEEQEPCHVGADLMAGSLIKNPGGGIVKTGGYIVGKEQYVEACAYRLTSPGIGAEAGASLYSLQEMYQGFFLAPHVAGQALKGAIFTAAFLEKLGMNTSPAWNAPRTDLIQSVQFDDKDRMVAFCQAIQYASPINSHFTPYANYMPGYEDDVIMAAGTFIQGASIELSADGPIRPPYVAYVQGGLTYSHVKIAICSAIDELIEKNLLTIS
>NC_022873.1|WP_023522793.1|4019962_4020352_-|transcriptional-repressor-GlnR
MKEDRRSAPLFPIGIVMDLTQLSARQIRYYEEHNLVSPTRTKGNRRLFSFNDVDRLLEIKDLLDQGLNMAGIKQVLLMKENQTEAVKVKEETKEISKTELRKILRDELQHTGRFNRTSLRQGDISRFFH
>NC_022873.1|WP_000092763.1|4018579_4019914_-|type-I-glutamate--ammonia-ligase
MSRYTKEDIFRLAKEENVKYIRLQFTDLLGVIKNVEIPVRQLTKALDNKMMFDGSSIEGFVRIEESDMYLYPDLDTWVIFPWTAEKGKVARLICDIYNADGTPFDGDPRNNLKRVLKEMEALGFSDFNLGPEPEFFLFKVDEKGNPTLELNDNGGYFDLAPMDLGENCRRDIVLELEEMGFEIEASHHEVAPGQHEIDFKYANAIRSCDDIQTFKLVVKTIARKHGLHATFMPKPLYGVNGSGMHCNLSLFKNGENVFFDANGDLQLSDDARHFIAGILKHAPAFTAIANPTVNSYKRLVPGYEAPCYVAWSAQNRSPLVRIPASRGISTRVEVRSVDPAANPYLVMATLLAAGLDGIKNKLTPPAAVDRNIYVMTKEEREEAGIVDLPATLAQALVTLQSNEVVCGALGEHLLEHFIEAKEIEWDIFRTQVHQWERDQYMSLY
>NC_022873.1|WP_023522792.1|4017735_4018059_-|PadR-family-transcriptional-regulator
MNVQFKKGVLELCVLALVKRRDSYGYELVQQISNKFLISEGSVYPLLRRLTKEGYFQTYLKESTEGPPRKYYQLTEQGETQFHLLVTEWRDFAKGVQEIIEGVEWDE
>NC_022873.1|WP_023522791.1|4017200_4017743_-|DUF1700-domain-containing-protein
MSKEGFLKELLSYLRKLPEEERQDILLDYEEHFQFGLEEGKTESEIIQGLGSPKVIAKELLAMYRFDEMKKNPSTSNVTRAVMAAIGLSLFNFIIVLGPLVAIVAFIFSFWIGGIASVVTPFFVIGKVFMGTFIWLDLFVSITFVGVGLLLCIIAFYSTKWFKRLCVRYVIWNFKMIKGE
>NC_022873.1|WP_000813896.1|4028365_4028590_-|RNA-chaperone-Hfq
MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEGKQQLIYKHAISTFVPQKNVSIELE
>NC_022873.1|WP_000504953.1|4028611_4029565_-|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MGEVQREKVAVIIGPTAVGKTKLSIDLAKALNGEIISGDSMQIYRTMDIGTAKVTQAEMDGIPHYMVDIKNPEDSFSVAEFQERVRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDVIYREQMEKLALERGVEYVHKKLQEVDPESAERIHANNVRRVIRALEIFHTTGEKMSDQIEKQEKELLYDVSLIGLTMDREMLYDRINLRVDLMMEQGLLEEVEGLYNRGIRDCQSIQAIGYKEIYDYFENRAPLEDAVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEKTSEILRYIEGKLQVKSNNSK
>NC_022873.1|WP_000814431.1|4029745_4029991_+|hypothetical-protein
MKQSTINFSSLTKDLILATSTKEQNCSQEELYFALNCLLRAFHSTLHETTSHPENKNTEYIQTQFCSAYKIITGKTIYPFQ
>NC_022873.1|WP_023522798.1|4030053_4030986_-|SH3-domain-containing-protein
MKKLLSIATAAVFGLGIFAGSAKAETIVTTDVLNVRENPNVESKLVGKVLSGNTLDVINTENGWTKIKLNGKEAFVSADFTKSTYYVTAGVLNVRAGANTDSEILGKLNKNDVIETTNQVQNEWLQFDYNGKVGYVHVPFLTGTAPVIEKKEVVAQEEAPVKNNTAVKNKESVKSNDSIKNVESSKPVVKEKPAAKPVAKSTETSAPTGGREITVEATAYTADPSENGSYGGRVLTAMGHDLTANPNMKVIAVDPKVIPLGSKVWVEGYGEAIAGDTGGAIKGNRIDVLVGSDGSANSWGRKSVKVKVIQ
>NC_022873.1|WP_023522799.1|4031335_4033192_-|PTS-fructose-transporter-subunit-IIABC
MKITELLKRDTVIMDLTASNKEAAIDELVEKLNGANRLNSKTEFKEAILKRESQSTTGIGEGIAIPHAKTKAVKQPSICFGRSVSGINYESLDGQPAYLFFMIAASEGANNTHLETLSRLSTLLMDEGFRKQLLEAKDESELLQLFDEKENEKEEEIEVAKPEGNEPYVLAVTACPTGIAHTYMAADSLKAKAAELGIAIKVETNGSTGIKNGLTKEDIERATAIIVAADKQVEMNRFAGKHVIQVPVADGIRKTENLLKRAVKQDAPIFKGVKEDGKTESIEREKGLGIYKHLMSGVSNMLPFVVGGGILIALAFSFGGIKAEGPLAELFMSIGGGKTGAFLFLVPILAGFIASSIADRPGFMPGVVGGFLAANANAGFLGGLIAGFLAGYVVLGLKRLFSGLPVQLEGIKPVLLYPVFGLLITGVVMQKVVIPPVVALNEMLTGWLNGLNGTNAILLGLILGGMMAIDMGGPINKAAFTFGIAAIEAQNFGVHSAVMAGGMVPPLAIAFATTFFKSKFTEAERKSGLTNYIMGASFITEGAIPFAAADPVRVIVSCVVGSSIAGALSMLFQITLPAPHGGLFVIALVNKPLLYIFSILIGTIVSAIMLGVWKKKVQ
>NC_022873.1|WP_023522800.1|4033205_4034117_-|1-phosphofructokinase
MIYTVTLNPSIDYVVQVPSFDLGTINRAEKDMKFPGGKGINVSRVLQRLGVKNIALGFTGGFTGQFIKEVLHDEGVTTNFVQVDEDTRINVKIKGKEETELNGQGPIVTKEQFEQLMKKIESMQPGDCVVLAGSVPVSIPSTFYESIAAFGAEKGIRVVVDASGSALQHVIKNKPFLIKPNHHELGELFGVELSTVEDILPYGRKLIEQGVKHVIVSMAGEGALLFTAEGIYEATVPKGVVINSVGAGDSLVAGFVGKYEQTKDIEKAFQYGVATGSATAFSADLCKKEKVEELLSQVIVAKR
>NC_022873.1|WP_000957288.1|4034113_4034866_-|DeoR/GlpR-transcriptional-regulator
MLTPERHQMILQLVKEQKVVKLQQLVERTESSESTIRRDLAQLEKQRLLKRVHGGAAVLTGKGQEPTMVEKSSKNIQIKQQIANYAASVVEQGDCIYLDAGSTTFEMIPFLINKDVTVVTNGLMHIEALVENNIRAYLLGGMMKSRTKALIGAMAQESMQKYRFDKCFLGANGVHEQLGFTTPDPEEALLKQMALTLANEGYFLIDESKFSEVAFAKIANVEDANIITNHLEIDLEKYKKQTNVIEADKQ
>NC_022873.1|WP_001179068.1|4035025_4036189_-|iron-containing-alcohol-dehydrogenase
MQNFVFRNPTKLIFGKDQLEQLKTEIPQFGKKVLLVYGGGSIKRNGIYDNVISILKDINAEVFELTGVEPNPRVSTVKKGIQICKDNGVEFILAVGGGSVIDCTKAIAAGSKYDGDVWDIVTKKAFASEALPFGTVLTLAATGSEMNAGSVITNWETNEKYGWGSPVTFPQFSILDPVHTASVPRDQTIYGMVDIMSHVLEQYFHHGTNTELQDRYCESVLKTVIETAPKLLSDLENYEHRETILYCGTMALNGILAMGVRGDWATHNIEHAVSAVHDIPHGGGLAILFPNWMKHVVDENVSRFKQFAIRVFEIETDGKTDKEVALEGIEALRQFWTSIEAPATLADYGIGENEIDIMANKAMAYGEFGNFKKLNKDDVLSIYKASL
>NC_022873.1|WP_000228315.1|4036304_4036847_-|DUF420-domain-containing-protein
MVDQSTNQKSYAPIVITLSVIVNAIILFLFFGPVGYEGEVHFDVTILPMLNAIFNSFTFVFLLAALFSIIKKNVKMHRGFILAAFTTTLLFCVSYLSYHYLAPATHFGGEGFIKYVYFIILITHIILAAIIVPLALFALVFGFTNQLTRHRKIVRWTMPIWLYVSLSGVIVYLMISPYYQ
>NC_022873.1|WP_000393491.1|4037165_4037477_-|hypothetical-protein
MEEYVLELYNLLYTTEWQDIVSFLGIVFCMKIVIVYMEEQGMFYSFSSPFDVQREPLLNYANVNYEQFPFVVFFMIRFITAIVKKKESDDEECHATCKVANVF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_022873_8

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_022873_8

5518603-5519286

Orphan

Consensus_repeat	Method
GTTACTCCATCTGTTCCT	CRT

15 spacers

The CRISPR arrays of NC_022873_8

>merge|NC_022873|8|5518603-5519286|CRT
GTTACTCCATCTGTTCCTGCAGTTCCGGTCGCTCCTGTTGGACCTGTTACTCCATCTGTTCCTGCAGTTCCGGTCGCCCCTGTTGGACCCGTTACTCCATCTGTTCCTGCAGTTCCGGTCGCCCCTGTTGGACCTGTTACTCCATCTGTTCCTGCAGTTCCGGTCGCCCCTGTTGGACCTGTTACTCCATCTGTTCCTGCAGTTCCGGTCGCCCCTGTTGGACCCGTTACTCCATCTGTTCCTGCAGTTCCGGTCGCCCCTGTTGGACCCGTTACTCCATCTGTTCCTGCAGTTCCGGTCGCCCCTGTTGGACCTGTTACTCCATCTGTTCCTGCAGTTCCGGTCGCCCCTGTTGGACCCGTTACTCCATCTGTTCCTGCAGTTCCGGTCGCTCCTGTTGGACCTGTTACTCCATCTGTTCCTGCAGTTCCGGTCGCCCCTGTTGGACCCGTTACTCCATCTGTTCCTGCAGTTCCGGTCGCCCCTGTTGGACCCGTTACTCCATCTGTTCCTGCAGTTCCGGTCGCCCCTGTTGGACCCGTTACTCCATCTGTTCCTGCAGTTCCGGTCGCCCCTGTTGGACCTGTTACTCCATCTGTTCCGGTTGCTCCCGTTGGACCCGTTACTCCATCTGTTCCTGCAGTTCCGGTCGCTCCTGTTGGACCTGTTACTCCATCTGTTCCT

>NC_022873|8|2|5518603-5519286|CRT
GTTACTCCATCTGTTCCT	GCAGTTCCGGTCGCTCCTGTTGGACCT
GTTACTCCATCTGTTCCT	GCAGTTCCGGTCGCCCCTGTTGGACCC
GTTACTCCATCTGTTCCT	GCAGTTCCGGTCGCCCCTGTTGGACCT
GTTACTCCATCTGTTCCT	GCAGTTCCGGTCGCCCCTGTTGGACCT
GTTACTCCATCTGTTCCT	GCAGTTCCGGTCGCCCCTGTTGGACCC
GTTACTCCATCTGTTCCT	GCAGTTCCGGTCGCCCCTGTTGGACCC
GTTACTCCATCTGTTCCT	GCAGTTCCGGTCGCCCCTGTTGGACCT
GTTACTCCATCTGTTCCT	GCAGTTCCGGTCGCCCCTGTTGGACCC
GTTACTCCATCTGTTCCT	GCAGTTCCGGTCGCTCCTGTTGGACCT
GTTACTCCATCTGTTCCT	GCAGTTCCGGTCGCCCCTGTTGGACCC
GTTACTCCATCTGTTCCT	GCAGTTCCGGTCGCCCCTGTTGGACCC
GTTACTCCATCTGTTCCT	GCAGTTCCGGTCGCCCCTGTTGGACCC
GTTACTCCATCTGTTCCT	GCAGTTCCGGTCGCCCCTGTTGGACCT
GTTACTCCATCTGTTCCG	GTTGCTCCCGTTGGACCC
GTTACTCCATCTGTTCCT	GCAGTTCCGGTCGCTCCTGTTGGACCT
GTTACTCCATCTGTTCCT

Protein	Signature genes	Signature genes Name	Protein_function
NC_022873.1\|WP_016123739.1\|5509926_5510694_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379228
NC_022873.1\|WP_023523384.1\|5516335_5517394_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133005
NC_022873.1\|WP_023523389.1\|5525549_5529401_-\|phage-tail-tape-measure-protein	unknown	unknown	gnl\|CDD\|378413
NC_022873.1\|WP_001123920.1\|5511501_5511969_-\|SsrA-binding-protein	unknown	unknown	gnl\|CDD\|376590
NC_022873.1\|WP_023523382.1\|5512095_5514528_-\|ribonuclease-R	unknown	unknown	gnl\|CDD\|273947
NC_022873.1\|WP_023523392.1\|5530590_5530950_-\|DUF3168-domain-containing-protein	unknown	unknown	gnl\|CDD\|378648
NC_022873.1\|WP_023523383.1\|5515013_5516090_+\|replication-protein	unknown	unknown	unknown
NC_022873.1\|WP_000344051.1\|5529415_5529592_-\|hypothetical-protein	unknown	unknown	unknown
NC_022873.1\|WP_023523391.1\|5529987_5530590_-\|phi13-family-phage-major-tail-protein	unknown	unknown	gnl\|CDD\|273713
NC_022873.1\|WP_000815803.1\|5508752_5509430_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NC_022873.1\|WP_000631247.1\|5505253_5506318_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	unknown	unknown	gnl\|CDD\|226964
NC_022873.1\|WP_023523388.1\|5524053_5525538_-\|phage-tail-family-protein	unknown	unknown	gnl\|CDD\|368574
NC_022873.1\|WP_043924707.1\|5521295_5521559_+\|hypothetical-protein	unknown	unknown	unknown
NC_022873.1\|WP_000042077.1\|5506314_5507331_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	unknown	unknown	gnl\|CDD\|226965
NC_022873.1\|WP_000590061.1\|5504504_5505257_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|226963
NC_022873.1\|WP_023523386.1\|5522627_5522831_-\|hypothetical-protein	unknown	unknown	unknown
NC_022873.1\|WP_023523032.1\|5521524_5522568_-\|N-acetylmuramoyl-L-alanine-amidase	unknown	unknown	gnl\|CDD\|133475
NC_022873.1\|WP_000151299.1\|5522833_5523115_-\|hypothetical-protein	unknown	unknown	unknown
NC_022873.1\|WP_023523390.1\|5529621_5529939_-\|hypothetical-protein	unknown	unknown	unknown
NC_022873.1\|WP_000749445.1\|5507350_5508367_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238560

Protein	Function_ID	Function_description	E-value
NC_022873.1\|WP_016123739.1\|5509926_5510694_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379228	pfam13508, Acetyltransf_7, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	5.50044e-07
NC_022873.1\|WP_023523384.1\|5516335_5517394_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|133005	cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.	5.8542e-49
NC_022873.1\|WP_001123920.1\|5511501_5511969_-\|SsrA-binding-protein	gnl\|CDD\|376590	pfam01668, SmpB, SmpB protein.	4.95132e-93
NC_022873.1\|WP_023523382.1\|5512095_5514528_-\|ribonuclease-R	gnl\|CDD\|273947	TIGR02063, Ribonuclease_R, ribonuclease R. This family consists of an exoribonuclease, ribonuclease R, also called VacB. It is one of the eight exoribonucleases reported in E. coli and is broadly distributed throughout the bacteria. In E. coli, double mutants of this protein and polynucleotide phosphorylase are not viable. Scoring between trusted and noise cutoffs to the model are shorter, divergent forms from the Chlamydiae, and divergent forms from the Campylobacterales (including Helicobacter pylori) and Leptospira interrogans. [Transcription, Degradation of RNA].	0
NC_022873.1\|WP_023523392.1\|5530590_5530950_-\|DUF3168-domain-containing-protein	gnl\|CDD\|378648	pfam11367, DUF3168, Protein of unknown function (DUF3168). This family of proteins has no known function but is likely to be a component of bacteriophage.	9.28085e-06
NC_022873.1\|WP_023523391.1\|5529987_5530590_-\|phi13-family-phage-major-tail-protein	gnl\|CDD\|273713	TIGR01603, Uncharacterized_phage_related_protein, phage major tail protein, phi13 family. This model describes a set of proteins that share low levels of sequence similarity but similar lengths and similar patterns of charged, hydrophobic, and Gly/Pro residues. All members (except one attributed to mouse embryo cDNA) belong to phage of Gram-positive bacteria. Several are identified as phage major tail proteins. Some members of this family have additional C-terminal regions of about 100 residues not included in this model. [Mobile and extrachromosomal element functions, Prophage functions].	3.94619e-28
NC_022873.1\|WP_000815803.1\|5508752_5509430_-\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	3.04905e-66
NC_022873.1\|WP_000631247.1\|5505253_5506318_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	gnl\|CDD\|226964	COG4605, CeuC, ABC-type enterochelin transport system, permease component [Inorganic ion transport and metabolism].	3.64555e-96
NC_022873.1\|WP_023523388.1\|5524053_5525538_-\|phage-tail-family-protein	gnl\|CDD\|368574	pfam05709, Sipho_tail, Phage tail protein. This family consists of several Siphovirus and other phage tail component proteins as well as some bacterial proteins of unknown function.	6.32433e-30
NC_022873.1\|WP_000042077.1\|5506314_5507331_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	gnl\|CDD\|226965	COG4606, CeuB, ABC-type enterochelin transport system, permease component [Inorganic ion transport and metabolism].	2.80713e-115
NC_022873.1\|WP_000590061.1\|5504504_5505257_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|226963	COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism].	1.01925e-132
NC_022873.1\|WP_023523032.1\|5521524_5522568_-\|N-acetylmuramoyl-L-alanine-amidase	gnl\|CDD\|133475	cd06583, PGRP, Peptidoglycan recognition proteins (PGRPs) are pattern recognition receptors that bind, and in certain cases, hydrolyze peptidoglycans (PGNs) of bacterial cell walls. PGRPs have been divided into three classes: short PGRPs (PGRP-S), that are small (20 kDa) extracellular proteins; intermediate PGRPs (PGRP-I) that are 40-45 kDa and are predicted to be transmembrane proteins; and long PGRPs (PGRP-L), up to 90 kDa, which may be either intracellular or transmembrane. Several structures of PGRPs are known in insects and mammals, some bound with substrates like Muramyl Tripeptide (MTP) or Tracheal Cytotoxin (TCT). The substrate binding site is conserved in PGRP-LCx, PGRP-LE, and PGRP-Ialpha proteins. This family includes Zn-dependent N-Acetylmuramoyl-L-alanine Amidase, EC:3.5.1.28. This enzyme cleaves the amide bond between N-acetylmuramoyl and L-amino acids, preferentially D-lactyl-L-Ala, in bacterial cell walls. The structure for the bacteriophage T7 lysozyme shows that two of the conserved histidines and a cysteine are zinc binding residues. Site-directed mutagenesis of T7 lysozyme indicates that two conserved residues, a Tyr and a Lys, are important for amidase activity.	3.74935e-20
NC_022873.1\|WP_023523389.1\|5525549_5529401_-\|phage-tail-tape-measure-protein	gnl\|CDD\|378413	pfam10145, PhageMin_Tail, Phage-related minor tail protein. Members of this family are found in putative phage tail tape measure proteins.	6.28591e-31
NC_022873.1\|WP_000749445.1\|5507350_5508367_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238560	cd01140, FatB, Siderophore binding protein FatB. These proteins have been shown to function as ABC-type initial receptors in the siderophore-mediated iron uptake in some eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.	1.1565e-90

>NC_022873.1|WP_023523384.1|5516335_5517394_-|glycosyltransferase-family-2-protein
MISISLCLIVKNEEQTLNNCLSSVRGIPDEIIIVDTGSTDRTKEIAKKWTSHVYEFEWIDDFSAARNASFQYATKDYILWLDADDVLEQEQSRKLKQLKESLSEGVDAVSMKYLMLNSEERGITSYTTRLRLVKREKGFKWKGIVHEDLAINQAYTSLQSDICITHTKKGNTNMPSSRRNLEIYERHIAKGYQLNVSDMFHYARECKIHKEYEKAIQYFEQCKNHPEISLENTIFVYHQLATCYAMVQKPQNELELTLQSLSLDIPYPAFSCRMGEHFLRKGHLEAAIFWYTTAYTQPLLERYAWSVADQAYHTWLPHQQLALCYQTLGEQEQAIFHEQQAKEYQNISSDSF
>NC_022873.1|WP_023523383.1|5515013_5516090_+|replication-protein
MKKLTAYNADIQKYMQQNRLSSQKKNEIMNAMRKRIDDMNQSFESLFPSRSKRKDVMDHIIYMLSGNGICKIAAETLADKADCSVRTVNAAVRALKQTGEILVAGLADGKNKYVFVLKMHPNFTTIMNEVFFINTEQIAERNAGQVAEQKNDETVEAVGIETEKTSSNYTNSINSFNSLKQEKNNDKVSLVESIENELKEAQTDVKKEFEKIHTYFVNEYQEMMYHTIKAGTYHPTLKANASIIGLRVGSNCDKSLFHLASNALGKIDRFLKNNGILTDSVQALFTKVYSDNIKLSRMPKKHHTGSSNVHNTKTPFIFYNWLEDNGTKESSVKTMDSSFVPNVYYKISKEEADKMGLY
>NC_022873.1|WP_023523382.1|5512095_5514528_-|ribonuclease-R
MEEITQEHIDKLLLFMREEAYKPLTIQELEEAFGIEGSEGFKDFVKALVMMEEKGLVIRTRSNRYGLPEKMNLVRGKLIGHARGFAFVVPDEKKTGDDDLFIPPTELNGALHGDTVLARLSSQSSGSRQEGSIVRILERGTKELVGTYTESKNFGFVIPDNKRWTSDIFILKSASMGAVEGHKVVVKITSYPENRLSAEGEVIQILGHKNDPGVDILSVIHKHHLPLAFPEEVMEHANSVPETISEEDLKDRRDLRDQMIVTIDGADAKDLDDAVTVTKLENGNYKLGVHIADVSHYVQEGSPIDVEAAERATSVYLVDRVIPMIPHRLSNGICSLNPKVDRLTLSCEMEINNLGDVVKHEIFQSVIKTTERMTYADVRSILEDEDEELIKRYEPLVPMFKEMGQLAQILREKRMRRGAIDFDFKEAKVLVDEEGKPTDVVMRDRSVSEKLIEEFMLVANETVAEHFHWMNVPFMYRVHEDPKEDKLERFFEFVTNFGYAVKGRANEVHPRALQQILEMVQGQPEEVVISTVMLRSMKQARYDSESLGHFGLSTEFYTHFTSPIRRYPDTIVHRLIREYIINGKVDSETQAKWRENLPEIAEHSSNMERRAVEAERETDEMKKAEYMVDKIGEEYDGMISSVTNFGLFVGLPNTIEGLVHVSYLTDDYYRYDEKHFAMIGERTGNVFRIGDEITIRVINVNKDERAIDFEIVGMKGTPRRKFKDRPVVIEQPRTGRKKRGGRSERSNERGGERGTGRKFDRGGKGKGRGSASASTSASASQPGKKDGNGKKKKGFFENVPGFKKKKKKRK
>NC_022873.1|WP_001123920.1|5511501_5511969_-|SsrA-binding-protein
MPKGTGKVIAQNKKAFHDYFIEETYEAGLVLQGTEIKSIRAGRVNLKDAFARVHNGEVWVHNMHINTYEQGNRFNHDPLRTRKLLLHKKEIDKLAGAAKETGYALVPLRIYLKNGFAKMALGLAKGKKQYDKRHDLKEKEAKREIARVFRDRQKM
>NC_022873.1|WP_016123739.1|5509926_5510694_+|GNAT-family-N-acetyltransferase
MITNQQLVINNLEEKLKVFTHTVSGKLTKEEDFIIANTEIPTDTFNVVLPKSPNIKNAVKIRHGIDNFSYKKYPFSIWIDAQYLTEDWTKLMQEYDLKEAERNVMMKLDNTLNVDQRISHQLMITNVKNNEELLKYIDVFMSLFEGTPEKDALESYFNKFSQVKLGSEVQMFIGCIDDMPVTTGLLIESKDSYGIYDVMTKETFRGKGIGSEMFQFLLNQTTDKQKPVVLQASDDGKNIYKRFGFIDVGEMVVFE
>NC_022873.1|WP_000815803.1|5508752_5509430_-|response-regulator-transcription-factor
MKQVLVIKNERSLAKKIVSGLTQEGYFILKLHNENEGLNIIYEQDWDIIILDWDSLSISGPEICRQIRLVKTTPIIIVTDNVSSKDCVAGLQAGADDYIRKPFAKEELVARVQAILRRSDCNQQKEINFFQFKDLFVDASSNIVKKGGENLSLTKREYDLLVFLIKNKNTILSREMLLNQVWGYNVVVNPNVVDLYIGYVRKKLKCEKKDRYIQTIHGRGYSMID
>NC_022873.1|WP_000749445.1|5507350_5508367_-|ABC-transporter-substrate-binding-protein
MKKSMLLKLVSILAVFTLMLVACSDSSKETSKANNKDNGSDKPKTVEITDAHGTVKVPVNPKNVVALDNRTFETLSDWGIKLAAAPKDIMPADSAYKKDEKVQNIGNHREPNLEIIAAANPDLVIVGQRFADHYEEIKKLVPNAAVIDLNFDVSEKATKPGENLVKGLKDSTITLGKIFNKDKEAKQLVADFDKSIEKAKSAYNGKDKVMSVIVTGGNIGFAAPHSGRVWGPMYEIFGWTPALEVSNSTAGHKGDDVSVEAIAQTNPDWIFVLDRDAATSDAAKSTPAKDVISKSPALQNTTAVSKKQVIYAPEDTYTNESIQTYIELFGNMAKTLAK
>NC_022873.1|WP_000042077.1|5506314_5507331_-|iron-chelate-uptake-ABC-transporter-family-permease-subunit
MSKNMISRVENISQPQFYNQNKIWTKPFIIAVIVVIILGIISLFTGVYDIRGQEDGTEMFFITRVPRTAALMLTGAAMAMAGLVMQLITQNRFVEPTTTGTIEWSGLGLLFVYLLFPAPTLVQRMTGAIIFSFIGTMIFFLFLRRVKLRSSLIVPIIGLMLGAVISAVSTFLGLLFQKTQSIETWFVGSFANIQVGRYEYLWLIVIITFLIFMYANRLTLAGLGEDVATSLGVNYNRIVLFGTALISVAVGIVAAVIGHLPFLGLIVPNIVSMFRGDDLRSNLPWVCVIGMGSITACDIISRTIIQPFELPVSLILATVGAVVFITILLRQRKPRRLR
>NC_022873.1|WP_000631247.1|5505253_5506318_-|iron-chelate-uptake-ABC-transporter-family-permease-subunit
MITLEYRKKENVEIDSSLHNESRSASAFRSKKEARRYWILLITLIGLGLLSSYGLLVYNNPVPIDSPSFIPVVKRRIVAIVAMIIAAVCHSLSTVAFQSITNNKIITPSLLGFESLYSAIQTSTVFFFGASALINFNGIGSFLFQVVVMVFMSLILYGWLLSGKYGNLQLMLLVGIIIGTGLNSVSTFMRKLLAPSEFDILQARLFGSVNHADPAYFPIVIPMIIIVAVLIFAHSKNLNVLSLGKDVATSFGVKYQPSVIYTLVLVAILMSISTALIGPLTFYGFLVATLSYQAASTYDHRYIFPMAFAIGFLIMTSAYFLMYHVFHAQGVVSVIIELFGGIIFLTIVLRKRAL
>NC_022873.1|WP_000590061.1|5504504_5505257_-|ATP-binding-cassette-domain-containing-protein
MIKIDNVKKFYTDKVKIGPLDIEIPKAGFTSLIGPNGAGKSTTLLMIGRLLDMDEGQIQVANMDVSESKSKDLAKVLTILRQENHFVTRLTVRQLVGFGRFPYSKGRLTKEDEAIISKYIDFLDLTSLENRYLDELSGGQRQRAYVAMVLCQETEYVLLDEPLNNLDVARSVQMMEHLRRAANEFGRTILTVMHDINFAAKYSDKICAMKDGQIAAFGTVEEVMDPTLLTDIFETKIEIINGPYGPIAVY
>NC_022873.1|WP_043924707.1|5521295_5521559_+|hypothetical-protein
MIFKLSLALLLLLFAGLWLFIGYYLKTSLLLGLGLGVMFGVLIMLLPDVLAWMIKEDRPETMFLLSNKEASTSLFLFTSHIQMLHLQ
>NC_022873.1|WP_023523032.1|5521524_5522568_-|N-acetylmuramoyl-L-alanine-amidase
MKRLLGIVIILCMIFSLSTSVFADRILLIPDAPKTPYRGGVGAYEGVVAHSTATPEAPAINIQRYETRTWRNAFVHYAVDWYETIQIADTKYIVYGAGPAANKRFVHVELCETADYAKFKRSYEKYVKLLAKILQDNNLSVEKGLWTHNDVRKYLGGTDHEDPIDYLRSHGVSEVQFRSDVQQAYNNSSVDVSVPSKPEEVPTAVTDGIAYILGNNVNLRKGPGTSYSVIRQLNKPESYIVWAEKDGWLNLGGDQWIKNDPSYVTFEKKSTVASSIVGKRVVSKVNNLSFYDAPSWADTDVAGTVEAGLGFVIDDKIMVNGSQQYKVHNSKGKTYYVTANAAFVYVK
>NC_022873.1|WP_023523386.1|5522627_5522831_-|hypothetical-protein
MTKENIRKRLRNWKTWVALASLLGFICAKAGLLETKSFIDEMLPYLFTLGVALGIWSDHEGTVQTDK
>NC_022873.1|WP_000151299.1|5522833_5523115_-|hypothetical-protein
MTIELGVLIALLSLAISYFGYALNKSKSIKADGQQSAEVKAELGYIRKGVDDIRIDLKASEKQMVALGERVTRVEESTKQAHKRLDTIEKETD
>NC_022873.1|WP_023523388.1|5524053_5525538_-|phage-tail-family-protein
MLGKLSFTFNKIRKDYVQMLVGRKRPSWAPIKRRLVRVPHRAGALFLHTETEERRIDVPFVIKAAKDMADLQKIKEDLADWLYTEQPAELVFDDELDRTYLALIDGSVDLDEIVNRGKGVITFVCPMPYKLGKQNTHMFSQSSSTEVATSFINQGNIEAPAIIEIEAQKLSTFLDVRFGEYPYNRDYFRIGYPLKTEQLPVERNQRLIWDEMANTVGWSKVSSMEDGEPIGEMKSDKYQFYCSDFGTSAGKGWHGAAVKKNIPGGPVQDFIMQAYVTCKSKRINEMGRVEIAILDENSKVLSKIAMSDVFWQAEQNFGTMVIGYDNKPGKIGLIYESGDYPNTWNQYYGRLWIARTGNVWEAYISKFLPGTEKDDSERFARWTDENNYHMEKAAQIQISMMQWQDVPPVEAMTVSDLKFWKVNLDTQNNPPYIFDTGDKIIIDTEKSLVTINGKNAINLKDIFSNFPTVIRGENRIDIMPPDVKATVSYRERYR
>NC_022873.1|WP_023523389.1|5525549_5529401_-|phage-tail-tape-measure-protein
MANEMNNLVVRLSLDNVNFRQGIANSGRAVRTLQNELKSVSTGMGGFANASQQTQAKMNTLTRLIEAQKEKVRALRQAYDQNKATLGENDAATQRYASQVNKAVADLNRFENELKQVNRQAEQKGMDKLNNALKALQAEFQSITTGMGGFSNATEQTRAKVDLLSRIVDKQKEKVRELQQAYNRAKAEEGEASQSAQRYAEQIHRATAELNRFETELQQSNRELEQQGNRLLNFGNRMESLGNHLQNAGMQRGMVFGGMTYAIGRGLKSAVEESMNFEQQMANIKAVSGATGQEMSKLSELAVKYGEDTKYSSVEAGKGIEEFIQSRVSLTDIINGGLEGALNLAAAGELELGEAAEIASTALNAFKKDGLSVTDAANLLAGAANASATDVHELKYGLSASAAVAAGAGMTFKDTAPALAVFAQNGLKGSDAGTSLKTMLMRLNPSTKEAYNKMADLGLITYNAQAGFDFLVKNGVTPASRSVGDIEVALEKYVMQTEGVTKWNDKCDTTFRELATSSAFLSSKFYDQQGKIQSLEHISGILKESMKDLTDQQRSMALETLFGSDAVRGATILFNEGSQGVNKMYTEMSKVTALETANTKMNTLKGRIEQLSGAFDTMKKTIGDALAPVVSAFVAGLQKLVDGFNSLSGPVQKAIAITGGIVLALTAVATAIGVVLATFGMIASGIGSLSLALASVGGIAGVAAGAVGFLGSAIGLLFGPVGLVAAALIGTGVVAYKAYQKATEDSIASVDRFATNTEGKVSSSTKKVLGEYFKLSDGIRQKLTEMRLNHEVITEEQSQKLIGQYDKLGNTIIEKTNARQQKEVEGLKKFFADSYVLTAEEENKRMEQMNQHYEQEKLKTQEKENKIKEIIQTAANEKRDFTTSERISLQALQDEMDRTAIQHMSANQMEQKVIYENMRVQVSEISARQAAEVVENSAKARDKVIEDAKKTRDDKIAYAIRLRDESGTLNKEEANAAIAEANRQYESTVSTARDKHREIVSEAKSQAGEHANQVDWETGQIKSKYQVMKDDVVRKMQETWSGITKWWEETKTSANNKVEEIKNTVSRKFEEKKKAVVDKMKEIKSDIEDKWNTVEKFFSTVNLRSIGKSIIEGLGKGIDDASGGLFSKAAGIANDIKRTISGALEINSPSKVMIPVGSAVPEGVGVGMDKGKRFVVDAAKNVVGTVKKQMSNMPSVFDFGFQTNQYSIPQNTFDNFSGYTQPQLDYNNPSMAKTMFSDRSGREQELNVTVNMTNVLHGTEIANASYAYTTKLQDRDQKRRAEF
>NC_022873.1|WP_000344051.1|5529415_5529592_-|hypothetical-protein
MDELYLSLLRQGYKHHHIDNEMDIWHYLRLNQKYREQDQSNRENYNSNEMEVPAENII
>NC_022873.1|WP_023523390.1|5529621_5529939_-|hypothetical-protein
MKLSLRMDGEQHIFNMPTFIPARLIRQAPELADVPNNPGPEDMDKMVQYVVKVYGEQFTLDQYWDGVDARKFLSTTSDVINAIINETVGAAGGTPETGEETNPNA
>NC_022873.1|WP_023523391.1|5529987_5530590_-|phi13-family-phage-major-tail-protein
MAGEVIKISSTVGVDSLVYAKLLKDDATGVDYSAVKEMEGAVKIKTSKKVASEIMWSDNKKSEIAESDGEVEVEIELRSISLSTKADIEGYPEVKDGVLDERREGEKPYVAIGWRFLKANGKYRYVWLLKGKLSQEEEEGETKKDKPNFQTTKLKGSFIERDFDDRPKFTADADEPTFTKTVGDNWFKKVYEKAVTPSPK
>NC_022873.1|WP_023523392.1|5530590_5530950_-|DUF3168-domain-containing-protein
MINLRPEIVQALENNQELVSLLGGKRDYYRKAKNAEEFPRITFFELDNRPDGFADNEENESEITFQIDIWSKGSTTVIHQKVNEIMKRIGFSRYAVADLYEDDTQIFHYAMRFAKGVEL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_022873_9

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_022873_9

5781904-5782037

Orphan

Consensus_repeat	Method
GTTGATTTCTCTTCTTTTTGAGA	CRISPRCasFinder

2 spacers

The CRISPR arrays of NC_022873_9

>merge|NC_022873|9|5781904-5782037|CRISPRCasFinder
GTTGATTTTTCTTCTTTCTTCGGTTCTTCTTTTTTGTCACTAGTTGAACCGCTTGTTGATTTCTCTTCTTTTTGAGACTTGTCTTCTGTTTTATTTTCTGGTTTCGTGCTCGTTGACTTCTCTTCTTTTTGAGA

>NC_022873|9|7|5781904-5782037|CRISPRCasFinder
GTTGATTTTTCTTCTTTCTTCGG	TTCTTCTTTTTTGTCACTAGTTGAACCGCTT
GTTGATTTCTCTTCTTTTTGAGA	CTTGTCTTCTGTTTTATTTTCTGGTTTCGTGCTC
GTTGACTTCTCTTCTTTTTGAGA

Protein	Signature genes	Signature genes Name	Protein_function
NC_022873.1\|WP_175056341.1\|5773531_5774119_-\|sugar-transferase	unknown	unknown	gnl\|CDD\|376775
NC_022873.1\|WP_000457978.1\|5779838_5780840_-\|rod-shape-determining-protein	unknown	unknown	gnl\|CDD\|237563
NC_022873.1\|WP_000144418.1\|5782925_5783633_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|378925
NC_022873.1\|WP_000170824.1\|5783632_5784475_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224054
NC_022873.1\|WP_000411275.1\|5786988_5788293_-\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	unknown	unknown	gnl\|CDD\|236486
NC_022873.1\|WP_023523546.1\|5775349_5776117_-\|capsular-polysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|226870
NC_022873.1\|WP_023523547.1\|5776225_5776927_-\|CpsD/CapB-family-tyrosine-protein-kinase	unknown	unknown	gnl\|CDD\|349772
NC_022873.1\|WP_023523551.1\|5785761_5786781_-\|stage-II-sporulation-protein-D	unknown	unknown	gnl\|CDD\|274332
NC_022873.1\|WP_000931959.1\|5778977_5779412_-\|3-hydroxyacyl-ACP-dehydratase-FabZ	unknown	unknown	gnl\|CDD\|234568
NC_022873.1\|WP_000008903.1\|5781581_5781716_-\|hypothetical-protein	unknown	unknown	unknown
NC_022873.1\|WP_023523548.1\|5776916_5777660_-\|capsular-polysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|226453
NC_022873.1\|WP_023523545.1\|5774228_5775110_-\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	unknown	unknown	gnl\|CDD\|224131
NC_022873.1\|WP_000544012.1\|5781000_5781273_-\|sporulation-transcriptional-regulator-SpoIIID	unknown	unknown	gnl\|CDD\|378813
NC_022873.1\|WP_001185908.1\|5784656_5785664_-\|LytTR-family-transcriptional-regulator-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|224054
NC_022873.1\|WP_000568236.1\|5792548_5794411_-\|NADH-quinone-oxidoreductase-subunit-L	unknown	unknown	gnl\|CDD\|235836
NC_022873.1\|WP_000057889.1\|5789088_5789325_-\|DUF1146-domain-containing-protein	unknown	unknown	gnl\|CDD\|227173
NC_022873.1\|WP_023523553.1\|5791049_5792552_-\|NADH-quinone-oxidoreductase-subunit-M	unknown	unknown	gnl\|CDD\|235622
NC_022873.1\|WP_023523549.1\|5777933_5778611_-\|CpsD/CapB-family-tyrosine-protein-kinase	unknown	unknown	gnl\|CDD\|349772
NC_022873.1\|WP_023523552.1\|5789527_5791048_-\|NADH-quinone-oxidoreductase-subunit-NuoN	unknown	unknown	gnl\|CDD\|235603
NC_022873.1\|WP_003272396.1\|5788332_5789043_-\|YwmB-family-TATA-box-binding-protein	unknown	unknown	gnl\|CDD\|370056

Protein	Function_ID	Function_description	E-value
NC_022873.1\|WP_175056341.1\|5773531_5774119_-\|sugar-transferase	gnl\|CDD\|376775	pfam02397, Bac_transf, Bacterial sugar transferase. This Pfam family represents a conserved region from a number of different bacterial sugar transferases, involved in diverse biosynthesis pathways.	6.15365e-89
NC_022873.1\|WP_000457978.1\|5779838_5780840_-\|rod-shape-determining-protein	gnl\|CDD\|237563	PRK13928, PRK13928, rod shape-determining protein Mbl; Provisional.	0
NC_022873.1\|WP_023523552.1\|5789527_5791048_-\|NADH-quinone-oxidoreductase-subunit-NuoN	gnl\|CDD\|235603	PRK05777, PRK05777, NADH-quinone oxidoreductase subunit NuoN.	9.27601e-150
NC_022873.1\|WP_023523545.1\|5774228_5775110_-\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	gnl\|CDD\|224131	COG1210, GalU, UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane].	0
NC_022873.1\|WP_000411275.1\|5786988_5788293_-\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	gnl\|CDD\|236486	PRK09369, PRK09369, UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Validated.	0
NC_022873.1\|WP_000144418.1\|5782925_5783633_-\|ABC-transporter-permease	gnl\|CDD\|378925	pfam12698, ABC2_membrane_3, ABC-2 family transporter protein. This family is related to the ABC-2 membrane transporter family pfam01061.	1.63691e-09
NC_022873.1\|WP_023523547.1\|5776225_5776927_-\|CpsD/CapB-family-tyrosine-protein-kinase	gnl\|CDD\|349772	cd05387, BY-kinase, bacterial tyrosine-kinase. Bacterial tyrosine (BY)-kinases catalyze the autophosphorylation on a C-terminal tyrosine cluster and also phosphorylate endogenous protein substrates by using ATP as phosphoryl donor. Besides their capacity to function as tyrosine kinase, most of these proteins are also involved in the production and transport of exopolysaccharides. BY-kinases are involved in a number of physiological processes ranging from stress resistance to pathogenicity.	1.44375e-82
NC_022873.1\|WP_023523551.1\|5785761_5786781_-\|stage-II-sporulation-protein-D	gnl\|CDD\|274332	TIGR02870, Stage_II_sporulation_protein_D, stage II sporulation protein D. Stage II sporulation protein D (SpoIID) is a protein of the endospore formation program in a number of lineages in the Firmicutes (low-GC Gram-positive bacteria). It is expressed in the mother cell compartment, under control of Sigma-E. SpoIID, along with SpoIIM and SpoIIP, is one of three major proteins involved in engulfment of the forespore by the mother cell. [Cellular processes, Sporulation and germination].	3.96643e-135
NC_022873.1\|WP_000931959.1\|5778977_5779412_-\|3-hydroxyacyl-ACP-dehydratase-FabZ	gnl\|CDD\|234568	PRK00006, fabZ, 3-hydroxyacyl-ACP dehydratase FabZ.	5.26499e-95
NC_022873.1\|WP_000170824.1\|5783632_5784475_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	2.15663e-89
NC_022873.1\|WP_023523548.1\|5776916_5777660_-\|capsular-polysaccharide-biosynthesis-protein	gnl\|CDD\|226453	COG3944, COG3944, Capsular polysaccharide biosynthesis protein [Cell envelope biogenesis, outer membrane].	2.10549e-84
NC_022873.1\|WP_000544012.1\|5781000_5781273_-\|sporulation-transcriptional-regulator-SpoIIID	gnl\|CDD\|378813	pfam12116, SpoIIID, Stage III sporulation protein D. This stage III sporulation protein is a small DNA-binding family that is essential for gene expression of the mother-cell compartment during sporulation. The domain is found in bacteria and viruses, and is about 40 amino acids in length. It has a conserved RGG sequence motif.	1.17272e-38
NC_022873.1\|WP_001185908.1\|5784656_5785664_-\|LytTR-family-transcriptional-regulator-DNA-binding-domain-containing-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	1.31454e-30
NC_022873.1\|WP_000568236.1\|5792548_5794411_-\|NADH-quinone-oxidoreductase-subunit-L	gnl\|CDD\|235836	PRK06590, PRK06590, NADH:ubiquinone oxidoreductase subunit L; Reviewed.	0
NC_022873.1\|WP_023523546.1\|5775349_5776117_-\|capsular-polysaccharide-biosynthesis-protein	gnl\|CDD\|226870	COG4464, CapC, Capsular polysaccharide biosynthesis protein [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane].	4.29224e-107
NC_022873.1\|WP_023523553.1\|5791049_5792552_-\|NADH-quinone-oxidoreductase-subunit-M	gnl\|CDD\|235622	PRK05846, PRK05846, NADH:ubiquinone oxidoreductase subunit M; Reviewed.	4.3382e-177
NC_022873.1\|WP_023523549.1\|5777933_5778611_-\|CpsD/CapB-family-tyrosine-protein-kinase	gnl\|CDD\|349772	cd05387, BY-kinase, bacterial tyrosine-kinase. Bacterial tyrosine (BY)-kinases catalyze the autophosphorylation on a C-terminal tyrosine cluster and also phosphorylate endogenous protein substrates by using ATP as phosphoryl donor. Besides their capacity to function as tyrosine kinase, most of these proteins are also involved in the production and transport of exopolysaccharides. BY-kinases are involved in a number of physiological processes ranging from stress resistance to pathogenicity.	2.71668e-81
NC_022873.1\|WP_000057889.1\|5789088_5789325_-\|DUF1146-domain-containing-protein	gnl\|CDD\|227173	COG4836, COG4836, Predicted membrane protein [Function unknown].	1.23409e-23
NC_022873.1\|WP_003272396.1\|5788332_5789043_-\|YwmB-family-TATA-box-binding-protein	gnl\|CDD\|370056	pfam08680, DUF1779, TATA-box binding. TATA-box_bdg is a family of bacterial proteins. YwmB from Bacillus subtilis contains a circularly permuted TATA-box binding protein-like fold. Jian-Xiang Liu, Qi Xie, Jun Lin. Protein Structural Data Mining and Evolutionary Bioinformatic Analysis on Domains of TATA-box Binding Protein-like Fold. Life Science Journal 2014; 11(2): 298-302 (not yet in PubMed 27-02-2014).	1.11897e-33

>NC_022873.1|WP_000008903.1|5781581_5781716_-|hypothetical-protein
MSFLFVLSTAIILLFVLFTLYYYIAGKKEVPHHQLLEEELEREE
>NC_022873.1|WP_000544012.1|5781000_5781273_-|sporulation-transcriptional-regulator-SpoIIID
MHDYIKERTIKIGKYIVETRKTVRVIAKEFGVSKSTVHKDLTERLPEINPELANEVKEILDYHKSIRHLRGGEATKQKYRKEDVEKPVRQ
>NC_022873.1|WP_000457978.1|5779838_5780840_-|rod-shape-determining-protein
MFARDIGIDLGTANVLIHVKGKGIVLNEPSVVAIDRNSGKVLAVGEEARSMVGRTPGNIVAIRPLKDGVIADFEITEAMLKYFINKLDVKSFFSKPRILICCPTNITSVEQKAIREAAERSGGKTVFLEEEPKVAAVGAGMEIFQPSGNMVVDIGGGTTDIAVLSMGDIVTSSSIKMAGDKFDMEILNYIKRKYKLLIGERTSEDIKIKVGTVFPGARSEELEIRGRDMVTGLPRTITVCSEEITEALKENAAVIVQAAKGVLERTPPELSADIIDRGVILTGGGALLHGIDMLLAEELKVPVLIAENPMHCVAVGTGIMLENIDRLPKRALR
>NC_022873.1|WP_000931959.1|5778977_5779412_-|3-hydroxyacyl-ACP-dehydratase-FabZ
MLNIEQIKEIIPHRYPFLLVDKILEVDEGKRAVGIKNVSANEEFFNGHFPDYAVMPGVLIVEALAQVGAVAVLKKEENRGRLAFFAGIDNCRFKKQVRPGDQLRLEVEMTRVRGPIGKGKAIATVDGEVACEAEITFAIGDKKE
>NC_022873.1|WP_023523549.1|5777933_5778611_-|CpsD/CapB-family-tyrosine-protein-kinase
MFGRKKRKPLRQLITNKEPKSRIAEQYRNIRTNIEFTSVDNHIRSIIVTSADPGDGKTTTISNLAVVFGQQGKKVLLIGADLRKPTLQNLFAAHNPNGLTNLLSGQSSFVQCIQKTDIENVYVMSAGPIPPNPAELLGYRKMDELLLEAYKMFDIVLIDTPPVLAVTDAQILANKCDGVILVARSEKTEKDKLIKAKQILDKASGKLLGVILNDKREEQEQYGYY
>NC_022873.1|WP_023523548.1|5776916_5777660_-|capsular-polysaccharide-biosynthesis-protein
MEETISLKELFHILKKRLAMILVIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGSMFQAGEVQTNIQLTNTYKVIIKSPVILEQVNEKLNLNMTAQALTKKVNVANEKDSQVISVTAEDKDPKVARDIANATADVFKGEVAKIMNVDNVTVLSKAEVAENQSPIKPRPMLNVAIAFVVGLMAAVGLAFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETMNVKSHAPSSRKVRGQTIGS
>NC_022873.1|WP_023523547.1|5776225_5776927_-|CpsD/CapB-family-tyrosine-protein-kinase
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKVLLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDLVIFDLPPILAVTDAQIMANQCDASILVVRSESTEKESAVKAKGLLESAKGKLLGVVLNDREREQSLYYYYGAN
>NC_022873.1|WP_023523546.1|5775349_5776117_-|capsular-polysaccharide-biosynthesis-protein
MIDLHCHILPGIDDGAQTVTDSLVMAQKAIEEGIHTIVATPHHQNGKYINERTSIIHQVKQLNDELQQHNIPLTILPGQEVRLYGDLLEDYEAGKIVTLNETNKYIFIEFPSNHVPRYAEQLFYELRVKGMIPIIVHPERNAELIERPDKLYNLVNKGALTQVTAGSLLGKFGKKIKKFSLQLVEHNLTHMIASDAHNTTSRGFHLAESYELIEKEFGATVMNDLRENPYLIISGKAIYKEDPEQIRRKKLFGIF
>NC_022873.1|WP_023523545.1|5774228_5775110_-|UTP--glucose-1-phosphate-uridylyltransferase-GalU
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAIESGIEDIIIVTGKGKRAIEDHFDHSFELEQTLLEKGKLEVLEKVQASSKINIHYIRQKEPKGLGHAVWCARKFIGNEPFAVLLGDDIVQAETPCLRQLMDQYDGTQSSVIGVQTVPENETHRYGIIDPVEQNDRRYQVRQFVEKPAQGTAPSNLAIMGRYILTPEIFTFLENQQTGAGGEIQLTDAIQRLNEIQRVFAYDFEGTRYDVGEKFGFIKTTIEIALQHENLNEELINYMNEVIKREKVTV
>NC_022873.1|WP_175056341.1|5773531_5774119_-|sugar-transferase
MDLSGAIVGLIIFSPIFLLISILYMTGDNKGPVFFKQIRMGKNGKEFYIYKFRSMIVNAEEKLRSNEVLYKKYIDNNYKLEPDEDPRITKVGQFLRKTSLDELPQFLNVLKGDMSLVGPRPVVQEELIEYGKRKDEFLSVKPGLTGYWQVSGRSDVGYPERVELELHYIYNCSILFDMKIIFLTMVHVIMRKGAY
>NC_022873.1|WP_000144418.1|5782925_5783633_-|ABC-transporter-permease
MTFSMKRFSAIVRKEINDAGKNSQVILMALLPILLAVFYSNMDSIKEFFAGFIIVMTITMVGSYVQAIIIAEEKEKHTLRVLMLSPASPIEVILGKSVLTVFFVLASSFISLVILDTFKGNIGMLVIIILIGTLLCVVLGTIVGLLSQNIAQTSILGLPIFIIFIMGPMLKEMVKNEFIIKVVNLLPTNHVMEALQKVIKGEGFIAIQEHILNNTIWTICLIILCIMVYKKKQLD
>NC_022873.1|WP_000170824.1|5783632_5784475_-|ABC-transporter-ATP-binding-protein
MTLAIEMKDVMKSFDGKTALGNVNIEVKQGEIFGFLGPSGSGKTTTVKILTSQLLHSVGTVRVLGKDITGPSSIDYKRIGILTDNSGLYERLSIYDNLLLFCDLYDCKKERIDEVLTQVNLLDDKKTPVKKLSKGMKQRVTLARAILHKPDILFLDEPTSALDPVNVQNIHKILKDLNEEGTTIFLTTHNMDEAETLCNRIAFLCGGEIVALDTPENLRLQYAKDQIQVVLKDKQKEVVQKDEVGAKRISEWMKKGELLSIHSHEPTLGDIFIEVTGRGL
>NC_022873.1|WP_001185908.1|5784656_5785664_-|LytTR-family-transcriptional-regulator-DNA-binding-domain-containing-protein
MALLELKQLEKTNQLPEIELKVEKGQCIVLQCNNHTAKVLHRIIIGEEEASTGNVLFEGEAIGKKNYSRIGFCFLKDEAYDRLKVKEYFKFLIGLYESKISIEEVVQPVGLLDKLNVKIEKLSFSEKRRLHIGRIMIHNPDLVILEEPEQNVDTESTVIIRKAIMKMKEQGKAIFITSSFLSDALSLTEDVYILNNDGVKKIEIEQEEVEEVDEEKVIQMIPQMKLERIPAKVNDKIILLDPMEIHFIETQNGVTHIHVREGHFVCALTLSELEARLTGFGFFRCHRSYLVNLQRVREVITWTRNSFSLILDDERKSSIPLSKGRMDELKGVIGL
>NC_022873.1|WP_023523551.1|5785761_5786781_-|stage-II-sporulation-protein-D
MKFSKPLFITVALLIALVIIVPAALVIPFAKAKVGEETASKTPPAIESIPAPGKVDTAVQVAVYREKQKKVESLPMEEYVTGVVASEMNASFEIEALKAQALAARTFVVQRMLSGGKKNNADVTDTVKDQVYKSKEELKKQWGNNYENNLKKIKEAVSKTAGQVLTYDGKPISASFFSTSNGRTENAADYWGNDYPYLKSVDSPWDQASPKFTSEQTFTVADFQKRLGVKVLADGKVGNIKDLTEGKRVKDVAFQGKTLTGKEVREKLDLRSSDFTWKQQGDKIIVTTKGFGHGVGMSQYGANGMAAEGKKYTDIVAHYYKGVEIKTMNDYEGKLMVKK
>NC_022873.1|WP_000411275.1|5786988_5788293_-|UDP-N-acetylglucosamine-1-carboxyvinyltransferase
MEKIIVRGGKRLNGTVRVEGAKNAVLPIIAAALLASDGKNVLSEVPVLSDVYTINEVLRHLNAEVVFENNQVTIDSSKELNIEAPFEYVRKMRASVQVMGPLLARNGRARIALPGGCAIGSRPIDQHLKGFEAMGAKVQVGNGFVEAYVEGELKGAKIYLDFPSVGATENIMSAATLAKGTTILENAAKEPEIVDLANFLNAMGAKVRGAGTGTIRIEGVDKLYGANHSIIPDRIEAGTFMVAAAITGGDILIENAVPEHLRSITAKMEEMGVKIIEENEGVRVIGPDKLKAVDIKTMPHPGFPTDMQSQMMALLLQADGTSMITETVFENRFMHVEEFRRMNADIKIEGRSVIMNGPNSLQGAEVGATDLRAAAALILAGLVSEGYTRVTELKHLDRGYVDFHKKLAALGATIERVNEKVEEVKEQEVSDLHA
>NC_022873.1|WP_003272396.1|5788332_5789043_-|YwmB-family-TATA-box-binding-protein
MKLKLKAILIVALSVVLFLVGYREMKPISDEQKMESMIKALEKNDAKVEKWSWLARETKTISNIHTFQKLLNDVKDKANIQKWEVEQSPDGYKATSYKKFASHEERVVVTWSKENTKENTFIIFEVSGAKWDPKYVQKVNKIFSEKPIIYTCVQGVLNDKIEGVLQNKTNQVLKDLSARAIEQVEERAFVSVSAYNKKWDDALSTNREKINVQIAIRSTDNKDTIVVGTPIITSEY
>NC_022873.1|WP_000057889.1|5789088_5789325_-|DUF1146-domain-containing-protein
MAQLLGQQALIAIVSHLLFITITWWALQGIHIERLMKSGKVLQTRVLLILITIAIGTSVSNFFLDYLGYSKSLTYLVK
>NC_022873.1|WP_023523552.1|5789527_5791048_-|NADH-quinone-oxidoreductase-subunit-NuoN
MDMNTLLSLSWHLMVPEFIILGAAILLSICDLFFKLNHRYVALGAIAAIVLALVSLITLYSEPAGDILNGSFVLDGFSKGFKTMLLGASALILCIAMSNDKKNPIEDKGEYYYLFLMALLGAMFMASSVDFITLFVGLELLSLSSYILVGIRKKNRASNEAAMKYVISGGIGTAITLFGMSYLYGITGSTNIVDMQKVLTGELASGIQLLLALAFLLLLVGLSFKIATVPFHMWAPDVYEGATTPVTAFLGTISKIAGFLLIIRLFLMVFASVLIQGDMQSLYGHMSIYIAVLASITMIVGNVVALKQYNIKRLFAYSGIAHAGYLLVPLVALSPFTLDSMWFYMLAYMLMNIGAFAIIHGLILQNDKENITIFTGLYKKSPFAAIMMTIFILSLAGIPGTAGFIGKINIFLGALHVEPAHYVLASIMMGTTVVSFVYYFRILQQMFFRTGETEERIRLPLNIKVVMSLCAISIVILGIMPMIGYNFFYEYFPLMKDFFFLGNVVQ
>NC_022873.1|WP_023523553.1|5791049_5792552_-|NADH-quinone-oxidoreductase-subunit-M
MNDLLLTFFIFSPLLGILLLVLTPKKELRTVRALGLFGTALPFGIAIVLACTYASGKSLSLFDEKVKWIKFGDFTAVDKRWFAIYYELGIDGLSLVMMVLTALLAMLAAIAAFSIKGNLKAFYMLLLMLEIGMLGVFAAQNLMLFFIFFEITLPPMFLLIGKWGKLSSEKAAYSYLIYNGIGSAILLIVFSILFAKTGTTNIVELKEILRSVSAEGELIIPSSLQLGVFISIMIAFAIKLPVFPLHRWMVNVHIEAHPAVVMLHAGVLLKIGAYGIIRFGKGLFPEYFHDVATLIAILGVINLLYGAFLALIQTDFRKVLAYSSISHMGIVLMGLASLNAPGTQGALFQVVSHGLIAALLFFLLGVIEQRFGTSDITALGGLAKSVPVLSGFFLAGGMASLGLPGMSGFVSEFLAFLGLFQGEPVIAAVGVIGIILTAVYVLRATLQVTFGKKEWEAKSDIHGWEFVPVLLLIFCIIAIGVMPEILGDPLQNTLKTLGVK
>NC_022873.1|WP_000568236.1|5792548_5794411_-|NADH-quinone-oxidoreductase-subunit-L
MIDYAWLIPLFPLVSFLLLIIFGKKIREGSSVLSIFFVFLSFILAVLVLIERFSEASVKHKWVWLRAGDVDISFGFEVTALGALMLFIVTLVSLLVHVYSKGYMKGDERLPTFYAYLGLFTFAMLGLVISTNLLQLYIFWELVGLGSFLLIGFYFFKEEAKAAAKKAFIMTRIGDVGLFIGMILIFWYAGSFEYDAIFRAIYTGDLPPYMITITAILIFIGAMGKSGQFPLHTWLPDAMEGPTPVSALIHAATMVAAGVYLVATMFPLFSASTVAMQTVAIVGAFTAIFAASIGLVQTDIKRVLAYSTVSQLGYMMLALGSAGYVAGVFHLTTHAFFKALLFLAAGSVIHAVHTQNINKMGGLQKKMKVTGTLFLIGTLAISGVPLLSGFFSKDEILAATWMNGNYVLFTLAVIAAFLTAFYMFRLYFLVFTGETKTKEDVHESPRVMTYPMIVLGVLAVVAGYINTPWFGTFLGDWLTKDVGFKVEEAHGPVWIMIVATLVSFAGIALAYFIYGKKSISRDWAGGTETSLYNLLKEKYYVDELYNMTVIPITKGIAHVLRLFEVYVVEGIAVLIGSVVKGTSNLGSKLQNGNVQVYGTVTAVSLAVLVIILLYTGGDLR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_022873_10

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_022873_10

5798440-5798548

Orphan

Consensus_repeat	Method
TTTCTGCTTCGCTAATGCTGCCGCT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_022873_10

>merge|NC_022873|10|5798440-5798548|CRISPRCasFinder
TTTCTGCTTCGCTAATGCTGCCGCTGCTGCCTTCGCCTTGGCTTTCGCTTTTTCTTCTTCCGTTACTTCTTCTGTTCCTTCTCTTTTCTGCTTCGCTAACGCTGCCGCT

>NC_022873|10|8|5798440-5798548|CRISPRCasFinder
TTTCTGCTTCGCTAATGCTGCCGCT	GCTGCCTTCGCCTTGGCTTTCGCTTTTTCTTCTTCCGTTACTTCTTCTGTTCCTTCTCT
TTTCTGCTTCGCTAACGCTGCCGCT

Protein	Signature genes	Signature genes Name	Protein_function
NC_022873.1\|WP_023523552.1\|5789527_5791048_-\|NADH-quinone-oxidoreductase-subunit-NuoN	unknown	unknown	gnl\|CDD\|235603
NC_022873.1\|WP_023523558.1\|5802749_5803394_-\|DUF975-family-protein	unknown	unknown	gnl\|CDD\|283754
NC_022873.1\|WP_023523556.1\|5798864_5799383_-\|NADH-quinone-oxidoreductase-subunit-NuoB	unknown	unknown	gnl\|CDD\|235797
NC_022873.1\|WP_000179273.1\|5799373_5799742_-\|NADH-quinone-oxidoreductase-subunit-NuoA	unknown	unknown	gnl\|CDD\|169084
NC_022873.1\|WP_023523560.1\|5806435_5807296_-\|F0F1-ATP-synthase-subunit-gamma	unknown	unknown	gnl\|CDD\|235535
NC_022873.1\|WP_023523557.1\|5799996_5802726_+\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|236645
NC_022873.1\|WP_023523554.1\|5795269_5795689_-\|NADH-quinone-oxidoreductase-subunit-NuoI	unknown	unknown	gnl\|CDD\|235637
NC_022873.1\|WP_000847215.1\|5804367_5804769_-\|F0F1-ATP-synthase-subunit-epsilon	unknown	unknown	gnl\|CDD\|234796
NC_022873.1\|WP_023523559.1\|5803443_5804229_-\|DUF975-family-protein	unknown	unknown	gnl\|CDD\|283754
NC_022873.1\|WP_001032596.1\|5804789_5806196_-\|F0F1-ATP-synthase-subunit-beta	unknown	unknown	gnl\|CDD\|236447
NC_022873.1\|WP_023523553.1\|5791049_5792552_-\|NADH-quinone-oxidoreductase-subunit-M	unknown	unknown	gnl\|CDD\|235622
NC_022873.1\|WP_001012812.1\|5794748_5795273_-\|NADH-quinone-oxidoreductase-subunit-J	unknown	unknown	gnl\|CDD\|235844
NC_022873.1\|WP_000100079.1\|5794441_5794756_-\|NADH-quinone-oxidoreductase-subunit-NuoK	unknown	unknown	gnl\|CDD\|180218
NC_022873.1\|WP_003272396.1\|5788332_5789043_-\|YwmB-family-TATA-box-binding-protein	unknown	unknown	gnl\|CDD\|370056
NC_022873.1\|WP_000027521.1\|5807562_5809071_-\|F0F1-ATP-synthase-subunit-alpha	unknown	unknown	gnl\|CDD\|236448
NC_022873.1\|WP_000568236.1\|5792548_5794411_-\|NADH-quinone-oxidoreductase-subunit-L	unknown	unknown	gnl\|CDD\|235836
NC_022873.1\|WP_000057889.1\|5789088_5789325_-\|DUF1146-domain-containing-protein	unknown	unknown	gnl\|CDD\|227173
NC_022873.1\|WP_000621434.1\|5796715_5797816_-\|NADH-quinone-oxidoreductase-subunit-NuoD	unknown	unknown	gnl\|CDD\|183437
NC_022873.1\|WP_000064682.1\|5809082_5809625_-\|F0F1-ATP-synthase-subunit-delta	unknown	unknown	gnl\|CDD\|235593
NC_022873.1\|WP_000573426.1\|5795714_5796716_-\|NADH-quinone-oxidoreductase-subunit-NuoH	unknown	unknown	gnl\|CDD\|235692

Protein	Function_ID	Function_description	E-value
NC_022873.1\|WP_023523552.1\|5789527_5791048_-\|NADH-quinone-oxidoreductase-subunit-NuoN	gnl\|CDD\|235603	PRK05777, PRK05777, NADH-quinone oxidoreductase subunit NuoN.	9.27601e-150
NC_022873.1\|WP_023523558.1\|5802749_5803394_-\|DUF975-family-protein	gnl\|CDD\|283754	pfam06161, DUF975, Protein of unknown function (DUF975). Family of uncharacterized bacterial proteins.	1.93711e-26
NC_022873.1\|WP_023523556.1\|5798864_5799383_-\|NADH-quinone-oxidoreductase-subunit-NuoB	gnl\|CDD\|235797	PRK06411, PRK06411, NADH-quinone oxidoreductase subunit NuoB.	5.04828e-108
NC_022873.1\|WP_000179273.1\|5799373_5799742_-\|NADH-quinone-oxidoreductase-subunit-NuoA	gnl\|CDD\|169084	PRK07756, PRK07756, NADH-quinone oxidoreductase subunit A.	1.38962e-71
NC_022873.1\|WP_023523560.1\|5806435_5807296_-\|F0F1-ATP-synthase-subunit-gamma	gnl\|CDD\|235535	PRK05621, PRK05621, F0F1 ATP synthase subunit gamma; Validated.	5.66753e-154
NC_022873.1\|WP_023523557.1\|5799996_5802726_+\|EAL-domain-containing-protein	gnl\|CDD\|236645	PRK10060, PRK10060, cyclic di-GMP phosphodiesterase.	1.74372e-105
NC_022873.1\|WP_023523554.1\|5795269_5795689_-\|NADH-quinone-oxidoreductase-subunit-NuoI	gnl\|CDD\|235637	PRK05888, PRK05888, NADH-quinone oxidoreductase subunit NuoI.	2.05772e-55
NC_022873.1\|WP_000847215.1\|5804367_5804769_-\|F0F1-ATP-synthase-subunit-epsilon	gnl\|CDD\|234796	PRK00571, atpC, F0F1 ATP synthase subunit epsilon; Validated.	2.97511e-56
NC_022873.1\|WP_023523559.1\|5803443_5804229_-\|DUF975-family-protein	gnl\|CDD\|283754	pfam06161, DUF975, Protein of unknown function (DUF975). Family of uncharacterized bacterial proteins.	3.64685e-21
NC_022873.1\|WP_001032596.1\|5804789_5806196_-\|F0F1-ATP-synthase-subunit-beta	gnl\|CDD\|236447	PRK09280, PRK09280, F0F1 ATP synthase subunit beta; Validated.	0
NC_022873.1\|WP_023523553.1\|5791049_5792552_-\|NADH-quinone-oxidoreductase-subunit-M	gnl\|CDD\|235622	PRK05846, PRK05846, NADH:ubiquinone oxidoreductase subunit M; Reviewed.	4.3382e-177
NC_022873.1\|WP_001012812.1\|5794748_5795273_-\|NADH-quinone-oxidoreductase-subunit-J	gnl\|CDD\|235844	PRK06638, PRK06638, NADH-quinone oxidoreductase subunit J.	3.84326e-52
NC_022873.1\|WP_000100079.1\|5794441_5794756_-\|NADH-quinone-oxidoreductase-subunit-NuoK	gnl\|CDD\|180218	PRK05715, PRK05715, NADH-quinone oxidoreductase subunit NuoK.	5.00316e-40
NC_022873.1\|WP_003272396.1\|5788332_5789043_-\|YwmB-family-TATA-box-binding-protein	gnl\|CDD\|370056	pfam08680, DUF1779, TATA-box binding. TATA-box_bdg is a family of bacterial proteins. YwmB from Bacillus subtilis contains a circularly permuted TATA-box binding protein-like fold. Jian-Xiang Liu, Qi Xie, Jun Lin. Protein Structural Data Mining and Evolutionary Bioinformatic Analysis on Domains of TATA-box Binding Protein-like Fold. Life Science Journal 2014; 11(2): 298-302 (not yet in PubMed 27-02-2014).	1.11897e-33
NC_022873.1\|WP_000027521.1\|5807562_5809071_-\|F0F1-ATP-synthase-subunit-alpha	gnl\|CDD\|236448	PRK09281, PRK09281, F0F1 ATP synthase subunit alpha; Validated.	0
NC_022873.1\|WP_000568236.1\|5792548_5794411_-\|NADH-quinone-oxidoreductase-subunit-L	gnl\|CDD\|235836	PRK06590, PRK06590, NADH:ubiquinone oxidoreductase subunit L; Reviewed.	0
NC_022873.1\|WP_000057889.1\|5789088_5789325_-\|DUF1146-domain-containing-protein	gnl\|CDD\|227173	COG4836, COG4836, Predicted membrane protein [Function unknown].	1.23409e-23
NC_022873.1\|WP_000621434.1\|5796715_5797816_-\|NADH-quinone-oxidoreductase-subunit-NuoD	gnl\|CDD\|183437	PRK12322, PRK12322, NADH-quinone oxidoreductase subunit D.	0
NC_022873.1\|WP_000064682.1\|5809082_5809625_-\|F0F1-ATP-synthase-subunit-delta	gnl\|CDD\|235593	PRK05758, PRK05758, F0F1 ATP synthase subunit delta; Validated.	5.20087e-62
NC_022873.1\|WP_000573426.1\|5795714_5796716_-\|NADH-quinone-oxidoreductase-subunit-NuoH	gnl\|CDD\|235692	PRK06076, PRK06076, NADH-quinone oxidoreductase subunit NuoH.	8.24893e-149

>NC_022873.1|WP_000621434.1|5796715_5797816_-|NADH-quinone-oxidoreductase-subunit-NuoD
MIRTEEMLLNVGPQHPSTHGVFRLVIKIDGEIIKEATPVIGYLHRGTEKIAESLQYTQIIPYTDRMDYLSAMTNNYVICHAVETMMGLEIPERAEYLRVLAMELGRIASHLVWWGTNLLDIGAVSPFLYAFREREMIINLLNELCGARLTFNYMRVGGVKWDAPDGWIEKVEEFVPYMREQLAGYHDLVSGNEIFLNRVKGVGIYSAEEAISYSLSGANLRCTGVNWDLRKDEPYSIYDRFDFDIPVGSVGDAWDRYVCRMQEIEESLKIVEQAVQQFPKDGAVLAKVPKIIKAPKGEAFVRIESPRGEIGCYIASDGKKEPYRLKFRRPSFYNLQILPKLLKGENIANLITILGGVDIVLGEVDG
>NC_022873.1|WP_000573426.1|5795714_5796716_-|NADH-quinone-oxidoreductase-subunit-NuoH
MIETLLQSPSSWTNFFIFFGLAVLLLFAVLGFVTYGILAERKVMGFMQGRIGPNQVGGRFGLLQTVADVLKLLLKEDSIPKAADKPLFILAPVIAFAPAFMVLAVIPFTDKFQFADIGVGLLYYIAVSGITTIGVVTGGWASNNKYSLLGGMRAAAQMISYEIPLVMSVIGIVLLAGSLNLNEIVAAQEKVWYIFVQPIGFVVFLIAAVAELNRTPFDLPEAESELVSGYHTEYSGFRWAFFMLSEYVYFFGMASLITVLFLGGWNPVMFLGFIPGAVWFALKFSSVVFLLIWFRVTFPRIRGDQLMEFGWKVLLPIALANIFLTALIKELFF
>NC_022873.1|WP_023523554.1|5795269_5795689_-|NADH-quinone-oxidoreductase-subunit-NuoI
MKGLFKGLTYTLSNLSKKKVTYDYPNQPLPLPDRFRGIQKFYPEKCIVCNQCSNICPTDCIQLTGKKHPDPTKKGKIIDTYDINFEICILCDLCTEVCPTEAIVMTNNFELAEYSRDDLFKNLQWLDENDENVRKENKA
>NC_022873.1|WP_001012812.1|5794748_5795273_-|NADH-quinone-oxidoreductase-subunit-J
MNGEFVAFFILSLSAIIGGVLMLNLTKVMHMMLALVLTFLSIAGLYFLLSAEFIGVAQILLYSGAITIIMIFGIMLTKHNAENESRLTLRKWIIFFAVVAFGAVMYFAVNNVDFANESTQGSLPLHENNTLQIGTLLYSKYIIPFELTSVILLVALVGAIILAKKDEKEEDSNE
>NC_022873.1|WP_000100079.1|5794441_5794756_-|NADH-quinone-oxidoreductase-subunit-NuoK
MSSVPASAYLTLAIILFCIGLFGALTKRNTVIVLVCIELMLNAANLNLVAFSKLGLFPNLTGQIFSLFTMAVAAAEAAVGLAILIALYRNRTTVQVDEMDTLKG
>NC_022873.1|WP_000568236.1|5792548_5794411_-|NADH-quinone-oxidoreductase-subunit-L
MIDYAWLIPLFPLVSFLLLIIFGKKIREGSSVLSIFFVFLSFILAVLVLIERFSEASVKHKWVWLRAGDVDISFGFEVTALGALMLFIVTLVSLLVHVYSKGYMKGDERLPTFYAYLGLFTFAMLGLVISTNLLQLYIFWELVGLGSFLLIGFYFFKEEAKAAAKKAFIMTRIGDVGLFIGMILIFWYAGSFEYDAIFRAIYTGDLPPYMITITAILIFIGAMGKSGQFPLHTWLPDAMEGPTPVSALIHAATMVAAGVYLVATMFPLFSASTVAMQTVAIVGAFTAIFAASIGLVQTDIKRVLAYSTVSQLGYMMLALGSAGYVAGVFHLTTHAFFKALLFLAAGSVIHAVHTQNINKMGGLQKKMKVTGTLFLIGTLAISGVPLLSGFFSKDEILAATWMNGNYVLFTLAVIAAFLTAFYMFRLYFLVFTGETKTKEDVHESPRVMTYPMIVLGVLAVVAGYINTPWFGTFLGDWLTKDVGFKVEEAHGPVWIMIVATLVSFAGIALAYFIYGKKSISRDWAGGTETSLYNLLKEKYYVDELYNMTVIPITKGIAHVLRLFEVYVVEGIAVLIGSVVKGTSNLGSKLQNGNVQVYGTVTAVSLAVLVIILLYTGGDLR
>NC_022873.1|WP_023523553.1|5791049_5792552_-|NADH-quinone-oxidoreductase-subunit-M
MNDLLLTFFIFSPLLGILLLVLTPKKELRTVRALGLFGTALPFGIAIVLACTYASGKSLSLFDEKVKWIKFGDFTAVDKRWFAIYYELGIDGLSLVMMVLTALLAMLAAIAAFSIKGNLKAFYMLLLMLEIGMLGVFAAQNLMLFFIFFEITLPPMFLLIGKWGKLSSEKAAYSYLIYNGIGSAILLIVFSILFAKTGTTNIVELKEILRSVSAEGELIIPSSLQLGVFISIMIAFAIKLPVFPLHRWMVNVHIEAHPAVVMLHAGVLLKIGAYGIIRFGKGLFPEYFHDVATLIAILGVINLLYGAFLALIQTDFRKVLAYSSISHMGIVLMGLASLNAPGTQGALFQVVSHGLIAALLFFLLGVIEQRFGTSDITALGGLAKSVPVLSGFFLAGGMASLGLPGMSGFVSEFLAFLGLFQGEPVIAAVGVIGIILTAVYVLRATLQVTFGKKEWEAKSDIHGWEFVPVLLLIFCIIAIGVMPEILGDPLQNTLKTLGVK
>NC_022873.1|WP_023523552.1|5789527_5791048_-|NADH-quinone-oxidoreductase-subunit-NuoN
MDMNTLLSLSWHLMVPEFIILGAAILLSICDLFFKLNHRYVALGAIAAIVLALVSLITLYSEPAGDILNGSFVLDGFSKGFKTMLLGASALILCIAMSNDKKNPIEDKGEYYYLFLMALLGAMFMASSVDFITLFVGLELLSLSSYILVGIRKKNRASNEAAMKYVISGGIGTAITLFGMSYLYGITGSTNIVDMQKVLTGELASGIQLLLALAFLLLLVGLSFKIATVPFHMWAPDVYEGATTPVTAFLGTISKIAGFLLIIRLFLMVFASVLIQGDMQSLYGHMSIYIAVLASITMIVGNVVALKQYNIKRLFAYSGIAHAGYLLVPLVALSPFTLDSMWFYMLAYMLMNIGAFAIIHGLILQNDKENITIFTGLYKKSPFAAIMMTIFILSLAGIPGTAGFIGKINIFLGALHVEPAHYVLASIMMGTTVVSFVYYFRILQQMFFRTGETEERIRLPLNIKVVMSLCAISIVILGIMPMIGYNFFYEYFPLMKDFFFLGNVVQ
>NC_022873.1|WP_000057889.1|5789088_5789325_-|DUF1146-domain-containing-protein
MAQLLGQQALIAIVSHLLFITITWWALQGIHIERLMKSGKVLQTRVLLILITIAIGTSVSNFFLDYLGYSKSLTYLVK
>NC_022873.1|WP_003272396.1|5788332_5789043_-|YwmB-family-TATA-box-binding-protein
MKLKLKAILIVALSVVLFLVGYREMKPISDEQKMESMIKALEKNDAKVEKWSWLARETKTISNIHTFQKLLNDVKDKANIQKWEVEQSPDGYKATSYKKFASHEERVVVTWSKENTKENTFIIFEVSGAKWDPKYVQKVNKIFSEKPIIYTCVQGVLNDKIEGVLQNKTNQVLKDLSARAIEQVEERAFVSVSAYNKKWDDALSTNREKINVQIAIRSTDNKDTIVVGTPIITSEY
>NC_022873.1|WP_023523556.1|5798864_5799383_-|NADH-quinone-oxidoreductase-subunit-NuoB
MVINFEELHPNERAELERNIFFSTLEQLKGWARSNSLWPMTFGLACCAIEMMGVGSSHYDLDRFGSFFRTSPRQSDVMIVSGTVTKKMAPIVRRLYDQMPEPKWVIAMGSCATAGGPYVNSYAVVKGVDQIVPVDVYIPGCPPNPAALIYGINKLKEKIRYEAMTGKQVTNK
>NC_022873.1|WP_000179273.1|5799373_5799742_-|NADH-quinone-oxidoreductase-subunit-NuoA
MASVYENSYMIVLIFLLLGILLPVVALTLGRMLRPNKPSAAKATTYESGIEPFHDANIRFHARYYIFALLFVIFDVETLFLYPWAVAYDKLGLFALIEMLIFVVMLLVGLAYAWKKKVLQWL
>NC_022873.1|WP_023523557.1|5799996_5802726_+|EAL-domain-containing-protein
MKKQTHVSILISIVLLSITIHYVAMPFLYEYSFPFQLLIGTSTLLIDIIACSYILYFSNMKEGLSRLFWIILSVGALSYFIGDIVVAYQRLIVKDFYTFVDPSDFFYLLFLVSFSFAFLYEIIYNRDLLEKLFMLCDICIIVTAQFTLSYYLLIERTIHIFTTSYIDIFVQLTYPMADLLFLLIGINLLFKPLSLLPKKVGALLGSALILYATTDAIYAYIKYFIPEYSMFTVTPFYQVTLVLVAISCILHTKEPEKQEQVLLTLKIGEAIRLSLPYISVVMLIVFILVEYVFAPIIVIGLIITFSFVLIRHSLVRKQNKILLLAQMQFNSELEKQIELRTEDLVEQKNELYHNQQMFKSLYEHHPDPIFTLDLYGNFLKVNNAGTTLLGYQTNELLNQPYYSLIYEEDLEEMINAFHRVKKGYSISLEIRAYHKNRDIYYLHVTAVPIFLKEKISGVYLMIKDITESKQQQEQINFLAYHDTLTELANRRAFHKHLEQAIARAKVSKKSFAVMFLDLDRFKVINDTLGHRVGDLLLIAVAKRLERISTSNMKLARLAGDEFTILIENYKKKPDVQKIADMIVAAMNEPFEIENQHLQISPSIGIAIYPEAGEDPLSILQHADMAMYEAKNKGKNGSSLYTKELYKKMERKARIEKDLPIALVNKEFYLVYQPQIDTTTNKIIGAEALIRWKHPLLGDISPCEFIPIVEETPQVVPLGHWVLQEACLQLKIWHTFGYQNLKISVNLSAKEFRQDQLIENISQILNDVQVDPKYVTLELTERIAMIDEKETLLRLKQLKEYGIQTSIDDFGTGYSSLAYLSIFPIDTLKVPREFTQLADHRPEERAIVSTILSLANTLNLSVVAEGIETEKQLKFLQKHKCKYMQGYYFSKPLTSNQFIKFLQKTPSMNK
>NC_022873.1|WP_023523558.1|5802749_5803394_-|DUF975-family-protein
MISDLKGEALDSLEGKWGLAVGATLLISILITAFSFSVDWGFSLIFGWQKTNGSLSTNILTFFVTGPLTLGGYYLGLNILRENQASIGNVFIWFSEGKRFLKSFLLYLLVNLYLFLWTLLFIIPGIIKSFSYAMTYFIINDHPEYSLNQAITESRRMMDGHKMEYFILCLSFIGWFILSCITLGIGFLWLIPYFYTTSAAFYEEIAEEYYEKNI
>NC_022873.1|WP_023523559.1|5803443_5804229_-|DUF975-family-protein
MIGEMKREALYSLKGKWGLGVGSTILYFILSYVVSMAAMFILLIPGIIIFFLVVSLAGSVEAETMSIGAAITFGIFYCIMIILSNASYGITSYGYTNVFLQISKREDAKVDYLFEGFRGFKRMMKTMWAMLAILLYTGTWIPMLLTGLFIFLGEEGNLSFTIAFFVLLAISIVGMIVMYFSYALTYYVMIENPEYSVSQAMKESKNLMKGHKLDLFLLWLSFIGWVVLALLTFGIGFLWLSPYMSTTTAHFYRYILKGEFQ
>NC_022873.1|WP_000847215.1|5804367_5804769_-|F0F1-ATP-synthase-subunit-epsilon
MKTFPVSIVTPDGPVYEKEVEMVSVKAESGEMGILPGHIPTVAPLKISAVRLKNGGHTDYVAVSGGFIEVRPDKVTVLSSSAEEANHIDIHRANEAKRRAEQRMQDKQAHVDFRRAEMALQRAVNRLNVSDMK
>NC_022873.1|WP_001032596.1|5804789_5806196_-|F0F1-ATP-synthase-subunit-beta
MNKGRVTQIMGPVVDVKFDGGKLPEIYNALTVKQSNENGSMNLTFEVALHLGDDTVRTVAMSSTDGLVRGTEVEDTGKAISVPVGDATLGRVFNVLGDAIDLDGELPADVHRDPIHRQAPAFEELSTKVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYHEMSDSGVIKKTAMVFGQMNEPPGARQRVALTGLTMAEHFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNKGSITSIQAVYVPADDYTDPAPATTFAHLDATTNLERRLTQMGIYPAVDPLASTSRALSPEIVGEEHYEVARQVQQTLQRYKELQDIIAILGMDELSEEDKLVVHRARRIQFFLSQNFHVAEQFTGQKGSYVPVKNTVSGFKEILEGKYDDLPEDAFRLVGSIEEVIENAKKMMA
>NC_022873.1|WP_023523560.1|5806435_5807296_-|F0F1-ATP-synthase-subunit-gamma
MASLRDIKAKITSTKKTSQITKAMEMVSASKLNRAEQNAKSFVPYMEKIQEVVASIAQGSKGINHPMLNARPVKRTGYIVITSDRGLAGGYNSNVLRTVSNVIRERHNMDSNQYSIIVLGRLGRDYLKLRGFNIIDEVVGLSDHPSFTDIKDLASRAIAMFADGAYDELYIYYNHYVSKISQEVTENKILPLTDVASDKPTTAYEFEPSEEEILKVLLPQYAESLVYGALLDGKASEHAARMTAMKSATDNAMEVIDSLTLSFNRARQAAITQEITEIVGGAAALE
>NC_022873.1|WP_000027521.1|5807562_5809071_-|F0F1-ATP-synthase-subunit-alpha
MSIRAEEISALIKQQIENYQSEIEVSDVGTVIQVGDGIARAHGLDNVMAGELVEFSNGVMGLAQNLEENNVGIIILGPYTEIREGDEVRRTGRIMQVPVGKELIGRVVNPLGQPVDGLGPINTTNTRPIESPAPGVMDRKSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTAVALDTIINQKDEDMICIYVAIGQKESTVRNVVETLRKHGALEYTIVVTASASQPAPLLYLAPYAGVTMGEEFMYNGKHVLVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDARGGGSLTALPFIETQAGDVSAYIPTNVISITDGQIFLQSDLFFSGVRPAIDAGTSVSRVGGSAQIKAMSKVSGTLRLDLASYRELEAFAQFGSDLDKATQAKLNRGARTVEVLKQGLHKPLRVEKQVIILYALTRGFLDDIPVVDITRFEEEFHAWLDSNATDLLEEIRTTKKLADDDKFAAAINGFKKVFVASE
>NC_022873.1|WP_000064682.1|5809082_5809625_-|F0F1-ATP-synthase-subunit-delta
MSNGIVAKRYAVALFKIAKEKHVLEMFEEELRLVQNVYVKNGELHSFLTQPNISKEQKKTFLANVFGSVSESILNTLYILIDNKRIDILPEIADEYVVLANEERNVADATVYSIRLLSEEEKLNIAEAFAKRTGKDAIRVKNVVDEDLLGGIKVRIGNRIYDGSLQGKLARIQRELMKNR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_022873_3	3.1\|3583825\|19\|NC_022873\|CRISPRCasFinder	3583825-3583843	19	NC_022873.1	2894094-2894112	1	0.947
NC_022873_4	4.1\|3584095\|19\|NC_022873\|CRISPRCasFinder	3584095-3584113	19	NC_022873.1	5108636-5108654	2	0.895
NC_022873_7	7.17\|4027558\|18\|NC_022873\|CRT	4027558-4027575	18	NC_022873.1	2893730-2893747	1	0.944
NC_022873_8	8.14\|5519206\|18\|NC_022873\|CRT	5519206-5519223	18	NC_022873.1	3581138-3581155	0	1.0
NC_022873_8	8.14\|5519206\|18\|NC_022873\|CRT	5519206-5519223	18	NC_022873.1	4623682-4623699	0	1.0
NC_022873_8	8.14\|5519206\|18\|NC_022873\|CRT	5519206-5519223	18	NC_022873.1	4623772-4623789	0	1.0
NC_022873_8	8.14\|5519206\|18\|NC_022873\|CRT	5519206-5519223	18	NC_022873.1	4623862-4623879	0	1.0
NC_022873_8	8.14\|5519206\|18\|NC_022873\|CRT	5519206-5519223	18	NC_022873.1	4623997-4624014	0	1.0
NC_022873_8	8.14\|5519206\|18\|NC_022873\|CRT	5519206-5519223	18	NC_022873.1	4624087-4624104	0	1.0
NC_022873_8	8.14\|5519206\|18\|NC_022873\|CRT	5519206-5519223	18	NC_022873.1	4900016-4900033	0	1.0
NC_022873_8	8.14\|5519206\|18\|NC_022873\|CRT	5519206-5519223	18	NC_022873.1	5316743-5316760	0	1.0
NC_022873_8	8.14\|5519206\|18\|NC_022873\|CRT	5519206-5519223	18	NC_022873.1	5518585-5518602	0	1.0
NC_022873_8	8.14\|5519206\|18\|NC_022873\|CRT	5519206-5519223	18	NC_022873.1	3581876-3581893	1	0.944
NC_022873_8	8.14\|5519206\|18\|NC_022873\|CRT	5519206-5519223	18	NC_022873.1	4623592-4623609	1	0.944
NC_022873_8	8.14\|5519206\|18\|NC_022873\|CRT	5519206-5519223	18	NC_022873.1	4623637-4623654	1	0.944
NC_022873_8	8.14\|5519206\|18\|NC_022873\|CRT	5519206-5519223	18	NC_022873.1	4623952-4623969	1	0.944
NC_022873_8	8.14\|5519206\|18\|NC_022873\|CRT	5519206-5519223	18	NC_022873.1	5316878-5316895	1	0.944
NC_022873_8	8.14\|5519206\|18\|NC_022873\|CRT	5519206-5519223	18	NC_022873.1	5519296-5519313	1	0.944
NC_022873_10	10.1\|5798465\|59\|NC_022873\|CRISPRCasFinder	5798465-5798523	59	NC_022873.1	5798567-5798625	1	0.983

1. spacer 3.1|3583825|19|NC_022873|CRISPRCasFinder matches to position: 2894094-2894112, mismatch: 1, identity: 0.947

ttccttgcactccttgaga	CRISPR spacer
ttccttgcacaccttgaga	Protospacer
********** ********

2. spacer 4.1|3584095|19|NC_022873|CRISPRCasFinder matches to position: 5108636-5108654, mismatch: 2, identity: 0.895

caccttgaataccttgaat	CRISPR spacer
caccttgaattccctgaat	Protospacer
********** **.*****

3. spacer 7.17|4027558|18|NC_022873|CRT matches to position: 2893730-2893747, mismatch: 1, identity: 0.944

tggacctcaaggcgttca	CRISPR spacer
tggacctcaaggagttca	Protospacer
************ *****

4. spacer 8.14|5519206|18|NC_022873|CRT matches to position: 3581138-3581155, mismatch: 0, identity: 1.0

gttgctcccgttggaccc	CRISPR spacer
gttgctcccgttggaccc	Protospacer
******************

5. spacer 8.14|5519206|18|NC_022873|CRT matches to position: 4623682-4623699, mismatch: 0, identity: 1.0

gttgctcccgttggaccc	CRISPR spacer
gttgctcccgttggaccc	Protospacer
******************

6. spacer 8.14|5519206|18|NC_022873|CRT matches to position: 4623772-4623789, mismatch: 0, identity: 1.0

gttgctcccgttggaccc	CRISPR spacer
gttgctcccgttggaccc	Protospacer
******************

7. spacer 8.14|5519206|18|NC_022873|CRT matches to position: 4623862-4623879, mismatch: 0, identity: 1.0

gttgctcccgttggaccc	CRISPR spacer
gttgctcccgttggaccc	Protospacer
******************

8. spacer 8.14|5519206|18|NC_022873|CRT matches to position: 4623997-4624014, mismatch: 0, identity: 1.0

gttgctcccgttggaccc	CRISPR spacer
gttgctcccgttggaccc	Protospacer
******************

9. spacer 8.14|5519206|18|NC_022873|CRT matches to position: 4624087-4624104, mismatch: 0, identity: 1.0

gttgctcccgttggaccc	CRISPR spacer
gttgctcccgttggaccc	Protospacer
******************

10. spacer 8.14|5519206|18|NC_022873|CRT matches to position: 4900016-4900033, mismatch: 0, identity: 1.0

gttgctcccgttggaccc	CRISPR spacer
gttgctcccgttggaccc	Protospacer
******************

11. spacer 8.14|5519206|18|NC_022873|CRT matches to position: 5316743-5316760, mismatch: 0, identity: 1.0

gttgctcccgttggaccc	CRISPR spacer
gttgctcccgttggaccc	Protospacer
******************

12. spacer 8.14|5519206|18|NC_022873|CRT matches to position: 5518585-5518602, mismatch: 0, identity: 1.0

gttgctcccgttggaccc	CRISPR spacer
gttgctcccgttggaccc	Protospacer
******************

13. spacer 8.14|5519206|18|NC_022873|CRT matches to position: 3581876-3581893, mismatch: 1, identity: 0.944

gttgctcccgttggaccc	CRISPR spacer
gttgctcctgttggaccc	Protospacer
********.*********

14. spacer 8.14|5519206|18|NC_022873|CRT matches to position: 4623592-4623609, mismatch: 1, identity: 0.944

gttgctcccgttggaccc	CRISPR spacer
gttgcccccgttggaccc	Protospacer
*****.************

15. spacer 8.14|5519206|18|NC_022873|CRT matches to position: 4623637-4623654, mismatch: 1, identity: 0.944

gttgctcccgttggaccc	CRISPR spacer
gttgctcctgttggaccc	Protospacer
********.*********

16. spacer 8.14|5519206|18|NC_022873|CRT matches to position: 4623952-4623969, mismatch: 1, identity: 0.944

gttgctcccgttggaccc	CRISPR spacer
gttgctcctgttggaccc	Protospacer
********.*********

17. spacer 8.14|5519206|18|NC_022873|CRT matches to position: 5316878-5316895, mismatch: 1, identity: 0.944

gttgctcccgttggaccc	CRISPR spacer
gttgctcctgttggaccc	Protospacer
********.*********

18. spacer 8.14|5519206|18|NC_022873|CRT matches to position: 5519296-5519313, mismatch: 1, identity: 0.944

gttgctcccgttggaccc	CRISPR spacer
gttgctcctgttggaccc	Protospacer
********.*********

19. spacer 10.1|5798465|59|NC_022873|CRISPRCasFinder matches to position: 5798567-5798625, mismatch: 1, identity: 0.983

gctgccttcgccttggctttcgctttttcttcttccgttacttcttctgttccttctct	CRISPR spacer
gccgccttcgccttggctttcgctttttcttcttccgttacttcttctgttccttctct	Protospacer
**.********************************************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_022873_4	4.1\|3584095\|19\|NC_022873\|CRISPRCasFinder	3584095-3584113	19	MN689516	Lactococcus phage CHPC148, complete genome	18112-18130	0	1.0
NC_022873_4	4.1\|3584095\|19\|NC_022873\|CRISPRCasFinder	3584095-3584113	19	NC_004746	Lactococcus phage 4268, complete genome	31982-32000	0	1.0
NC_022873_4	4.1\|3584095\|19\|NC_022873\|CRISPRCasFinder	3584095-3584113	19	MN689530	Lactococcus phage CHPC974, partial genome	16223-16241	0	1.0
NC_022873_4	4.1\|3584095\|19\|NC_022873\|CRISPRCasFinder	3584095-3584113	19	AJ245616	Lactococcus lactis phage BK5-T complete genome	11689-11707	0	1.0
NC_022873_4	4.1\|3584095\|19\|NC_022873\|CRISPRCasFinder	3584095-3584113	19	AF176025	Lactococcus phage BK5-T, complete genome	11689-11707	0	1.0
NC_022873_4	4.1\|3584095\|19\|NC_022873\|CRISPRCasFinder	3584095-3584113	19	GU075905	Prochlorococcus phage P-HM2, complete genome	71396-71414	0	1.0
NC_022873_4	4.1\|3584095\|19\|NC_022873\|CRISPRCasFinder	3584095-3584113	19	AF489521	Lactococcus bacteriophage 4268, complete genome	31982-32000	0	1.0
NC_022873_5	5.2\|3584374\|22\|NC_022873\|CRISPRCasFinder	3584374-3584395	22	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125328-125349	0	1.0
NC_022873_5	5.2\|3584374\|22\|NC_022873\|CRISPRCasFinder	3584374-3584395	22	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125385-125406	0	1.0
NC_022873_5	5.2\|3584374\|22\|NC_022873\|CRISPRCasFinder	3584374-3584395	22	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125460-125481	0	1.0
NC_022873_5	5.2\|3584374\|22\|NC_022873\|CRISPRCasFinder	3584374-3584395	22	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125517-125538	0	1.0
NC_022873_5	5.2\|3584374\|22\|NC_022873\|CRISPRCasFinder	3584374-3584395	22	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125574-125595	0	1.0
NC_022873_5	5.2\|3584374\|22\|NC_022873\|CRISPRCasFinder	3584374-3584395	22	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125631-125652	0	1.0
NC_022873_5	5.2\|3584374\|22\|NC_022873\|CRISPRCasFinder	3584374-3584395	22	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125688-125709	0	1.0
NC_022873_5	5.2\|3584374\|22\|NC_022873\|CRISPRCasFinder	3584374-3584395	22	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125745-125766	0	1.0
NC_022873_7	7.5\|4027054\|27\|NC_022873\|CRT	4027054-4027080	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1998-2024	3	0.889
NC_022873_7	7.18\|4027594\|27\|NC_022873\|CRT	4027594-4027620	27	MN693092	Marine virus AFVG_25M37, complete genome	19117-19143	3	0.889
NC_022873_7	7.1\|4026892\|27\|NC_022873\|CRT	4026892-4026918	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1998-2024	4	0.852
NC_022873_7	7.1\|4026892\|27\|NC_022873\|CRT	4026892-4026918	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	83709-83735	4	0.852
NC_022873_7	7.1\|4026892\|27\|NC_022873\|CRT	4026892-4026918	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	88214-88240	4	0.852
NC_022873_7	7.3\|4026973\|27\|NC_022873\|CRT	4026973-4026999	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1998-2024	4	0.852
NC_022873_7	7.3\|4026973\|27\|NC_022873\|CRT	4026973-4026999	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	83709-83735	4	0.852
NC_022873_7	7.3\|4026973\|27\|NC_022873\|CRT	4026973-4026999	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	88214-88240	4	0.852
NC_022873_7	7.5\|4027054\|27\|NC_022873\|CRT	4027054-4027080	27	MN204498	Streptomyces phage Saftant, complete genome	18450-18476	4	0.852
NC_022873_7	7.7\|4027135\|27\|NC_022873\|CRT	4027135-4027161	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1998-2024	4	0.852
NC_022873_7	7.7\|4027135\|27\|NC_022873\|CRT	4027135-4027161	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	83709-83735	4	0.852
NC_022873_7	7.7\|4027135\|27\|NC_022873\|CRT	4027135-4027161	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	88214-88240	4	0.852
NC_022873_7	7.9\|4027216\|27\|NC_022873\|CRT	4027216-4027242	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1998-2024	4	0.852
NC_022873_7	7.9\|4027216\|27\|NC_022873\|CRT	4027216-4027242	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	83709-83735	4	0.852
NC_022873_7	7.9\|4027216\|27\|NC_022873\|CRT	4027216-4027242	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	88214-88240	4	0.852
NC_022873_7	7.12\|4027333\|27\|NC_022873\|CRT	4027333-4027359	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1998-2024	4	0.852
NC_022873_7	7.12\|4027333\|27\|NC_022873\|CRT	4027333-4027359	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	83709-83735	4	0.852
NC_022873_7	7.12\|4027333\|27\|NC_022873\|CRT	4027333-4027359	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	88214-88240	4	0.852
NC_022873_7	7.14\|4027414\|27\|NC_022873\|CRT	4027414-4027440	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1998-2024	4	0.852
NC_022873_7	7.14\|4027414\|27\|NC_022873\|CRT	4027414-4027440	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	83709-83735	4	0.852
NC_022873_7	7.14\|4027414\|27\|NC_022873\|CRT	4027414-4027440	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	88214-88240	4	0.852
NC_022873_2	2.1\|3528831\|27\|NC_022873\|CRISPRCasFinder	3528831-3528857	27	MN855978	Bacteriophage sp. isolate 105, complete genome	12320-12346	5	0.815
NC_022873_7	7.1\|4026892\|27\|NC_022873\|CRT	4026892-4026918	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2043-2069	5	0.815
NC_022873_7	7.1\|4026892\|27\|NC_022873\|CRT	4026892-4026918	27	MH825709	Mycobacterium phage NicoleTera, complete genome	5047-5073	5	0.815
NC_022873_7	7.1\|4026892\|27\|NC_022873\|CRT	4026892-4026918	27	MN204498	Streptomyces phage Saftant, complete genome	18450-18476	5	0.815
NC_022873_7	7.3\|4026973\|27\|NC_022873\|CRT	4026973-4026999	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2043-2069	5	0.815
NC_022873_7	7.3\|4026973\|27\|NC_022873\|CRT	4026973-4026999	27	MH825709	Mycobacterium phage NicoleTera, complete genome	5047-5073	5	0.815
NC_022873_7	7.3\|4026973\|27\|NC_022873\|CRT	4026973-4026999	27	MN204498	Streptomyces phage Saftant, complete genome	18450-18476	5	0.815
NC_022873_7	7.5\|4027054\|27\|NC_022873\|CRT	4027054-4027080	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2043-2069	5	0.815
NC_022873_7	7.5\|4027054\|27\|NC_022873\|CRT	4027054-4027080	27	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	2376902-2376928	5	0.815
NC_022873_7	7.5\|4027054\|27\|NC_022873\|CRT	4027054-4027080	27	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	1250407-1250433	5	0.815
NC_022873_7	7.5\|4027054\|27\|NC_022873\|CRT	4027054-4027080	27	MH825709	Mycobacterium phage NicoleTera, complete genome	5047-5073	5	0.815
NC_022873_7	7.5\|4027054\|27\|NC_022873\|CRT	4027054-4027080	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	83709-83735	5	0.815
NC_022873_7	7.5\|4027054\|27\|NC_022873\|CRT	4027054-4027080	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	88214-88240	5	0.815
NC_022873_7	7.7\|4027135\|27\|NC_022873\|CRT	4027135-4027161	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2043-2069	5	0.815
NC_022873_7	7.7\|4027135\|27\|NC_022873\|CRT	4027135-4027161	27	MH825709	Mycobacterium phage NicoleTera, complete genome	5047-5073	5	0.815
NC_022873_7	7.7\|4027135\|27\|NC_022873\|CRT	4027135-4027161	27	MN204498	Streptomyces phage Saftant, complete genome	18450-18476	5	0.815
NC_022873_7	7.9\|4027216\|27\|NC_022873\|CRT	4027216-4027242	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2043-2069	5	0.815
NC_022873_7	7.9\|4027216\|27\|NC_022873\|CRT	4027216-4027242	27	MH825709	Mycobacterium phage NicoleTera, complete genome	5047-5073	5	0.815
NC_022873_7	7.9\|4027216\|27\|NC_022873\|CRT	4027216-4027242	27	MN204498	Streptomyces phage Saftant, complete genome	18450-18476	5	0.815
NC_022873_7	7.12\|4027333\|27\|NC_022873\|CRT	4027333-4027359	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2043-2069	5	0.815
NC_022873_7	7.12\|4027333\|27\|NC_022873\|CRT	4027333-4027359	27	MH825709	Mycobacterium phage NicoleTera, complete genome	5047-5073	5	0.815
NC_022873_7	7.12\|4027333\|27\|NC_022873\|CRT	4027333-4027359	27	MN204498	Streptomyces phage Saftant, complete genome	18450-18476	5	0.815
NC_022873_7	7.14\|4027414\|27\|NC_022873\|CRT	4027414-4027440	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2043-2069	5	0.815
NC_022873_7	7.14\|4027414\|27\|NC_022873\|CRT	4027414-4027440	27	MH825709	Mycobacterium phage NicoleTera, complete genome	5047-5073	5	0.815
NC_022873_7	7.14\|4027414\|27\|NC_022873\|CRT	4027414-4027440	27	MN204498	Streptomyces phage Saftant, complete genome	18450-18476	5	0.815
NC_022873_7	7.15\|4027459\|27\|NC_022873\|CRT	4027459-4027485	27	MN693092	Marine virus AFVG_25M37, complete genome	19117-19143	5	0.815
NC_022873_7	7.18\|4027594\|27\|NC_022873\|CRT	4027594-4027620	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	181146-181172	5	0.815
NC_022873_7	7.18\|4027594\|27\|NC_022873\|CRT	4027594-4027620	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	179828-179854	5	0.815
NC_022873_7	7.18\|4027594\|27\|NC_022873\|CRT	4027594-4027620	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	182247-182273	5	0.815
NC_022873_7	7.18\|4027594\|27\|NC_022873\|CRT	4027594-4027620	27	MN693099	Marine virus AFVG_25M184, complete genome	13864-13890	5	0.815
NC_022873_8	8.1\|5518621\|27\|NC_022873\|CRT	5518621-5518647	27	NZ_KY270853	Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence	191326-191352	5	0.815
NC_022873_8	8.1\|5518621\|27\|NC_022873\|CRT	5518621-5518647	27	MN175386	Klebsiella pneumoniae strain KP-13-14 plasmid pKP-13-14-NDM-9, complete sequence	20270-20296	5	0.815
NC_022873_8	8.1\|5518621\|27\|NC_022873\|CRT	5518621-5518647	27	NZ_CP021328	Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence	28980-29006	5	0.815
NC_022873_8	8.1\|5518621\|27\|NC_022873\|CRT	5518621-5518647	27	NZ_CP022441	Klebsiella sp. LY plasmid unnamed3, complete sequence	43134-43160	5	0.815
NC_022873_8	8.1\|5518621\|27\|NC_022873\|CRT	5518621-5518647	27	KU318421	Klebsiella pneumoniae strain KP04 plasmid pKP04VIM, complete sequence	241296-241322	5	0.815
NC_022873_8	8.1\|5518621\|27\|NC_022873\|CRT	5518621-5518647	27	NC_023911	Raoultella planticola strain KpNDM1 plasmid pKpNDM1, complete sequence	169354-169380	5	0.815
NC_022873_8	8.1\|5518621\|27\|NC_022873\|CRT	5518621-5518647	27	NZ_CP025964	Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence	108955-108981	5	0.815
NC_022873_8	8.1\|5518621\|27\|NC_022873\|CRT	5518621-5518647	27	NZ_CP046614	Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence	200945-200971	5	0.815
NC_022873_8	8.1\|5518621\|27\|NC_022873\|CRT	5518621-5518647	27	NZ_CP026019	Klebsiella pneumoniae strain 13190 plasmid p13190-1, complete sequence	199734-199760	5	0.815
NC_022873_8	8.1\|5518621\|27\|NC_022873\|CRT	5518621-5518647	27	NZ_MF344566	Klebsiella pneumoniae strain A324 plasmid pA324-IMP, complete sequence	241189-241215	5	0.815
NC_022873_8	8.1\|5518621\|27\|NC_022873\|CRT	5518621-5518647	27	NZ_MF344562	Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence	265017-265043	5	0.815
NC_022873_8	8.1\|5518621\|27\|NC_022873\|CRT	5518621-5518647	27	NZ_MF344563	Klebsiella pneumoniae strain 13190 plasmid p13190-VIM, complete sequence	253189-253215	5	0.815
NC_022873_8	8.1\|5518621\|27\|NC_022873\|CRT	5518621-5518647	27	MN661402	Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence	367803-367829	5	0.815
NC_022873_8	8.1\|5518621\|27\|NC_022873\|CRT	5518621-5518647	27	NZ_CP019048	Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166a, complete sequence	87011-87037	5	0.815
NC_022873_8	8.1\|5518621\|27\|NC_022873\|CRT	5518621-5518647	27	NC_018107	Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence	40505-40531	5	0.815
NC_022873_8	8.1\|5518621\|27\|NC_022873\|CRT	5518621-5518647	27	NZ_CP026014	Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence	300731-300757	5	0.815
NC_022873_8	8.1\|5518621\|27\|NC_022873\|CRT	5518621-5518647	27	NZ_MF344565	Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence	189248-189274	5	0.815
NC_022873_8	8.1\|5518621\|27\|NC_022873\|CRT	5518621-5518647	27	NZ_MF344564	Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence	221473-221499	5	0.815
NC_022873_8	8.2\|5518666\|27\|NC_022873\|CRT	5518666-5518692	27	NZ_CP019048	Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166a, complete sequence	87011-87037	5	0.815
NC_022873_8	8.2\|5518666\|27\|NC_022873\|CRT	5518666-5518692	27	NC_018107	Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence	40505-40531	5	0.815
NC_022873_8	8.2\|5518666\|27\|NC_022873\|CRT	5518666-5518692	27	NZ_CP026014	Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence	300731-300757	5	0.815
NC_022873_8	8.2\|5518666\|27\|NC_022873\|CRT	5518666-5518692	27	NZ_MF344565	Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence	189248-189274	5	0.815
NC_022873_8	8.2\|5518666\|27\|NC_022873\|CRT	5518666-5518692	27	NZ_MF344564	Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence	221473-221499	5	0.815
NC_022873_8	8.2\|5518666\|27\|NC_022873\|CRT	5518666-5518692	27	NZ_KY270853	Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence	191326-191352	5	0.815
NC_022873_8	8.2\|5518666\|27\|NC_022873\|CRT	5518666-5518692	27	MN175386	Klebsiella pneumoniae strain KP-13-14 plasmid pKP-13-14-NDM-9, complete sequence	20270-20296	5	0.815
NC_022873_8	8.2\|5518666\|27\|NC_022873\|CRT	5518666-5518692	27	NZ_CP021328	Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence	28980-29006	5	0.815
NC_022873_8	8.2\|5518666\|27\|NC_022873\|CRT	5518666-5518692	27	NZ_CP022441	Klebsiella sp. LY plasmid unnamed3, complete sequence	43134-43160	5	0.815
NC_022873_8	8.2\|5518666\|27\|NC_022873\|CRT	5518666-5518692	27	KU318421	Klebsiella pneumoniae strain KP04 plasmid pKP04VIM, complete sequence	241296-241322	5	0.815
NC_022873_8	8.2\|5518666\|27\|NC_022873\|CRT	5518666-5518692	27	NC_023911	Raoultella planticola strain KpNDM1 plasmid pKpNDM1, complete sequence	169354-169380	5	0.815
NC_022873_8	8.2\|5518666\|27\|NC_022873\|CRT	5518666-5518692	27	NZ_CP025964	Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence	108955-108981	5	0.815
NC_022873_8	8.2\|5518666\|27\|NC_022873\|CRT	5518666-5518692	27	NZ_CP046614	Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence	200945-200971	5	0.815
NC_022873_8	8.2\|5518666\|27\|NC_022873\|CRT	5518666-5518692	27	NZ_CP026019	Klebsiella pneumoniae strain 13190 plasmid p13190-1, complete sequence	199734-199760	5	0.815
NC_022873_8	8.2\|5518666\|27\|NC_022873\|CRT	5518666-5518692	27	NZ_MF344566	Klebsiella pneumoniae strain A324 plasmid pA324-IMP, complete sequence	241189-241215	5	0.815
NC_022873_8	8.2\|5518666\|27\|NC_022873\|CRT	5518666-5518692	27	NZ_MF344562	Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence	265017-265043	5	0.815
NC_022873_8	8.2\|5518666\|27\|NC_022873\|CRT	5518666-5518692	27	NZ_MF344563	Klebsiella pneumoniae strain 13190 plasmid p13190-VIM, complete sequence	253189-253215	5	0.815
NC_022873_8	8.2\|5518666\|27\|NC_022873\|CRT	5518666-5518692	27	MN661402	Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence	367803-367829	5	0.815
NC_022873_8	8.3\|5518711\|27\|NC_022873\|CRT	5518711-5518737	27	NZ_KY270853	Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence	191326-191352	5	0.815
NC_022873_8	8.3\|5518711\|27\|NC_022873\|CRT	5518711-5518737	27	MN175386	Klebsiella pneumoniae strain KP-13-14 plasmid pKP-13-14-NDM-9, complete sequence	20270-20296	5	0.815
NC_022873_8	8.3\|5518711\|27\|NC_022873\|CRT	5518711-5518737	27	NZ_CP021328	Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence	28980-29006	5	0.815
NC_022873_8	8.3\|5518711\|27\|NC_022873\|CRT	5518711-5518737	27	NZ_CP019048	Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166a, complete sequence	87011-87037	5	0.815
NC_022873_8	8.3\|5518711\|27\|NC_022873\|CRT	5518711-5518737	27	NC_018107	Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence	40505-40531	5	0.815
NC_022873_8	8.3\|5518711\|27\|NC_022873\|CRT	5518711-5518737	27	NZ_CP022441	Klebsiella sp. LY plasmid unnamed3, complete sequence	43134-43160	5	0.815
NC_022873_8	8.3\|5518711\|27\|NC_022873\|CRT	5518711-5518737	27	KU318421	Klebsiella pneumoniae strain KP04 plasmid pKP04VIM, complete sequence	241296-241322	5	0.815
NC_022873_8	8.3\|5518711\|27\|NC_022873\|CRT	5518711-5518737	27	NC_023911	Raoultella planticola strain KpNDM1 plasmid pKpNDM1, complete sequence	169354-169380	5	0.815
NC_022873_8	8.3\|5518711\|27\|NC_022873\|CRT	5518711-5518737	27	NZ_CP025964	Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence	108955-108981	5	0.815
NC_022873_8	8.3\|5518711\|27\|NC_022873\|CRT	5518711-5518737	27	NZ_CP046614	Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence	200945-200971	5	0.815
NC_022873_8	8.3\|5518711\|27\|NC_022873\|CRT	5518711-5518737	27	NZ_CP026014	Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence	300731-300757	5	0.815
NC_022873_8	8.3\|5518711\|27\|NC_022873\|CRT	5518711-5518737	27	NZ_CP026019	Klebsiella pneumoniae strain 13190 plasmid p13190-1, complete sequence	199734-199760	5	0.815
NC_022873_8	8.3\|5518711\|27\|NC_022873\|CRT	5518711-5518737	27	NZ_MF344566	Klebsiella pneumoniae strain A324 plasmid pA324-IMP, complete sequence	241189-241215	5	0.815
NC_022873_8	8.3\|5518711\|27\|NC_022873\|CRT	5518711-5518737	27	NZ_MF344565	Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence	189248-189274	5	0.815
NC_022873_8	8.3\|5518711\|27\|NC_022873\|CRT	5518711-5518737	27	NZ_MF344562	Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence	265017-265043	5	0.815
NC_022873_8	8.3\|5518711\|27\|NC_022873\|CRT	5518711-5518737	27	NZ_MF344563	Klebsiella pneumoniae strain 13190 plasmid p13190-VIM, complete sequence	253189-253215	5	0.815
NC_022873_8	8.3\|5518711\|27\|NC_022873\|CRT	5518711-5518737	27	NZ_MF344564	Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence	221473-221499	5	0.815
NC_022873_8	8.3\|5518711\|27\|NC_022873\|CRT	5518711-5518737	27	MN661402	Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence	367803-367829	5	0.815
NC_022873_8	8.4\|5518756\|27\|NC_022873\|CRT	5518756-5518782	27	NZ_KY270853	Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence	191326-191352	5	0.815
NC_022873_8	8.4\|5518756\|27\|NC_022873\|CRT	5518756-5518782	27	MN175386	Klebsiella pneumoniae strain KP-13-14 plasmid pKP-13-14-NDM-9, complete sequence	20270-20296	5	0.815
NC_022873_8	8.4\|5518756\|27\|NC_022873\|CRT	5518756-5518782	27	NZ_CP021328	Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence	28980-29006	5	0.815
NC_022873_8	8.4\|5518756\|27\|NC_022873\|CRT	5518756-5518782	27	NZ_CP019048	Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166a, complete sequence	87011-87037	5	0.815
NC_022873_8	8.4\|5518756\|27\|NC_022873\|CRT	5518756-5518782	27	NC_018107	Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence	40505-40531	5	0.815
NC_022873_8	8.4\|5518756\|27\|NC_022873\|CRT	5518756-5518782	27	NZ_CP022441	Klebsiella sp. LY plasmid unnamed3, complete sequence	43134-43160	5	0.815
NC_022873_8	8.4\|5518756\|27\|NC_022873\|CRT	5518756-5518782	27	KU318421	Klebsiella pneumoniae strain KP04 plasmid pKP04VIM, complete sequence	241296-241322	5	0.815
NC_022873_8	8.4\|5518756\|27\|NC_022873\|CRT	5518756-5518782	27	NC_023911	Raoultella planticola strain KpNDM1 plasmid pKpNDM1, complete sequence	169354-169380	5	0.815
NC_022873_8	8.4\|5518756\|27\|NC_022873\|CRT	5518756-5518782	27	NZ_CP025964	Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence	108955-108981	5	0.815
NC_022873_8	8.4\|5518756\|27\|NC_022873\|CRT	5518756-5518782	27	NZ_CP046614	Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence	200945-200971	5	0.815
NC_022873_8	8.4\|5518756\|27\|NC_022873\|CRT	5518756-5518782	27	NZ_CP026014	Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence	300731-300757	5	0.815
NC_022873_8	8.4\|5518756\|27\|NC_022873\|CRT	5518756-5518782	27	NZ_CP026019	Klebsiella pneumoniae strain 13190 plasmid p13190-1, complete sequence	199734-199760	5	0.815
NC_022873_8	8.4\|5518756\|27\|NC_022873\|CRT	5518756-5518782	27	NZ_MF344566	Klebsiella pneumoniae strain A324 plasmid pA324-IMP, complete sequence	241189-241215	5	0.815
NC_022873_8	8.4\|5518756\|27\|NC_022873\|CRT	5518756-5518782	27	NZ_MF344565	Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence	189248-189274	5	0.815
NC_022873_8	8.4\|5518756\|27\|NC_022873\|CRT	5518756-5518782	27	NZ_MF344562	Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence	265017-265043	5	0.815
NC_022873_8	8.4\|5518756\|27\|NC_022873\|CRT	5518756-5518782	27	NZ_MF344563	Klebsiella pneumoniae strain 13190 plasmid p13190-VIM, complete sequence	253189-253215	5	0.815
NC_022873_8	8.4\|5518756\|27\|NC_022873\|CRT	5518756-5518782	27	NZ_MF344564	Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence	221473-221499	5	0.815
NC_022873_8	8.4\|5518756\|27\|NC_022873\|CRT	5518756-5518782	27	MN661402	Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence	367803-367829	5	0.815
NC_022873_8	8.5\|5518801\|27\|NC_022873\|CRT	5518801-5518827	27	NZ_CP019048	Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166a, complete sequence	87011-87037	5	0.815
NC_022873_8	8.5\|5518801\|27\|NC_022873\|CRT	5518801-5518827	27	NC_018107	Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence	40505-40531	5	0.815
NC_022873_8	8.5\|5518801\|27\|NC_022873\|CRT	5518801-5518827	27	NZ_CP026014	Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence	300731-300757	5	0.815
NC_022873_8	8.5\|5518801\|27\|NC_022873\|CRT	5518801-5518827	27	NZ_MF344565	Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence	189248-189274	5	0.815
NC_022873_8	8.5\|5518801\|27\|NC_022873\|CRT	5518801-5518827	27	NZ_MF344564	Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence	221473-221499	5	0.815
NC_022873_8	8.5\|5518801\|27\|NC_022873\|CRT	5518801-5518827	27	NZ_KY270853	Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence	191326-191352	5	0.815
NC_022873_8	8.5\|5518801\|27\|NC_022873\|CRT	5518801-5518827	27	MN175386	Klebsiella pneumoniae strain KP-13-14 plasmid pKP-13-14-NDM-9, complete sequence	20270-20296	5	0.815
NC_022873_8	8.5\|5518801\|27\|NC_022873\|CRT	5518801-5518827	27	NZ_CP021328	Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence	28980-29006	5	0.815
NC_022873_8	8.5\|5518801\|27\|NC_022873\|CRT	5518801-5518827	27	NZ_CP022441	Klebsiella sp. LY plasmid unnamed3, complete sequence	43134-43160	5	0.815
NC_022873_8	8.5\|5518801\|27\|NC_022873\|CRT	5518801-5518827	27	KU318421	Klebsiella pneumoniae strain KP04 plasmid pKP04VIM, complete sequence	241296-241322	5	0.815
NC_022873_8	8.5\|5518801\|27\|NC_022873\|CRT	5518801-5518827	27	NC_023911	Raoultella planticola strain KpNDM1 plasmid pKpNDM1, complete sequence	169354-169380	5	0.815
NC_022873_8	8.5\|5518801\|27\|NC_022873\|CRT	5518801-5518827	27	NZ_CP025964	Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence	108955-108981	5	0.815
NC_022873_8	8.5\|5518801\|27\|NC_022873\|CRT	5518801-5518827	27	NZ_CP046614	Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence	200945-200971	5	0.815
NC_022873_8	8.5\|5518801\|27\|NC_022873\|CRT	5518801-5518827	27	NZ_CP026019	Klebsiella pneumoniae strain 13190 plasmid p13190-1, complete sequence	199734-199760	5	0.815
NC_022873_8	8.5\|5518801\|27\|NC_022873\|CRT	5518801-5518827	27	NZ_MF344566	Klebsiella pneumoniae strain A324 plasmid pA324-IMP, complete sequence	241189-241215	5	0.815
NC_022873_8	8.5\|5518801\|27\|NC_022873\|CRT	5518801-5518827	27	NZ_MF344562	Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence	265017-265043	5	0.815
NC_022873_8	8.5\|5518801\|27\|NC_022873\|CRT	5518801-5518827	27	NZ_MF344563	Klebsiella pneumoniae strain 13190 plasmid p13190-VIM, complete sequence	253189-253215	5	0.815
NC_022873_8	8.5\|5518801\|27\|NC_022873\|CRT	5518801-5518827	27	MN661402	Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence	367803-367829	5	0.815
NC_022873_8	8.6\|5518846\|27\|NC_022873\|CRT	5518846-5518872	27	NZ_CP019048	Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166a, complete sequence	87011-87037	5	0.815
NC_022873_8	8.6\|5518846\|27\|NC_022873\|CRT	5518846-5518872	27	NC_018107	Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence	40505-40531	5	0.815
NC_022873_8	8.6\|5518846\|27\|NC_022873\|CRT	5518846-5518872	27	NZ_CP026014	Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence	300731-300757	5	0.815
NC_022873_8	8.6\|5518846\|27\|NC_022873\|CRT	5518846-5518872	27	NZ_MF344565	Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence	189248-189274	5	0.815
NC_022873_8	8.6\|5518846\|27\|NC_022873\|CRT	5518846-5518872	27	NZ_MF344564	Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence	221473-221499	5	0.815
NC_022873_8	8.6\|5518846\|27\|NC_022873\|CRT	5518846-5518872	27	NZ_KY270853	Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence	191326-191352	5	0.815
NC_022873_8	8.6\|5518846\|27\|NC_022873\|CRT	5518846-5518872	27	MN175386	Klebsiella pneumoniae strain KP-13-14 plasmid pKP-13-14-NDM-9, complete sequence	20270-20296	5	0.815
NC_022873_8	8.6\|5518846\|27\|NC_022873\|CRT	5518846-5518872	27	NZ_CP021328	Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence	28980-29006	5	0.815
NC_022873_8	8.6\|5518846\|27\|NC_022873\|CRT	5518846-5518872	27	NZ_CP022441	Klebsiella sp. LY plasmid unnamed3, complete sequence	43134-43160	5	0.815
NC_022873_8	8.6\|5518846\|27\|NC_022873\|CRT	5518846-5518872	27	KU318421	Klebsiella pneumoniae strain KP04 plasmid pKP04VIM, complete sequence	241296-241322	5	0.815
NC_022873_8	8.6\|5518846\|27\|NC_022873\|CRT	5518846-5518872	27	NC_023911	Raoultella planticola strain KpNDM1 plasmid pKpNDM1, complete sequence	169354-169380	5	0.815
NC_022873_8	8.6\|5518846\|27\|NC_022873\|CRT	5518846-5518872	27	NZ_CP025964	Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence	108955-108981	5	0.815
NC_022873_8	8.6\|5518846\|27\|NC_022873\|CRT	5518846-5518872	27	NZ_CP046614	Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence	200945-200971	5	0.815
NC_022873_8	8.6\|5518846\|27\|NC_022873\|CRT	5518846-5518872	27	NZ_CP026019	Klebsiella pneumoniae strain 13190 plasmid p13190-1, complete sequence	199734-199760	5	0.815
NC_022873_8	8.6\|5518846\|27\|NC_022873\|CRT	5518846-5518872	27	NZ_MF344566	Klebsiella pneumoniae strain A324 plasmid pA324-IMP, complete sequence	241189-241215	5	0.815
NC_022873_8	8.6\|5518846\|27\|NC_022873\|CRT	5518846-5518872	27	NZ_MF344562	Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence	265017-265043	5	0.815
NC_022873_8	8.6\|5518846\|27\|NC_022873\|CRT	5518846-5518872	27	NZ_MF344563	Klebsiella pneumoniae strain 13190 plasmid p13190-VIM, complete sequence	253189-253215	5	0.815
NC_022873_8	8.6\|5518846\|27\|NC_022873\|CRT	5518846-5518872	27	MN661402	Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence	367803-367829	5	0.815
NC_022873_8	8.7\|5518891\|27\|NC_022873\|CRT	5518891-5518917	27	NZ_KY270853	Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence	191326-191352	5	0.815
NC_022873_8	8.7\|5518891\|27\|NC_022873\|CRT	5518891-5518917	27	MN175386	Klebsiella pneumoniae strain KP-13-14 plasmid pKP-13-14-NDM-9, complete sequence	20270-20296	5	0.815
NC_022873_8	8.7\|5518891\|27\|NC_022873\|CRT	5518891-5518917	27	NZ_CP021328	Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence	28980-29006	5	0.815
NC_022873_8	8.7\|5518891\|27\|NC_022873\|CRT	5518891-5518917	27	NZ_CP019048	Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166a, complete sequence	87011-87037	5	0.815
NC_022873_8	8.7\|5518891\|27\|NC_022873\|CRT	5518891-5518917	27	NC_018107	Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence	40505-40531	5	0.815
NC_022873_8	8.7\|5518891\|27\|NC_022873\|CRT	5518891-5518917	27	NZ_CP022441	Klebsiella sp. LY plasmid unnamed3, complete sequence	43134-43160	5	0.815
NC_022873_8	8.7\|5518891\|27\|NC_022873\|CRT	5518891-5518917	27	KU318421	Klebsiella pneumoniae strain KP04 plasmid pKP04VIM, complete sequence	241296-241322	5	0.815
NC_022873_8	8.7\|5518891\|27\|NC_022873\|CRT	5518891-5518917	27	NC_023911	Raoultella planticola strain KpNDM1 plasmid pKpNDM1, complete sequence	169354-169380	5	0.815
NC_022873_8	8.7\|5518891\|27\|NC_022873\|CRT	5518891-5518917	27	NZ_CP025964	Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence	108955-108981	5	0.815
NC_022873_8	8.7\|5518891\|27\|NC_022873\|CRT	5518891-5518917	27	NZ_CP046614	Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence	200945-200971	5	0.815
NC_022873_8	8.7\|5518891\|27\|NC_022873\|CRT	5518891-5518917	27	NZ_CP026014	Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence	300731-300757	5	0.815
NC_022873_8	8.7\|5518891\|27\|NC_022873\|CRT	5518891-5518917	27	NZ_CP026019	Klebsiella pneumoniae strain 13190 plasmid p13190-1, complete sequence	199734-199760	5	0.815
NC_022873_8	8.7\|5518891\|27\|NC_022873\|CRT	5518891-5518917	27	NZ_MF344566	Klebsiella pneumoniae strain A324 plasmid pA324-IMP, complete sequence	241189-241215	5	0.815
NC_022873_8	8.7\|5518891\|27\|NC_022873\|CRT	5518891-5518917	27	NZ_MF344565	Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence	189248-189274	5	0.815
NC_022873_8	8.7\|5518891\|27\|NC_022873\|CRT	5518891-5518917	27	NZ_MF344562	Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence	265017-265043	5	0.815
NC_022873_8	8.7\|5518891\|27\|NC_022873\|CRT	5518891-5518917	27	NZ_MF344563	Klebsiella pneumoniae strain 13190 plasmid p13190-VIM, complete sequence	253189-253215	5	0.815
NC_022873_8	8.7\|5518891\|27\|NC_022873\|CRT	5518891-5518917	27	NZ_MF344564	Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence	221473-221499	5	0.815
NC_022873_8	8.7\|5518891\|27\|NC_022873\|CRT	5518891-5518917	27	MN661402	Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence	367803-367829	5	0.815
NC_022873_8	8.8\|5518936\|27\|NC_022873\|CRT	5518936-5518962	27	NZ_CP019048	Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166a, complete sequence	87011-87037	5	0.815
NC_022873_8	8.8\|5518936\|27\|NC_022873\|CRT	5518936-5518962	27	NC_018107	Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence	40505-40531	5	0.815
NC_022873_8	8.8\|5518936\|27\|NC_022873\|CRT	5518936-5518962	27	NZ_CP026014	Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence	300731-300757	5	0.815
NC_022873_8	8.8\|5518936\|27\|NC_022873\|CRT	5518936-5518962	27	NZ_MF344565	Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence	189248-189274	5	0.815
NC_022873_8	8.8\|5518936\|27\|NC_022873\|CRT	5518936-5518962	27	NZ_MF344564	Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence	221473-221499	5	0.815
NC_022873_8	8.8\|5518936\|27\|NC_022873\|CRT	5518936-5518962	27	NZ_KY270853	Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence	191326-191352	5	0.815
NC_022873_8	8.8\|5518936\|27\|NC_022873\|CRT	5518936-5518962	27	MN175386	Klebsiella pneumoniae strain KP-13-14 plasmid pKP-13-14-NDM-9, complete sequence	20270-20296	5	0.815
NC_022873_8	8.8\|5518936\|27\|NC_022873\|CRT	5518936-5518962	27	NZ_CP021328	Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence	28980-29006	5	0.815
NC_022873_8	8.8\|5518936\|27\|NC_022873\|CRT	5518936-5518962	27	NZ_CP022441	Klebsiella sp. LY plasmid unnamed3, complete sequence	43134-43160	5	0.815
NC_022873_8	8.8\|5518936\|27\|NC_022873\|CRT	5518936-5518962	27	KU318421	Klebsiella pneumoniae strain KP04 plasmid pKP04VIM, complete sequence	241296-241322	5	0.815
NC_022873_8	8.8\|5518936\|27\|NC_022873\|CRT	5518936-5518962	27	NC_023911	Raoultella planticola strain KpNDM1 plasmid pKpNDM1, complete sequence	169354-169380	5	0.815
NC_022873_8	8.8\|5518936\|27\|NC_022873\|CRT	5518936-5518962	27	NZ_CP025964	Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence	108955-108981	5	0.815
NC_022873_8	8.8\|5518936\|27\|NC_022873\|CRT	5518936-5518962	27	NZ_CP046614	Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence	200945-200971	5	0.815
NC_022873_8	8.8\|5518936\|27\|NC_022873\|CRT	5518936-5518962	27	NZ_CP026019	Klebsiella pneumoniae strain 13190 plasmid p13190-1, complete sequence	199734-199760	5	0.815
NC_022873_8	8.8\|5518936\|27\|NC_022873\|CRT	5518936-5518962	27	NZ_MF344566	Klebsiella pneumoniae strain A324 plasmid pA324-IMP, complete sequence	241189-241215	5	0.815
NC_022873_8	8.8\|5518936\|27\|NC_022873\|CRT	5518936-5518962	27	NZ_MF344562	Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence	265017-265043	5	0.815
NC_022873_8	8.8\|5518936\|27\|NC_022873\|CRT	5518936-5518962	27	NZ_MF344563	Klebsiella pneumoniae strain 13190 plasmid p13190-VIM, complete sequence	253189-253215	5	0.815
NC_022873_8	8.8\|5518936\|27\|NC_022873\|CRT	5518936-5518962	27	MN661402	Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence	367803-367829	5	0.815
NC_022873_8	8.9\|5518981\|27\|NC_022873\|CRT	5518981-5519007	27	NZ_KY270853	Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence	191326-191352	5	0.815
NC_022873_8	8.9\|5518981\|27\|NC_022873\|CRT	5518981-5519007	27	MN175386	Klebsiella pneumoniae strain KP-13-14 plasmid pKP-13-14-NDM-9, complete sequence	20270-20296	5	0.815
NC_022873_8	8.9\|5518981\|27\|NC_022873\|CRT	5518981-5519007	27	NZ_CP021328	Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence	28980-29006	5	0.815
NC_022873_8	8.9\|5518981\|27\|NC_022873\|CRT	5518981-5519007	27	NZ_CP022441	Klebsiella sp. LY plasmid unnamed3, complete sequence	43134-43160	5	0.815
NC_022873_8	8.9\|5518981\|27\|NC_022873\|CRT	5518981-5519007	27	KU318421	Klebsiella pneumoniae strain KP04 plasmid pKP04VIM, complete sequence	241296-241322	5	0.815
NC_022873_8	8.9\|5518981\|27\|NC_022873\|CRT	5518981-5519007	27	NC_023911	Raoultella planticola strain KpNDM1 plasmid pKpNDM1, complete sequence	169354-169380	5	0.815
NC_022873_8	8.9\|5518981\|27\|NC_022873\|CRT	5518981-5519007	27	NZ_CP025964	Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence	108955-108981	5	0.815
NC_022873_8	8.9\|5518981\|27\|NC_022873\|CRT	5518981-5519007	27	NZ_CP046614	Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence	200945-200971	5	0.815
NC_022873_8	8.9\|5518981\|27\|NC_022873\|CRT	5518981-5519007	27	NZ_CP026019	Klebsiella pneumoniae strain 13190 plasmid p13190-1, complete sequence	199734-199760	5	0.815
NC_022873_8	8.9\|5518981\|27\|NC_022873\|CRT	5518981-5519007	27	NZ_MF344566	Klebsiella pneumoniae strain A324 plasmid pA324-IMP, complete sequence	241189-241215	5	0.815
NC_022873_8	8.9\|5518981\|27\|NC_022873\|CRT	5518981-5519007	27	NZ_MF344562	Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence	265017-265043	5	0.815
NC_022873_8	8.9\|5518981\|27\|NC_022873\|CRT	5518981-5519007	27	NZ_MF344563	Klebsiella pneumoniae strain 13190 plasmid p13190-VIM, complete sequence	253189-253215	5	0.815
NC_022873_8	8.9\|5518981\|27\|NC_022873\|CRT	5518981-5519007	27	MN661402	Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence	367803-367829	5	0.815
NC_022873_8	8.9\|5518981\|27\|NC_022873\|CRT	5518981-5519007	27	NZ_CP019048	Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166a, complete sequence	87011-87037	5	0.815
NC_022873_8	8.9\|5518981\|27\|NC_022873\|CRT	5518981-5519007	27	NC_018107	Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence	40505-40531	5	0.815
NC_022873_8	8.9\|5518981\|27\|NC_022873\|CRT	5518981-5519007	27	NZ_CP026014	Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence	300731-300757	5	0.815
NC_022873_8	8.9\|5518981\|27\|NC_022873\|CRT	5518981-5519007	27	NZ_MF344565	Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence	189248-189274	5	0.815
NC_022873_8	8.9\|5518981\|27\|NC_022873\|CRT	5518981-5519007	27	NZ_MF344564	Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence	221473-221499	5	0.815
NC_022873_8	8.10\|5519026\|27\|NC_022873\|CRT	5519026-5519052	27	NZ_CP019048	Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166a, complete sequence	87011-87037	5	0.815
NC_022873_8	8.10\|5519026\|27\|NC_022873\|CRT	5519026-5519052	27	NC_018107	Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence	40505-40531	5	0.815
NC_022873_8	8.10\|5519026\|27\|NC_022873\|CRT	5519026-5519052	27	NZ_CP026014	Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence	300731-300757	5	0.815
NC_022873_8	8.10\|5519026\|27\|NC_022873\|CRT	5519026-5519052	27	NZ_MF344565	Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence	189248-189274	5	0.815
NC_022873_8	8.10\|5519026\|27\|NC_022873\|CRT	5519026-5519052	27	NZ_MF344564	Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence	221473-221499	5	0.815
NC_022873_8	8.10\|5519026\|27\|NC_022873\|CRT	5519026-5519052	27	NZ_KY270853	Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence	191326-191352	5	0.815
NC_022873_8	8.10\|5519026\|27\|NC_022873\|CRT	5519026-5519052	27	MN175386	Klebsiella pneumoniae strain KP-13-14 plasmid pKP-13-14-NDM-9, complete sequence	20270-20296	5	0.815
NC_022873_8	8.10\|5519026\|27\|NC_022873\|CRT	5519026-5519052	27	NZ_CP021328	Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence	28980-29006	5	0.815
NC_022873_8	8.10\|5519026\|27\|NC_022873\|CRT	5519026-5519052	27	NZ_CP022441	Klebsiella sp. LY plasmid unnamed3, complete sequence	43134-43160	5	0.815
NC_022873_8	8.10\|5519026\|27\|NC_022873\|CRT	5519026-5519052	27	KU318421	Klebsiella pneumoniae strain KP04 plasmid pKP04VIM, complete sequence	241296-241322	5	0.815
NC_022873_8	8.10\|5519026\|27\|NC_022873\|CRT	5519026-5519052	27	NC_023911	Raoultella planticola strain KpNDM1 plasmid pKpNDM1, complete sequence	169354-169380	5	0.815
NC_022873_8	8.10\|5519026\|27\|NC_022873\|CRT	5519026-5519052	27	NZ_CP025964	Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence	108955-108981	5	0.815
NC_022873_8	8.10\|5519026\|27\|NC_022873\|CRT	5519026-5519052	27	NZ_CP046614	Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence	200945-200971	5	0.815
NC_022873_8	8.10\|5519026\|27\|NC_022873\|CRT	5519026-5519052	27	NZ_CP026019	Klebsiella pneumoniae strain 13190 plasmid p13190-1, complete sequence	199734-199760	5	0.815
NC_022873_8	8.10\|5519026\|27\|NC_022873\|CRT	5519026-5519052	27	NZ_MF344566	Klebsiella pneumoniae strain A324 plasmid pA324-IMP, complete sequence	241189-241215	5	0.815
NC_022873_8	8.10\|5519026\|27\|NC_022873\|CRT	5519026-5519052	27	NZ_MF344562	Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence	265017-265043	5	0.815
NC_022873_8	8.10\|5519026\|27\|NC_022873\|CRT	5519026-5519052	27	NZ_MF344563	Klebsiella pneumoniae strain 13190 plasmid p13190-VIM, complete sequence	253189-253215	5	0.815
NC_022873_8	8.10\|5519026\|27\|NC_022873\|CRT	5519026-5519052	27	MN661402	Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence	367803-367829	5	0.815
NC_022873_8	8.11\|5519071\|27\|NC_022873\|CRT	5519071-5519097	27	NZ_CP019048	Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166a, complete sequence	87011-87037	5	0.815
NC_022873_8	8.11\|5519071\|27\|NC_022873\|CRT	5519071-5519097	27	NC_018107	Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence	40505-40531	5	0.815
NC_022873_8	8.11\|5519071\|27\|NC_022873\|CRT	5519071-5519097	27	NZ_CP026014	Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence	300731-300757	5	0.815
NC_022873_8	8.11\|5519071\|27\|NC_022873\|CRT	5519071-5519097	27	NZ_MF344565	Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence	189248-189274	5	0.815
NC_022873_8	8.11\|5519071\|27\|NC_022873\|CRT	5519071-5519097	27	NZ_MF344564	Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence	221473-221499	5	0.815
NC_022873_8	8.11\|5519071\|27\|NC_022873\|CRT	5519071-5519097	27	NZ_KY270853	Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence	191326-191352	5	0.815
NC_022873_8	8.11\|5519071\|27\|NC_022873\|CRT	5519071-5519097	27	MN175386	Klebsiella pneumoniae strain KP-13-14 plasmid pKP-13-14-NDM-9, complete sequence	20270-20296	5	0.815
NC_022873_8	8.11\|5519071\|27\|NC_022873\|CRT	5519071-5519097	27	NZ_CP021328	Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence	28980-29006	5	0.815
NC_022873_8	8.11\|5519071\|27\|NC_022873\|CRT	5519071-5519097	27	NZ_CP022441	Klebsiella sp. LY plasmid unnamed3, complete sequence	43134-43160	5	0.815
NC_022873_8	8.11\|5519071\|27\|NC_022873\|CRT	5519071-5519097	27	KU318421	Klebsiella pneumoniae strain KP04 plasmid pKP04VIM, complete sequence	241296-241322	5	0.815
NC_022873_8	8.11\|5519071\|27\|NC_022873\|CRT	5519071-5519097	27	NC_023911	Raoultella planticola strain KpNDM1 plasmid pKpNDM1, complete sequence	169354-169380	5	0.815
NC_022873_8	8.11\|5519071\|27\|NC_022873\|CRT	5519071-5519097	27	NZ_CP025964	Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence	108955-108981	5	0.815
NC_022873_8	8.11\|5519071\|27\|NC_022873\|CRT	5519071-5519097	27	NZ_CP046614	Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence	200945-200971	5	0.815
NC_022873_8	8.11\|5519071\|27\|NC_022873\|CRT	5519071-5519097	27	NZ_CP026019	Klebsiella pneumoniae strain 13190 plasmid p13190-1, complete sequence	199734-199760	5	0.815
NC_022873_8	8.11\|5519071\|27\|NC_022873\|CRT	5519071-5519097	27	NZ_MF344566	Klebsiella pneumoniae strain A324 plasmid pA324-IMP, complete sequence	241189-241215	5	0.815
NC_022873_8	8.11\|5519071\|27\|NC_022873\|CRT	5519071-5519097	27	NZ_MF344562	Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence	265017-265043	5	0.815
NC_022873_8	8.11\|5519071\|27\|NC_022873\|CRT	5519071-5519097	27	NZ_MF344563	Klebsiella pneumoniae strain 13190 plasmid p13190-VIM, complete sequence	253189-253215	5	0.815
NC_022873_8	8.11\|5519071\|27\|NC_022873\|CRT	5519071-5519097	27	MN661402	Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence	367803-367829	5	0.815
NC_022873_8	8.12\|5519116\|27\|NC_022873\|CRT	5519116-5519142	27	NZ_CP019048	Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166a, complete sequence	87011-87037	5	0.815
NC_022873_8	8.12\|5519116\|27\|NC_022873\|CRT	5519116-5519142	27	NC_018107	Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence	40505-40531	5	0.815
NC_022873_8	8.12\|5519116\|27\|NC_022873\|CRT	5519116-5519142	27	NZ_CP026014	Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence	300731-300757	5	0.815
NC_022873_8	8.12\|5519116\|27\|NC_022873\|CRT	5519116-5519142	27	NZ_MF344565	Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence	189248-189274	5	0.815
NC_022873_8	8.12\|5519116\|27\|NC_022873\|CRT	5519116-5519142	27	NZ_MF344564	Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence	221473-221499	5	0.815
NC_022873_8	8.12\|5519116\|27\|NC_022873\|CRT	5519116-5519142	27	NZ_KY270853	Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence	191326-191352	5	0.815
NC_022873_8	8.12\|5519116\|27\|NC_022873\|CRT	5519116-5519142	27	MN175386	Klebsiella pneumoniae strain KP-13-14 plasmid pKP-13-14-NDM-9, complete sequence	20270-20296	5	0.815
NC_022873_8	8.12\|5519116\|27\|NC_022873\|CRT	5519116-5519142	27	NZ_CP021328	Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence	28980-29006	5	0.815
NC_022873_8	8.12\|5519116\|27\|NC_022873\|CRT	5519116-5519142	27	NZ_CP022441	Klebsiella sp. LY plasmid unnamed3, complete sequence	43134-43160	5	0.815
NC_022873_8	8.12\|5519116\|27\|NC_022873\|CRT	5519116-5519142	27	KU318421	Klebsiella pneumoniae strain KP04 plasmid pKP04VIM, complete sequence	241296-241322	5	0.815
NC_022873_8	8.12\|5519116\|27\|NC_022873\|CRT	5519116-5519142	27	NC_023911	Raoultella planticola strain KpNDM1 plasmid pKpNDM1, complete sequence	169354-169380	5	0.815
NC_022873_8	8.12\|5519116\|27\|NC_022873\|CRT	5519116-5519142	27	NZ_CP025964	Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence	108955-108981	5	0.815
NC_022873_8	8.12\|5519116\|27\|NC_022873\|CRT	5519116-5519142	27	NZ_CP046614	Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence	200945-200971	5	0.815
NC_022873_8	8.12\|5519116\|27\|NC_022873\|CRT	5519116-5519142	27	NZ_CP026019	Klebsiella pneumoniae strain 13190 plasmid p13190-1, complete sequence	199734-199760	5	0.815
NC_022873_8	8.12\|5519116\|27\|NC_022873\|CRT	5519116-5519142	27	NZ_MF344566	Klebsiella pneumoniae strain A324 plasmid pA324-IMP, complete sequence	241189-241215	5	0.815
NC_022873_8	8.12\|5519116\|27\|NC_022873\|CRT	5519116-5519142	27	NZ_MF344562	Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence	265017-265043	5	0.815
NC_022873_8	8.12\|5519116\|27\|NC_022873\|CRT	5519116-5519142	27	NZ_MF344563	Klebsiella pneumoniae strain 13190 plasmid p13190-VIM, complete sequence	253189-253215	5	0.815
NC_022873_8	8.12\|5519116\|27\|NC_022873\|CRT	5519116-5519142	27	MN661402	Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence	367803-367829	5	0.815
NC_022873_8	8.13\|5519161\|27\|NC_022873\|CRT	5519161-5519187	27	NZ_KY270853	Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence	191326-191352	5	0.815
NC_022873_8	8.13\|5519161\|27\|NC_022873\|CRT	5519161-5519187	27	MN175386	Klebsiella pneumoniae strain KP-13-14 plasmid pKP-13-14-NDM-9, complete sequence	20270-20296	5	0.815
NC_022873_8	8.13\|5519161\|27\|NC_022873\|CRT	5519161-5519187	27	NZ_CP021328	Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence	28980-29006	5	0.815
NC_022873_8	8.13\|5519161\|27\|NC_022873\|CRT	5519161-5519187	27	NZ_CP019048	Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166a, complete sequence	87011-87037	5	0.815
NC_022873_8	8.13\|5519161\|27\|NC_022873\|CRT	5519161-5519187	27	NC_018107	Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence	40505-40531	5	0.815
NC_022873_8	8.13\|5519161\|27\|NC_022873\|CRT	5519161-5519187	27	NZ_CP022441	Klebsiella sp. LY plasmid unnamed3, complete sequence	43134-43160	5	0.815
NC_022873_8	8.13\|5519161\|27\|NC_022873\|CRT	5519161-5519187	27	KU318421	Klebsiella pneumoniae strain KP04 plasmid pKP04VIM, complete sequence	241296-241322	5	0.815
NC_022873_8	8.13\|5519161\|27\|NC_022873\|CRT	5519161-5519187	27	NC_023911	Raoultella planticola strain KpNDM1 plasmid pKpNDM1, complete sequence	169354-169380	5	0.815
NC_022873_8	8.13\|5519161\|27\|NC_022873\|CRT	5519161-5519187	27	NZ_CP025964	Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence	108955-108981	5	0.815
NC_022873_8	8.13\|5519161\|27\|NC_022873\|CRT	5519161-5519187	27	NZ_CP046614	Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence	200945-200971	5	0.815
NC_022873_8	8.13\|5519161\|27\|NC_022873\|CRT	5519161-5519187	27	NZ_CP026014	Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence	300731-300757	5	0.815
NC_022873_8	8.13\|5519161\|27\|NC_022873\|CRT	5519161-5519187	27	NZ_CP026019	Klebsiella pneumoniae strain 13190 plasmid p13190-1, complete sequence	199734-199760	5	0.815
NC_022873_8	8.13\|5519161\|27\|NC_022873\|CRT	5519161-5519187	27	NZ_MF344566	Klebsiella pneumoniae strain A324 plasmid pA324-IMP, complete sequence	241189-241215	5	0.815
NC_022873_8	8.13\|5519161\|27\|NC_022873\|CRT	5519161-5519187	27	NZ_MF344565	Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence	189248-189274	5	0.815
NC_022873_8	8.13\|5519161\|27\|NC_022873\|CRT	5519161-5519187	27	NZ_MF344562	Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence	265017-265043	5	0.815
NC_022873_8	8.13\|5519161\|27\|NC_022873\|CRT	5519161-5519187	27	NZ_MF344563	Klebsiella pneumoniae strain 13190 plasmid p13190-VIM, complete sequence	253189-253215	5	0.815
NC_022873_8	8.13\|5519161\|27\|NC_022873\|CRT	5519161-5519187	27	NZ_MF344564	Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence	221473-221499	5	0.815
NC_022873_8	8.13\|5519161\|27\|NC_022873\|CRT	5519161-5519187	27	MN661402	Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence	367803-367829	5	0.815
NC_022873_8	8.15\|5519242\|27\|NC_022873\|CRT	5519242-5519268	27	NZ_KY270853	Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence	191326-191352	5	0.815
NC_022873_8	8.15\|5519242\|27\|NC_022873\|CRT	5519242-5519268	27	MN175386	Klebsiella pneumoniae strain KP-13-14 plasmid pKP-13-14-NDM-9, complete sequence	20270-20296	5	0.815
NC_022873_8	8.15\|5519242\|27\|NC_022873\|CRT	5519242-5519268	27	NZ_CP021328	Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence	28980-29006	5	0.815
NC_022873_8	8.15\|5519242\|27\|NC_022873\|CRT	5519242-5519268	27	NZ_CP022441	Klebsiella sp. LY plasmid unnamed3, complete sequence	43134-43160	5	0.815
NC_022873_8	8.15\|5519242\|27\|NC_022873\|CRT	5519242-5519268	27	KU318421	Klebsiella pneumoniae strain KP04 plasmid pKP04VIM, complete sequence	241296-241322	5	0.815
NC_022873_8	8.15\|5519242\|27\|NC_022873\|CRT	5519242-5519268	27	NC_023911	Raoultella planticola strain KpNDM1 plasmid pKpNDM1, complete sequence	169354-169380	5	0.815
NC_022873_8	8.15\|5519242\|27\|NC_022873\|CRT	5519242-5519268	27	NZ_CP025964	Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence	108955-108981	5	0.815
NC_022873_8	8.15\|5519242\|27\|NC_022873\|CRT	5519242-5519268	27	NZ_CP046614	Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence	200945-200971	5	0.815
NC_022873_8	8.15\|5519242\|27\|NC_022873\|CRT	5519242-5519268	27	NZ_CP026019	Klebsiella pneumoniae strain 13190 plasmid p13190-1, complete sequence	199734-199760	5	0.815
NC_022873_8	8.15\|5519242\|27\|NC_022873\|CRT	5519242-5519268	27	NZ_MF344566	Klebsiella pneumoniae strain A324 plasmid pA324-IMP, complete sequence	241189-241215	5	0.815
NC_022873_8	8.15\|5519242\|27\|NC_022873\|CRT	5519242-5519268	27	NZ_MF344562	Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence	265017-265043	5	0.815
NC_022873_8	8.15\|5519242\|27\|NC_022873\|CRT	5519242-5519268	27	NZ_MF344563	Klebsiella pneumoniae strain 13190 plasmid p13190-VIM, complete sequence	253189-253215	5	0.815
NC_022873_8	8.15\|5519242\|27\|NC_022873\|CRT	5519242-5519268	27	MN661402	Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence	367803-367829	5	0.815
NC_022873_8	8.15\|5519242\|27\|NC_022873\|CRT	5519242-5519268	27	NZ_CP019048	Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166a, complete sequence	87011-87037	5	0.815
NC_022873_8	8.15\|5519242\|27\|NC_022873\|CRT	5519242-5519268	27	NC_018107	Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence	40505-40531	5	0.815
NC_022873_8	8.15\|5519242\|27\|NC_022873\|CRT	5519242-5519268	27	NZ_CP026014	Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence	300731-300757	5	0.815
NC_022873_8	8.15\|5519242\|27\|NC_022873\|CRT	5519242-5519268	27	NZ_MF344565	Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence	189248-189274	5	0.815
NC_022873_8	8.15\|5519242\|27\|NC_022873\|CRT	5519242-5519268	27	NZ_MF344564	Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence	221473-221499	5	0.815
NC_022873_7	7.1\|4026892\|27\|NC_022873\|CRT	4026892-4026918	27	MT701598	Streptomyces phage Sitrop, complete genome	15910-15936	6	0.778
NC_022873_7	7.1\|4026892\|27\|NC_022873\|CRT	4026892-4026918	27	MT066160	Vibrio phage Saratov-12, complete genome	4498-4524	6	0.778
NC_022873_7	7.1\|4026892\|27\|NC_022873\|CRT	4026892-4026918	27	MT767883	Vibrio phage Saratov-15, complete genome	10808-10834	6	0.778
NC_022873_7	7.3\|4026973\|27\|NC_022873\|CRT	4026973-4026999	27	MT701598	Streptomyces phage Sitrop, complete genome	15910-15936	6	0.778
NC_022873_7	7.3\|4026973\|27\|NC_022873\|CRT	4026973-4026999	27	MT066160	Vibrio phage Saratov-12, complete genome	4498-4524	6	0.778
NC_022873_7	7.3\|4026973\|27\|NC_022873\|CRT	4026973-4026999	27	MT767883	Vibrio phage Saratov-15, complete genome	10808-10834	6	0.778
NC_022873_7	7.5\|4027054\|27\|NC_022873\|CRT	4027054-4027080	27	MT701598	Streptomyces phage Sitrop, complete genome	15910-15936	6	0.778
NC_022873_7	7.5\|4027054\|27\|NC_022873\|CRT	4027054-4027080	27	MT066160	Vibrio phage Saratov-12, complete genome	4498-4524	6	0.778
NC_022873_7	7.5\|4027054\|27\|NC_022873\|CRT	4027054-4027080	27	MT767883	Vibrio phage Saratov-15, complete genome	10808-10834	6	0.778
NC_022873_7	7.7\|4027135\|27\|NC_022873\|CRT	4027135-4027161	27	MT701598	Streptomyces phage Sitrop, complete genome	15910-15936	6	0.778
NC_022873_7	7.7\|4027135\|27\|NC_022873\|CRT	4027135-4027161	27	MT066160	Vibrio phage Saratov-12, complete genome	4498-4524	6	0.778
NC_022873_7	7.7\|4027135\|27\|NC_022873\|CRT	4027135-4027161	27	MT767883	Vibrio phage Saratov-15, complete genome	10808-10834	6	0.778
NC_022873_7	7.9\|4027216\|27\|NC_022873\|CRT	4027216-4027242	27	MT701598	Streptomyces phage Sitrop, complete genome	15910-15936	6	0.778
NC_022873_7	7.9\|4027216\|27\|NC_022873\|CRT	4027216-4027242	27	MT066160	Vibrio phage Saratov-12, complete genome	4498-4524	6	0.778
NC_022873_7	7.9\|4027216\|27\|NC_022873\|CRT	4027216-4027242	27	MT767883	Vibrio phage Saratov-15, complete genome	10808-10834	6	0.778
NC_022873_7	7.12\|4027333\|27\|NC_022873\|CRT	4027333-4027359	27	MT701598	Streptomyces phage Sitrop, complete genome	15910-15936	6	0.778
NC_022873_7	7.12\|4027333\|27\|NC_022873\|CRT	4027333-4027359	27	MT066160	Vibrio phage Saratov-12, complete genome	4498-4524	6	0.778
NC_022873_7	7.12\|4027333\|27\|NC_022873\|CRT	4027333-4027359	27	MT767883	Vibrio phage Saratov-15, complete genome	10808-10834	6	0.778
NC_022873_7	7.14\|4027414\|27\|NC_022873\|CRT	4027414-4027440	27	MT701598	Streptomyces phage Sitrop, complete genome	15910-15936	6	0.778
NC_022873_7	7.14\|4027414\|27\|NC_022873\|CRT	4027414-4027440	27	MT066160	Vibrio phage Saratov-12, complete genome	4498-4524	6	0.778
NC_022873_7	7.14\|4027414\|27\|NC_022873\|CRT	4027414-4027440	27	MT767883	Vibrio phage Saratov-15, complete genome	10808-10834	6	0.778
NC_022873_7	7.18\|4027594\|27\|NC_022873\|CRT	4027594-4027620	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	13201-13227	6	0.778
NC_022873_7	7.18\|4027594\|27\|NC_022873\|CRT	4027594-4027620	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	13204-13230	6	0.778
NC_022873_7	7.18\|4027594\|27\|NC_022873\|CRT	4027594-4027620	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	13201-13227	6	0.778
NC_022873_7	7.18\|4027594\|27\|NC_022873\|CRT	4027594-4027620	27	MN693189	Marine virus AFVG_25M326, complete genome	18918-18944	6	0.778
NC_022873_7	7.18\|4027594\|27\|NC_022873\|CRT	4027594-4027620	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3984-4010	6	0.778
NC_022873_7	7.18\|4027594\|27\|NC_022873\|CRT	4027594-4027620	27	NZ_CP025547	Mycobacterium paragordonae strain 49061 plasmid unnamed1, complete sequence	134824-134850	6	0.778
NC_022873_7	7.18\|4027594\|27\|NC_022873\|CRT	4027594-4027620	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29495-29521	6	0.778
NC_022873_8	8.1\|5518621\|27\|NC_022873\|CRT	5518621-5518647	27	MN150686	Bacillus phage BC-T25, complete genome	23896-23922	6	0.778
NC_022873_8	8.9\|5518981\|27\|NC_022873\|CRT	5518981-5519007	27	MN150686	Bacillus phage BC-T25, complete genome	23896-23922	6	0.778
NC_022873_8	8.15\|5519242\|27\|NC_022873\|CRT	5519242-5519268	27	MN150686	Bacillus phage BC-T25, complete genome	23896-23922	6	0.778
NC_022873_7	7.15\|4027459\|27\|NC_022873\|CRT	4027459-4027485	27	MN586053	Arthrobacter phage BeatusComedenti, complete genome	29812-29838	7	0.741
NC_022873_7	7.15\|4027459\|27\|NC_022873\|CRT	4027459-4027485	27	NC_031231	Arthrobacter phage KellEzio, complete genome	29814-29840	7	0.741
NC_022873_7	7.19\|4027639\|36\|NC_022873\|CRT	4027639-4027674	36	MN693405	Marine virus AFVG_25M416, complete genome	18970-19005	7	0.806
NC_022873_7	7.19\|4027639\|36\|NC_022873\|CRT	4027639-4027674	36	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3666-3701	7	0.806
NC_022873_7	7.19\|4027639\|36\|NC_022873\|CRT	4027639-4027674	36	MN693333	Marine virus AFVG_25M417, complete genome	18970-19005	7	0.806
NC_022873_7	7.19\|4027639\|36\|NC_022873\|CRT	4027639-4027674	36	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29804-29839	7	0.806
NC_022873_7	7.21\|4027729\|27\|NC_022873\|CRT	4027729-4027755	27	AP013564	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, * SEQUENCING IN PROGRESS *, 4 ordered pieces	9195-9221	7	0.741
NC_022873_7	7.21\|4027729\|27\|NC_022873\|CRT	4027729-4027755	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	9025-9051	7	0.741
NC_022873_7	7.21\|4027729\|27\|NC_022873\|CRT	4027729-4027755	27	AP013943	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, * SEQUENCING IN PROGRESS *	9797-9823	7	0.741
NC_022873_7	7.21\|4027729\|27\|NC_022873\|CRT	4027729-4027755	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	4494-4520	7	0.741
NC_022873_7	7.21\|4027729\|27\|NC_022873\|CRT	4027729-4027755	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	17307-17333	7	0.741
NC_022873_7	7.21\|4027729\|27\|NC_022873\|CRT	4027729-4027755	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	14907-14933	7	0.741
NC_022873_9	9.1\|5781927\|31\|NC_022873\|CRISPRCasFinder	5781927-5781957	31	JX238501	Bacillus phage phiAGATE, complete genome	124559-124589	8	0.742
NC_022873_9	9.2\|5781981\|34\|NC_022873\|CRISPRCasFinder	5781981-5782014	34	NZ_CP014851	Bacillus thuringiensis strain HD12 plasmid pHD120112, complete sequence	100650-100683	8	0.765
NC_022873_9	9.2\|5781981\|34\|NC_022873\|CRISPRCasFinder	5781981-5782014	34	MN812210	Flavobacterium phage vB_FspS_hemulen9-1, complete genome	22854-22887	8	0.765
NC_022873_9	9.2\|5781981\|34\|NC_022873\|CRISPRCasFinder	5781981-5782014	34	MN812215	Flavobacterium phage vB_FspS_lillamy9-4, complete genome	22191-22224	8	0.765
NC_022873_9	9.2\|5781981\|34\|NC_022873\|CRISPRCasFinder	5781981-5782014	34	MN812216	Flavobacterium phage vB_FspS_lillamy9-5, complete genome	22191-22224	8	0.765
NC_022873_9	9.2\|5781981\|34\|NC_022873\|CRISPRCasFinder	5781981-5782014	34	NC_048835	Flavobacterium phage vB_FspS_lillamy9-1, complete genome	22191-22224	8	0.765
NC_022873_9	9.2\|5781981\|34\|NC_022873\|CRISPRCasFinder	5781981-5782014	34	MN812213	Flavobacterium phage vB_FspS_lillamy9-2, complete genome	22191-22224	8	0.765
NC_022873_9	9.2\|5781981\|34\|NC_022873\|CRISPRCasFinder	5781981-5782014	34	MN812230	Flavobacterium phage vB_FspS_sniff9-2, complete genome	21831-21864	8	0.765
NC_022873_9	9.2\|5781981\|34\|NC_022873\|CRISPRCasFinder	5781981-5782014	34	MN812209	Flavobacterium phage vB_FspS_hemulen6-2, complete genome	22983-23016	8	0.765
NC_022873_9	9.2\|5781981\|34\|NC_022873\|CRISPRCasFinder	5781981-5782014	34	MN812218	Flavobacterium phage vB_FspS_lillamy9-7, complete genome	21454-21487	8	0.765
NC_022873_9	9.2\|5781981\|34\|NC_022873\|CRISPRCasFinder	5781981-5782014	34	MN812233	Flavobacterium phage vB_FspS_snork9-1, complete genome	22007-22040	8	0.765
NC_022873_9	9.2\|5781981\|34\|NC_022873\|CRISPRCasFinder	5781981-5782014	34	MN812219	Flavobacterium phage vB_FspS_morran9-1, complete genome	22308-22341	8	0.765
NC_022873_9	9.2\|5781981\|34\|NC_022873\|CRISPRCasFinder	5781981-5782014	34	MN812217	Flavobacterium phage vB_FspS_lillamy9-6, complete genome	21930-21963	8	0.765
NC_022873_9	9.2\|5781981\|34\|NC_022873\|CRISPRCasFinder	5781981-5782014	34	NC_048840	Flavobacterium phage vB_FspS_snork6-1, complete genome	22137-22170	8	0.765
NC_022873_9	9.2\|5781981\|34\|NC_022873\|CRISPRCasFinder	5781981-5782014	34	NC_048839	Flavobacterium phage vB_FspS_sniff9-1, complete genome	22057-22090	8	0.765
NC_022873_9	9.2\|5781981\|34\|NC_022873\|CRISPRCasFinder	5781981-5782014	34	NC_048842	Flavobacterium phage vB_FspS_stinky9-1, complete genome	21673-21706	8	0.765
NC_022873_9	9.2\|5781981\|34\|NC_022873\|CRISPRCasFinder	5781981-5782014	34	MN812232	Flavobacterium phage vB_FspS_snork6-2, complete genome	21655-21688	8	0.765
NC_022873_9	9.2\|5781981\|34\|NC_022873\|CRISPRCasFinder	5781981-5782014	34	MN812208	Flavobacterium phage vB_FspS_hemulen6-1, complete genome	22983-23016	8	0.765
NC_022873_9	9.2\|5781981\|34\|NC_022873\|CRISPRCasFinder	5781981-5782014	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	47181-47214	11	0.676
NC_022873_9	9.2\|5781981\|34\|NC_022873\|CRISPRCasFinder	5781981-5782014	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	47565-47598	11	0.676
NC_022873_9	9.2\|5781981\|34\|NC_022873\|CRISPRCasFinder	5781981-5782014	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	47949-47982	11	0.676
NC_022873_9	9.2\|5781981\|34\|NC_022873\|CRISPRCasFinder	5781981-5782014	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	48333-48366	11	0.676
NC_022873_9	9.2\|5781981\|34\|NC_022873\|CRISPRCasFinder	5781981-5782014	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	48717-48750	11	0.676
NC_022873_9	9.2\|5781981\|34\|NC_022873\|CRISPRCasFinder	5781981-5782014	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	49101-49134	11	0.676
NC_022873_9	9.2\|5781981\|34\|NC_022873\|CRISPRCasFinder	5781981-5782014	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	49485-49518	11	0.676

1. spacer 4.1|3584095|19|NC_022873|CRISPRCasFinder matches to MN689516 (Lactococcus phage CHPC148, complete genome) position: , mismatch: 0, identity: 1.0

caccttgaataccttgaat	CRISPR spacer
caccttgaataccttgaat	Protospacer
*******************

2. spacer 4.1|3584095|19|NC_022873|CRISPRCasFinder matches to NC_004746 (Lactococcus phage 4268, complete genome) position: , mismatch: 0, identity: 1.0

caccttgaataccttgaat	CRISPR spacer
caccttgaataccttgaat	Protospacer
*******************

3. spacer 4.1|3584095|19|NC_022873|CRISPRCasFinder matches to MN689530 (Lactococcus phage CHPC974, partial genome) position: , mismatch: 0, identity: 1.0

caccttgaataccttgaat	CRISPR spacer
caccttgaataccttgaat	Protospacer
*******************

4. spacer 4.1|3584095|19|NC_022873|CRISPRCasFinder matches to AJ245616 (Lactococcus lactis phage BK5-T complete genome) position: , mismatch: 0, identity: 1.0

caccttgaataccttgaat	CRISPR spacer
caccttgaataccttgaat	Protospacer
*******************

5. spacer 4.1|3584095|19|NC_022873|CRISPRCasFinder matches to AF176025 (Lactococcus phage BK5-T, complete genome) position: , mismatch: 0, identity: 1.0

caccttgaataccttgaat	CRISPR spacer
caccttgaataccttgaat	Protospacer
*******************

6. spacer 4.1|3584095|19|NC_022873|CRISPRCasFinder matches to GU075905 (Prochlorococcus phage P-HM2, complete genome) position: , mismatch: 0, identity: 1.0

caccttgaataccttgaat	CRISPR spacer
caccttgaataccttgaat	Protospacer
*******************

7. spacer 4.1|3584095|19|NC_022873|CRISPRCasFinder matches to AF489521 (Lactococcus bacteriophage 4268, complete genome) position: , mismatch: 0, identity: 1.0

caccttgaataccttgaat	CRISPR spacer
caccttgaataccttgaat	Protospacer
*******************

8. spacer 5.2|3584374|22|NC_022873|CRISPRCasFinder matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ctcccgttggacctggtggacc	CRISPR spacer
ctcccgttggacctggtggacc	Protospacer
**********************

9. spacer 5.2|3584374|22|NC_022873|CRISPRCasFinder matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ctcccgttggacctggtggacc	CRISPR spacer
ctcccgttggacctggtggacc	Protospacer
**********************

10. spacer 5.2|3584374|22|NC_022873|CRISPRCasFinder matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ctcccgttggacctggtggacc	CRISPR spacer
ctcccgttggacctggtggacc	Protospacer
**********************

11. spacer 5.2|3584374|22|NC_022873|CRISPRCasFinder matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ctcccgttggacctggtggacc	CRISPR spacer
ctcccgttggacctggtggacc	Protospacer
**********************

12. spacer 5.2|3584374|22|NC_022873|CRISPRCasFinder matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ctcccgttggacctggtggacc	CRISPR spacer
ctcccgttggacctggtggacc	Protospacer
**********************

13. spacer 5.2|3584374|22|NC_022873|CRISPRCasFinder matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ctcccgttggacctggtggacc	CRISPR spacer
ctcccgttggacctggtggacc	Protospacer
**********************

14. spacer 5.2|3584374|22|NC_022873|CRISPRCasFinder matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ctcccgttggacctggtggacc	CRISPR spacer
ctcccgttggacctggtggacc	Protospacer
**********************

15. spacer 5.2|3584374|22|NC_022873|CRISPRCasFinder matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ctcccgttggacctggtggacc	CRISPR spacer
ctcccgttggacctggtggacc	Protospacer
**********************

16. spacer 7.5|4027054|27|NC_022873|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.889

cggcgctaccggtgccactggacctcg	CRISPR spacer
cggcgctaccggtgctactggacctac	Protospacer
***************.*********

17. spacer 7.18|4027594|27|NC_022873|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 3, identity: 0.889

tggtgctaccggacctcaaggtgctca	CRISPR spacer
tggtgctactggacctcaaggtgctac	Protospacer
*********.***************

18. spacer 7.1|4026892|27|NC_022873|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

tggcgctaccggtgccactggacctcg	CRISPR spacer
cggcgctaccggtgctactggacctac	Protospacer
.**************.*********

19. spacer 7.1|4026892|27|NC_022873|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tggcgctaccggtgccactggacctcg	CRISPR spacer
tggcgctactggtgctactggaccgca	Protospacer
*********.*****.******** *.

20. spacer 7.1|4026892|27|NC_022873|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tggcgctaccggtgccactggacctcg	CRISPR spacer
tggcgctactggtgctactggaccgca	Protospacer
*********.*****.******** *.

21. spacer 7.3|4026973|27|NC_022873|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

tggcgctaccggtgccactggacctcg	CRISPR spacer
cggcgctaccggtgctactggacctac	Protospacer
.**************.*********

22. spacer 7.3|4026973|27|NC_022873|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tggcgctaccggtgccactggacctcg	CRISPR spacer
tggcgctactggtgctactggaccgca	Protospacer
*********.*****.******** *.

23. spacer 7.3|4026973|27|NC_022873|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tggcgctaccggtgccactggacctcg	CRISPR spacer
tggcgctactggtgctactggaccgca	Protospacer
*********.*****.******** *.

24. spacer 7.5|4027054|27|NC_022873|CRT matches to MN204498 (Streptomyces phage Saftant, complete genome) position: , mismatch: 4, identity: 0.852

cggcgctaccggtgccactggacctcg	CRISPR spacer
cggtgctaccggtgccactggtccgca	Protospacer
***.***************** ** *.

25. spacer 7.7|4027135|27|NC_022873|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

tggcgctaccggtgccactggacctcg	CRISPR spacer
cggcgctaccggtgctactggacctac	Protospacer
.**************.*********

26. spacer 7.7|4027135|27|NC_022873|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tggcgctaccggtgccactggacctcg	CRISPR spacer
tggcgctactggtgctactggaccgca	Protospacer
*********.*****.******** *.

27. spacer 7.7|4027135|27|NC_022873|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tggcgctaccggtgccactggacctcg	CRISPR spacer
tggcgctactggtgctactggaccgca	Protospacer
*********.*****.******** *.

28. spacer 7.9|4027216|27|NC_022873|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

tggcgctaccggtgccactggacctcg	CRISPR spacer
cggcgctaccggtgctactggacctac	Protospacer
.**************.*********

29. spacer 7.9|4027216|27|NC_022873|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tggcgctaccggtgccactggacctcg	CRISPR spacer
tggcgctactggtgctactggaccgca	Protospacer
*********.*****.******** *.

30. spacer 7.9|4027216|27|NC_022873|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tggcgctaccggtgccactggacctcg	CRISPR spacer
tggcgctactggtgctactggaccgca	Protospacer
*********.*****.******** *.

31. spacer 7.12|4027333|27|NC_022873|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

tggcgctaccggtgccactggacctcg	CRISPR spacer
cggcgctaccggtgctactggacctac	Protospacer
.**************.*********

32. spacer 7.12|4027333|27|NC_022873|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tggcgctaccggtgccactggacctcg	CRISPR spacer
tggcgctactggtgctactggaccgca	Protospacer
*********.*****.******** *.

33. spacer 7.12|4027333|27|NC_022873|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tggcgctaccggtgccactggacctcg	CRISPR spacer
tggcgctactggtgctactggaccgca	Protospacer
*********.*****.******** *.

34. spacer 7.14|4027414|27|NC_022873|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

tggcgctaccggtgccactggacctcg	CRISPR spacer
cggcgctaccggtgctactggacctac	Protospacer
.**************.*********

35. spacer 7.14|4027414|27|NC_022873|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tggcgctaccggtgccactggacctcg	CRISPR spacer
tggcgctactggtgctactggaccgca	Protospacer
*********.*****.******** *.

36. spacer 7.14|4027414|27|NC_022873|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tggcgctaccggtgccactggacctcg	CRISPR spacer
tggcgctactggtgctactggaccgca	Protospacer
*********.*****.******** *.

37. spacer 2.1|3528831|27|NC_022873|CRISPRCasFinder matches to MN855978 (Bacteriophage sp. isolate 105, complete genome) position: , mismatch: 5, identity: 0.815

taaaacataaacgaatgaattgcaaac	CRISPR spacer
cgaaacaaaaacgactgaattgcaaaa	Protospacer
..***** ****** ***********

38. spacer 7.1|4026892|27|NC_022873|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tggcgctaccggtgccactggacctcg	CRISPR spacer
aggtgctaccggtgctactggacctac	Protospacer
 **.***********.*********

39. spacer 7.1|4026892|27|NC_022873|CRT matches to MH825709 (Mycobacterium phage NicoleTera, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctaccggtgccactggacctcg	CRISPR spacer
aggagctaccggtgccacgggaccgca	Protospacer
 ** ************** ***** *.

40. spacer 7.1|4026892|27|NC_022873|CRT matches to MN204498 (Streptomyces phage Saftant, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctaccggtgccactggacctcg	CRISPR spacer
cggtgctaccggtgccactggtccgca	Protospacer
.**.***************** ** *.

41. spacer 7.3|4026973|27|NC_022873|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tggcgctaccggtgccactggacctcg	CRISPR spacer
aggtgctaccggtgctactggacctac	Protospacer
 **.***********.*********

42. spacer 7.3|4026973|27|NC_022873|CRT matches to MH825709 (Mycobacterium phage NicoleTera, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctaccggtgccactggacctcg	CRISPR spacer
aggagctaccggtgccacgggaccgca	Protospacer
 ** ************** ***** *.

43. spacer 7.3|4026973|27|NC_022873|CRT matches to MN204498 (Streptomyces phage Saftant, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctaccggtgccactggacctcg	CRISPR spacer
cggtgctaccggtgccactggtccgca	Protospacer
.**.***************** ** *.

44. spacer 7.5|4027054|27|NC_022873|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

cggcgctaccggtgccactggacctcg	CRISPR spacer
aggtgctaccggtgctactggacctac	Protospacer
 **.***********.*********

45. spacer 7.5|4027054|27|NC_022873|CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 5, identity: 0.815

cggcgctaccggtgccactggacctcg	CRISPR spacer
cggcgctaccggtgccacgggtctgca	Protospacer
****************** ** *. *.

46. spacer 7.5|4027054|27|NC_022873|CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 5, identity: 0.815

cggcgctaccggtgccactggacctcg	CRISPR spacer
cggcgctaccggtgccacgggtctgca	Protospacer
****************** ** *. *.

47. spacer 7.5|4027054|27|NC_022873|CRT matches to MH825709 (Mycobacterium phage NicoleTera, complete genome) position: , mismatch: 5, identity: 0.815

cggcgctaccggtgccactggacctcg	CRISPR spacer
aggagctaccggtgccacgggaccgca	Protospacer
 ** ************** ***** *.

48. spacer 7.5|4027054|27|NC_022873|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 5, identity: 0.815

cggcgctaccggtgccactggacctcg	CRISPR spacer
tggcgctactggtgctactggaccgca	Protospacer
.********.*****.******** *.

49. spacer 7.5|4027054|27|NC_022873|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 5, identity: 0.815

cggcgctaccggtgccactggacctcg	CRISPR spacer
tggcgctactggtgctactggaccgca	Protospacer
.********.*****.******** *.

50. spacer 7.7|4027135|27|NC_022873|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tggcgctaccggtgccactggacctcg	CRISPR spacer
aggtgctaccggtgctactggacctac	Protospacer
 **.***********.*********

51. spacer 7.7|4027135|27|NC_022873|CRT matches to MH825709 (Mycobacterium phage NicoleTera, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctaccggtgccactggacctcg	CRISPR spacer
aggagctaccggtgccacgggaccgca	Protospacer
 ** ************** ***** *.

52. spacer 7.7|4027135|27|NC_022873|CRT matches to MN204498 (Streptomyces phage Saftant, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctaccggtgccactggacctcg	CRISPR spacer
cggtgctaccggtgccactggtccgca	Protospacer
.**.***************** ** *.

53. spacer 7.9|4027216|27|NC_022873|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tggcgctaccggtgccactggacctcg	CRISPR spacer
aggtgctaccggtgctactggacctac	Protospacer
 **.***********.*********

54. spacer 7.9|4027216|27|NC_022873|CRT matches to MH825709 (Mycobacterium phage NicoleTera, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctaccggtgccactggacctcg	CRISPR spacer
aggagctaccggtgccacgggaccgca	Protospacer
 ** ************** ***** *.

55. spacer 7.9|4027216|27|NC_022873|CRT matches to MN204498 (Streptomyces phage Saftant, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctaccggtgccactggacctcg	CRISPR spacer
cggtgctaccggtgccactggtccgca	Protospacer
.**.***************** ** *.

56. spacer 7.12|4027333|27|NC_022873|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tggcgctaccggtgccactggacctcg	CRISPR spacer
aggtgctaccggtgctactggacctac	Protospacer
 **.***********.*********

57. spacer 7.12|4027333|27|NC_022873|CRT matches to MH825709 (Mycobacterium phage NicoleTera, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctaccggtgccactggacctcg	CRISPR spacer
aggagctaccggtgccacgggaccgca	Protospacer
 ** ************** ***** *.

58. spacer 7.12|4027333|27|NC_022873|CRT matches to MN204498 (Streptomyces phage Saftant, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctaccggtgccactggacctcg	CRISPR spacer
cggtgctaccggtgccactggtccgca	Protospacer
.**.***************** ** *.

59. spacer 7.14|4027414|27|NC_022873|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tggcgctaccggtgccactggacctcg	CRISPR spacer
aggtgctaccggtgctactggacctac	Protospacer
 **.***********.*********

60. spacer 7.14|4027414|27|NC_022873|CRT matches to MH825709 (Mycobacterium phage NicoleTera, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctaccggtgccactggacctcg	CRISPR spacer
aggagctaccggtgccacgggaccgca	Protospacer
 ** ************** ***** *.

61. spacer 7.14|4027414|27|NC_022873|CRT matches to MN204498 (Streptomyces phage Saftant, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctaccggtgccactggacctcg	CRISPR spacer
cggtgctaccggtgccactggtccgca	Protospacer
.**.***************** ** *.

62. spacer 7.15|4027459|27|NC_022873|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctactggacctcagggtgttca	CRISPR spacer
tggtgctactggacctcaaggtgctac	Protospacer
***.**************.****.*

63. spacer 7.18|4027594|27|NC_022873|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

tggtgctaccggacctcaaggtgctca	CRISPR spacer
cggtgctaccggtcctcaaggtgatat	Protospacer
.*********** ********** *

64. spacer 7.18|4027594|27|NC_022873|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

tggtgctaccggacctcaaggtgctca	CRISPR spacer
cggtgctaccggtcctcaaggtgatat	Protospacer
.*********** ********** *

65. spacer 7.18|4027594|27|NC_022873|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

tggtgctaccggacctcaaggtgctca	CRISPR spacer
cggtgctaccggtcctcaaggtgatat	Protospacer
.*********** ********** *

66. spacer 7.18|4027594|27|NC_022873|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 5, identity: 0.815

tggtgctaccggacctcaaggtgctca	CRISPR spacer
tggtgctactggacctcaaggacctac	Protospacer
*********.***********  **

67. spacer 8.1|5518621|27|NC_022873|CRT matches to NZ_KY270853 (Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

68. spacer 8.1|5518621|27|NC_022873|CRT matches to MN175386 (Klebsiella pneumoniae strain KP-13-14 plasmid pKP-13-14-NDM-9, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

69. spacer 8.1|5518621|27|NC_022873|CRT matches to NZ_CP021328 (Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

70. spacer 8.1|5518621|27|NC_022873|CRT matches to NZ_CP022441 (Klebsiella sp. LY plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

71. spacer 8.1|5518621|27|NC_022873|CRT matches to KU318421 (Klebsiella pneumoniae strain KP04 plasmid pKP04VIM, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

72. spacer 8.1|5518621|27|NC_022873|CRT matches to NC_023911 (Raoultella planticola strain KpNDM1 plasmid pKpNDM1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

73. spacer 8.1|5518621|27|NC_022873|CRT matches to NZ_CP025964 (Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

74. spacer 8.1|5518621|27|NC_022873|CRT matches to NZ_CP046614 (Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

75. spacer 8.1|5518621|27|NC_022873|CRT matches to NZ_CP026019 (Klebsiella pneumoniae strain 13190 plasmid p13190-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

76. spacer 8.1|5518621|27|NC_022873|CRT matches to NZ_MF344566 (Klebsiella pneumoniae strain A324 plasmid pA324-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

77. spacer 8.1|5518621|27|NC_022873|CRT matches to NZ_MF344562 (Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

78. spacer 8.1|5518621|27|NC_022873|CRT matches to NZ_MF344563 (Klebsiella pneumoniae strain 13190 plasmid p13190-VIM, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

79. spacer 8.1|5518621|27|NC_022873|CRT matches to MN661402 (Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

80. spacer 8.1|5518621|27|NC_022873|CRT matches to NZ_CP019048 (Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166a, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

81. spacer 8.1|5518621|27|NC_022873|CRT matches to NC_018107 (Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

82. spacer 8.1|5518621|27|NC_022873|CRT matches to NZ_CP026014 (Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

83. spacer 8.1|5518621|27|NC_022873|CRT matches to NZ_MF344565 (Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

84. spacer 8.1|5518621|27|NC_022873|CRT matches to NZ_MF344564 (Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

85. spacer 8.2|5518666|27|NC_022873|CRT matches to NZ_CP019048 (Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166a, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

86. spacer 8.2|5518666|27|NC_022873|CRT matches to NC_018107 (Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

87. spacer 8.2|5518666|27|NC_022873|CRT matches to NZ_CP026014 (Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

88. spacer 8.2|5518666|27|NC_022873|CRT matches to NZ_MF344565 (Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

89. spacer 8.2|5518666|27|NC_022873|CRT matches to NZ_MF344564 (Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

90. spacer 8.2|5518666|27|NC_022873|CRT matches to NZ_KY270853 (Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

91. spacer 8.2|5518666|27|NC_022873|CRT matches to MN175386 (Klebsiella pneumoniae strain KP-13-14 plasmid pKP-13-14-NDM-9, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

92. spacer 8.2|5518666|27|NC_022873|CRT matches to NZ_CP021328 (Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

93. spacer 8.2|5518666|27|NC_022873|CRT matches to NZ_CP022441 (Klebsiella sp. LY plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

94. spacer 8.2|5518666|27|NC_022873|CRT matches to KU318421 (Klebsiella pneumoniae strain KP04 plasmid pKP04VIM, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

95. spacer 8.2|5518666|27|NC_022873|CRT matches to NC_023911 (Raoultella planticola strain KpNDM1 plasmid pKpNDM1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

96. spacer 8.2|5518666|27|NC_022873|CRT matches to NZ_CP025964 (Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

97. spacer 8.2|5518666|27|NC_022873|CRT matches to NZ_CP046614 (Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

98. spacer 8.2|5518666|27|NC_022873|CRT matches to NZ_CP026019 (Klebsiella pneumoniae strain 13190 plasmid p13190-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

99. spacer 8.2|5518666|27|NC_022873|CRT matches to NZ_MF344566 (Klebsiella pneumoniae strain A324 plasmid pA324-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

100. spacer 8.2|5518666|27|NC_022873|CRT matches to NZ_MF344562 (Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

101. spacer 8.2|5518666|27|NC_022873|CRT matches to NZ_MF344563 (Klebsiella pneumoniae strain 13190 plasmid p13190-VIM, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

102. spacer 8.2|5518666|27|NC_022873|CRT matches to MN661402 (Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

103. spacer 8.3|5518711|27|NC_022873|CRT matches to NZ_KY270853 (Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

104. spacer 8.3|5518711|27|NC_022873|CRT matches to MN175386 (Klebsiella pneumoniae strain KP-13-14 plasmid pKP-13-14-NDM-9, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

105. spacer 8.3|5518711|27|NC_022873|CRT matches to NZ_CP021328 (Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

106. spacer 8.3|5518711|27|NC_022873|CRT matches to NZ_CP019048 (Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166a, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

107. spacer 8.3|5518711|27|NC_022873|CRT matches to NC_018107 (Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

108. spacer 8.3|5518711|27|NC_022873|CRT matches to NZ_CP022441 (Klebsiella sp. LY plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

109. spacer 8.3|5518711|27|NC_022873|CRT matches to KU318421 (Klebsiella pneumoniae strain KP04 plasmid pKP04VIM, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

110. spacer 8.3|5518711|27|NC_022873|CRT matches to NC_023911 (Raoultella planticola strain KpNDM1 plasmid pKpNDM1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

111. spacer 8.3|5518711|27|NC_022873|CRT matches to NZ_CP025964 (Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

112. spacer 8.3|5518711|27|NC_022873|CRT matches to NZ_CP046614 (Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

113. spacer 8.3|5518711|27|NC_022873|CRT matches to NZ_CP026014 (Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

114. spacer 8.3|5518711|27|NC_022873|CRT matches to NZ_CP026019 (Klebsiella pneumoniae strain 13190 plasmid p13190-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

115. spacer 8.3|5518711|27|NC_022873|CRT matches to NZ_MF344566 (Klebsiella pneumoniae strain A324 plasmid pA324-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

116. spacer 8.3|5518711|27|NC_022873|CRT matches to NZ_MF344565 (Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

117. spacer 8.3|5518711|27|NC_022873|CRT matches to NZ_MF344562 (Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

118. spacer 8.3|5518711|27|NC_022873|CRT matches to NZ_MF344563 (Klebsiella pneumoniae strain 13190 plasmid p13190-VIM, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

119. spacer 8.3|5518711|27|NC_022873|CRT matches to NZ_MF344564 (Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

120. spacer 8.3|5518711|27|NC_022873|CRT matches to MN661402 (Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

121. spacer 8.4|5518756|27|NC_022873|CRT matches to NZ_KY270853 (Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

122. spacer 8.4|5518756|27|NC_022873|CRT matches to MN175386 (Klebsiella pneumoniae strain KP-13-14 plasmid pKP-13-14-NDM-9, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

123. spacer 8.4|5518756|27|NC_022873|CRT matches to NZ_CP021328 (Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

124. spacer 8.4|5518756|27|NC_022873|CRT matches to NZ_CP019048 (Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166a, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

125. spacer 8.4|5518756|27|NC_022873|CRT matches to NC_018107 (Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

126. spacer 8.4|5518756|27|NC_022873|CRT matches to NZ_CP022441 (Klebsiella sp. LY plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

127. spacer 8.4|5518756|27|NC_022873|CRT matches to KU318421 (Klebsiella pneumoniae strain KP04 plasmid pKP04VIM, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

128. spacer 8.4|5518756|27|NC_022873|CRT matches to NC_023911 (Raoultella planticola strain KpNDM1 plasmid pKpNDM1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

129. spacer 8.4|5518756|27|NC_022873|CRT matches to NZ_CP025964 (Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

130. spacer 8.4|5518756|27|NC_022873|CRT matches to NZ_CP046614 (Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

131. spacer 8.4|5518756|27|NC_022873|CRT matches to NZ_CP026014 (Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

132. spacer 8.4|5518756|27|NC_022873|CRT matches to NZ_CP026019 (Klebsiella pneumoniae strain 13190 plasmid p13190-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

133. spacer 8.4|5518756|27|NC_022873|CRT matches to NZ_MF344566 (Klebsiella pneumoniae strain A324 plasmid pA324-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

134. spacer 8.4|5518756|27|NC_022873|CRT matches to NZ_MF344565 (Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

135. spacer 8.4|5518756|27|NC_022873|CRT matches to NZ_MF344562 (Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

136. spacer 8.4|5518756|27|NC_022873|CRT matches to NZ_MF344563 (Klebsiella pneumoniae strain 13190 plasmid p13190-VIM, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

137. spacer 8.4|5518756|27|NC_022873|CRT matches to NZ_MF344564 (Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

138. spacer 8.4|5518756|27|NC_022873|CRT matches to MN661402 (Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

139. spacer 8.5|5518801|27|NC_022873|CRT matches to NZ_CP019048 (Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166a, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

140. spacer 8.5|5518801|27|NC_022873|CRT matches to NC_018107 (Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

141. spacer 8.5|5518801|27|NC_022873|CRT matches to NZ_CP026014 (Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

142. spacer 8.5|5518801|27|NC_022873|CRT matches to NZ_MF344565 (Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

143. spacer 8.5|5518801|27|NC_022873|CRT matches to NZ_MF344564 (Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

144. spacer 8.5|5518801|27|NC_022873|CRT matches to NZ_KY270853 (Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

145. spacer 8.5|5518801|27|NC_022873|CRT matches to MN175386 (Klebsiella pneumoniae strain KP-13-14 plasmid pKP-13-14-NDM-9, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

146. spacer 8.5|5518801|27|NC_022873|CRT matches to NZ_CP021328 (Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

147. spacer 8.5|5518801|27|NC_022873|CRT matches to NZ_CP022441 (Klebsiella sp. LY plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

148. spacer 8.5|5518801|27|NC_022873|CRT matches to KU318421 (Klebsiella pneumoniae strain KP04 plasmid pKP04VIM, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

149. spacer 8.5|5518801|27|NC_022873|CRT matches to NC_023911 (Raoultella planticola strain KpNDM1 plasmid pKpNDM1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

150. spacer 8.5|5518801|27|NC_022873|CRT matches to NZ_CP025964 (Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

151. spacer 8.5|5518801|27|NC_022873|CRT matches to NZ_CP046614 (Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

152. spacer 8.5|5518801|27|NC_022873|CRT matches to NZ_CP026019 (Klebsiella pneumoniae strain 13190 plasmid p13190-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

153. spacer 8.5|5518801|27|NC_022873|CRT matches to NZ_MF344566 (Klebsiella pneumoniae strain A324 plasmid pA324-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

154. spacer 8.5|5518801|27|NC_022873|CRT matches to NZ_MF344562 (Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

155. spacer 8.5|5518801|27|NC_022873|CRT matches to NZ_MF344563 (Klebsiella pneumoniae strain 13190 plasmid p13190-VIM, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

156. spacer 8.5|5518801|27|NC_022873|CRT matches to MN661402 (Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

157. spacer 8.6|5518846|27|NC_022873|CRT matches to NZ_CP019048 (Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166a, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

158. spacer 8.6|5518846|27|NC_022873|CRT matches to NC_018107 (Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

159. spacer 8.6|5518846|27|NC_022873|CRT matches to NZ_CP026014 (Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

160. spacer 8.6|5518846|27|NC_022873|CRT matches to NZ_MF344565 (Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

161. spacer 8.6|5518846|27|NC_022873|CRT matches to NZ_MF344564 (Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

162. spacer 8.6|5518846|27|NC_022873|CRT matches to NZ_KY270853 (Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

163. spacer 8.6|5518846|27|NC_022873|CRT matches to MN175386 (Klebsiella pneumoniae strain KP-13-14 plasmid pKP-13-14-NDM-9, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

164. spacer 8.6|5518846|27|NC_022873|CRT matches to NZ_CP021328 (Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

165. spacer 8.6|5518846|27|NC_022873|CRT matches to NZ_CP022441 (Klebsiella sp. LY plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

166. spacer 8.6|5518846|27|NC_022873|CRT matches to KU318421 (Klebsiella pneumoniae strain KP04 plasmid pKP04VIM, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

167. spacer 8.6|5518846|27|NC_022873|CRT matches to NC_023911 (Raoultella planticola strain KpNDM1 plasmid pKpNDM1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

168. spacer 8.6|5518846|27|NC_022873|CRT matches to NZ_CP025964 (Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

169. spacer 8.6|5518846|27|NC_022873|CRT matches to NZ_CP046614 (Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

170. spacer 8.6|5518846|27|NC_022873|CRT matches to NZ_CP026019 (Klebsiella pneumoniae strain 13190 plasmid p13190-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

171. spacer 8.6|5518846|27|NC_022873|CRT matches to NZ_MF344566 (Klebsiella pneumoniae strain A324 plasmid pA324-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

172. spacer 8.6|5518846|27|NC_022873|CRT matches to NZ_MF344562 (Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

173. spacer 8.6|5518846|27|NC_022873|CRT matches to NZ_MF344563 (Klebsiella pneumoniae strain 13190 plasmid p13190-VIM, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

174. spacer 8.6|5518846|27|NC_022873|CRT matches to MN661402 (Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

175. spacer 8.7|5518891|27|NC_022873|CRT matches to NZ_KY270853 (Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

176. spacer 8.7|5518891|27|NC_022873|CRT matches to MN175386 (Klebsiella pneumoniae strain KP-13-14 plasmid pKP-13-14-NDM-9, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

177. spacer 8.7|5518891|27|NC_022873|CRT matches to NZ_CP021328 (Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

178. spacer 8.7|5518891|27|NC_022873|CRT matches to NZ_CP019048 (Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166a, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

179. spacer 8.7|5518891|27|NC_022873|CRT matches to NC_018107 (Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

180. spacer 8.7|5518891|27|NC_022873|CRT matches to NZ_CP022441 (Klebsiella sp. LY plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

181. spacer 8.7|5518891|27|NC_022873|CRT matches to KU318421 (Klebsiella pneumoniae strain KP04 plasmid pKP04VIM, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

182. spacer 8.7|5518891|27|NC_022873|CRT matches to NC_023911 (Raoultella planticola strain KpNDM1 plasmid pKpNDM1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

183. spacer 8.7|5518891|27|NC_022873|CRT matches to NZ_CP025964 (Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

184. spacer 8.7|5518891|27|NC_022873|CRT matches to NZ_CP046614 (Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

185. spacer 8.7|5518891|27|NC_022873|CRT matches to NZ_CP026014 (Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

186. spacer 8.7|5518891|27|NC_022873|CRT matches to NZ_CP026019 (Klebsiella pneumoniae strain 13190 plasmid p13190-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

187. spacer 8.7|5518891|27|NC_022873|CRT matches to NZ_MF344566 (Klebsiella pneumoniae strain A324 plasmid pA324-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

188. spacer 8.7|5518891|27|NC_022873|CRT matches to NZ_MF344565 (Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

189. spacer 8.7|5518891|27|NC_022873|CRT matches to NZ_MF344562 (Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

190. spacer 8.7|5518891|27|NC_022873|CRT matches to NZ_MF344563 (Klebsiella pneumoniae strain 13190 plasmid p13190-VIM, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

191. spacer 8.7|5518891|27|NC_022873|CRT matches to NZ_MF344564 (Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

192. spacer 8.7|5518891|27|NC_022873|CRT matches to MN661402 (Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

193. spacer 8.8|5518936|27|NC_022873|CRT matches to NZ_CP019048 (Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166a, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

194. spacer 8.8|5518936|27|NC_022873|CRT matches to NC_018107 (Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

195. spacer 8.8|5518936|27|NC_022873|CRT matches to NZ_CP026014 (Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

196. spacer 8.8|5518936|27|NC_022873|CRT matches to NZ_MF344565 (Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

197. spacer 8.8|5518936|27|NC_022873|CRT matches to NZ_MF344564 (Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

198. spacer 8.8|5518936|27|NC_022873|CRT matches to NZ_KY270853 (Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

199. spacer 8.8|5518936|27|NC_022873|CRT matches to MN175386 (Klebsiella pneumoniae strain KP-13-14 plasmid pKP-13-14-NDM-9, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

200. spacer 8.8|5518936|27|NC_022873|CRT matches to NZ_CP021328 (Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

201. spacer 8.8|5518936|27|NC_022873|CRT matches to NZ_CP022441 (Klebsiella sp. LY plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

202. spacer 8.8|5518936|27|NC_022873|CRT matches to KU318421 (Klebsiella pneumoniae strain KP04 plasmid pKP04VIM, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

203. spacer 8.8|5518936|27|NC_022873|CRT matches to NC_023911 (Raoultella planticola strain KpNDM1 plasmid pKpNDM1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

204. spacer 8.8|5518936|27|NC_022873|CRT matches to NZ_CP025964 (Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

205. spacer 8.8|5518936|27|NC_022873|CRT matches to NZ_CP046614 (Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

206. spacer 8.8|5518936|27|NC_022873|CRT matches to NZ_CP026019 (Klebsiella pneumoniae strain 13190 plasmid p13190-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

207. spacer 8.8|5518936|27|NC_022873|CRT matches to NZ_MF344566 (Klebsiella pneumoniae strain A324 plasmid pA324-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

208. spacer 8.8|5518936|27|NC_022873|CRT matches to NZ_MF344562 (Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

209. spacer 8.8|5518936|27|NC_022873|CRT matches to NZ_MF344563 (Klebsiella pneumoniae strain 13190 plasmid p13190-VIM, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

210. spacer 8.8|5518936|27|NC_022873|CRT matches to MN661402 (Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

211. spacer 8.9|5518981|27|NC_022873|CRT matches to NZ_KY270853 (Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

212. spacer 8.9|5518981|27|NC_022873|CRT matches to MN175386 (Klebsiella pneumoniae strain KP-13-14 plasmid pKP-13-14-NDM-9, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

213. spacer 8.9|5518981|27|NC_022873|CRT matches to NZ_CP021328 (Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

214. spacer 8.9|5518981|27|NC_022873|CRT matches to NZ_CP022441 (Klebsiella sp. LY plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

215. spacer 8.9|5518981|27|NC_022873|CRT matches to KU318421 (Klebsiella pneumoniae strain KP04 plasmid pKP04VIM, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

216. spacer 8.9|5518981|27|NC_022873|CRT matches to NC_023911 (Raoultella planticola strain KpNDM1 plasmid pKpNDM1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

217. spacer 8.9|5518981|27|NC_022873|CRT matches to NZ_CP025964 (Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

218. spacer 8.9|5518981|27|NC_022873|CRT matches to NZ_CP046614 (Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

219. spacer 8.9|5518981|27|NC_022873|CRT matches to NZ_CP026019 (Klebsiella pneumoniae strain 13190 plasmid p13190-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

220. spacer 8.9|5518981|27|NC_022873|CRT matches to NZ_MF344566 (Klebsiella pneumoniae strain A324 plasmid pA324-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

221. spacer 8.9|5518981|27|NC_022873|CRT matches to NZ_MF344562 (Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

222. spacer 8.9|5518981|27|NC_022873|CRT matches to NZ_MF344563 (Klebsiella pneumoniae strain 13190 plasmid p13190-VIM, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

223. spacer 8.9|5518981|27|NC_022873|CRT matches to MN661402 (Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

224. spacer 8.9|5518981|27|NC_022873|CRT matches to NZ_CP019048 (Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166a, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

225. spacer 8.9|5518981|27|NC_022873|CRT matches to NC_018107 (Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

226. spacer 8.9|5518981|27|NC_022873|CRT matches to NZ_CP026014 (Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

227. spacer 8.9|5518981|27|NC_022873|CRT matches to NZ_MF344565 (Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

228. spacer 8.9|5518981|27|NC_022873|CRT matches to NZ_MF344564 (Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

229. spacer 8.10|5519026|27|NC_022873|CRT matches to NZ_CP019048 (Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166a, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

230. spacer 8.10|5519026|27|NC_022873|CRT matches to NC_018107 (Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

231. spacer 8.10|5519026|27|NC_022873|CRT matches to NZ_CP026014 (Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

232. spacer 8.10|5519026|27|NC_022873|CRT matches to NZ_MF344565 (Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

233. spacer 8.10|5519026|27|NC_022873|CRT matches to NZ_MF344564 (Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

234. spacer 8.10|5519026|27|NC_022873|CRT matches to NZ_KY270853 (Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

235. spacer 8.10|5519026|27|NC_022873|CRT matches to MN175386 (Klebsiella pneumoniae strain KP-13-14 plasmid pKP-13-14-NDM-9, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

236. spacer 8.10|5519026|27|NC_022873|CRT matches to NZ_CP021328 (Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

237. spacer 8.10|5519026|27|NC_022873|CRT matches to NZ_CP022441 (Klebsiella sp. LY plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

238. spacer 8.10|5519026|27|NC_022873|CRT matches to KU318421 (Klebsiella pneumoniae strain KP04 plasmid pKP04VIM, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

239. spacer 8.10|5519026|27|NC_022873|CRT matches to NC_023911 (Raoultella planticola strain KpNDM1 plasmid pKpNDM1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

240. spacer 8.10|5519026|27|NC_022873|CRT matches to NZ_CP025964 (Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

241. spacer 8.10|5519026|27|NC_022873|CRT matches to NZ_CP046614 (Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

242. spacer 8.10|5519026|27|NC_022873|CRT matches to NZ_CP026019 (Klebsiella pneumoniae strain 13190 plasmid p13190-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

243. spacer 8.10|5519026|27|NC_022873|CRT matches to NZ_MF344566 (Klebsiella pneumoniae strain A324 plasmid pA324-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

244. spacer 8.10|5519026|27|NC_022873|CRT matches to NZ_MF344562 (Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

245. spacer 8.10|5519026|27|NC_022873|CRT matches to NZ_MF344563 (Klebsiella pneumoniae strain 13190 plasmid p13190-VIM, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

246. spacer 8.10|5519026|27|NC_022873|CRT matches to MN661402 (Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

247. spacer 8.11|5519071|27|NC_022873|CRT matches to NZ_CP019048 (Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166a, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

248. spacer 8.11|5519071|27|NC_022873|CRT matches to NC_018107 (Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

249. spacer 8.11|5519071|27|NC_022873|CRT matches to NZ_CP026014 (Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

250. spacer 8.11|5519071|27|NC_022873|CRT matches to NZ_MF344565 (Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

251. spacer 8.11|5519071|27|NC_022873|CRT matches to NZ_MF344564 (Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

252. spacer 8.11|5519071|27|NC_022873|CRT matches to NZ_KY270853 (Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

253. spacer 8.11|5519071|27|NC_022873|CRT matches to MN175386 (Klebsiella pneumoniae strain KP-13-14 plasmid pKP-13-14-NDM-9, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

254. spacer 8.11|5519071|27|NC_022873|CRT matches to NZ_CP021328 (Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

255. spacer 8.11|5519071|27|NC_022873|CRT matches to NZ_CP022441 (Klebsiella sp. LY plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

256. spacer 8.11|5519071|27|NC_022873|CRT matches to KU318421 (Klebsiella pneumoniae strain KP04 plasmid pKP04VIM, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

257. spacer 8.11|5519071|27|NC_022873|CRT matches to NC_023911 (Raoultella planticola strain KpNDM1 plasmid pKpNDM1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

258. spacer 8.11|5519071|27|NC_022873|CRT matches to NZ_CP025964 (Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

259. spacer 8.11|5519071|27|NC_022873|CRT matches to NZ_CP046614 (Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

260. spacer 8.11|5519071|27|NC_022873|CRT matches to NZ_CP026019 (Klebsiella pneumoniae strain 13190 plasmid p13190-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

261. spacer 8.11|5519071|27|NC_022873|CRT matches to NZ_MF344566 (Klebsiella pneumoniae strain A324 plasmid pA324-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

262. spacer 8.11|5519071|27|NC_022873|CRT matches to NZ_MF344562 (Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

263. spacer 8.11|5519071|27|NC_022873|CRT matches to NZ_MF344563 (Klebsiella pneumoniae strain 13190 plasmid p13190-VIM, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

264. spacer 8.11|5519071|27|NC_022873|CRT matches to MN661402 (Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

265. spacer 8.12|5519116|27|NC_022873|CRT matches to NZ_CP019048 (Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166a, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

266. spacer 8.12|5519116|27|NC_022873|CRT matches to NC_018107 (Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

267. spacer 8.12|5519116|27|NC_022873|CRT matches to NZ_CP026014 (Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

268. spacer 8.12|5519116|27|NC_022873|CRT matches to NZ_MF344565 (Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

269. spacer 8.12|5519116|27|NC_022873|CRT matches to NZ_MF344564 (Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

270. spacer 8.12|5519116|27|NC_022873|CRT matches to NZ_KY270853 (Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

271. spacer 8.12|5519116|27|NC_022873|CRT matches to MN175386 (Klebsiella pneumoniae strain KP-13-14 plasmid pKP-13-14-NDM-9, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

272. spacer 8.12|5519116|27|NC_022873|CRT matches to NZ_CP021328 (Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

273. spacer 8.12|5519116|27|NC_022873|CRT matches to NZ_CP022441 (Klebsiella sp. LY plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

274. spacer 8.12|5519116|27|NC_022873|CRT matches to KU318421 (Klebsiella pneumoniae strain KP04 plasmid pKP04VIM, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

275. spacer 8.12|5519116|27|NC_022873|CRT matches to NC_023911 (Raoultella planticola strain KpNDM1 plasmid pKpNDM1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

276. spacer 8.12|5519116|27|NC_022873|CRT matches to NZ_CP025964 (Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

277. spacer 8.12|5519116|27|NC_022873|CRT matches to NZ_CP046614 (Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

278. spacer 8.12|5519116|27|NC_022873|CRT matches to NZ_CP026019 (Klebsiella pneumoniae strain 13190 plasmid p13190-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

279. spacer 8.12|5519116|27|NC_022873|CRT matches to NZ_MF344566 (Klebsiella pneumoniae strain A324 plasmid pA324-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

280. spacer 8.12|5519116|27|NC_022873|CRT matches to NZ_MF344562 (Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

281. spacer 8.12|5519116|27|NC_022873|CRT matches to NZ_MF344563 (Klebsiella pneumoniae strain 13190 plasmid p13190-VIM, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

282. spacer 8.12|5519116|27|NC_022873|CRT matches to MN661402 (Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gaccc	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

283. spacer 8.13|5519161|27|NC_022873|CRT matches to NZ_KY270853 (Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

284. spacer 8.13|5519161|27|NC_022873|CRT matches to MN175386 (Klebsiella pneumoniae strain KP-13-14 plasmid pKP-13-14-NDM-9, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

285. spacer 8.13|5519161|27|NC_022873|CRT matches to NZ_CP021328 (Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

286. spacer 8.13|5519161|27|NC_022873|CRT matches to NZ_CP019048 (Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166a, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

287. spacer 8.13|5519161|27|NC_022873|CRT matches to NC_018107 (Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

288. spacer 8.13|5519161|27|NC_022873|CRT matches to NZ_CP022441 (Klebsiella sp. LY plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

289. spacer 8.13|5519161|27|NC_022873|CRT matches to KU318421 (Klebsiella pneumoniae strain KP04 plasmid pKP04VIM, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

290. spacer 8.13|5519161|27|NC_022873|CRT matches to NC_023911 (Raoultella planticola strain KpNDM1 plasmid pKpNDM1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

291. spacer 8.13|5519161|27|NC_022873|CRT matches to NZ_CP025964 (Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

292. spacer 8.13|5519161|27|NC_022873|CRT matches to NZ_CP046614 (Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

293. spacer 8.13|5519161|27|NC_022873|CRT matches to NZ_CP026014 (Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

294. spacer 8.13|5519161|27|NC_022873|CRT matches to NZ_CP026019 (Klebsiella pneumoniae strain 13190 plasmid p13190-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

295. spacer 8.13|5519161|27|NC_022873|CRT matches to NZ_MF344566 (Klebsiella pneumoniae strain A324 plasmid pA324-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

296. spacer 8.13|5519161|27|NC_022873|CRT matches to NZ_MF344565 (Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

297. spacer 8.13|5519161|27|NC_022873|CRT matches to NZ_MF344562 (Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

298. spacer 8.13|5519161|27|NC_022873|CRT matches to NZ_MF344563 (Klebsiella pneumoniae strain 13190 plasmid p13190-VIM, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

299. spacer 8.13|5519161|27|NC_022873|CRT matches to NZ_MF344564 (Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

300. spacer 8.13|5519161|27|NC_022873|CRT matches to MN661402 (Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgcccctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

301. spacer 8.15|5519242|27|NC_022873|CRT matches to NZ_KY270853 (Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

302. spacer 8.15|5519242|27|NC_022873|CRT matches to MN175386 (Klebsiella pneumoniae strain KP-13-14 plasmid pKP-13-14-NDM-9, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

303. spacer 8.15|5519242|27|NC_022873|CRT matches to NZ_CP021328 (Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

304. spacer 8.15|5519242|27|NC_022873|CRT matches to NZ_CP022441 (Klebsiella sp. LY plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

305. spacer 8.15|5519242|27|NC_022873|CRT matches to KU318421 (Klebsiella pneumoniae strain KP04 plasmid pKP04VIM, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

306. spacer 8.15|5519242|27|NC_022873|CRT matches to NC_023911 (Raoultella planticola strain KpNDM1 plasmid pKpNDM1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

307. spacer 8.15|5519242|27|NC_022873|CRT matches to NZ_CP025964 (Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

308. spacer 8.15|5519242|27|NC_022873|CRT matches to NZ_CP046614 (Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

309. spacer 8.15|5519242|27|NC_022873|CRT matches to NZ_CP026019 (Klebsiella pneumoniae strain 13190 plasmid p13190-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

310. spacer 8.15|5519242|27|NC_022873|CRT matches to NZ_MF344566 (Klebsiella pneumoniae strain A324 plasmid pA324-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

311. spacer 8.15|5519242|27|NC_022873|CRT matches to NZ_MF344562 (Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

312. spacer 8.15|5519242|27|NC_022873|CRT matches to NZ_MF344563 (Klebsiella pneumoniae strain 13190 plasmid p13190-VIM, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

313. spacer 8.15|5519242|27|NC_022873|CRT matches to MN661402 (Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

314. spacer 8.15|5519242|27|NC_022873|CRT matches to NZ_CP019048 (Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166a, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

315. spacer 8.15|5519242|27|NC_022873|CRT matches to NC_018107 (Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

316. spacer 8.15|5519242|27|NC_022873|CRT matches to NZ_CP026014 (Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

317. spacer 8.15|5519242|27|NC_022873|CRT matches to NZ_MF344565 (Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

318. spacer 8.15|5519242|27|NC_022873|CRT matches to NZ_MF344564 (Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence) position: , mismatch: 5, identity: 0.815

gcagttccggtcgctcctgttg---gacct	CRISPR spacer
tcagttccggtcgcgcctgttgtcaga---	Protospacer
 ************* *******   **

319. spacer 7.1|4026892|27|NC_022873|CRT matches to MT701598 (Streptomyces phage Sitrop, complete genome) position: , mismatch: 6, identity: 0.778

tggcgctaccggtgccactggacctcg	CRISPR spacer
gggcgctaccggtgcgactggtcccac	Protospacer
 ************** ***** **.

320. spacer 7.1|4026892|27|NC_022873|CRT matches to MT066160 (Vibrio phage Saratov-12, complete genome) position: , mismatch: 6, identity: 0.778

tggcgctaccggtgccactggacctcg	CRISPR spacer
aggccctaccggtgctactggaccagt	Protospacer
 *** **********.********

321. spacer 7.1|4026892|27|NC_022873|CRT matches to MT767883 (Vibrio phage Saratov-15, complete genome) position: , mismatch: 6, identity: 0.778

tggcgctaccggtgccactggacctcg	CRISPR spacer
aggccctaccggtgctactggaccagt	Protospacer
 *** **********.********

322. spacer 7.3|4026973|27|NC_022873|CRT matches to MT701598 (Streptomyces phage Sitrop, complete genome) position: , mismatch: 6, identity: 0.778

tggcgctaccggtgccactggacctcg	CRISPR spacer
gggcgctaccggtgcgactggtcccac	Protospacer
 ************** ***** **.

323. spacer 7.3|4026973|27|NC_022873|CRT matches to MT066160 (Vibrio phage Saratov-12, complete genome) position: , mismatch: 6, identity: 0.778

tggcgctaccggtgccactggacctcg	CRISPR spacer
aggccctaccggtgctactggaccagt	Protospacer
 *** **********.********

324. spacer 7.3|4026973|27|NC_022873|CRT matches to MT767883 (Vibrio phage Saratov-15, complete genome) position: , mismatch: 6, identity: 0.778

tggcgctaccggtgccactggacctcg	CRISPR spacer
aggccctaccggtgctactggaccagt	Protospacer
 *** **********.********

325. spacer 7.5|4027054|27|NC_022873|CRT matches to MT701598 (Streptomyces phage Sitrop, complete genome) position: , mismatch: 6, identity: 0.778

cggcgctaccggtgccactggacctcg	CRISPR spacer
gggcgctaccggtgcgactggtcccac	Protospacer
 ************** ***** **.

326. spacer 7.5|4027054|27|NC_022873|CRT matches to MT066160 (Vibrio phage Saratov-12, complete genome) position: , mismatch: 6, identity: 0.778

cggcgctaccggtgccactggacctcg	CRISPR spacer
aggccctaccggtgctactggaccagt	Protospacer
 *** **********.********

327. spacer 7.5|4027054|27|NC_022873|CRT matches to MT767883 (Vibrio phage Saratov-15, complete genome) position: , mismatch: 6, identity: 0.778

cggcgctaccggtgccactggacctcg	CRISPR spacer
aggccctaccggtgctactggaccagt	Protospacer
 *** **********.********

328. spacer 7.7|4027135|27|NC_022873|CRT matches to MT701598 (Streptomyces phage Sitrop, complete genome) position: , mismatch: 6, identity: 0.778

tggcgctaccggtgccactggacctcg	CRISPR spacer
gggcgctaccggtgcgactggtcccac	Protospacer
 ************** ***** **.

329. spacer 7.7|4027135|27|NC_022873|CRT matches to MT066160 (Vibrio phage Saratov-12, complete genome) position: , mismatch: 6, identity: 0.778

tggcgctaccggtgccactggacctcg	CRISPR spacer
aggccctaccggtgctactggaccagt	Protospacer
 *** **********.********

330. spacer 7.7|4027135|27|NC_022873|CRT matches to MT767883 (Vibrio phage Saratov-15, complete genome) position: , mismatch: 6, identity: 0.778

tggcgctaccggtgccactggacctcg	CRISPR spacer
aggccctaccggtgctactggaccagt	Protospacer
 *** **********.********

331. spacer 7.9|4027216|27|NC_022873|CRT matches to MT701598 (Streptomyces phage Sitrop, complete genome) position: , mismatch: 6, identity: 0.778

tggcgctaccggtgccactggacctcg	CRISPR spacer
gggcgctaccggtgcgactggtcccac	Protospacer
 ************** ***** **.

332. spacer 7.9|4027216|27|NC_022873|CRT matches to MT066160 (Vibrio phage Saratov-12, complete genome) position: , mismatch: 6, identity: 0.778

tggcgctaccggtgccactggacctcg	CRISPR spacer
aggccctaccggtgctactggaccagt	Protospacer
 *** **********.********

333. spacer 7.9|4027216|27|NC_022873|CRT matches to MT767883 (Vibrio phage Saratov-15, complete genome) position: , mismatch: 6, identity: 0.778

tggcgctaccggtgccactggacctcg	CRISPR spacer
aggccctaccggtgctactggaccagt	Protospacer
 *** **********.********

334. spacer 7.12|4027333|27|NC_022873|CRT matches to MT701598 (Streptomyces phage Sitrop, complete genome) position: , mismatch: 6, identity: 0.778

tggcgctaccggtgccactggacctcg	CRISPR spacer
gggcgctaccggtgcgactggtcccac	Protospacer
 ************** ***** **.

335. spacer 7.12|4027333|27|NC_022873|CRT matches to MT066160 (Vibrio phage Saratov-12, complete genome) position: , mismatch: 6, identity: 0.778

tggcgctaccggtgccactggacctcg	CRISPR spacer
aggccctaccggtgctactggaccagt	Protospacer
 *** **********.********

336. spacer 7.12|4027333|27|NC_022873|CRT matches to MT767883 (Vibrio phage Saratov-15, complete genome) position: , mismatch: 6, identity: 0.778

tggcgctaccggtgccactggacctcg	CRISPR spacer
aggccctaccggtgctactggaccagt	Protospacer
 *** **********.********

337. spacer 7.14|4027414|27|NC_022873|CRT matches to MT701598 (Streptomyces phage Sitrop, complete genome) position: , mismatch: 6, identity: 0.778

tggcgctaccggtgccactggacctcg	CRISPR spacer
gggcgctaccggtgcgactggtcccac	Protospacer
 ************** ***** **.

338. spacer 7.14|4027414|27|NC_022873|CRT matches to MT066160 (Vibrio phage Saratov-12, complete genome) position: , mismatch: 6, identity: 0.778

tggcgctaccggtgccactggacctcg	CRISPR spacer
aggccctaccggtgctactggaccagt	Protospacer
 *** **********.********

339. spacer 7.14|4027414|27|NC_022873|CRT matches to MT767883 (Vibrio phage Saratov-15, complete genome) position: , mismatch: 6, identity: 0.778

tggcgctaccggtgccactggacctcg	CRISPR spacer
aggccctaccggtgctactggaccagt	Protospacer
 *** **********.********

340. spacer 7.18|4027594|27|NC_022873|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 6, identity: 0.778

tggtgctaccggacctcaaggtgctca	CRISPR spacer
tggtgctactggtcctcaaggtgagtt	Protospacer
*********.** **********  .

341. spacer 7.18|4027594|27|NC_022873|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 6, identity: 0.778

tggtgctaccggacctcaaggtgctca	CRISPR spacer
tggtgctactggtcctcaaggtgagtt	Protospacer
*********.** **********  .

342. spacer 7.18|4027594|27|NC_022873|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 6, identity: 0.778

tggtgctaccggacctcaaggtgctca	CRISPR spacer
tggtgctactggtcctcaaggtgagtt	Protospacer
*********.** **********  .

343. spacer 7.18|4027594|27|NC_022873|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 6, identity: 0.778

tggtgctaccggacctcaaggtgctca	CRISPR spacer
aggtgctactggacctcaaggtccagc	Protospacer
 ********.************ *

344. spacer 7.18|4027594|27|NC_022873|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

tggtgctaccggacctcaaggtgctca	CRISPR spacer
tggtgctactggacctcaaggaccagc	Protospacer
*********.***********  *

345. spacer 7.18|4027594|27|NC_022873|CRT matches to NZ_CP025547 (Mycobacterium paragordonae strain 49061 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

tggtgctaccggacctcaaggtgctca	CRISPR spacer
ccacgctacccgacctcagggtgctca	Protospacer
. ..****** *******.********

346. spacer 7.18|4027594|27|NC_022873|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 6, identity: 0.778

tggtgctaccggacctcaaggtgctca	CRISPR spacer
tggtgctactggacctcaaggaccagc	Protospacer
*********.***********  *

347. spacer 8.1|5518621|27|NC_022873|CRT matches to MN150686 (Bacillus phage BC-T25, complete genome) position: , mismatch: 6, identity: 0.778

gcagttccggtcgctcctgttggacct	CRISPR spacer
ttagttcctgtcgctcctgttgggcac	Protospacer
 .****** **************.* .

348. spacer 8.9|5518981|27|NC_022873|CRT matches to MN150686 (Bacillus phage BC-T25, complete genome) position: , mismatch: 6, identity: 0.778

gcagttccggtcgctcctgttggacct	CRISPR spacer
ttagttcctgtcgctcctgttgggcac	Protospacer
 .****** **************.* .

349. spacer 8.15|5519242|27|NC_022873|CRT matches to MN150686 (Bacillus phage BC-T25, complete genome) position: , mismatch: 6, identity: 0.778

gcagttccggtcgctcctgttggacct	CRISPR spacer
ttagttcctgtcgctcctgttgggcac	Protospacer
 .****** **************.* .

350. spacer 7.15|4027459|27|NC_022873|CRT matches to MN586053 (Arthrobacter phage BeatusComedenti, complete genome) position: , mismatch: 7, identity: 0.741

tggcgctactggacctcagggtgttca	CRISPR spacer
cggcgccactggacctcagggtccggg	Protospacer
.*****.*************** .  .

351. spacer 7.15|4027459|27|NC_022873|CRT matches to NC_031231 (Arthrobacter phage KellEzio, complete genome) position: , mismatch: 7, identity: 0.741

tggcgctactggacctcagggtgttca	CRISPR spacer
cggcgccactggacctcagggtccggg	Protospacer
.*****.*************** .  .

352. spacer 7.19|4027639|36|NC_022873|CRT matches to MN693405 (Marine virus AFVG_25M416, complete genome) position: , mismatch: 7, identity: 0.806

tggtgctactggcgctactggacctcaaggcgttca	CRISPR spacer
tggtgctactggagctactggccctcaaggtgcaac	Protospacer
************ ******** ********.*.

353. spacer 7.19|4027639|36|NC_022873|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 7, identity: 0.806

tggtgctactggcgctactggacctcaaggcgttca	CRISPR spacer
tggtgctactggtgcaactggacctcaaggttctac	Protospacer
************.** **************. .*

354. spacer 7.19|4027639|36|NC_022873|CRT matches to MN693333 (Marine virus AFVG_25M417, complete genome) position: , mismatch: 7, identity: 0.806

tggtgctactggcgctactggacctcaaggcgttca	CRISPR spacer
tggtgctactggagctactggccctcaaggtgcaac	Protospacer
************ ******** ********.*.

355. spacer 7.19|4027639|36|NC_022873|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 7, identity: 0.806

tggtgctactggcgctactggacctcaaggcgttca	CRISPR spacer
tggtgctactggtgcaactggacctcaaggttctac	Protospacer
************.** **************. .*

356. spacer 7.21|4027729|27|NC_022873|CRT matches to AP013564 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 7, identity: 0.741

cggcgctactggacctcaaggcgttca	CRISPR spacer
cggcgctactgggcctcaaggaccagc	Protospacer
************.********  .

357. spacer 7.21|4027729|27|NC_022873|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 7, identity: 0.741

cggcgctactggacctcaaggcgttca	CRISPR spacer
cggcgctactgggcctcaaggaccagc	Protospacer
************.********  .

358. spacer 7.21|4027729|27|NC_022873|CRT matches to AP013943 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 7, identity: 0.741

cggcgctactggacctcaaggcgttca	CRISPR spacer
cggcgctactgggcctcaaggaccagc	Protospacer
************.********  .

359. spacer 7.21|4027729|27|NC_022873|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 7, identity: 0.741

cggcgctactggacctcaaggcgttca	CRISPR spacer
cggcgctactgggcctcaaggaccagc	Protospacer
************.********  .

360. spacer 7.21|4027729|27|NC_022873|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 7, identity: 0.741

cggcgctactggacctcaaggcgttca	CRISPR spacer
cggcgctactgggcctcaaggaccagc	Protospacer
************.********  .

361. spacer 7.21|4027729|27|NC_022873|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 7, identity: 0.741

cggcgctactggacctcaaggcgttca	CRISPR spacer
cggcgctactgggcctcaaggaccagc	Protospacer
************.********  .

362. spacer 9.1|5781927|31|NC_022873|CRISPRCasFinder matches to JX238501 (Bacillus phage phiAGATE, complete genome) position: , mismatch: 8, identity: 0.742

ttcttcttttttgtcactagttgaaccgctt	CRISPR spacer
ctaaccttttttgccactagttaaaccgccc	Protospacer
.*  .********.********.******..

363. spacer 9.2|5781981|34|NC_022873|CRISPRCasFinder matches to NZ_CP014851 (Bacillus thuringiensis strain HD12 plasmid pHD120112, complete sequence) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
tttatcttcttttttattttctggtttattttcc	Protospacer
.**.****** ****************  * ..*

364. spacer 9.2|5781981|34|NC_022873|CRISPRCasFinder matches to MN812210 (Flavobacterium phage vB_FspS_hemulen9-1, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

365. spacer 9.2|5781981|34|NC_022873|CRISPRCasFinder matches to MN812215 (Flavobacterium phage vB_FspS_lillamy9-4, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

366. spacer 9.2|5781981|34|NC_022873|CRISPRCasFinder matches to MN812216 (Flavobacterium phage vB_FspS_lillamy9-5, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

367. spacer 9.2|5781981|34|NC_022873|CRISPRCasFinder matches to NC_048835 (Flavobacterium phage vB_FspS_lillamy9-1, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

368. spacer 9.2|5781981|34|NC_022873|CRISPRCasFinder matches to MN812213 (Flavobacterium phage vB_FspS_lillamy9-2, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

369. spacer 9.2|5781981|34|NC_022873|CRISPRCasFinder matches to MN812230 (Flavobacterium phage vB_FspS_sniff9-2, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

370. spacer 9.2|5781981|34|NC_022873|CRISPRCasFinder matches to MN812209 (Flavobacterium phage vB_FspS_hemulen6-2, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

371. spacer 9.2|5781981|34|NC_022873|CRISPRCasFinder matches to MN812218 (Flavobacterium phage vB_FspS_lillamy9-7, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

372. spacer 9.2|5781981|34|NC_022873|CRISPRCasFinder matches to MN812233 (Flavobacterium phage vB_FspS_snork9-1, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

373. spacer 9.2|5781981|34|NC_022873|CRISPRCasFinder matches to MN812219 (Flavobacterium phage vB_FspS_morran9-1, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

374. spacer 9.2|5781981|34|NC_022873|CRISPRCasFinder matches to MN812217 (Flavobacterium phage vB_FspS_lillamy9-6, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

375. spacer 9.2|5781981|34|NC_022873|CRISPRCasFinder matches to NC_048840 (Flavobacterium phage vB_FspS_snork6-1, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

376. spacer 9.2|5781981|34|NC_022873|CRISPRCasFinder matches to NC_048839 (Flavobacterium phage vB_FspS_sniff9-1, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

377. spacer 9.2|5781981|34|NC_022873|CRISPRCasFinder matches to NC_048842 (Flavobacterium phage vB_FspS_stinky9-1, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

378. spacer 9.2|5781981|34|NC_022873|CRISPRCasFinder matches to MN812232 (Flavobacterium phage vB_FspS_snork6-2, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

379. spacer 9.2|5781981|34|NC_022873|CRISPRCasFinder matches to MN812208 (Flavobacterium phage vB_FspS_hemulen6-1, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

380. spacer 9.2|5781981|34|NC_022873|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

381. spacer 9.2|5781981|34|NC_022873|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

382. spacer 9.2|5781981|34|NC_022873|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

383. spacer 9.2|5781981|34|NC_022873|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

384. spacer 9.2|5781981|34|NC_022873|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

385. spacer 9.2|5781981|34|NC_022873|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

386. spacer 9.2|5781981|34|NC_022873|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

240697 : 353788

Bacillus_phage(61.36%)

tRNA,head,integrase,terminase,transposase,portal,tail,capsid,protease

attL 263779:263798|attR 300618:300637

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000908526.1\|240697_241270_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_000583419.1\|241363_241723_+	holo-ACP synthase	NA	NA	NA	NA
WP_002094231.1\|241879_242830_+	outer membrane lipoprotein carrier protein LolA	NA	NA	NA	NA
WP_000390593.1\|242947_244117_+	alanine racemase	NA	NA	NA	NA
WP_000004570.1\|244425_244713_+	antitoxin EndoAI	NA	NA	NA	NA
WP_000635965.1\|244717_245068_+	type II toxin-antitoxin system endoribonuclease NdoA	A0A2P0ZKX3	Lactobacillus_phage	1.7e-13	37.7
WP_000426207.1\|245136_247305_+	RNA-binding transcriptional accessory protein	NA	NA	NA	NA
WP_001143640.1\|247362_247479_-	cortex morphogenetic protein CmpA	NA	NA	NA	NA
WP_000503730.1\|247674_248133_+	SprT family protein	NA	NA	NA	NA
WP_000049640.1\|254624_255098_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_023520858.1\|255078_255771_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_000367207.1\|255785_256229_+	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_000414595.1\|256228_257245_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	4.1e-68	43.1
WP_043924594.1\|257729_259718_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	2.3e-54	30.5
WP_000372699.1\|259850_260480_+	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_001246201.1\|260509_260701_-	YdiK family protein	NA	NA	NA	NA
WP_000745323.1\|260697_261447_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_000917311.1\|261838_262123_+	co-chaperone GroES	A0A221S3C8	uncultured_virus	1.2e-20	54.8
WP_001029992.1\|262161_263796_+	chaperonin GroEL	A0A219YK78	uncultured_virus	1.3e-156	57.8
263779:263798	attL	NA	NA	NA	NA
WP_023520860.1\|263873_265055_-\|integrase	site-specific integrase	A0A1W6JPB2	Staphylococcus_phage	4.8e-100	50.5
WP_023520861.1\|265071_265683_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_023520862.1\|265867_266092_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_175056338.1\|266148_266409_+	excisionase family DNA-binding protein	A0A1W6JPE8	Staphylococcus_phage	1.6e-24	66.2
WP_023520864.1\|266749_269143_+	DNA primase	A0A1B1IMF8	Lactococcus_phage	1.3e-104	42.1
WP_023520865.1\|269437_269848_+	hypothetical protein	A0A2H4J819	uncultured_Caudovirales_phage	1.8e-51	59.8
WP_023520866.1\|269861_269987_+	Fur-regulated basic protein FbpA	NA	NA	NA	NA
WP_175056339.1\|270958_271354_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_023520868.1\|271447_271831_+	hypothetical protein	A0A288WFT8	Bacillus_phage	2.2e-46	70.2
WP_023520869.1\|272293_273865_+	S8 family serine peptidase	A0A1B0T6A2	Bacillus_phage	1.6e-39	32.4
WP_023520870.1\|274064_274457_+	HNH endonuclease	A0A2H4JFG4	uncultured_Caudovirales_phage	4.9e-70	93.1
WP_000104850.1\|274542_274980_+\|terminase	P27 family phage terminase small subunit	A0A2H4JFK0	uncultured_Caudovirales_phage	3.6e-69	93.8
WP_000572796.1\|274976_276704_+\|terminase	terminase large subunit	A0A2H4JDG5	uncultured_Caudovirales_phage	0.0e+00	97.7
WP_001009049.1\|276718_276991_+	DUF2829 domain-containing protein	A0A0S2MV93	Bacillus_phage	1.4e-42	82.2
WP_023520871.1\|276990_277248_+	hypothetical protein	A0A1B1P7N4	Bacillus_phage	9.2e-25	64.7
WP_023520872.1\|277296_278481_+\|portal	phage portal protein	A0A1B1P7N5	Bacillus_phage	4.6e-220	97.5
WP_023520873.1\|278470_279052_+\|head,protease	HK97 family phage prohead protease	A0A1B1P7P1	Bacillus_phage	7.0e-97	95.3
WP_023520874.1\|279053_280370_+\|capsid	phage major capsid protein	A0A1C8E976	Bacillus_phage	3.4e-208	97.2
WP_043924595.1\|280371_280632_+	phage protein	A0A1B0T690	Bacillus_phage	8.4e-42	100.0
WP_043924596.1\|280606_280942_+	phage protein	A0A1C8E986	Bacillus_phage	5.5e-54	97.2
WP_023520877.1\|280931_281261_+	hypothetical protein	A0A1C8E981	Bacillus_phage	4.0e-57	99.1
WP_000157915.1\|281260_281638_+	HK97 gp10 family phage protein	A0A1B1P7P3	Bacillus_phage	8.7e-64	98.4
WP_000151366.1\|281649_282285_+	hypothetical protein	A0A1C8E980	Bacillus_phage	1.6e-115	99.1
WP_000113340.1\|282296_282683_+	hypothetical protein	A0A1C8E984	Bacillus_phage	3.6e-65	99.2
WP_006927278.1\|282721_282910_+	hypothetical protein	A0A1C8E979	Bacillus_phage	8.2e-31	98.4
WP_023520878.1\|282926_286451_+\|tail	phage tail tape measure protein	A0A1B1P7P9	Bacillus_phage	0.0e+00	95.0
WP_023520879.1\|286451_287135_+\|tail	phage tail family protein	A0A1B0T6A0	Bacillus_phage	1.1e-125	96.5
WP_023520880.1\|287131_289474_+\|tail	phage tail protein	A0A1B0T695	Bacillus_phage	0.0e+00	98.2
WP_023520881.1\|290817_291048_+	hypothetical protein	A0A1B1P7Q9	Bacillus_phage	4.8e-33	97.4
WP_023520882.1\|291044_292097_+	N-acetylmuramoyl-L-alanine amidase	A0A1C8E990	Bacillus_phage	5.6e-185	92.2
WP_023520883.1\|292471_294715_+	peptidase domain-containing ABC transporter	W8CYL7	Bacillus_phage	1.0e-47	28.5
WP_080448637.1\|294815_295178_+	hypothetical protein	NA	NA	NA	NA
WP_023520885.1\|295192_296314_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_023520886.1\|296529_296865_+	hypothetical protein	NA	NA	NA	NA
WP_023520887.1\|296955_297819_+	hypothetical protein	NA	NA	NA	NA
WP_023520888.1\|298277_298616_-	hypothetical protein	A0A1B1P7R0	Bacillus_phage	2.0e-43	86.6
WP_023520889.1\|298754_298973_+	hypothetical protein	A0A1C8E991	Bacillus_phage	3.6e-30	91.7
WP_023520890.1\|298996_299290_+	YolD-like family protein	A0A1C8E992	Bacillus_phage	4.7e-41	85.6
WP_167332619.1\|301038_302580_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	8.9e-22	31.7
300618:300637	attR	NA	NA	NA	NA
WP_000833096.1\|302966_304292_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	4.1e-44	29.4
WP_023520893.1\|304437_305139_+	response regulator transcription factor	W8CYM9	Bacillus_phage	7.3e-40	36.9
WP_023520894.1\|305122_306628_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	5.4e-32	30.8
WP_043924598.1\|312221_313124_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_000687922.1\|313323_314055_+	DsbA family oxidoreductase	NA	NA	NA	NA
WP_023520896.1\|319180_320257_-	glycoside hydrolase family 99-like domain-containing protein	NA	NA	NA	NA
WP_023520897.1\|320489_321362_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_000405127.1\|321389_322112_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_023520898.1\|322327_323122_-	sulfotransferase family 2 domain-containing protein	A0A288WG17	Bacillus_phage	3.3e-65	50.8
WP_001230828.1\|323414_324359_+	GDP-mannose 4,6-dehydratase	L7RCI0	Acanthamoeba_polyphaga_moumouvirus	1.6e-26	31.3
WP_023520899.1\|324399_325176_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_023520900.1\|325242_327174_-	glycosyltransferase	NA	NA	NA	NA
WP_023520901.1\|332664_334077_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_023520902.1\|334194_335154_+	proline dehydrogenase family protein	NA	NA	NA	NA
WP_001072428.1\|341284_341743_-	ASCH domain-containing protein	NA	NA	NA	NA
WP_001279951.1\|342099_342897_-	undecaprenyl-diphosphate phosphatase UppP	NA	NA	NA	NA
WP_000247717.1\|342914_343652_-	ABC transporter permease	NA	NA	NA	NA
WP_000074583.1\|343644_344574_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.0e-41	43.8
WP_000845349.1\|344642_345656_-	HAMP domain-containing histidine kinase	A0A2K9L4R6	Tupanvirus	1.6e-08	23.4
WP_000652004.1\|345645_346359_-	response regulator transcription factor	W8CYM9	Bacillus_phage	3.8e-36	37.2
WP_000658281.1\|351876_352797_+	DMT family transporter	NA	NA	NA	NA
WP_023520903.1\|352918_353788_+\|transposase	ISNCY family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

362208 : 370584

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000625682.1\|362208_363516_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.9e-21	25.3
WP_001170549.1\|363604_364324_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	8.0e-50	44.8
WP_000278823.1\|364316_364571_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_000666785.1\|364567_365251_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_000055559.1\|365234_367454_+	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	2.0e-163	41.2
WP_000879026.1\|367438_368854_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	3.3e-55	35.4
WP_001262441.1\|368959_370000_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.1e-67	45.9
WP_000088590.1\|369996_370584_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	9.1e-28	37.4

DBSCAN-SWA_3

397435 : 436801

Bacillus_phage(94.59%)

tRNA,head,integrase,terminase,portal,tail,capsid,protease

attL 415154:415182|attR 450120:450148

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000086999.1\|397435_397726_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_000051441.1\|397741_399199_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_001047685.1\|399213_400641_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_000977679.1\|401199_402105_+	diacylglycerol kinase	A0A1V0SBJ0	Catovirus	4.1e-27	30.8
WP_000416662.1\|402245_402992_+	HAD family hydrolase	NA	NA	NA	NA
WP_023520919.1\|403146_404511_+	4-aminobutyrate--2-oxoglutarate transaminase	NA	NA	NA	NA
WP_000225140.1\|404626_405994_+	sigma 54-interacting transcriptional regulator	NA	NA	NA	NA
WP_023520920.1\|405986_407438_+	NADP-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_000263262.1\|407485_407809_+	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_000915109.1\|407941_408433_+	DUF4352 domain-containing protein	NA	NA	NA	NA
WP_000007349.1\|408478_409708_-	aminopeptidase	NA	NA	NA	NA
WP_023520921.1\|409824_410907_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_000643594.1\|411054_411228_-	hypothetical protein	NA	NA	NA	NA
WP_023520922.1\|411444_412152_+	hypothetical protein	NA	NA	NA	NA
WP_001200491.1\|412198_413395_-	NupC family nucleoside transporter	NA	NA	NA	NA
WP_023520923.1\|413820_415200_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	1.9e-116	46.4
415154:415182	attL	NA	NA	NA	NA
WP_023520924.1\|415258_416383_-\|integrase	site-specific integrase	A0A1B0T6A8	Bacillus_phage	5.5e-215	100.0
WP_023520925.1\|416555_416714_+	hypothetical protein	A0A1B0T6B0	Bacillus_phage	3.9e-18	100.0
WP_023520926.1\|417381_417708_-	TM2 domain-containing protein	A0A1B0T6B3	Bacillus_phage	6.3e-55	98.1
WP_023520927.1\|418753_419899_+	hypothetical protein	A0A1B0T6A5	Bacillus_phage	2.4e-213	100.0
WP_157762857.1\|420251_420422_+	hypothetical protein	A0A1B0T6D8	Bacillus_phage	7.4e-15	100.0
WP_023520928.1\|420468_420822_-	helix-turn-helix transcriptional regulator	A0A1B0T6A7	Bacillus_phage	1.9e-57	100.0
WP_023520929.1\|421046_421268_+	helix-turn-helix transcriptional regulator	A0A1B0T6B2	Bacillus_phage	2.7e-33	100.0
WP_023520930.1\|421286_421637_+	helix-turn-helix domain-containing protein	A0A1B0T6C2	Bacillus_phage	5.8e-62	100.0
WP_157762858.1\|421633_421801_+	hypothetical protein	A0A1B0T6C1	Bacillus_phage	1.2e-22	100.0
WP_023520932.1\|422013_422733_+	DnaD domain protein	A0A1B0T6C0	Bacillus_phage	2.5e-104	100.0
WP_023520933.1\|422680_423544_+	ATP-binding protein	A0A1B0T6C3	Bacillus_phage	1.1e-138	98.8
WP_023520934.1\|423546_423741_+	hypothetical protein	A0A1B0T6B4	Bacillus_phage	4.9e-31	100.0
WP_023520935.1\|423765_423939_+	DUF3954 domain-containing protein	A0A1B0T6B8	Bacillus_phage	4.7e-25	100.0
WP_023520936.1\|423953_424208_+	hypothetical protein	A0A1B0T6B9	Bacillus_phage	1.3e-42	100.0
WP_023520938.1\|424663_424855_+	hypothetical protein	A0A1B0T6B5	Bacillus_phage	3.9e-28	100.0
WP_023520939.1\|424913_425312_+	hypothetical protein	A0A1B0T6B6	Bacillus_phage	2.5e-69	99.2
WP_142326415.1\|425989_426121_+	DUF3983 domain-containing protein	A0A1B0T6D3	Bacillus_phage	4.8e-14	100.0
WP_000645943.1\|426225_426387_+	hypothetical protein	A0A1B0T6D0	Bacillus_phage	4.4e-17	100.0
WP_023520941.1\|426412_426901_+	epimerase/dehydratase	A0A1B0T6C9	Bacillus_phage	1.2e-86	100.0
WP_023520942.1\|426897_427440_+\|integrase	site-specific integrase	A0A1B0T6D2	Bacillus_phage	7.5e-93	96.7
WP_023520943.1\|427648_427894_+	hypothetical protein	A0A1B0T6C4	Bacillus_phage	1.4e-38	100.0
WP_023520944.1\|428245_428560_+	phage protein	A0A1B0T6C6	Bacillus_phage	1.1e-51	100.0
WP_023520945.1\|428556_428949_+	HNH endonuclease	A0A1B0T6C5	Bacillus_phage	1.0e-75	100.0
WP_023520946.1\|429031_429457_+\|terminase	P27 family phage terminase small subunit	A0A1B0T688	Bacillus_phage	4.0e-73	100.0
WP_023520947.1\|429453_431178_+\|terminase	terminase large subunit	A0A1B0T685	Bacillus_phage	0.0e+00	99.1
WP_023520948.1\|431193_432378_+\|portal	phage portal protein	A0A1B0T684	Bacillus_phage	2.8e-225	100.0
WP_023520949.1\|432367_432949_+\|head,protease	HK97 family phage prohead protease	A0A1B0T687	Bacillus_phage	1.8e-100	100.0
WP_023520950.1\|432950_434261_+\|capsid	phage major capsid protein	A0A1B0T682	Bacillus_phage	7.9e-197	100.0
WP_043924595.1\|434262_434523_+	phage protein	A0A1B0T690	Bacillus_phage	8.4e-42	100.0
WP_043924601.1\|434497_434833_+\|head,tail	head-tail adaptor protein	A0A1B0T691	Bacillus_phage	2.2e-55	100.0
WP_001167233.1\|434822_435152_+	hypothetical protein	A0A1B0T6B7	Bacillus_phage	3.1e-57	100.0
WP_000168639.1\|435151_435529_+	HK97 gp10 family phage protein	A0A1B0T694	Bacillus_phage	6.6e-64	100.0
WP_023520952.1\|435540_436176_+	phage protein	A0A1B0T693	Bacillus_phage	3.7e-115	99.5
WP_023520953.1\|436187_436574_+	hypothetical protein	A0A1B1P7Q6	Bacillus_phage	4.0e-64	98.4
WP_000383691.1\|436612_436801_+	hypothetical protein	A0A1B0T6A1	Bacillus_phage	1.6e-31	100.0
450120:450148	attR	NA	NA	NA	NA

DBSCAN-SWA_4

440342 : 449446

Bacillus_phage(100.0%)

plate,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023520954.1\|440342_441026_+\|tail	phage tail family protein	A0A1B0T6A0	Bacillus_phage	8.2e-129	98.7
WP_023520955.1\|443379_444648_+\|plate	BppU family phage baseplate upper protein	A0A1B0T696	Bacillus_phage	1.2e-239	100.0
WP_023520956.1\|444708_444939_+	hypothetical protein	A0A1B0T697	Bacillus_phage	2.8e-33	98.7
WP_023520957.1\|444935_445988_+	N-acetylmuramoyl-L-alanine amidase	A0A1B0T6C8	Bacillus_phage	6.6e-202	99.1
WP_023520958.1\|446023_446221_-	hypothetical protein	A0A1B0T6A3	Bacillus_phage	2.4e-25	100.0
WP_023520959.1\|446880_448071_-	peptidase S8	A0A1B0T6A2	Bacillus_phage	7.9e-220	98.5
WP_023520961.1\|448810_449446_-	hypothetical protein	A0A1B0T6B1	Bacillus_phage	3.4e-97	100.0

DBSCAN-SWA_5

752242 : 760400

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023521050.1\|752242_753196_-	YafY family transcriptional regulator	A0A1B0RXM1	Streptococcus_phage	3.1e-17	29.9
WP_023521051.1\|753300_753822_+	dihydrofolate reductase	NA	NA	NA	NA
WP_000822580.1\|753987_755379_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	3.1e-34	30.5
WP_023521052.1\|755390_756068_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.4e-32	35.6
WP_000738870.1\|756243_757491_+	hypothetical protein	NA	NA	NA	NA
WP_000277054.1\|757624_758155_+	DUF4352 domain-containing protein	A0A0S2MVG4	Bacillus_phage	2.5e-16	33.5
WP_000831286.1\|758167_758512_+	DUF4064 domain-containing protein	A0A0S2MVJ2	Bacillus_phage	8.5e-42	78.1
WP_000487919.1\|758948_760400_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	5.8e-140	54.4

DBSCAN-SWA_6

772057 : 790921

Bacillus_phage(66.67%)

integrase

attL 773523:773538|attR 789672:789687

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001132859.1\|772057_772954_+	ribokinase	A0A0K0KW05	Prochlorococcus_phage	1.5e-05	30.9
WP_000716151.1\|772950_773346_+	D-ribose pyranase	NA	NA	NA	NA
773523:773538	attL	NA	NA	NA	NA
WP_023521054.1\|773750_774911_-\|integrase	site-specific integrase	A0A1C8E994	Bacillus_phage	1.4e-205	93.0
WP_023521055.1\|774989_775448_-	ImmA/IrrE family metallo-endopeptidase	A0A0S2MV59	Bacillus_phage	6.5e-21	40.5
WP_023521056.1\|775476_775914_-	helix-turn-helix transcriptional regulator	A0A1C8E9A4	Bacillus_phage	7.3e-30	47.3
WP_023521057.1\|776185_776371_+	helix-turn-helix transcriptional regulator	A0A0M3ULF9	Bacillus_phage	1.3e-17	80.4
WP_023521058.1\|776370_776643_+	DUF771 domain-containing protein	A0A1C8E9B3	Bacillus_phage	5.7e-41	88.9
WP_157762859.1\|776671_776842_+	hypothetical protein	A0A1B1P7M3	Bacillus_phage	2.4e-05	57.4
WP_023521059.1\|776858_777644_+	antA/AntB antirepressor family protein	A0A0B5D0I2	Listeria_phage	1.7e-24	39.4
WP_043924609.1\|777721_778072_+	hypothetical protein	A0A2H4JBP9	uncultured_Caudovirales_phage	1.3e-45	80.2
WP_043924749.1\|778167_778368_+	hypothetical protein	NA	NA	NA	NA
WP_167332609.1\|778369_778546_+	hypothetical protein	NA	NA	NA	NA
WP_023521063.1\|778542_778734_+	hypothetical protein	NA	NA	NA	NA
WP_043924610.1\|778739_779411_+	AAA family ATPase	A0A1B2AQ06	Phage_Wrath	1.9e-114	91.0
WP_023521065.1\|779432_779909_+	DUF669 domain-containing protein	A0A1B2AQ07	Phage_Wrath	3.3e-28	47.5
WP_023521066.1\|779981_782336_+	hypothetical protein	A0A1B2AQ05	Phage_Wrath	0.0e+00	78.2
WP_043924611.1\|782818_783247_+	hypothetical protein	A0A2H4JFQ6	uncultured_Caudovirales_phage	2.8e-58	71.8
WP_023521068.1\|783249_783789_+	ERCC4 domain-containing protein	A0A0S2SXQ1	Bacillus_phage	3.6e-47	52.0
WP_023521069.1\|784308_784545_+	zinc-finger domain-containing protein	NA	NA	NA	NA
WP_023521070.1\|784551_784800_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_023521071.1\|784893_785289_+	phage protein	A0A288WFT8	Bacillus_phage	8.8e-59	84.7
WP_023521072.1\|785537_785852_+	phage protein	A0A1B0T6C6	Bacillus_phage	2.4e-43	83.7
WP_000872551.1\|785848_786241_+	HNH endonuclease	A0A1B1P7N1	Bacillus_phage	6.4e-70	93.1
WP_000827883.1\|788335_788560_+	helix-turn-helix transcriptional regulator	A0A0S2GLH4	Bacillus_phage	2.8e-09	44.8
WP_023521073.1\|788598_789216_-	replication-relaxation family protein	H0USY2	Bacillus_phage	1.1e-31	41.0
WP_023521074.1\|789154_790336_-	cell division protein FtsK	H0USY1	Bacillus_phage	7.8e-127	56.2
789672:789687	attR	NA	NA	NA	NA
WP_023521075.1\|790437_790623_-	hypothetical protein	NA	NA	NA	NA
WP_023521076.1\|790624_790921_-	hypothetical protein	H0USY0	Bacillus_phage	5.8e-15	43.7

DBSCAN-SWA_7

820399 : 922673

Bacillus_phage(84.06%)

head,integrase,terminase,plate,transposase,portal,tail,capsid,bacteriocin,protease

attL 838641:838657|attR 915832:915848

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023520903.1\|820399_821269_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_023521098.1\|821914_822487_+	hypothetical protein	NA	NA	NA	NA
WP_023521099.1\|822514_823765_+	replication/maintenance protein RepL	NA	NA	NA	NA
WP_000431537.1\|823796_823967_-	ribbon-helix-helix domain-containing protein	B5LPT4	Bacillus_virus	3.7e-06	53.7
WP_043924613.1\|824076_824613_+	hypothetical protein	NA	NA	NA	NA
WP_023521101.1\|824659_824818_+	hypothetical protein	NA	NA	NA	NA
WP_157762860.1\|824843_824987_+	hypothetical protein	NA	NA	NA	NA
WP_006920904.1\|825069_825378_+	hypothetical protein	NA	NA	NA	NA
WP_006920905.1\|825496_826156_+	hypothetical protein	NA	NA	NA	NA
WP_080672338.1\|826205_828338_+	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	2.9e-63	33.6
WP_043924614.1\|828865_829648_+	hypothetical protein	NA	NA	NA	NA
WP_023521104.1\|829953_830139_-	aspartyl-phosphate phosphatase Spo0E family protein	NA	NA	NA	NA
WP_023521105.1\|830261_830543_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	7.0e-10	55.7
WP_023521106.1\|830564_830753_+	RNA chaperone Hfq	NA	NA	NA	NA
WP_023521107.1\|830850_831129_-	HU family DNA-binding protein	A7KV42	Bacillus_phage	4.3e-20	61.8
WP_023521109.1\|831601_831910_+	hypothetical protein	NA	NA	NA	NA
WP_023521110.1\|832341_833283_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_023521111.1\|833329_833617_-	hypothetical protein	NA	NA	NA	NA
WP_023521113.1\|834380_835835_-	hypothetical protein	NA	NA	NA	NA
WP_080672461.1\|836062_836740_+	recombinase family protein	M9Q1K0	Clostridium_phage	1.1e-21	36.6
WP_023521115.1\|837609_839193_+	amidase	NA	NA	NA	NA
838641:838657	attL	NA	NA	NA	NA
WP_023521119.1\|841214_841778_-	recombinase family protein	A0A1V0E035	Clostridioides_phage	7.4e-27	37.8
WP_157762861.1\|845085_845526_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	4.9e-34	48.9
WP_023521123.1\|845567_846347_-	RNA polymerase sigma factor SigB	A0A0Y0ATF9	Bacillus_phage	8.2e-16	30.4
WP_023521124.1\|846312_846801_-	anti-sigma B factor RsbW	NA	NA	NA	NA
WP_023521125.1\|846808_847129_-	STAS domain-containing protein	NA	NA	NA	NA
WP_000022437.1\|847319_848462_+	fused response regulator/phosphatase	Q8QKV7	Ectocarpus_siliculosus_virus	7.0e-08	30.1
WP_023521126.1\|848634_851343_-	response regulator	A0A1V0SGX0	Hokovirus	9.1e-38	29.3
WP_023521128.1\|853858_854440_+\|head,protease	HK97 family phage prohead protease	A0A1B0T687	Bacillus_phage	6.2e-93	94.3
WP_023521129.1\|854441_855752_+\|capsid	phage major capsid protein	A0A1C8E976	Bacillus_phage	5.9e-200	95.3
WP_023521130.1\|855753_856014_+\|head,tail	phage head-tail connector protein	A0A1B1P7M9	Bacillus_phage	6.0e-40	95.3
WP_043924615.1\|855988_856324_+\|head,tail	head-tail adaptor protein	A0A1C8E986	Bacillus_phage	1.5e-54	98.2
WP_023521132.1\|856313_856643_+	hypothetical protein	A0A1B1P7P2	Bacillus_phage	9.9e-56	97.2
WP_023521133.1\|856642_857020_+	HK97 gp10 family phage protein	A0A1C8E995	Bacillus_phage	1.5e-63	98.4
WP_023521134.1\|857031_857667_+	phage protein	A0A1B1P7Q4	Bacillus_phage	1.4e-114	97.6
WP_023521135.1\|857678_858065_+	hypothetical protein	A0A1B1P7Q6	Bacillus_phage	6.1e-65	98.4
WP_006927278.1\|858103_858292_+	hypothetical protein	A0A1C8E979	Bacillus_phage	8.2e-31	98.4
WP_023521136.1\|858308_861830_+\|tail	phage tail tape measure protein	A0A1B1P7P9	Bacillus_phage	0.0e+00	95.6
WP_023521137.1\|861831_862515_+\|tail	phage tail family protein	A0A1B1P7Q0	Bacillus_phage	6.1e-124	96.0
WP_023521138.1\|862511_864854_+\|tail	phage tail protein	A0A1B0T695	Bacillus_phage	0.0e+00	95.6
WP_023521139.1\|864868_866044_+\|plate	BppU family phage baseplate upper protein	A0A1B1P768	Bacillus_phage	2.2e-166	77.1
WP_033692567.1\|866107_866338_+\|bacteriocin	bacteriocin biosynthesis protein	A0A1B1P7Q9	Bacillus_phage	3.7e-33	97.4
WP_023521140.1\|866334_867396_+	N-acetylmuramoyl-L-alanine amidase	A0A1B1P878	Bacillus_phage	6.2e-168	80.5
WP_023521141.1\|867832_871570_-	pesticidal crystal protein cry5Ba	NA	NA	NA	NA
WP_023521142.1\|871887_872955_-	hypothetical protein	A0A0S2MVF4	Bacillus_phage	2.0e-09	40.8
WP_001074641.1\|874477_875413_+	ribose ABC transporter permease	NA	NA	NA	NA
WP_000758975.1\|875427_876354_+	ribose ABC transporter substrate-binding protein RbsB	NA	NA	NA	NA
WP_000667666.1\|876388_877036_+	fructose-6-phosphate aldolase	G8EY84	Synechococcus_phage	5.1e-48	48.8
WP_023520903.1\|879168_880038_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_021036119.1\|881139_881481_+	hypothetical protein	NA	NA	NA	NA
WP_000873271.1\|881516_882671_-	MFS transporter	NA	NA	NA	NA
WP_000645827.1\|882896_883949_+	(R,R)-butanediol dehydrogenase	E3SJ82	Synechococcus_phage	3.9e-21	27.6
WP_023521146.1\|884067_884412_+	two pore domain potassium channel family protein	NA	NA	NA	NA
WP_000730997.1\|884665_885517_+	phospholipase C	NA	NA	NA	NA
WP_023521147.1\|885593_886640_+	sphingomyelin phosphodiesterase	A0A1P8L6H7	Staphylococcus_phage	3.1e-87	59.0
WP_000262043.1\|886578_887679_-\|integrase	site-specific integrase	A0A0S2GLI2	Bacillus_phage	1.4e-199	96.7
WP_023521148.1\|888505_889708_+	hypothetical protein	W8CYT9	Bacillus_phage	6.8e-86	43.1
WP_000511081.1\|890050_890395_-	helix-turn-helix transcriptional regulator	W8CZ48	Bacillus_phage	1.9e-57	100.0
WP_023521149.1\|890543_890780_+	helix-turn-helix transcriptional regulator	W8CYU0	Bacillus_phage	8.1e-36	97.4
WP_023521150.1\|890812_891001_+	helix-turn-helix transcriptional regulator	W8CYN7	Bacillus_phage	4.6e-26	96.8
WP_023521151.1\|891025_891181_+	hypothetical protein	I7J4K2	Bacillus_phage	1.7e-21	94.1
WP_023521152.1\|891226_892006_+	ORF6C domain-containing protein	A0A0S2GLP8	Bacillus_phage	2.0e-139	99.2
WP_023521153.1\|892169_892484_+	hypothetical protein	H0USU0	Bacillus_phage	3.6e-47	93.3
WP_023521154.1\|892757_893405_+	sigma-70 family RNA polymerase sigma factor	A0A0S2GLJ1	Bacillus_phage	1.1e-111	96.3
WP_023521155.1\|893646_894663_+	hypothetical protein	A0A0S2GLI6	Bacillus_phage	1.2e-181	96.2
WP_016098382.1\|894625_895438_+	ATP-binding protein	A0A0S2GLK2	Bacillus_phage	1.0e-154	99.6
WP_000436951.1\|895479_895746_+	hypothetical protein	A0A0S2GLK4	Bacillus_phage	7.7e-43	100.0
WP_016098383.1\|895817_895982_+	DUF3954 domain-containing protein	A0A0S2GLF5	Bacillus_phage	2.9e-24	98.1
WP_023521156.1\|896281_896689_-	DUF4870 domain-containing protein	NA	NA	NA	NA
WP_023521157.1\|896877_897126_-	hypothetical protein	A0A288WFY7	Bacillus_phage	8.5e-36	92.7
WP_023521158.1\|898224_898383_+	hypothetical protein	NA	NA	NA	NA
WP_023521159.1\|898520_898802_+	hypothetical protein	A0A0S2GLD3	Bacillus_phage	2.2e-43	97.8
WP_023521160.1\|899163_899649_+	phage transcriptional regulator, ArpU family protein	H0USV3	Bacillus_phage	1.2e-70	80.1
WP_023521161.1\|899645_900188_+\|integrase	site-specific integrase	H0USV4	Bacillus_phage	1.0e-94	98.9
WP_043924616.1\|900394_900640_+	hypothetical protein	W8CYG8	Bacillus_phage	1.0e-36	96.3
WP_023521163.1\|901038_901326_+	hypothetical protein	H0USV6	Bacillus_phage	8.1e-46	96.8
WP_023521164.1\|901362_901590_+	hypothetical protein	NA	NA	NA	NA
WP_023521165.1\|901635_901821_+	hypothetical protein	A0A0S2GLH7	Bacillus_phage	1.6e-23	96.7
WP_023521166.1\|901849_902089_+	hypothetical protein	A0A0S2GLE8	Bacillus_phage	2.6e-21	97.5
WP_000773601.1\|902105_902318_+	hypothetical protein	H0USV9	Bacillus_phage	1.0e-29	97.1
WP_023521168.1\|902696_903074_+	HNH endonuclease	H0USW1	Bacillus_phage	9.9e-68	97.6
WP_000233390.1\|903202_903706_+\|terminase	phage terminase small subunit P27 family	A0A0S2GLF2	Bacillus_phage	1.0e-88	99.4
WP_043924758.1\|903707_905402_+\|terminase	terminase large subunit	A0A0S2GLF0	Bacillus_phage	0.0e+00	99.1
WP_023521170.1\|905681_906875_-\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	1.0e-25	26.8
WP_023521171.1\|907173_908427_+\|portal	phage portal protein	H0USW4	Bacillus_phage	2.9e-241	99.5
WP_023521172.1\|908413_909124_+\|protease	Clp protease ClpP	H0USW5	Bacillus_phage	3.6e-127	99.2
WP_023521173.1\|909161_910328_+\|capsid	phage major capsid protein	W8CYN2	Bacillus_phage	1.5e-207	96.6
WP_023521174.1\|910348_910636_+\|head,tail	phage gp6-like head-tail connector protein	A0A0S2GLH6	Bacillus_phage	2.0e-44	97.9
WP_023521175.1\|910622_910946_+\|head	phage head closure protein	H0USW8	Bacillus_phage	1.8e-54	96.3
WP_000763224.1\|910938_911376_+	HK97 gp10 family phage protein	A0A0S2GLH3	Bacillus_phage	1.8e-76	99.3
WP_023521176.1\|911372_911732_+	DUF3168 domain-containing protein	A0A0S2GLE3	Bacillus_phage	1.9e-60	96.6
WP_023521177.1\|911732_912341_+\|tail	phi13 family phage major tail protein	W8CYT6	Bacillus_phage	5.1e-98	96.0
WP_023521178.1\|912389_912707_+	hypothetical protein	Q2I8F1	Bacillus_phage	4.7e-47	88.6
WP_023521179.1\|912736_912913_+	hypothetical protein	W8CYG0	Bacillus_phage	1.5e-26	98.3
WP_043924617.1\|912927_914244_+\|tail	phage tail tape measure protein	W8CZ45	Bacillus_phage	1.7e-167	98.2
WP_043924618.1\|914425_917119_+\|tail	phage tail tape measure protein	A0A0S2GLG8	Bacillus_phage	5.9e-255	96.3
915832:915848	attR	NA	NA	NA	NA
WP_043924619.1\|917130_918615_+\|tail	phage tail family protein	W8CYY9	Bacillus_phage	1.2e-294	99.4
WP_023521181.1\|918611_922673_+\|tail	tail fiber domain-containing protein	W8CYT7	Bacillus_phage	0.0e+00	96.6

DBSCAN-SWA_8

1808675 : 1838567

Bacillus_phage(70.0%)

integrase,terminase,plate,transposase,tail

attL 1800634:1800650|attR 1838292:1838308

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1800634:1800650	attL	NA	NA	NA	NA
WP_052364207.1\|1808675_1809977_+	hypothetical protein	A0A288WG12	Bacillus_phage	2.3e-225	88.9
WP_080672358.1\|1810300_1810657_-	helix-turn-helix transcriptional regulator	Q2I8D5	Bacillus_phage	5.5e-52	90.7
WP_023521536.1\|1810817_1811045_+	helix-turn-helix transcriptional regulator	A0A288WG39	Bacillus_phage	6.4e-30	88.0
WP_023521537.1\|1811083_1811242_+	hypothetical protein	A0A288WGC5	Bacillus_phage	1.9e-17	88.5
WP_023521538.1\|1811314_1811470_+	hypothetical protein	A0A288WFZ6	Bacillus_phage	1.2e-16	80.4
WP_023521539.1\|1811525_1811846_+	germination protein PF	A0A0S2GLB6	Bacillus_phage	1.6e-26	62.7
WP_023521540.1\|1811973_1812966_+	DnaD domain protein	D2XR43	Bacillus_phage	4.0e-60	52.2
WP_023521541.1\|1812969_1813248_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	8.7e-13	62.7
WP_023521542.1\|1813240_1813600_+	hypothetical protein	A0A1B1P7A1	Bacillus_phage	1.4e-31	52.5
WP_023521543.1\|1813618_1813783_+	DUF3954 domain-containing protein	A0A0S2GLF5	Bacillus_phage	1.5e-09	48.1
WP_023521544.1\|1813808_1814282_+	hypothetical protein	A0A1B1P7W1	Bacillus_phage	5.1e-05	36.9
WP_023521545.1\|1814307_1814817_+	dUTP diphosphatase	A0A1L2JY27	Aeribacillus_phage	3.9e-27	45.1
WP_023521546.1\|1814820_1815294_+	hypothetical protein	A0A288WFT9	Bacillus_phage	7.5e-65	70.5
WP_023521547.1\|1815373_1815559_+	hypothetical protein	NA	NA	NA	NA
WP_043924639.1\|1815595_1815994_+	hypothetical protein	A0A1B0T6B6	Bacillus_phage	8.0e-68	97.7
WP_023521549.1\|1816077_1816368_+	hypothetical protein	A0A1B1P8C3	Bacillus_phage	3.9e-24	62.5
WP_023521550.1\|1816412_1816787_+	hypothetical protein	NA	NA	NA	NA
WP_023521551.1\|1816829_1817372_+	DNA (cytosine-5-)-methyltransferase	A0A1I9KKE7	Lactobacillus_phage	9.9e-53	56.2
WP_167332613.1\|1817271_1817754_+	DNA cytosine methyltransferase	A0A218MND0	uncultured_virus	9.5e-23	48.1
WP_023521553.1\|1817791_1817917_+	DUF3983 domain-containing protein	NA	NA	NA	NA
WP_023521554.1\|1818032_1818203_+	hypothetical protein	A0A1B0T6D0	Bacillus_phage	3.9e-08	71.4
WP_023521555.1\|1818229_1818712_+	conjugal transfer protein TraR	H0USV3	Bacillus_phage	3.4e-73	84.4
WP_099046434.1\|1818780_1819570_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_043924640.1\|1819565_1820105_+\|integrase	site-specific integrase	A0A0S2GLG4	Bacillus_phage	2.0e-77	88.4
WP_023521558.1\|1820314_1821280_+	hypothetical protein	NA	NA	NA	NA
WP_023521559.1\|1821627_1821846_+	cell division protein FtsK	A0A160DCQ1	Gordonia_phage	2.1e-06	48.1
WP_023521560.1\|1821867_1822281_+	HNH endonuclease	Q0SPJ9	Clostridium_phage	3.6e-23	43.0
WP_023521561.1\|1822381_1822903_+\|terminase	phage terminase small subunit P27 family	Q9ZXG2	Bacillus_phage	2.3e-54	66.1
WP_023521562.1\|1822911_1823070_+	hypothetical protein	A0A286QRG1	Streptococcus_phage	3.3e-09	64.1
WP_023520826.1\|1823547_1824822_+	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_080672360.1\|1824882_1825293_+\|tail	phage tail family protein	NA	NA	NA	NA
WP_023521564.1\|1825310_1826165_+	hypothetical protein	A0A0K2CY64	Paenibacillus_phage	2.1e-20	36.9
WP_023521565.1\|1826181_1827303_+	siphovirus ReqiPepy6 Gp37-like family protein	A0A0K2CZQ1	Paenibacillus_phage	2.0e-63	37.4
WP_023521566.1\|1827349_1829953_+\|plate	BppU family phage baseplate upper protein	U5Q0T6	Bacillus_phage	1.2e-239	57.0
WP_023521567.1\|1830025_1830262_+	hemolysin XhlA family protein	A0A2H4J382	uncultured_Caudovirales_phage	2.2e-17	96.2
WP_023521568.1\|1830261_1830501_+	hypothetical protein	A0A2H4J378	uncultured_Caudovirales_phage	8.0e-31	92.4
WP_023521569.1\|1830497_1831562_+	N-acetylmuramoyl-L-alanine amidase	A0A0A7AQV3	Bacillus_phage	2.7e-187	89.8
WP_023521570.1\|1831669_1832209_+	hypothetical protein	NA	NA	NA	NA
WP_023521571.1\|1832262_1832616_-	YolD-like family protein	A0A2H4JEH6	uncultured_Caudovirales_phage	2.0e-09	29.8
WP_023521572.1\|1832688_1832883_-	helix-turn-helix transcriptional regulator	A0A288WG80	Bacillus_phage	5.9e-08	46.0
WP_023521573.1\|1833046_1833349_+	hypothetical protein	Q2I8E3	Bacillus_phage	4.8e-49	95.0
WP_023521574.1\|1833351_1833534_+	hypothetical protein	Q2I8E2	Bacillus_phage	4.6e-23	90.0
WP_023521575.1\|1833649_1834831_+	cell division protein FtsK	H0USY1	Bacillus_phage	2.7e-188	82.2
WP_043924642.1\|1834772_1835393_+	replication-relaxation family protein	H0USY2	Bacillus_phage	1.5e-92	78.6
WP_023521577.1\|1835407_1835620_+	hypothetical protein	NA	NA	NA	NA
WP_023521578.1\|1835647_1835884_-	helix-turn-helix domain-containing protein	Q2I8D9	Bacillus_phage	2.2e-33	94.9
WP_023521579.1\|1836047_1836167_+	DUF3961 domain-containing protein	Q3HKZ4	Bacillus_phage	4.0e-07	69.2
WP_023521580.1\|1836182_1837046_+	helix-turn-helix domain-containing protein	A0A288WFX2	Bacillus_phage	1.6e-142	90.9
WP_080672361.1\|1837112_1838567_+	recombinase family protein	Q3HKZ2	Bacillus_phage	1.1e-260	93.4
1838292:1838308	attR	NA	NA	NA	NA

DBSCAN-SWA_9

2147131 : 2156430

Bacillus_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000755523.1\|2147131_2148424_+	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	5.0e-10	30.3
WP_023521720.1\|2148523_2149288_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_000453879.1\|2149528_2151289_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.8e-273	98.0
WP_015055113.1\|2151329_2152007_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.5e-122	99.1
WP_001231619.1\|2152003_2153077_+	HAMP domain-containing sensor histidine kinase	W8CYF6	Bacillus_phage	8.8e-186	97.8
WP_003270270.1\|2153101_2153695_-	DUF3139 domain-containing protein	NA	NA	NA	NA
WP_000818985.1\|2153885_2154605_+	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
WP_000014165.1\|2154752_2155424_+	O-methyltransferase	W8CYT3	Bacillus_phage	1.8e-64	92.0
WP_023521721.1\|2155557_2156430_+	aminoglycoside 6-adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	9.0e-64	44.0

DBSCAN-SWA_10

4229760 : 4306739

Bacillus_phage(63.04%)

tRNA,head,integrase,holin,terminase,transposase,portal,tail,capsid,protease

attL 4229388:4229404|attR 4307130:4307146

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4229388:4229404	attL	NA	NA	NA	NA
WP_023522858.1\|4229760_4232526_-\|tRNA	isoleucine--tRNA ligase	A0A2K9L260	Tupanvirus	5.4e-86	28.2
WP_001131611.1\|4232872_4233379_-	septum site-determining protein DivIVA	NA	NA	NA	NA
WP_023522859.1\|4233468_4234236_-	RNA-binding protein	NA	NA	NA	NA
WP_000214324.1\|4234251_4234515_-	YggT family protein	NA	NA	NA	NA
WP_000119129.1\|4234521_4234992_-	cell division protein SepF	NA	NA	NA	NA
WP_023522860.1\|4235011_4235686_-	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_001209012.1\|4235682_4236501_-	peptidoglycan editing factor PgeF	NA	NA	NA	NA
WP_000236749.1\|4236620_4236902_-	YlmC/YmxH family sporulation protein	NA	NA	NA	NA
WP_000197755.1\|4237065_4237845_-	RNA polymerase sporulation sigma factor SigG	A0A0Y0AU18	Bacillus_phage	3.4e-46	43.9
WP_000976948.1\|4238002_4238722_-	RNA polymerase sporulation sigma factor SigE	A0A2H4JC68	uncultured_Caudovirales_phage	3.3e-19	42.9
WP_023522861.1\|4238741_4239659_-	sigma-E processing peptidase SpoIIGA	NA	NA	NA	NA
WP_000888984.1\|4239919_4241074_-	cell division protein FtsZ	NA	NA	NA	NA
WP_001087557.1\|4241113_4242421_-	cell division protein FtsA	NA	NA	NA	NA
WP_001065789.1\|4242820_4243591_-	cell division protein DivIB	NA	NA	NA	NA
WP_023522862.1\|4243689_4244595_-	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_023522863.1\|4244808_4245903_-	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	NA	NA	NA	NA
WP_000753524.1\|4246006_4247098_-	stage V sporulation protein E	NA	NA	NA	NA
WP_000860103.1\|4247188_4248541_-	UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase	NA	NA	NA	NA
WP_023522864.1\|4248541_4249516_-	phospho-N-acetylmuramoyl-pentapeptide- transferase	NA	NA	NA	NA
WP_000766289.1\|4249538_4251014_-	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase	NA	NA	NA	NA
WP_023522865.1\|4251199_4253116_-	stage V sporulation protein D	NA	NA	NA	NA
WP_043924825.1\|4253197_4255297_-	penicillin-binding protein	NA	NA	NA	NA
WP_000182804.1\|4255369_4255732_-	cell division protein FtsL	NA	NA	NA	NA
WP_000472508.1\|4255747_4256680_-	16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH	NA	NA	NA	NA
WP_023522867.1\|4257049_4258666_-	bacillithiol biosynthesis cysteine-adding enzyme BshC	NA	NA	NA	NA
WP_014482115.1\|4258745_4259630_-	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_000506690.1\|4259925_4260399_+	N-acetyltransferase	NA	NA	NA	NA
WP_000246469.1\|4260434_4260941_-	RsfA family transcriptional regulator	G3MB11	Bacillus_virus	3.0e-11	34.7
WP_001984764.1\|4261070_4261244_-	50S ribosomal protein L32	NA	NA	NA	NA
WP_000872146.1\|4261305_4261806_-	DUF177 domain-containing protein	NA	NA	NA	NA
WP_023522868.1\|4262397_4262910_+	hypothetical protein	D2XR34	Bacillus_phage	1.7e-41	87.1
WP_023522869.1\|4263288_4264062_-	N-acetylmuramoyl-L-alanine amidase	S5M842	Bacillus_phage	1.1e-76	60.7
WP_023522870.1\|4264061_4264502_-\|holin	phage holin family protein	A0A1B1P7S2	Bacillus_phage	6.5e-71	92.5
WP_023520826.1\|4265576_4266851_-	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_023522873.1\|4267367_4273172_-\|tail	phage tail protein	D2XR28	Bacillus_phage	0.0e+00	43.7
WP_023522874.1\|4273168_4274644_-\|tail	phage tail family protein	A0A1Z1LZM7	Bacillus_phage	4.2e-162	55.8
WP_080672425.1\|4274685_4278312_-	DUF2207 domain-containing protein	A0A2H4JAI2	uncultured_Caudovirales_phage	1.0e-185	86.0
WP_023522876.1\|4278324_4278900_-	hypothetical protein	A0A2H4JAG8	uncultured_Caudovirales_phage	2.4e-41	70.6
WP_023522877.1\|4278906_4279500_-\|tail	phage tail protein	A0A2H4JDV4	uncultured_Caudovirales_phage	1.4e-100	91.3
WP_023522878.1\|4279500_4279830_-	hypothetical protein	A0A2H4JAG4	uncultured_Caudovirales_phage	5.4e-54	95.4
WP_023522879.1\|4279829_4280171_-	HK97 gp10 family phage protein	A0A2H4JAH8	uncultured_Caudovirales_phage	1.9e-49	87.6
WP_023522880.1\|4280172_4280523_-\|head	phage head closure protein	D2XR20	Bacillus_phage	1.9e-52	87.8
WP_023522881.1\|4280524_4280818_-	hypothetical protein	D2XR19	Bacillus_phage	2.9e-43	89.7
WP_023522882.1\|4280830_4281994_-\|capsid	phage major capsid protein	A0A2H4JH29	uncultured_Caudovirales_phage	6.8e-208	95.6
WP_023522883.1\|4282013_4282790_-\|protease	Clp protease ClpP	R9TLM7	Paenibacillus_phage	4.6e-59	53.7
WP_023521170.1\|4283090_4284284_+\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	1.0e-25	26.8
WP_043924828.1\|4284377_4285463_-\|portal	phage portal protein	A0A2H4JAJ1	uncultured_Caudovirales_phage	2.4e-183	90.5
WP_023522885.1\|4285528_4287187_-\|terminase	terminase large subunit	A0A2H4JHE9	uncultured_Caudovirales_phage	8.6e-257	79.0
WP_043924700.1\|4287183_4287519_-	hypothetical protein	A0A1B1P762	Bacillus_phage	2.3e-07	31.2
WP_023522887.1\|4287672_4288008_-	HNH endonuclease	D2XR61	Bacillus_phage	2.7e-48	83.8
WP_023522888.1\|4288023_4288332_-	hypothetical protein	A0A288WFY9	Bacillus_phage	1.2e-15	45.8
WP_023522889.1\|4288814_4289027_-	hypothetical protein	A0A1B1P8F3	Bacillus_phage	2.0e-25	84.3
WP_023522890.1\|4290133_4290325_-	hypothetical protein	NA	NA	NA	NA
WP_023522891.1\|4290800_4291022_-	hypothetical protein	A0A1B0T6C4	Bacillus_phage	2.2e-11	43.8
WP_006929356.1\|4291238_4291781_-\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	1.7e-92	95.0
WP_023522892.1\|4291780_4292263_-	ArpU family phage transcriptional regulator	H0USV3	Bacillus_phage	2.0e-73	83.1
WP_000645584.1\|4292542_4292665_-	DUF3983 domain-containing protein	NA	NA	NA	NA
WP_001013298.1\|4292917_4293163_+	hypothetical protein	NA	NA	NA	NA
WP_023522893.1\|4294033_4294438_+	helix-turn-helix domain-containing protein	A0A142F1N8	Bacillus_phage	1.8e-06	57.8
WP_023522894.1\|4295033_4295309_-	hypothetical protein	J9PL99	Bacillus_phage	4.1e-31	70.0
WP_023522895.1\|4295492_4295975_-	nucleoside triphosphate pyrophosphohydrolase family protein	A0A0U4IBD0	Bacillus_phage	1.2e-20	48.2
WP_023522896.1\|4295994_4296246_-	hypothetical protein	A0A0K2CNP4	Brevibacillus_phage	8.4e-07	42.2
WP_000717826.1\|4296271_4296439_-	DUF3954 domain-containing protein	A0A1B0T6B8	Bacillus_phage	1.4e-13	62.3
WP_023522897.1\|4296457_4296817_-	hypothetical protein	A0A1B1P7A1	Bacillus_phage	3.2e-31	52.5
WP_023522898.1\|4296809_4297088_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	5.7e-12	57.6
WP_023522899.1\|4297104_4297299_-	hypothetical protein	A0A1B1P7U7	Bacillus_phage	5.3e-25	87.5
WP_023522900.1\|4297379_4297604_+	hypothetical protein	Q9T1I9	Lactobacillus_phage	2.6e-15	61.4
WP_023522901.1\|4297600_4297804_-	hypothetical protein	NA	NA	NA	NA
WP_052364204.1\|4297820_4298696_-	ATP-binding protein	Q2I8C8	Bacillus_phage	4.5e-63	45.8
WP_023522903.1\|4298634_4299522_-	DnaD domain protein	W8CYG5	Bacillus_phage	1.1e-43	43.6
WP_023522904.1\|4299528_4299705_-	hypothetical protein	A0A0U3SQC4	Bacillus_phage	1.4e-24	94.7
WP_023522905.1\|4299734_4299899_-	hypothetical protein	A0A0U3B230	Bacillus_phage	4.5e-17	79.6
WP_023522906.1\|4299955_4300156_-	helix-turn-helix domain-containing protein	A0A0U4IIS1	Bacillus_phage	1.5e-06	48.0
WP_023522907.1\|4300214_4300436_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_023522908.1\|4300656_4301025_+	helix-turn-helix transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	7.0e-10	38.7
WP_023522910.1\|4301292_4301442_-	hypothetical protein	NA	NA	NA	NA
WP_023522911.1\|4301454_4302552_-	hypothetical protein	NA	NA	NA	NA
WP_023522912.1\|4302989_4303334_+	helix-turn-helix transcriptional regulator	A0A1B1P888	Bacillus_phage	2.1e-16	37.5
WP_023522913.1\|4303423_4303585_-	hypothetical protein	NA	NA	NA	NA
WP_000924328.1\|4303581_4303740_-	hypothetical protein	NA	NA	NA	NA
WP_023522914.1\|4303741_4303900_-	hypothetical protein	NA	NA	NA	NA
WP_023522915.1\|4303922_4304072_-	hypothetical protein	NA	NA	NA	NA
WP_000511407.1\|4304181_4304487_-	STAS-like domain-containing protein	J7KJ12	Streptococcus_phage	4.8e-12	45.2
WP_023522916.1\|4304477_4305380_-	sensor histidine kinase	NA	NA	NA	NA
WP_023522917.1\|4305608_4306739_+\|integrase	site-specific integrase	A0A0U4JNS1	Bacillus_phage	6.9e-64	38.8
4307130:4307146	attR	NA	NA	NA	NA

DBSCAN-SWA_11

4595449 : 4647036

Bacillus_phage(62.96%)

terminase,plate,transposase,portal,tail,capsid,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023523017.1\|4595449_4596580_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	D2XQ03	Bacillus_virus	4.0e-72	42.7
WP_023523018.1\|4597475_4600874_-	methionine synthase	A0A140XBC7	Dickeya_phage	4.8e-12	51.7
WP_023523019.1\|4600873_4602706_-	bifunctional homocysteine S-methyltransferase/methylenetetrahydrofolate reductase	NA	NA	NA	NA
WP_000103889.1\|4603294_4604407_+	cystathionine gamma-synthase/O-acetylhomoserine thiolyase	A0A0B5JD48	Pandoravirus	4.4e-15	28.2
WP_023523020.1\|4604403_4605567_+	cystathionine beta-lyase	NA	NA	NA	NA
WP_000379154.1\|4605731_4606244_+	cysteine hydrolase	NA	NA	NA	NA
WP_000894377.1\|4606677_4606968_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_023523021.1\|4607110_4608223_-	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_000871225.1\|4608232_4608862_-	MBL fold metallo-hydrolase	A0A1X9I5D3	Streptococcus_phage	5.4e-34	38.2
WP_000524852.1\|4609032_4609206_+	DUF2759 domain-containing protein	NA	NA	NA	NA
WP_000391701.1\|4609286_4610270_-	glucokinase	NA	NA	NA	NA
WP_000253699.1\|4610289_4610490_-	YqgQ family protein	NA	NA	NA	NA
WP_023523022.1\|4610592_4611171_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_001265616.1\|4611275_4611425_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_023523023.1\|4611494_4613849_-	NTP transferase domain-containing protein	G3MA50	Bacillus_virus	2.8e-19	32.5
WP_023523024.1\|4614189_4614846_-	phosphate signaling complex protein PhoU	NA	NA	NA	NA
WP_023523025.1\|4615135_4615951_-	phosphate ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.5e-17	30.2
WP_023523026.1\|4615979_4616846_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_023523027.1\|4616847_4617798_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_000871814.1\|4617825_4618743_-	PstS family phosphate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_023523028.1\|4619196_4621326_-	penicillin-binding protein 2	NA	NA	NA	NA
WP_023523029.1\|4621785_4622862_+	hypothetical protein	A0A0S2MVF4	Bacillus_phage	2.5e-07	40.0
WP_023523030.1\|4623182_4624880_-	hypothetical protein	NA	NA	NA	NA
WP_043924707.1\|4626152_4626416_+	hypothetical protein	A0A1B0T6A3	Bacillus_phage	1.3e-18	82.5
WP_023523032.1\|4626381_4627425_-	N-acetylmuramoyl-L-alanine amidase	A0A0A7AQV3	Bacillus_phage	1.3e-165	82.0
WP_023523033.1\|4627484_4627688_-	hypothetical protein	D2XR32	Bacillus_phage	1.1e-17	60.6
WP_023523034.1\|4627690_4627972_-	hypothetical protein	D2XR31	Bacillus_phage	8.5e-32	74.2
WP_001113017.1\|4628044_4628263_-	hemolysin XhlA family protein	A0A1B1P780	Bacillus_phage	2.7e-17	67.6
WP_000389748.1\|4628469_4628694_-	hypothetical protein	A0A1B1P780	Bacillus_phage	1.4e-21	77.0
WP_023523035.1\|4629318_4630407_-\|plate	BppU family phage baseplate upper protein	A0A1B1P768	Bacillus_phage	8.2e-123	60.3
WP_023523036.1\|4630396_4632763_-\|tail	phage tail protein	A0A1C8E983	Bacillus_phage	0.0e+00	89.2
WP_023523037.1\|4632759_4633443_-\|tail	phage tail family protein	A0A1C8EA72	Bacillus_phage	6.3e-89	68.6
WP_023523038.1\|4633444_4636870_-	phage protein	A0A0S2SXL7	Bacillus_phage	3.1e-83	36.9
WP_000180528.1\|4637052_4637409_-	hypothetical protein	A0A1S7FZ84	Listeria_phage	8.3e-08	32.7
WP_001143441.1\|4637468_4638038_-	hypothetical protein	Q858W9	Listeria_phage	6.8e-36	42.2
WP_023523039.1\|4638038_4638449_-	hypothetical protein	NA	NA	NA	NA
WP_023523040.1\|4638438_4638819_-	hypothetical protein	NA	NA	NA	NA
WP_000963828.1\|4638796_4639162_-	hypothetical protein	NA	NA	NA	NA
WP_023523041.1\|4639161_4639473_-	hypothetical protein	A0A1B1P751	Bacillus_phage	2.2e-12	40.5
WP_023523042.1\|4639486_4640608_-\|capsid	phage major capsid protein	R4IBU5	Listeria_phage	6.7e-96	49.7
WP_004410858.1\|4640621_4641254_-\|protease	Clp protease ClpP	D2XR17	Bacillus_phage	1.9e-34	49.4
WP_023523043.1\|4641270_4642512_-\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	2.5e-75	39.1
WP_023521170.1\|4642809_4644003_+\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	1.0e-25	26.8
WP_023523044.1\|4644113_4645781_-\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	1.4e-182	57.8
WP_023523045.1\|4645764_4646217_-\|terminase	P27 family phage terminase small subunit	A0A1S7FYW6	Listeria_phage	6.6e-10	38.8
WP_000377852.1\|4646394_4646703_-	hypothetical protein	NA	NA	NA	NA
WP_023523046.1\|4646709_4647036_-	HNH endonuclease	A0A1S7FZ53	Listeria_phage	3.6e-18	47.6

DBSCAN-SWA_12

4908630 : 4916313

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000221100.1\|4908630_4909554_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	6.9e-46	44.0
WP_000247669.1\|4909680_4910616_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	4.9e-23	26.3
WP_000018060.1\|4910617_4911310_-	response regulator transcription factor	W8CYM9	Bacillus_phage	6.3e-36	38.2
WP_001293585.1\|4911478_4911652_+	hypothetical protein	NA	NA	NA	NA
WP_001014310.1\|4911652_4911847_+	YwbE family protein	NA	NA	NA	NA
WP_023523139.1\|4911887_4913087_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	7.3e-72	41.2
WP_000587824.1\|4913381_4913705_+	heme oxygenase	NA	NA	NA	NA
WP_000095598.1\|4913773_4914538_-	class B sortase	NA	NA	NA	NA
WP_000403738.1\|4914569_4915340_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.3e-13	26.6
WP_023523140.1\|4915329_4916313_-	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	7.1e-17	26.9

DBSCAN-SWA_13

5283417 : 5376004

Bacillus_phage(42.86%)

tRNA,head,integrase,terminase,transposase,coat,portal,tail,capsid,protease

attL 5277976:5277999|attR 5378058:5378081

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
5277976:5277999	attL	NA	NA	NA	NA
WP_000287154.1\|5283417_5284794_+\|tRNA	glycine--tRNA ligase	A0A1V0SIF1	Klosneuvirus	3.4e-49	28.1
WP_001140612.1\|5284833_5285217_-	hotdog fold thioesterase	NA	NA	NA	NA
WP_000810334.1\|5285312_5286056_+	DUF3298 and DUF4163 domain-containing protein	NA	NA	NA	NA
WP_001253379.1\|5286106_5286700_+	biotin transporter BioY	NA	NA	NA	NA
WP_000757822.1\|5286745_5287633_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.2e-79	54.1
WP_023523269.1\|5287740_5289465_-	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	1.2e-176	53.7
WP_023523270.1\|5289608_5290214_+	DNA integrity scanning protein DisA nucleotide-binding domain protein	NA	NA	NA	NA
WP_023523271.1\|5290627_5291875_-	hypothetical protein	NA	NA	NA	NA
WP_023523272.1\|5291890_5292313_-	divergent PAP2 family protein	NA	NA	NA	NA
WP_001183889.1\|5292324_5292669_-	EamA family transporter	NA	NA	NA	NA
WP_001206694.1\|5292771_5293659_-	decaprenyl-phosphate phosphoribosyltransferase	NA	NA	NA	NA
WP_023523274.1\|5294214_5295699_-	cytosol aminopeptidase	Q6GYZ8	Mycoplasma_phage	2.5e-58	36.4
WP_002094181.1\|5295844_5296471_-	3D domain-containing protein	A0A0H3UZG2	Geobacillus_virus	2.1e-14	43.0
WP_000027016.1\|5296556_5296874_-	YuiB family protein	NA	NA	NA	NA
WP_023523275.1\|5296870_5297377_-	NUDIX hydrolase	NA	NA	NA	NA
WP_000856602.1\|5297694_5298903_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_043924718.1\|5299365_5300355_+	NAD(P)/FAD-dependent oxidoreductase	Q9JRK7	Streptococcus_phage	2.3e-31	51.6
WP_023523277.1\|5300423_5310245_-	DUF11 domain-containing protein	NA	NA	NA	NA
WP_023523278.1\|5310708_5311188_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_000391931.1\|5311406_5312654_+	MFS transporter	NA	NA	NA	NA
WP_023523279.1\|5312671_5313553_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_000635489.1\|5313633_5314095_+	DUF523 domain-containing protein	NA	NA	NA	NA
WP_023523280.1\|5314420_5315497_+	hypothetical protein	NA	NA	NA	NA
WP_023523281.1\|5315697_5316000_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	5.9e-15	47.2
WP_167332625.1\|5316309_5317350_-	collagen-like protein	NA	NA	NA	NA
WP_023523283.1\|5318224_5318689_+	hypothetical protein	NA	NA	NA	NA
WP_023523284.1\|5318700_5319204_+	hypothetical protein	NA	NA	NA	NA
WP_023523285.1\|5319685_5320786_-	N-acetylmuramoyl-L-alanine amidase	A0A2H4JAS1	uncultured_Caudovirales_phage	1.4e-175	85.0
WP_023523286.1\|5320782_5321022_-	hypothetical protein	A0A2H4J378	uncultured_Caudovirales_phage	5.5e-32	93.7
WP_023523287.1\|5321021_5321258_-	hemolysin XhlA family protein	A0A2H4J382	uncultured_Caudovirales_phage	4.3e-13	85.9
WP_023523289.1\|5323316_5326487_-\|tail	phage tail protein	W8CYT7	Bacillus_phage	0.0e+00	71.9
WP_043924619.1\|5326483_5327968_-\|tail	phage tail family protein	W8CYY9	Bacillus_phage	1.2e-294	99.4
WP_023523290.1\|5327979_5331906_-\|tail	phage tail tape measure protein	A0A0S2GLG8	Bacillus_phage	0.0e+00	90.4
WP_023523291.1\|5332126_5332444_-	hypothetical protein	A0A0S2GLH2	Bacillus_phage	1.6e-50	95.2
WP_023523292.1\|5332490_5333081_-\|tail	phi13 family phage major tail protein	W8CYT6	Bacillus_phage	2.1e-93	97.4
WP_023523293.1\|5333081_5333441_-	DUF3168 domain-containing protein	H0USX0	Bacillus_phage	4.2e-60	97.5
WP_023523294.1\|5333437_5333872_-	HK97 gp10 family phage protein	W8CZ44	Bacillus_phage	8.4e-71	91.0
WP_023523295.1\|5333864_5334188_-\|head	phage head closure protein	H0USW8	Bacillus_phage	3.8e-52	91.6
WP_023523296.1\|5334174_5334462_-\|head,tail	phage gp6-like head-tail connector protein	H0USW7	Bacillus_phage	1.1e-37	86.2
WP_023523297.1\|5334482_5335655_-\|capsid	phage major capsid protein	A0A2H4J387	uncultured_Caudovirales_phage	3.6e-193	87.7
WP_080672440.1\|5335692_5336403_-\|protease	Clp protease ClpP	A0A0S2GLD5	Bacillus_phage	4.4e-117	89.8
WP_023523299.1\|5336386_5337637_-\|portal	phage portal protein	A0A0S2GLJ4	Bacillus_phage	9.5e-216	88.0
WP_023523300.1\|5337823_5339518_-\|terminase	terminase large subunit	A0A0S2GLF0	Bacillus_phage	6.2e-311	95.7
WP_023523301.1\|5339519_5340023_-\|terminase	phage terminase small subunit P27 family	A0A0S2GLF2	Bacillus_phage	2.9e-83	94.6
WP_043924719.1\|5340319_5340697_-	HNH endonuclease	A0A2H4J3B4	uncultured_Caudovirales_phage	1.6e-57	84.8
WP_023523303.1\|5340686_5340917_-	hypothetical protein	NA	NA	NA	NA
WP_023523304.1\|5340923_5341142_-	hypothetical protein	H0USV9	Bacillus_phage	1.3e-27	92.8
WP_023523307.1\|5341481_5341721_-	hypothetical protein	NA	NA	NA	NA
WP_023523308.1\|5341881_5342628_+\|protease	zinc-dependent metalloprotease	NA	NA	NA	NA
WP_023523309.1\|5342983_5343358_-	phage transcriptional regulator, ArpU family protein	D2XQ27	Bacillus_virus	7.1e-10	34.4
WP_023523311.1\|5344022_5344826_-	phage antirepressor KilAC domain-containing protein	A0A1Q1PVZ8	Staphylococcus_phage	4.1e-71	52.1
WP_043924720.1\|5344925_5345351_-	hypothetical protein	NA	NA	NA	NA
WP_080672441.1\|5345360_5346101_-	zinc-finger domain-containing protein	A0A2H4JAV2	uncultured_Caudovirales_phage	5.4e-09	34.3
WP_023523314.1\|5346066_5346774_-	hypothetical protein	NA	NA	NA	NA
WP_023523315.1\|5346773_5347205_-	DUF1064 domain-containing protein	A0A2P1JTY5	Anoxybacillus_phage	3.6e-29	51.1
WP_052364205.1\|5347211_5347475_-	hypothetical protein	NA	NA	NA	NA
WP_023523317.1\|5347479_5348781_-	AAA family ATPase	A0A1B1P7G6	Bacillus_phage	5.4e-89	41.9
WP_080672442.1\|5348780_5349656_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_023523319.1\|5349691_5350489_-	recombination protein RecT	S6AVW6	Thermus_phage	2.3e-90	65.0
WP_023523320.1\|5350509_5351445_-	YqaJ viral recombinase family protein	S6C475	Thermus_phage	1.3e-100	59.2
WP_023523321.1\|5351523_5351718_-	hypothetical protein	NA	NA	NA	NA
WP_023523322.1\|5351718_5352021_-	hypothetical protein	H0USU0	Bacillus_phage	8.0e-28	65.7
WP_023523323.1\|5352254_5352443_-	helix-turn-helix transcriptional regulator	A0A0S2GLE9	Bacillus_phage	1.2e-18	77.4
WP_023523324.1\|5352467_5352785_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_023523325.1\|5352964_5353303_+	helix-turn-helix transcriptional regulator	E9LUL4	Lactobacillus_phage	3.8e-10	37.1
WP_023523326.1\|5353322_5353499_-	hypothetical protein	NA	NA	NA	NA
WP_023523327.1\|5353773_5354904_-	hypothetical protein	NA	NA	NA	NA
WP_023523328.1\|5355556_5356618_+\|integrase	site-specific integrase	A0A1B2AQ00	Phage_Wrath	7.1e-172	84.7
WP_000833148.1\|5356707_5357061_-	YxeA family protein	A0A0K2CYS5	Paenibacillus_phage	1.3e-13	40.2
WP_003272374.1\|5357167_5357353_-	methyltransferase	NA	NA	NA	NA
WP_023523329.1\|5357756_5358527_-	hypothetical protein	NA	NA	NA	NA
WP_023523330.1\|5359438_5360002_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000573830.1\|5360107_5360461_-	iron-sulfur cluster assembly accessory protein	A0A2H4N7M3	Lake_Baikal_phage	8.2e-16	42.3
WP_000077392.1\|5360502_5361369_-	diaminopimelate epimerase	NA	NA	NA	NA
WP_000595026.1\|5361615_5361855_-	YuzB family protein	NA	NA	NA	NA
WP_000682065.1\|5362207_5363278_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_001054089.1\|5363511_5363685_+	aspartyl-phosphate phosphatase Spo0E family protein	NA	NA	NA	NA
WP_023523331.1\|5363739_5364399_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.9e-22	34.6
WP_000679254.1\|5364382_5365180_+	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
WP_023523332.1\|5365401_5365743_-	alkylphosphonate utilization operon protein PhnA	NA	NA	NA	NA
WP_141526248.1\|5366253_5367051_-	DUF2628 domain-containing protein	NA	NA	NA	NA
WP_023523335.1\|5367377_5368055_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_043924852.1\|5368152_5368947_-	nucleotidyltransferase domain-containing protein	NA	NA	NA	NA
WP_000248588.1\|5368999_5369308_-	YuzD family protein	NA	NA	NA	NA
WP_000431159.1\|5369503_5369740_+	NifU family protein	Q58MC7	Prochlorococcus_phage	2.0e-10	46.6
WP_001125507.1\|5369935_5370151_+	hypothetical protein	NA	NA	NA	NA
WP_000614216.1\|5370212_5371214_-\|coat	spore coat protein CotS	NA	NA	NA	NA
WP_000665103.1\|5371334_5371826_+	phosphatidylglycerophosphatase A	G3MBC5	Bacillus_virus	3.5e-41	53.8
WP_023523337.1\|5371849_5372329_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_023523338.1\|5372491_5373595_+	HpcH/HpaI aldolase/citrate lyase family protein	NA	NA	NA	NA
WP_023523339.1\|5373539_5374886_+	phosphoribosyltransferase family protein	NA	NA	NA	NA
WP_000241506.1\|5374891_5376004_+\|protease	cysteine protease StiP family protein	NA	NA	NA	NA
5378058:5378081	attR	NA	NA	NA	NA

DBSCAN-SWA_14

5483780 : 5557767

Bacillus_phage(69.05%)

tRNA,head,integrase,holin,terminase,transposase,portal,tail,capsid,protease

attL 5514661:5514681|attR 5555471:5555491

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099046439.1\|5483780_5484570_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_000760481.1\|5486027_5486372_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_001115309.1\|5486808_5487249_+	DUF1641 domain-containing protein	NA	NA	NA	NA
WP_000043199.1\|5487293_5488472_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_023523376.1\|5488667_5489927_-\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	4.0e-89	42.4
WP_001057105.1\|5490296_5491214_-	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_000573647.1\|5491596_5491992_-	SET domain-containing protein-lysine N-methyltransferase	NA	NA	NA	NA
WP_000455088.1\|5492200_5493703_-	DUF4077 domain-containing protein	NA	NA	NA	NA
WP_023523377.1\|5493735_5494794_-	endonuclease/exonuclease/phosphatase	NA	NA	NA	NA
WP_000639312.1\|5495140_5495545_+	fluoride efflux transporter CrcB	NA	NA	NA	NA
WP_000568581.1\|5495541_5495898_+	fluoride efflux transporter CrcB	NA	NA	NA	NA
WP_023523378.1\|5495967_5496207_-	DUF3947 family protein	NA	NA	NA	NA
WP_078994137.1\|5496286_5496538_-	DUF3955 domain-containing protein	NA	NA	NA	NA
WP_023523380.1\|5496655_5497177_-	spermidine N1-acetyltransferase	NA	NA	NA	NA
WP_000834709.1\|5497318_5497723_-	phosphate-starvation-inducible protein PsiE	NA	NA	NA	NA
WP_001001091.1\|5499164_5499722_+	cysteine hydrolase	A0A1V0SL12	Klosneuvirus	2.2e-07	28.3
WP_000460485.1\|5499762_5500191_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_023523381.1\|5500553_5501519_+	DUF4822 domain-containing protein	NA	NA	NA	NA
WP_000608841.1\|5501617_5502049_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_000409981.1\|5502038_5502335_-	transporter suffix domain-containing protein	NA	NA	NA	NA
WP_000576726.1\|5502530_5504069_-	anthrolysin O/cereolysin O family cholesterol-dependent cytolysin	NA	NA	NA	NA
WP_000590061.1\|5504504_5505257_-	ATP-binding cassette domain-containing protein	NA	NA	NA	NA
WP_000631247.1\|5505253_5506318_-	iron chelate uptake ABC transporter family permease subunit	NA	NA	NA	NA
WP_000042077.1\|5506314_5507331_-	iron chelate uptake ABC transporter family permease subunit	A0A2H4IY97	uncultured_Caudovirales_phage	3.0e-58	36.8
WP_000749445.1\|5507350_5508367_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000815803.1\|5508752_5509430_-	response regulator transcription factor	NA	NA	NA	NA
WP_016123739.1\|5509926_5510694_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_001123920.1\|5511501_5511969_-	SsrA-binding protein	W5RAM5	Staphylococcus_phage	5.4e-47	63.2
WP_023523382.1\|5512095_5514528_-	ribonuclease R	Q0GXV6	Lactococcus_phage	3.2e-90	40.4
5514661:5514681	attL	NA	NA	NA	NA
WP_023523383.1\|5515013_5516090_+	replication protein	A0A0S2MVF4	Bacillus_phage	1.1e-10	39.3
WP_023523384.1\|5516335_5517394_-	glycosyltransferase family 2 protein	S5WBE2	Pseudomonas_phage	2.6e-09	22.6
WP_023523385.1\|5517647_5520023_-	collagen-like triple helix repeat-containing protein	NA	NA	NA	NA
WP_043924707.1\|5521295_5521559_+	hypothetical protein	A0A1B0T6A3	Bacillus_phage	1.3e-18	82.5
WP_023523032.1\|5521524_5522568_-	N-acetylmuramoyl-L-alanine amidase	A0A0A7AQV3	Bacillus_phage	1.3e-165	82.0
WP_023523386.1\|5522627_5522831_-	hypothetical protein	D2XR32	Bacillus_phage	4.5e-19	63.6
WP_000151299.1\|5522833_5523115_-	hypothetical protein	D2XR31	Bacillus_phage	1.0e-32	76.9
WP_023523388.1\|5524053_5525538_-\|tail	phage tail family protein	W8CYY9	Bacillus_phage	3.8e-280	94.3
WP_023523389.1\|5525549_5529401_-\|tail	phage tail tape measure protein	A0A288WG88	Bacillus_phage	0.0e+00	87.7
WP_000344051.1\|5529415_5529592_-	hypothetical protein	I3WTY5	Bacillus_phage	5.9e-23	91.4
WP_023523390.1\|5529621_5529939_-	hypothetical protein	W8CYN3	Bacillus_phage	2.1e-47	88.6
WP_023523391.1\|5529987_5530590_-\|tail	phi13 family phage major tail protein	W8CYT6	Bacillus_phage	2.1e-96	97.0
WP_023523392.1\|5530590_5530950_-	DUF3168 domain-containing protein	W8CYY6	Bacillus_phage	3.6e-59	95.0
WP_023523393.1\|5530946_5531384_-	HK97 gp10 family phage protein	A0A288WGM7	Bacillus_phage	3.0e-76	98.6
WP_023523394.1\|5531376_5531700_-\|head	phage head closure protein	H0USW8	Bacillus_phage	6.5e-52	90.7
WP_023523395.1\|5531686_5531974_-\|head,tail	phage gp6-like head-tail connector protein	H0USW7	Bacillus_phage	1.3e-35	81.9
WP_023523396.1\|5531994_5533167_-\|capsid	phage major capsid protein	A0A2H4J387	uncultured_Caudovirales_phage	8.6e-195	90.5
WP_023523397.1\|5533204_5533915_-\|protease	Clp protease ClpP	H0USW5	Bacillus_phage	5.3e-123	95.3
WP_023521170.1\|5534204_5535398_+\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	1.0e-25	26.8
WP_023523398.1\|5535457_5536738_-\|portal	phage portal protein	A0A0S2GLJ4	Bacillus_phage	6.7e-233	97.1
WP_023523399.1\|5536925_5538620_-\|terminase	terminase large subunit	A0A0S2GLF0	Bacillus_phage	0.0e+00	93.4
WP_023523400.1\|5538621_5539125_-\|terminase	phage terminase small subunit P27 family	A0A0S2GLF2	Bacillus_phage	2.0e-87	97.6
WP_023523401.1\|5539437_5539815_-	HNH endonuclease	H0USW1	Bacillus_phage	8.4e-67	95.2
WP_023523402.1\|5539804_5540059_-	hypothetical protein	A0A0S2GLL6	Bacillus_phage	4.2e-38	88.1
WP_023523403.1\|5540192_5540405_-	hypothetical protein	A0A0S2MV92	Bacillus_phage	1.7e-29	95.7
WP_023523405.1\|5541069_5541444_-	phage transcriptional regulator, ArpU family protein	D2XQ27	Bacillus_virus	1.9e-10	34.4
WP_023523406.1\|5541838_5542642_-	phage antirepressor KilAC domain-containing protein	A0A1Q1PVZ8	Staphylococcus_phage	1.9e-68	50.2
WP_157762868.1\|5543743_5544010_-	zinc-finger domain-containing protein	NA	NA	NA	NA
WP_080672445.1\|5544019_5544739_-	zinc-finger domain-containing protein	A0A2H4JAV2	uncultured_Caudovirales_phage	2.3e-09	35.2
WP_023523315.1\|5545411_5545843_-	DUF1064 domain-containing protein	A0A2P1JTY5	Anoxybacillus_phage	3.6e-29	51.1
WP_052364205.1\|5545849_5546113_-	hypothetical protein	NA	NA	NA	NA
WP_023523413.1\|5546117_5547419_-	AAA family ATPase	A0A1B1P7G6	Bacillus_phage	1.3e-90	42.1
WP_080672446.1\|5547418_5548294_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_023523415.1\|5548329_5549127_-	recombination protein RecT	S6AVW6	Thermus_phage	7.6e-94	67.5
WP_023523416.1\|5549147_5550083_-	YqaJ viral recombinase family protein	S6C475	Thermus_phage	8.4e-100	59.2
WP_023523418.1\|5550355_5550658_-	hypothetical protein	H0USU0	Bacillus_phage	2.7e-28	68.6
WP_023523419.1\|5551030_5551219_-	helix-turn-helix transcriptional regulator	W8CYN7	Bacillus_phage	5.7e-24	90.3
WP_023523420.1\|5551297_5551501_-	helix-turn-helix transcriptional regulator	A0A0A7AQV9	Bacillus_phage	4.0e-15	59.1
WP_023523421.1\|5551661_5552021_+	helix-turn-helix transcriptional regulator	H0UST7	Bacillus_phage	3.3e-12	38.5
WP_043924862.1\|5552536_5553697_-	helix-turn-helix transcriptional regulator	A0A0S2MVK2	Bacillus_phage	1.0e-123	59.9
WP_043924722.1\|5554357_5555419_+\|integrase	site-specific integrase	H0UST3	Bacillus_phage	1.9e-156	75.9
WP_000761986.1\|5555480_5556221_-	carboxylesterase	NA	NA	NA	NA
5555471:5555491	attR	NA	NA	NA	NA
WP_000557266.1\|5556381_5556615_-	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_000078304.1\|5556709_5557402_-	LrgB family protein	NA	NA	NA	NA
WP_000673222.1\|5557398_5557767_-\|holin	CidA/LrgA family holin-like protein	NA	NA	NA	NA

DBSCAN-SWA_15

5584617 : 5684179

111

Bacillus_phage(44.07%)

head,holin,terminase,plate,transposase,portal,tail,capsid,bacteriocin,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023523437.1\|5584617_5585007_-	hypothetical protein	A0A1C8E9D1	Bacillus_phage	1.5e-34	55.5
WP_006921851.1\|5585024_5585147_-	DUF3983 domain-containing protein	NA	NA	NA	NA
WP_023523438.1\|5585315_5585510_-	hypothetical protein	NA	NA	NA	NA
WP_023523439.1\|5585964_5586510_-	ERCC4 domain-containing protein	A0A0S2SXQ1	Bacillus_phage	9.6e-48	53.1
WP_023523440.1\|5586500_5586935_-	hypothetical protein	A0A2H4JFQ6	uncultured_Caudovirales_phage	1.8e-52	64.5
WP_023523441.1\|5586922_5587147_-	hypothetical protein	NA	NA	NA	NA
WP_023523442.1\|5587417_5589772_-	hypothetical protein	A0A1B2AQ05	Phage_Wrath	0.0e+00	79.4
WP_023523443.1\|5589844_5590321_-	DUF669 domain-containing protein	A0A1B2AQ07	Phage_Wrath	1.9e-31	48.4
WP_043924723.1\|5590341_5591013_-	AAA family ATPase	A0A1B2AQ06	Phage_Wrath	6.0e-116	91.9
WP_023521063.1\|5591018_5591210_-	hypothetical protein	NA	NA	NA	NA
WP_157447755.1\|5591206_5591392_-	hypothetical protein	NA	NA	NA	NA
WP_023523445.1\|5591680_5592028_-	hypothetical protein	A0A2H4JBP9	uncultured_Caudovirales_phage	3.1e-52	88.6
WP_023521170.1\|5592326_5593520_+\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	1.0e-25	26.8
WP_043924724.1\|5593599_5593779_-	hypothetical protein	A0A1B2APZ0	Phage_Wrath	4.3e-13	76.9
WP_023523446.1\|5593837_5594071_-	DUF771 domain-containing protein	Q9MBW7	Lactococcus_phage	5.6e-05	43.5
WP_023523447.1\|5594105_5594336_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_023523448.1\|5594500_5594893_+	helix-turn-helix transcriptional regulator	A0A1Q1PVX8	Staphylococcus_phage	2.5e-13	58.5
WP_043924725.1\|5594903_5595371_+	hypothetical protein	NA	NA	NA	NA
WP_000216166.1\|5596951_5597158_+	DUF1657 domain-containing protein	NA	NA	NA	NA
WP_001228545.1\|5597251_5597737_+	YhcN/YlaJ family sporulation lipoprotein	NA	NA	NA	NA
WP_000095399.1\|5597766_5598243_+	stage V sporulation protein AC	NA	NA	NA	NA
WP_000938970.1\|5598243_5599260_+	stage V sporulation protein AD	NA	NA	NA	NA
WP_000575919.1\|5599256_5599607_+	stage V sporulation protein AE	NA	NA	NA	NA
WP_000215897.1\|5599618_5599825_+	DUF1657 domain-containing protein	NA	NA	NA	NA
WP_000018924.1\|5599845_5600715_+	DUF421 domain-containing protein	NA	NA	NA	NA
WP_001049162.1\|5600955_5601537_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	1.3e-55	56.5
WP_000250307.1\|5601869_5602118_-	HPr family phosphocarrier protein	NA	NA	NA	NA
WP_000006566.1\|5602141_5603092_-	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	1.3e-52	38.4
WP_000712187.1\|5603180_5604134_-	YvcK family protein	A1IMD5	Streptococcus_phage	2.6e-64	43.1
WP_000138459.1\|5604137_5605019_-	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	4.6e-07	28.9
WP_001190080.1\|5605039_5605498_-	8-oxo-dGTP diphosphatase	NA	NA	NA	NA
WP_023523450.1\|5605727_5606534_-	DUF368 domain-containing protein	NA	NA	NA	NA
WP_001288078.1\|5606699_5607656_-	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	1.4e-89	53.6
WP_000517723.1\|5607741_5609253_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_001255077.1\|5609392_5609905_-	acyltransferase	NA	NA	NA	NA
WP_001222403.1\|5609938_5610589_-	pyrophosphatase PpaX	NA	NA	NA	NA
WP_000924240.1\|5610656_5611469_-	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_001127251.1\|5611493_5612423_-	HPr(Ser) kinase/phosphatase	NA	NA	NA	NA
WP_001267308.1\|5612579_5612960_-\|holin	phage holin family protein	NA	NA	NA	NA
WP_000394744.1\|5613075_5613525_-	DUF4275 family protein	NA	NA	NA	NA
WP_000045587.1\|5613584_5616461_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	57.2
WP_000400989.1\|5616466_5618443_-	excinuclease ABC subunit B	NA	NA	NA	NA
WP_023523451.1\|5618595_5619027_-	DUF4362 domain-containing protein	NA	NA	NA	NA
WP_000025200.1\|5619071_5619692_-	hypothetical protein	NA	NA	NA	NA
WP_000260341.1\|5619688_5620450_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_000524131.1\|5620550_5620778_-	hypothetical protein	NA	NA	NA	NA
WP_023523452.1\|5620794_5621190_-	hypothetical protein	NA	NA	NA	NA
WP_001150199.1\|5621186_5621408_-	hypothetical protein	NA	NA	NA	NA
WP_000538364.1\|5621457_5621655_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_023523453.1\|5621972_5622995_-	YeiH family putative sulfate export transporter	NA	NA	NA	NA
WP_023523454.1\|5623146_5624040_+	LysR family transcriptional regulator	A0A2H4J8I9	uncultured_Caudovirales_phage	2.5e-08	42.5
WP_001219209.1\|5624091_5624460_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_023523455.1\|5624464_5625004_+	flavodoxin family protein	NA	NA	NA	NA
WP_023523456.1\|5625012_5625372_+	macrolide efflux pump	NA	NA	NA	NA
WP_023523457.1\|5625472_5625784_-	heavy metal-binding domain-containing protein	NA	NA	NA	NA
WP_000944629.1\|5625849_5627565_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	9.1e-60	31.4
WP_043924726.1\|5627835_5629038_-	membrane protein	NA	NA	NA	NA
WP_002094199.1\|5629129_5630614_-	S41 family peptidase	A0A0R6PIZ1	Moraxella_phage	1.1e-21	27.4
WP_000645028.1\|5630684_5631578_-	cell division ABC transporter permease FtsX	NA	NA	NA	NA
WP_000594326.1\|5631567_5632254_-	cell division ATP-binding protein FtsE	G9BWD6	Planktothrix_phage	2.0e-26	37.4
WP_000727975.1\|5632538_5632862_-	cytochrome c-551	NA	NA	NA	NA
WP_096001455.1\|5633301_5634400_-	peptide chain release factor 2	NA	NA	NA	NA
WP_000579372.1\|5634544_5637052_-	preprotein translocase subunit SecA	NA	NA	NA	NA
WP_000671189.1\|5637325_5637868_-	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
WP_001990088.1\|5638191_5638389_-	cold shock protein CspC	Q9AZD3	Lactococcus_phage	9.8e-19	67.7
WP_023523465.1\|5642248_5643082_+	winged helix-turn-helix domain-containing protein	A0A2H4J6G7	uncultured_Caudovirales_phage	7.9e-118	78.3
WP_080672494.1\|5643173_5644670_+	S8 family serine peptidase	A0A1B0T6A2	Bacillus_phage	2.8e-49	34.1
WP_098856440.1\|5646728_5647424_+	geobacillin-26 family protein	NA	NA	NA	NA
WP_000392440.1\|5648604_5648835_-\|bacteriocin	bacteriocin biosynthesis protein	A0A1B1P7Q9	Bacillus_phage	1.7e-33	98.7
WP_023523471.1\|5650756_5652097_-\|plate	BppU family phage baseplate upper protein	A0A1C8E978	Bacillus_phage	5.4e-116	52.6
WP_023523472.1\|5652111_5654463_-\|tail	phage tail protein	A0A1B0T695	Bacillus_phage	0.0e+00	96.7
WP_023523473.1\|5654459_5655143_-\|tail	phage tail family protein	A0A1C8EA72	Bacillus_phage	1.4e-125	97.4
WP_023523474.1\|5655144_5658435_-\|tail	phage tail tape measure protein	A0A1B0T698	Bacillus_phage	3.5e-302	82.6
WP_000383689.1\|5658451_5658640_-	hypothetical protein	A0A1C8E979	Bacillus_phage	1.6e-31	100.0
WP_023523475.1\|5658678_5659065_-	hypothetical protein	A0A1C8E984	Bacillus_phage	1.5e-63	96.1
WP_001121185.1\|5659076_5659733_-	hypothetical protein	A0A1B1P7Q4	Bacillus_phage	1.0e-104	88.2
WP_023523476.1\|5659744_5660122_-	HK97 gp10 family phage protein	A0A1C8E995	Bacillus_phage	5.1e-56	87.2
WP_001167235.1\|5660121_5660451_-	hypothetical protein	A0A1B1P7P2	Bacillus_phage	2.6e-56	98.2
WP_000824247.1\|5660440_5660770_-	hypothetical protein	A0A1C8E986	Bacillus_phage	2.9e-55	100.0
WP_023523477.1\|5660750_5661011_-\|head,tail	phage gp6-like head-tail connector protein	A0A1B0T690	Bacillus_phage	6.6e-39	93.0
WP_002179411.1\|5661025_5661343_-	collagen-like protein	NA	NA	NA	NA
WP_023523478.1\|5661411_5662710_-\|capsid	phage major capsid protein	A0A2H4JFZ3	uncultured_Caudovirales_phage	3.4e-208	94.7
WP_000687904.1\|5662711_5663293_-\|head,protease	HK97 family phage prohead protease	A0A2H4J861	uncultured_Caudovirales_phage	1.5e-94	93.8
WP_023523479.1\|5663255_5664467_-\|portal	phage portal protein	A0A1B1P7N5	Bacillus_phage	1.1e-216	96.2
WP_023523480.1\|5664482_5666207_-\|terminase	terminase large subunit	A0A1C8E985	Bacillus_phage	0.0e+00	94.3
WP_002179416.1\|5666203_5666629_-\|terminase	P27 family phage terminase small subunit	A0A1C8E969	Bacillus_phage	5.9e-69	92.9
WP_000872551.1\|5666712_5667105_-	HNH endonuclease	A0A1B1P7N1	Bacillus_phage	6.4e-70	93.1
WP_023523482.1\|5667101_5667416_-	Rho termination factor N-terminal domain-containing protein	A0A1B0T6C6	Bacillus_phage	4.7e-47	88.5
WP_167332617.1\|5668278_5668428_-	hypothetical protein	NA	NA	NA	NA
WP_023523483.1\|5669059_5669452_-	hypothetical protein	A0A1C8E9D1	Bacillus_phage	1.0e-38	59.2
WP_023523484.1\|5669469_5669592_-	DUF3983 domain-containing protein	NA	NA	NA	NA
WP_023523485.1\|5669760_5669955_-	hypothetical protein	NA	NA	NA	NA
WP_023523486.1\|5670459_5670999_-	ERCC4 domain-containing protein	A0A0S2SXQ1	Bacillus_phage	3.9e-49	53.7
WP_043924727.1\|5670995_5671436_-	hypothetical protein	A0A2H4JFQ6	uncultured_Caudovirales_phage	3.9e-55	65.7
WP_023523488.1\|5671741_5674117_-	hypothetical protein	A0A1B2AQ05	Phage_Wrath	0.0e+00	70.8
WP_000007638.1\|5674189_5674666_-	DUF669 domain-containing protein	A0A1B2AQ07	Phage_Wrath	7.4e-28	45.3
WP_080672496.1\|5674667_5675183_-	hypothetical protein	A0A2R4P8H7	Staphylococcus_phage	9.8e-42	48.2
WP_043924729.1\|5675298_5675979_-	AAA family ATPase	A0A1B2AQ06	Phage_Wrath	3.3e-114	92.7
WP_023521063.1\|5675984_5676176_-	hypothetical protein	NA	NA	NA	NA
WP_167332609.1\|5676172_5676349_-	hypothetical protein	NA	NA	NA	NA
WP_023523491.1\|5676646_5676997_-	hypothetical protein	A0A2H4JBP9	uncultured_Caudovirales_phage	2.3e-50	86.2
WP_167332618.1\|5676997_5677165_-	hypothetical protein	A0A2H4J829	uncultured_Caudovirales_phage	6.8e-13	78.2
WP_023523492.1\|5677171_5677405_-	hypothetical protein	A0A1B1P7N2	Bacillus_phage	4.1e-24	73.3
WP_023523493.1\|5677424_5677655_-	helix-turn-helix transcriptional regulator	A0A2H4JE95	uncultured_Caudovirales_phage	5.5e-29	90.3
WP_023523494.1\|5677851_5678508_+	helix-turn-helix domain-containing protein	A0A1B1P7L1	Bacillus_phage	2.2e-110	89.4
WP_023523495.1\|5678526_5679882_+	recombinase family protein	A0A2H4J992	uncultured_Caudovirales_phage	3.1e-212	82.5
WP_006917658.1\|5679914_5680316_-	hypothetical protein	NA	NA	NA	NA
WP_043924731.1\|5680443_5681829_-	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	1.3e-11	39.8
WP_000400857.1\|5681977_5682292_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000684727.1\|5682464_5683307_-	DegV family protein	A0A0N9SI50	Staphylococcus_phage	6.1e-17	40.8
WP_023523497.1\|5683543_5684179_+	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	4.7e-38	40.6

DBSCAN-SWA_16

5759751 : 5766640

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023523530.1\|5759751_5760744_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	1.8e-52	39.3
WP_023523531.1\|5760833_5761652_-	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_023523532.1\|5761750_5762665_-	LytR family transcriptional regulator	NA	NA	NA	NA
WP_023523533.1\|5762766_5763159_-	glycerol-3-phosphate cytidylyltransferase	A0A1V0SGE7	Hokovirus	2.2e-17	41.5
WP_023523534.1\|5763293_5764325_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	8.1e-80	47.3
WP_023523535.1\|5764326_5765181_-	dTDP-4-dehydrorhamnose reductase	I7HXC9	Enterobacteria_phage	2.4e-37	38.7
WP_023523536.1\|5765185_5765746_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A218MN57	uncultured_virus	1.8e-41	48.1
WP_023523537.1\|5765761_5766640_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	1.6e-108	67.4

Anti-CRISPR protein detection

Acr_ID: NC_022873.1|WP_023523307.1|5341481_5341721_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NC_022873.1|WP_023523307.1|5341481_5341721_-|hypothetical-protein

5341481_5341721_-

79 aa aa

5283417-5376004

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NC_022873_8	Orphan	8.14\|5519206\|18\|NC_022873\|CRT	5519206-5519223	18	5316743-5316760	0
NC_022873_8	Orphan	8.14\|5519206\|18\|NC_022873\|CRT	5519206-5519223	18	5316878-5316895	1

1. spacer 8.14|5519206|18|NC_022873|CRT matches to NC_022873 position: 5316743-5316760, mismatch: 0

gttgctcccgttggaccc	CRISPR spacer
gttgctcccgttggaccc	Protospacer
******************

2. spacer 8.14|5519206|18|NC_022873|CRT matches to NC_022873 position: 5316878-5316895, mismatch: 1

gttgctcccgttggaccc	CRISPR spacer
gttgctcctgttggaccc	Protospacer
********.*********

2. NC_022876

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 21163

Bacillus_phage(28.57%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000340569.1\|647_1925_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_023523695.1\|2076_2268_-	hypothetical protein	NA	NA	NA	NA
WP_000701946.1\|2772_3885_-	Ger(x)C family spore germination protein	NA	NA	NA	NA
WP_000847769.1\|3887_4973_-	GerAB/ArcD/ProY family transporter	NA	NA	NA	NA
WP_000151175.1\|4991_6440_-	spore germination protein	NA	NA	NA	NA
WP_001107533.1\|6672_6885_+	alpha/beta-type small acid-soluble spore protein	Q77YX0	Bacillus_phage	6.0e-14	58.2
WP_023523697.1\|8713_9793_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A1P8DJG9	Virus_Rctr71	1.4e-18	38.5
WP_001036869.1\|10417_11209_-	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_002180773.1\|11302_11932_-	class D sortase	NA	NA	NA	NA
WP_001009788.1\|11936_12644_-	hypothetical protein	NA	NA	NA	NA
WP_000684117.1\|12771_14094_-	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	1.5e-89	40.9
WP_001171822.1\|14172_15330_-	DegT/DnrJ/EryC1/StrS family aminotransferase	A0A2K9L470	Tupanvirus	1.6e-31	35.3
WP_000820821.1\|15362_15986_-	acetyltransferase	NA	NA	NA	NA
WP_142307213.1\|15982_16606_-	sugar transferase	NA	NA	NA	NA
WP_001023051.1\|16602_17814_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_001227670.1\|17874_19005_-	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A1V0SJE0	Klosneuvirus	1.3e-131	61.7
WP_000699475.1\|19010_20117_-	NAD-dependent epimerase/dehydratase family protein	A0A0P0YMY1	Yellowstone_lake_phycodnavirus	3.7e-06	26.1
WP_000475911.1\|20113_21163_-	polysaccharide biosynthesis protein	M4QPK0	Synechococcus_phage	2.8e-11	29.8

DBSCAN-SWA_2

25580 : 27401

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000221321.1\|25580_27401_-	polysaccharide biosynthesis protein	A0A1V0SAI8	Catovirus	2.2e-27	33.3

DBSCAN-SWA_3

46313 : 107579

Bacillus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085962062.1\|46313_47103_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_000085120.1\|47242_47539_+	hypothetical protein	H0USY0	Bacillus_phage	1.9e-13	44.3
WP_023523707.1\|47540_47726_+	hypothetical protein	NA	NA	NA	NA
WP_000492092.1\|47827_49009_+	cell division protein FtsK	H0USY1	Bacillus_phage	3.9e-126	55.3
WP_043924932.1\|48947_49565_+	replication-relaxation family protein	Q2LIA9	Bacillus_phage	1.5e-33	44.7
WP_001145764.1\|49569_49794_-	hypothetical protein	A0A0A7AR43	Bacillus_phage	5.9e-12	50.0
WP_002180785.1\|55073_55361_-	hypothetical protein	NA	NA	NA	NA
WP_001118152.1\|55494_57306_-	acetyltransferase	B5WZU0	Pseudomonas_phage	3.4e-41	36.0
WP_000291038.1\|57926_58112_+	YqbF domain-containing protein	NA	NA	NA	NA
WP_043924940.1\|58789_59077_-	adhesin	NA	NA	NA	NA
WP_000173394.1\|59715_60297_+	carbonic anhydrase	NA	NA	NA	NA
WP_023523713.1\|60329_62084_+	sulfate permease	A0A2H4J153	uncultured_Caudovirales_phage	2.6e-38	28.5
WP_002180787.1\|62322_62544_+	hypothetical protein	NA	NA	NA	NA
WP_000360819.1\|63193_64288_-	hypothetical protein	NA	NA	NA	NA
WP_000836692.1\|66084_66324_-	hypothetical protein	NA	NA	NA	NA
WP_023520903.1\|67221_68091_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_000654556.1\|68367_69558_-	C1 family peptidase	A0A2K9L9R4	Tupanvirus	9.6e-16	25.9
WP_002180792.1\|69756_70416_+	recombinase family protein	A0A1B0VBM1	Salmonella_phage	1.6e-12	32.1
WP_000217104.1\|70728_71424_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.3e-24	30.9
WP_000267188.1\|71420_72233_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_000865197.1\|72315_72816_-	nitrous oxide reductase accessory protein NosL	NA	NA	NA	NA
WP_000725500.1\|72812_74093_-	right-handed parallel beta-helix repeat-containing protein	NA	NA	NA	NA
WP_000509207.1\|74463_74604_+	hypothetical protein	NA	NA	NA	NA
WP_023523714.1\|74737_75136_+\|transposase	IS200/IS605 family transposase	A0A286QN76	Streptococcus_phage	8.3e-49	65.9
WP_023523715.1\|75147_76269_+	helix-turn-helix domain-containing protein	A0A288TXV8	Enterococcus_phage	8.3e-78	47.4
WP_000750747.1\|76479_76746_+	AbrB family transcriptional regulator	A0A2I7SC16	Paenibacillus_phage	5.8e-06	42.9
WP_023523716.1\|76865_77648_-	RNA polymerase sigma factor SigB	A0A0Y0ATF9	Bacillus_phage	4.8e-16	30.4
WP_023521124.1\|77613_78102_-	anti-sigma B factor RsbW	NA	NA	NA	NA
WP_023521125.1\|78109_78430_-	STAS domain-containing protein	NA	NA	NA	NA
WP_000022437.1\|78620_79763_+	fused response regulator/phosphatase	NA	NA	NA	NA
WP_023523717.1\|79935_82644_-	response regulator	A0A1V0SGX0	Hokovirus	5.3e-38	29.3
WP_001249914.1\|82835_83348_+	hypothetical protein	NA	NA	NA	NA
WP_000402411.1\|83761_84148_+	general stress protein	NA	NA	NA	NA
WP_000167282.1\|84229_84436_+	CsbD family protein	NA	NA	NA	NA
WP_000522907.1\|84509_84761_+	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_023523718.1\|84819_85230_+	hypothetical protein	NA	NA	NA	NA
WP_023523719.1\|85267_86284_+	ParM/StbA family protein	A0A0S2MVG2	Bacillus_phage	6.3e-77	43.3
WP_023523720.1\|86582_87263_-	TrkA C-terminal domain-containing protein	NA	NA	NA	NA
WP_023523721.1\|87392_88343_+	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_023523722.1\|88439_89747_+	HlyC/CorC family transporter	NA	NA	NA	NA
WP_023523723.1\|90115_90553_+	DUF3290 family protein	NA	NA	NA	NA
WP_023523724.1\|90571_91261_+	DUF421 domain-containing protein	NA	NA	NA	NA
WP_023523725.1\|91694_92045_+	hypothetical protein	NA	NA	NA	NA
WP_023523726.1\|92268_93924_-	peptidase M4 family protein	NA	NA	NA	NA
WP_052364211.1\|97066_97579_-	hypothetical protein	NA	NA	NA	NA
WP_043924941.1\|98167_98869_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_023523731.1\|99145_99532_+	UDP-N-acetylglucosamine 2-epimerase	NA	NA	NA	NA
WP_023523363.1\|99646_101059_-\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_023523732.1\|101122_101887_+	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	NA	NA	NA	NA
WP_023523733.1\|102253_103051_+	FkbM family methyltransferase	A0A291AUV0	Sinorhizobium_phage	6.9e-10	25.7
WP_023523734.1\|103432_103783_-	hypothetical protein	NA	NA	NA	NA
WP_023523735.1\|103967_104366_+\|transposase	IS200/IS605 family transposase	A0A286QN76	Streptococcus_phage	4.9e-49	65.9
WP_023523736.1\|104377_105490_+	helix-turn-helix domain-containing protein	A0A288TXV8	Enterococcus_phage	4.4e-79	47.4
WP_000070739.1\|106667_107579_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA

DBSCAN-SWA_4

118789 : 119767

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001023155.1\|118789_119767_-	SPFH/Band 7/PHB domain protein	A0A1V0SB59	Catovirus	2.1e-16	31.8

DBSCAN-SWA_5

123956 : 132180

Acinetobacter_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004410060.1\|123956_124208_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.1e-17	54.3
WP_000843033.1\|124790_125072_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	4.0e-13	67.2
WP_023523748.1\|126065_126686_-	hypothetical protein	NA	NA	NA	NA
WP_023523749.1\|126920_127256_-	DUF4257 domain-containing protein	NA	NA	NA	NA
WP_001065234.1\|128032_128644_-	recombinase family protein	A0A1V0E035	Clostridioides_phage	6.4e-16	32.0
WP_023523753.1\|130965_132180_-	peptidase S8	A0A1B0T6A2	Bacillus_phage	2.3e-89	47.2

DBSCAN-SWA_6

135983 : 136595

Paenibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000770552.1\|135983_136595_-	hypothetical protein	A0A2I7SCF1	Paenibacillus_phage	2.0e-30	48.4

DBSCAN-SWA_7

142784 : 145607

Bacillus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001043043.1\|142784_143063_+	HU family DNA-binding protein	A7KV42	Bacillus_phage	6.7e-21	62.2
WP_000448508.1\|143115_143349_-	RNA chaperone Hfq	NA	NA	NA	NA
WP_000648299.1\|143300_143651_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A1B1P791	Bacillus_phage	2.7e-11	31.9
WP_023523736.1\|144084_145197_-	helix-turn-helix domain-containing protein	A0A288TXV8	Enterococcus_phage	4.4e-79	47.4
WP_023523758.1\|145208_145607_-\|transposase	IS200/IS605 family transposase	A0A286QN76	Streptococcus_phage	2.4e-48	65.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NC_022874

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

8322 : 32021

Bacillus_phage(71.43%)

plate,terminase,portal,capsid,protease,tail,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023523046.1\|8322_8649_+	HNH endonuclease	A0A1B1P757	Bacillus_phage	2.1e-21	50.5
WP_000377852.1\|8655_8964_+	hypothetical protein	NA	NA	NA	NA
WP_023523045.1\|9141_9594_+\|terminase	P27 family phage terminase small subunit	E2ELI1	Clostridium_phage	1.8e-23	43.5
WP_023523044.1\|9577_11245_+\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	1.4e-182	57.8
WP_023521170.1\|11355_12549_-\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	1.0e-25	26.8
WP_023523043.1\|12846_14088_+\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	2.5e-75	39.1
WP_004410858.1\|14104_14737_+\|protease	Clp protease ClpP	D2XR17	Bacillus_phage	1.9e-34	49.4
WP_023523042.1\|14750_15872_+\|capsid	phage major capsid protein	R4IBU5	Listeria_phage	6.7e-96	49.7
WP_023523041.1\|15885_16197_+	hypothetical protein	A0A1B1P751	Bacillus_phage	2.2e-12	40.5
WP_000963828.1\|16196_16562_+	hypothetical protein	NA	NA	NA	NA
WP_023523040.1\|16539_16920_+	hypothetical protein	NA	NA	NA	NA
WP_023523039.1\|16909_17320_+	hypothetical protein	Q8W600	Listeria_phage	3.2e-11	34.8
WP_001143441.1\|17320_17890_+	hypothetical protein	Q858W9	Listeria_phage	6.8e-36	42.2
WP_000180528.1\|17949_18306_+	hypothetical protein	A0A1S7FZ84	Listeria_phage	8.3e-08	32.7
WP_023524120.1\|18488_21914_+	phage protein	A0A0S2SXL7	Bacillus_phage	3.1e-83	36.9
WP_023523037.1\|21915_22599_+\|tail	phage tail family protein	A0A1C8EA72	Bacillus_phage	6.3e-89	68.6
WP_023523036.1\|22595_24962_+\|tail	phage tail protein	A0A1C8E983	Bacillus_phage	0.0e+00	89.2
WP_023523035.1\|24951_26040_+\|plate	BppU family phage baseplate upper protein	A0A1B1P768	Bacillus_phage	8.2e-123	60.3
WP_000389748.1\|26664_26889_+	hypothetical protein	A0A1B1P780	Bacillus_phage	1.4e-21	77.0
WP_001113017.1\|27095_27314_+	hemolysin XhlA family protein	A0A1B1P780	Bacillus_phage	2.7e-17	67.6
WP_023523034.1\|27386_27668_+	hypothetical protein	D2XR31	Bacillus_phage	8.5e-32	74.2
WP_000159479.1\|27670_27877_+	hypothetical protein	D2XR32	Bacillus_phage	3.5e-27	84.8
WP_000501724.1\|27876_28656_+	N-acetylmuramoyl-L-alanine amidase	A0A1D6X870	Bacillus_phage	4.2e-44	43.7
WP_023524122.1\|28932_29118_-	hypothetical protein	NA	NA	NA	NA
WP_023524123.1\|29145_29490_-	hypothetical protein	NA	NA	NA	NA
WP_023524124.1\|29464_30265_-	ParA family protein	NA	NA	NA	NA
WP_023524125.1\|30713_32021_+	replication protein	B5LPT8	Bacillus_virus	5.9e-144	58.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NC_022875

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 6411

Bacillus_phage(80.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023523637.1\|1111_1330_+	hypothetical protein	NA	NA	NA	NA
WP_023523638.1\|2189_2414_+	helix-turn-helix transcriptional regulator	A0A0S2MVM0	Bacillus_phage	7.8e-12	50.7
WP_043924922.1\|2431_3049_-	replication-relaxation family protein	H0USY2	Bacillus_phage	2.1e-35	44.7
WP_023523640.1\|2987_4169_-	cell division protein FtsK	H0USY1	Bacillus_phage	5.4e-128	55.8
WP_000156991.1\|4270_4456_-	hypothetical protein	NA	NA	NA	NA
WP_023523641.1\|4457_4754_-	hypothetical protein	H0USY0	Bacillus_phage	4.2e-13	44.3
WP_023523642.1\|5310_6411_+	tetratricopeptide repeat protein	A0A2H4J8G3	uncultured_Caudovirales_phage	1.9e-63	39.7

DBSCAN-SWA_2

11148 : 11778

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023523647.1\|11148_11778_-	helix-turn-helix domain-containing protein	A0A1W6JPS3	Staphylococcus_phage	1.1e-05	36.0

DBSCAN-SWA_3

16390 : 19148

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023523655.1\|16390_16792_+	PrgI family protein	E4ZFJ8	Streptococcus_phage	5.9e-10	37.0
WP_023523656.1\|16733_19148_+	TrsE-like protein	G3MBM1	Bacillus_virus	2.3e-08	23.6

DBSCAN-SWA_4

31224 : 31506

Paenibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023523669.1\|31224_31506_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	4.0e-13	67.2

DBSCAN-SWA_5

35428 : 38222

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_175056343.1\|35428_36202_-	prohibitin family protein	A0A1C8E9A9	Bacillus_phage	1.6e-112	80.9
WP_023523677.1\|36210_36357_-	hypothetical protein	A0A1C8E9B6	Bacillus_phage	2.6e-08	66.7
WP_023523678.1\|36400_37096_-	DUF1282 family protein	NA	NA	NA	NA
WP_023523679.1\|37583_38222_+	recombinase family protein	M9Q1K0	Clostridium_phage	6.5e-19	36.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. NC_022877

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

292 : 82927

Bacillus_phage(42.86%)

integrase,transposase

attL 41200:41216|attR 89491:89507

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099046446.1\|292_1082_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_080672502.1\|2435_2615_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_023523828.1\|4344_4749_-	hypothetical protein	NA	NA	NA	NA
WP_023523829.1\|4763_5594_-	ParA family protein	F0PIG8	Enterococcus_phage	1.5e-39	40.4
WP_023523833.1\|9298_9532_+	RNA chaperone Hfq	NA	NA	NA	NA
WP_023523834.1\|9595_9871_-	HU family DNA-binding protein	A0A0H3UZA0	Geobacillus_virus	4.6e-22	60.7
WP_043924963.1\|10013_10304_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_023523837.1\|11050_11968_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_023523839.1\|13345_13555_-	hypothetical protein	NA	NA	NA	NA
WP_023523840.1\|13932_14559_+	recombinase family protein	M9Q1K0	Clostridium_phage	9.4e-23	37.6
WP_023520903.1\|15074_15944_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_023523841.1\|16069_16432_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_023523843.1\|17523_18327_-	polysaccharide deacetylase	NA	NA	NA	NA
WP_043924945.1\|18409_19465_-	phosphodiester glycosidase family protein	NA	NA	NA	NA
WP_023523845.1\|20979_22161_-	replication initiation protein	E5FFJ0	Burkholderia_phage	3.5e-10	25.0
WP_023523846.1\|22272_23712_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_080672503.1\|24765_25074_+	hypothetical protein	NA	NA	NA	NA
WP_142307149.1\|25132_25483_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_043924947.1\|25922_26297_-\|transposase	transposase	NA	NA	NA	NA
WP_023523849.1\|26648_26903_-	hypothetical protein	NA	NA	NA	NA
WP_023523850.1\|27608_28718_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_023523857.1\|32476_32695_+	hypothetical protein	H0USV5	Bacillus_phage	5.8e-20	63.5
WP_023523859.1\|35045_35321_+	hypothetical protein	H0USV6	Bacillus_phage	2.3e-18	54.9
WP_023523860.1\|35662_36016_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	A0A0P0I4A4	Acinetobacter_phage	4.4e-17	46.2
WP_023523861.1\|38190_38526_+	hypothetical protein	A0A0A7AR67	Bacillus_phage	5.8e-11	36.9
WP_043924949.1\|38922_40368_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_099046434.1\|40782_41572_-\|transposase	IS5 family transposase	NA	NA	NA	NA
41200:41216	attL	NA	NA	NA	NA
WP_157762874.1\|42807_43005_-	hypothetical protein	NA	NA	NA	NA
WP_023523865.1\|43479_43740_+	hypothetical protein	NA	NA	NA	NA
WP_023523866.1\|44846_45068_+	hypothetical protein	NA	NA	NA	NA
WP_043924967.1\|45952_46240_-	adhesin	NA	NA	NA	NA
WP_023523868.1\|46880_47462_+	carbonic anhydrase	NA	NA	NA	NA
WP_023523869.1\|47489_49166_+	STAS domain-containing protein	A0A2H4J153	uncultured_Caudovirales_phage	1.8e-31	26.8
WP_023523873.1\|52051_52645_-	camelysin	NA	NA	NA	NA
WP_023523874.1\|52966_53221_+	hypothetical protein	NA	NA	NA	NA
WP_099046447.1\|55258_56048_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_023523877.1\|57929_58388_+\|transposase	transposase	NA	NA	NA	NA
WP_023523878.1\|59098_60118_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_023523881.1\|61621_61990_+	hypothetical protein	NA	NA	NA	NA
WP_023520903.1\|62343_63213_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_023523882.1\|63635_64547_-	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	4.3e-08	32.6
WP_023523883.1\|64528_65638_-	polysaccharide pyruvyl transferase family protein	NA	NA	NA	NA
WP_099046435.1\|66946_67735_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_023523885.1\|67732_68077_-	DUF4183 domain-containing protein	NA	NA	NA	NA
WP_023523887.1\|69047_70055_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_023523888.1\|70457_71633_+\|integrase	site-specific integrase	A0A142F1N9	Bacillus_phage	4.0e-06	24.4
WP_023523889.1\|73956_74400_-	hypothetical protein	NA	NA	NA	NA
WP_023523890.1\|75106_75313_-	hypothetical protein	NA	NA	NA	NA
WP_052364212.1\|75946_76258_+\|transposase	transposase	A0A0P0I4A4	Acinetobacter_phage	1.6e-18	55.6
WP_023523893.1\|78005_78425_-	hypothetical protein	NA	NA	NA	NA
WP_023523894.1\|78452_79619_-	ParM/StbA family protein	NA	NA	NA	NA
WP_099046439.1\|79933_80722_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_023523895.1\|80962_81583_+	DUF3967 domain-containing protein	A0A1Z1LZN4	Bacillus_phage	4.9e-48	58.7
WP_023523896.1\|81994_82927_-\|integrase	site-specific integrase	A0A1B1P793	Bacillus_phage	5.1e-73	45.8
89491:89507	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

6. NC_022882

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_022882_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_022882_1

123767-124061

Orphan

Consensus_repeat	Method
TTCTTCTAGTGGTATTTCTTGTTCTGGTACTTCT	CRISPRCasFinder

4 spacers

The CRISPR arrays of NC_022882_1

>merge|NC_022882|1|123767-124061|CRISPRCasFinder
TTCTTTTGTTGAGATTTCTTGTTGTGGGATATTTGTTGAAATGTCCTGTTCTGACTGGATTTCTTCTGTTGGAATGTCTTGTTGTGGGATATCGGATGGGATTTCTTCAAATGTTTCATGATTTGCTGATACTTCCTCTAATGGAAGTTCTTGCGTTGGTACTTCTGTCTGGATTTCTTCATATACTTCCATATCGTTTGGAACTTCTTCTAGTGGTATTTCTTGTTCTGGTACTTCTTGTTGTACATCTTCATGTACTTCTATATCAGTCGGAATTTCTTCTAGTGGTACTTCT

>NC_022882|1|1|123767-124061|CRISPRCasFinder
TTCTTTTGTTGAGATTTCTTGTTGTGGGATATTT	GTTGAAATGTCCTGTTCTGACTGGAT
TTCTTCTGTTGGAATGTCTTGTTGTGGGATATCG	GATGGGATTTCTTCAAATGTTTCATGATTTGCTGATAC
TTCCTCTAATGGAAGTTCTTGCGTTGGTACTTCT	GTCTGGATTTCTTCATATACTTCCATATCGTTTGGAAC
TTCTTCTAGTGGTATTTCTTGTTCTGGTACTTCT	TGTTGTACATCTTCATGTACTTC
TATATCAGTCGGAATTTCTTCTAGTGGTACTTCT

Protein	Signature genes	Signature genes Name	Protein_function
NC_022882.1\|WP_023523914.1\|131745_132297_-\|transposase	unknown	unknown	gnl\|CDD\|372239
NC_022882.1\|WP_023520826.1\|121233_122508_-\|group-II-intron-reverse-transcriptase/maturase	RT	pfam00078_RT_CAS-I:CAS-III	gnl\|CDD\|275209
NC_022882.1\|WP_023523908.1\|135969_137859_-\|group-II-intron-reverse-transcriptase/maturase	RT	pfam00078_RT_CAS-I:CAS-III	gnl\|CDD\|275209
NC_022882.1\|WP_080672513.1\|126523_127537_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|315512
NC_022882.1\|WP_023523909.1\|134907_135843_-\|hypothetical-protein	unknown	unknown	unknown
NC_022882.1\|WP_023523929.1\|113182_113989_-\|Rpn-family-recombination-promoting-nuclease/putative-transposase	unknown	unknown	gnl\|CDD\|273806
NC_022882.1\|WP_023523921.1\|119842_120970_-\|peptidoglycan-DD-metalloendopeptidase-family-protein	unknown	unknown	gnl\|CDD\|366703
NC_022882.1\|WP_023523931.1\|110961_111930_+\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|187566
NC_022882.1\|WP_023523927.1\|116183_116396_-\|hypothetical-protein	unknown	unknown	unknown
NC_022882.1\|WP_023524038.1\|134059_134902_-\|replication-relaxation-family-protein	unknown	unknown	gnl\|CDD\|379384
NC_022882.1\|WP_023523925.1\|117080_118310_+\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|376564
NC_022882.1\|WP_023523930.1\|111945_113022_+\|CDP-glucose-4,6-dehydratase	unknown	unknown	gnl\|CDD\|274236
NC_022882.1\|WP_023524037.1\|133576_133831_-\|hypothetical-protein	unknown	unknown	unknown
NC_022882.1\|WP_023523928.1\|115375_115777_-\|IS200/IS605-family-transposase	unknown	unknown	gnl\|CDD\|376616
NC_022882.1\|WP_023523922.1\|119233_119818_-\|hypothetical-protein	unknown	unknown	unknown
NC_022882.1\|WP_023523913.1\|132585_133563_-\|conjugal-transfer-protein	unknown	unknown	gnl\|CDD\|372237
NC_022882.1\|WP_023523916.1\|127620_129447_-\|group-II-intron-reverse-transcriptase/maturase	RT	pfam00078_RT_CAS-I:CAS-III	gnl\|CDD\|275209
NC_022882.1\|WP_023523932.1\|108814_110929_+\|hypothetical-protein	unknown	unknown	unknown
NC_022882.1\|WP_023524036.1\|125955_126465_-\|hypothetical-protein	unknown	unknown	unknown
NC_022882.1\|WP_000281809.1\|132324_132576_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_022882.1\|WP_023523914.1\|131745_132297_-\|transposase	gnl\|CDD\|372239	pfam12648, TcpE, TcpE family. This family of proteins includes TcpE a conjugative transposon membrane protein.This family of proteins is found in bacteria. Proteins in this family are typically between 122 and 168 amino acids in length.	3.39831e-09
NC_022882.1\|WP_023520826.1\|121233_122508_-\|group-II-intron-reverse-transcriptase/maturase	gnl\|CDD\|275209	TIGR04416, hypothetical_protein, group II intron reverse transcriptase/maturase. Members of this protein family are multifunctional proteins encoded in most examples of bacterial group II introns. These group II introns are mobile selfish genetic elements, often with multiple highly identical copies per genome. Member proteins have an N-terminal reverse transcriptase (RNA-directed DNA polymerase) domain (pfam00078) followed by an RNA-binding maturase domain (pfam08388). Some members of this family may have an additional C-terminal DNA endonuclease domain that this model does not cover. A region of the group II intron ribozyme structure should be detectable nearby on the genome by Rfam model RF00029. [Mobile and extrachromosomal element functions, Other].	8.95356e-177
NC_022882.1\|WP_023523908.1\|135969_137859_-\|group-II-intron-reverse-transcriptase/maturase	gnl\|CDD\|275209	TIGR04416, hypothetical_protein, group II intron reverse transcriptase/maturase. Members of this protein family are multifunctional proteins encoded in most examples of bacterial group II introns. These group II introns are mobile selfish genetic elements, often with multiple highly identical copies per genome. Member proteins have an N-terminal reverse transcriptase (RNA-directed DNA polymerase) domain (pfam00078) followed by an RNA-binding maturase domain (pfam08388). Some members of this family may have an additional C-terminal DNA endonuclease domain that this model does not cover. A region of the group II intron ribozyme structure should be detectable nearby on the genome by Rfam model RF00029. [Mobile and extrachromosomal element functions, Other].	3.016e-111
NC_022882.1\|WP_080672513.1\|126523_127537_-\|ATP-binding-protein	gnl\|CDD\|315512	pfam12846, AAA_10, AAA-like domain. This family of domains contain a P-loop motif that is characteristic of the AAA superfamily. Many of the proteins in this family are conjugative transfer proteins.	6.14114e-57
NC_022882.1\|WP_023523929.1\|113182_113989_-\|Rpn-family-recombination-promoting-nuclease/putative-transposase	gnl\|CDD\|273806	TIGR01784, Uncharacterized_protein_pSLT051, conserved hypothetical protein (putative transposase or invertase). Several lines of evidence suggest that members of this family (loaded as a fragment mode model to find part-length matches) are associated with transposition, inversion, or recombination. Members are found in small numbers of genomes, but in large copy numbers in many of those species, including over 30 full length and fragmentary members in Treponema denticola. The strongest similarities are usually within rather than between species. PSI-BLAST shows similarity to proteins designated as possible transposases, DNA invertases (resolvases), and recombinases. In the oral pathogenic spirochete Treponema denticola, full-length members are often found near transporters or other membrane proteins. This family includes members of the putative transposase family pfam04754.	4.22057e-47
NC_022882.1\|WP_023523931.1\|110961_111930_+\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|187566	cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-epimerase, extended (e) SDRs. This subgroup contains UDP-N-acetylglucosamine 4-epimerase of Pseudomonas aeruginosa, WbpP, an extended SDR, that catalyzes the NAD+ dependent conversion of UDP-GlcNAc and UDPGalNA to UDP-Glc and UDP-Gal. This subgroup has the characteristic active site tetrad and NAD-binding motif of the extended SDRs. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	6.08819e-60
NC_022882.1\|WP_023523913.1\|132585_133563_-\|conjugal-transfer-protein	gnl\|CDD\|372237	pfam12642, TpcC, Conjugative transposon protein TcpC. This family of proteins are annotated as conjugative transposon protein TcpC. The transfer clostridial plasmid (tcp) locus is part of some conjugative antibiotic resistance and virulence plasmids. TcpC was one of five genes whose products had low-level sequence identity to Tn916 proteins, having similarity to ORF13 homologs from Tn916, Tn5397, and CW459tet. This family of proteins is found in bacteria. Proteins in this family are typically between 302 and 351 amino acids in length.	1.06689e-32
NC_022882.1\|WP_023523921.1\|119842_120970_-\|peptidoglycan-DD-metalloendopeptidase-family-protein	gnl\|CDD\|366703	pfam01551, Peptidase_M23, Peptidase family M23. Members of this family are zinc metallopeptidases with a range of specificities. The peptidase family M23 is included in this family, these are Gly-Gly endopeptidases. Peptidase family M23 are also endopeptidases. This family also includes some bacterial lipoproteins for which no proteolytic activity has been demonstrated. This family also includes leukocyte cell-derived chemotaxin 2 (LECT2) proteins. LECT2 is a liver-specific protein which is thought to be linked to hepatocyte growth although the exact function of this protein is unknown.	2.92207e-30
NC_022882.1\|WP_023523930.1\|111945_113022_+\|CDP-glucose-4,6-dehydratase	gnl\|CDD\|274236	TIGR02622, CDP-glucose_46-dehydratase, CDP-glucose 4,6-dehydratase. Members of this protein family are CDP-glucose 4,6-dehydratase from a variety of Gram-negative and Gram-positive bacteria. Members typically are encoded next to a gene that encodes a glucose-1-phosphate cytidylyltransferase, which produces the substrate, CDP-D-glucose, used by this enzyme to produce CDP-4-keto-6-deoxyglucose. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	6.21085e-174
NC_022882.1\|WP_023523928.1\|115375_115777_-\|IS200/IS605-family-transposase	gnl\|CDD\|376616	pfam01797, Y1_Tnp, Transposase IS200 like. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS200 from E. coli.	1.15092e-42
NC_022882.1\|WP_023524038.1\|134059_134902_-\|replication-relaxation-family-protein	gnl\|CDD\|379384	pfam13814, Replic_Relax, Replication-relaxation. This family includes proteins which are essential for plasmid replication and plasmid DNA relaxation.	1.22194e-08
NC_022882.1\|WP_023523925.1\|117080_118310_+\|IS110-family-transposase	gnl\|CDD\|376564	pfam01548, DEDD_Tnp_IS110, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family includes an amino-terminal region of the pilin gene inverting protein (PIVML) and of members of the IS111A/IS1328/IS1533 family of transposases. The C-terminus is represented by family pfam02371.	1.40668e-35
NC_022882.1\|WP_023523916.1\|127620_129447_-\|group-II-intron-reverse-transcriptase/maturase	gnl\|CDD\|275209	TIGR04416, hypothetical_protein, group II intron reverse transcriptase/maturase. Members of this protein family are multifunctional proteins encoded in most examples of bacterial group II introns. These group II introns are mobile selfish genetic elements, often with multiple highly identical copies per genome. Member proteins have an N-terminal reverse transcriptase (RNA-directed DNA polymerase) domain (pfam00078) followed by an RNA-binding maturase domain (pfam08388). Some members of this family may have an additional C-terminal DNA endonuclease domain that this model does not cover. A region of the group II intron ribozyme structure should be detectable nearby on the genome by Rfam model RF00029. [Mobile and extrachromosomal element functions, Other].	8.53444e-128

>NC_022882.1|WP_023520826.1|121233_122508_-|group-II-intron-reverse-transcriptase/maturase
MELLETILSNQNMNEAYLRVYKNKGASGVDGVTVDELKQYLKENKDELRQRIRTRKYQPQAALRVEIPKENGKMRKLGIPTVVDRVVQQAIHQILSPIFEKQFSEFSYGFRPKRSCEMAIVKSLEFLNAGYEWIVDIDLERFFDTVHHDKLMRIISNTISDGDVISLIRKYLVSGVMVNGKYEETSVGTPQGGNLSPLLSNIMLNELDKELESRELQFVRYADDALIFVKSEKAASRVMKSIVRFIEKNLGLIVNTEKSKISRPEDLKFLGFGYYYNSKDERYQTKPHPISVQKLQRKLRQLTKRNWSVPLDYRILKLKQVIFGWVNYFRITNMKGVMKQVDKKLRSRIRVIIWKQWKIPKKQIKSLVQLGIPEEEAKGLTYCRKGYRYIGLSKVVQRAMSNQRLKKRGVPSSLERYLKVRTAI
>NC_022882.1|WP_023523921.1|119842_120970_-|peptidoglycan-DD-metalloendopeptidase-family-protein
MRPEIKEVVDKTIQEEIEQEQKKKKKKKSWLLTFLFGSSTFTIGLFVCIGFLLFIVLGQGIGKKEEEAPATIPSNGMTVCRPGGKTVTPEELQPHLGGVFAGNAQAFLNAGTQNQIDPVLLAAIAKLETGNGTSNAVKNYNNPGGLMDPSSSQMKGFMKFATLDEGINAMARNLYKNYIGMGITTIEAIGAKYAPPGAANDPHGTNGLWPVLVTKFVAQMGGLTFNCAAGKPGGVVDTGSASSQGFIRPITQTTITSPFGPRWSTIHKGIDYSCQDGVTPIAASKGGVVEWAKFGASGSGFGGYGNVVAINHGNGYWSLYGHMSFITVQEGQNIGVGQQVGVCGRTGQVTGPHLHFEIKTSLRFGQVDPAPYLPK
>NC_022882.1|WP_023523922.1|119233_119818_-|hypothetical-protein
MKQGIVGFVILILVGISAWLWNQNRTLQHKVEQTEKKWTEQVKKLKTENRALEKRVTVLTENTQDKGQEVAKQFVELLIQNDNKQKEKPGFEKIKEMITGEARNKLLNAPEDAHNHIEDDGSMHIQTKAKITDMYYIKTADNKADVTVKYDYFVTVDGTEQQEKHTMKLNLVLEGEKWFVESYEFQINTGIEGP
>NC_022882.1|WP_023523925.1|117080_118310_+|IS110-family-transposase
MKLFVGLDVSSQDAKVCFLNGDGDRLQAFTITNDLPGAITLKEKILDTVSRSTCKTIKIGLESTSIYSYHPAMFLHNDKELRTYGSQVFMINPKQIANFKKSYSEMDKTDAIDAFIIADYVRFGRHTMSIVKEEQYIALQQLTRSRYQLVHALTKEKQHFLQHLSMKCSQFSQDVNSSVFGNAMMELFLEQFSLEDLIQMPLQELALFLQEKGRNRFGNPEEVAKSIQKAVKGSYRLSKVVEDSIDLLLSTSIRIMRTYQTQIKEIEKGIESLMSTLPQTLESIPGIGPVFAAGIVAEIGQIERFTDETKIAKYAGLFWKKYQSGRFTAENTSLSRAGNQYLRYYLVEAANSVRRNVPEYRDSYAKKAAEVPKHKHKRALVLTARKLVRLVDALLHNNQIYAFGRSADR
>NC_022882.1|WP_023523927.1|116183_116396_-|hypothetical-protein
MIHQYELNFSVIYSGKVTDSQSTIIPASSLEEANKKLQSEVKRRLGKCTIKVNTASLCVSEDSRYTLEQK
>NC_022882.1|WP_023523928.1|115375_115777_-|IS200/IS605-family-transposase
MMNEYRRAKTTVSLLNYHFVFCPRYGRKIFLNIKVEERFKELVQEVCIELDVVIVAMECDKDHVHLFLNTLPTLSPADTMAKIKGVTSKRLREEFPHLAHLPSLWTRSYFVSTAGNVSSKTIKHYVESQKTRG
>NC_022882.1|WP_023523929.1|113182_113989_-|Rpn-family-recombination-promoting-nuclease/putative-transposase
MGERKTPVQPTISEFAFLNAMLQNSLESPIVSLQLEDPHLHREHEEDKLSILDISATLDTETKVNIEIQLNNTHDMIKRSLYYWGRLYTSQLQKGMPYSFLHKTITINLLNFVMFPKYEGFHTTGVLWNQQQQKVLSRNIEVYIVEIPKLMQQWWNEQVNPWKDSFVRWLLLLPANEDEQLTQTLEDIAMNKWERMSQDSSFRQAYEARKKALMDEAAKFAHARNEGIQEGKIQMIKGMHELGVPIETIAKASKLSIEEVELILKGNS
>NC_022882.1|WP_023523930.1|111945_113022_+|CDP-glucose-4,6-dehydratase
MEYIKSDVFKGKRVLITGHTGFKGSWLTMWLTKLGAKVIGLSLDSGHKNGIFNLSQIGKDIIDIRGDIREEQKIKYVFETYKPEIIFHLAAQPLVKYSYQYPKDTYSINVMGTLNILEEMRKYSEPQIGIFVTSDKCYQNNDWDWGYREIDPMGGIDPYSSSKGCCELLISSYRDSYFNTQRFMEHQKVLATVRAGNVIGGGDWAVDRIIPDVVKAIKDKQDIIVRSPNAIRPWQHVLEALSGYLVLASKLLEGNIKYSGAWNFGPHSHNGITVKELVENIFQHWGYSGSWKLENNQTTFYEAKILNLDISKANRSLQWFPRWDIYETIEKTTDWYKNYETVSIKELCYRQINEYCNF
>NC_022882.1|WP_023523931.1|110961_111930_+|SDR-family-NAD(P)-dependent-oxidoreductase
MEDTLKYRRILITGGHGFIGSHLVKRLLKEGAHVFILAREHANLWRLKKVLKNIQVWNGDIINAVEVQTIVKQIQPDYVFHLAADTEHSLQDNSISKIKTNIIGTTNIMEAVRLIGCKKVINLGSSSEYGVTINTINENTPLNPQEIYGITKAAATQIAHHIAERSKINIVTLRPFNIFGEGASSKNLFTYIILQLIRDKEVHLTHCTQTRDYCYIENIVTGLILAATNTGIKNEIFNIGSGETHPLKFFVEKIFQHFNSQRKPLYGHIPYSLQERLEVTSDVQKIKNKLNWKVVVSLEEGIKNTINWYKNNQEWYVSNIKK
>NC_022882.1|WP_023523932.1|108814_110929_+|hypothetical-protein
MNNYIERLLEKFKEKFFLDFSSEFEKNRKYPQDEILESQKPIISIEEDEEQSQDEWTIQVSAATEDTSNIIIDGLNFCTIVGKEYLFKVLALYESLQKHSEKFNLFICCMDQLTFSFLEDKQLKNVVLISVKSFENPTLKKIKKERKINEYCWTLKAPFMEFLFRTYNIPRVLYCDSDLFFFSSPQPIFDEWREFAVYLCPQRDSQEVEKVFGKFQAGLIGFKNNFHGRKSLKWWKEQCLNDCSQERNGENFGDQKYLDKIPIYFHHIKISTHLGVDAAPWNCIYNNNYQFTQQGTDVYINNHKLIVFHFACLSTFSENQFDLWSLSPLKINKFIKNNIYIPYLETLRQIMKDVKERNENVFNQCISKKEIITSKTFYGYTKLRREMDQYDTFFTFGTIVSKQYILQFLAYYLSLGDKINNFHIWVLCVDQSVYNILQKMSLSHVTLIDIKKVETAELKNIKNTRSLQEYCWTLKPYLCSYVLLNYGEVDHIIYCDADKCFFSDPTELIKEWGLYSIFLCRQRGSSELESTFGIYQAGLIGFKREKNSFDILTWWQMKCLENCSTTYDAYYNSWGDQKYLEGIPNLFGNIKIIDNIGVNVAPWNVIMNNNHIISQKDNQVYIDNQPIISYHFGSMRLLNKYEYDIWFQEPLSFTSDILQHIYTPYIKLIHRASKKLQKTLATTDISQFYSQVSTSYVPKNPFKF
>NC_022882.1|WP_023524036.1|125955_126465_-|hypothetical-protein
MKKLRMLSGLCVAGMLMVTGVAGCSNETKSNANQQEVQKERDMKEADKAAMDYVRAYIEMDSNKINDLLYKKYDLGKDEVMNPGASKGMKERYDLYRYDLKEGENEYYYRVKYFDPVENAQMGRKLRMVKDEKDGKWKNYEWAWDSNNSLDSIVGSVKPVHVHKWGQKE
>NC_022882.1|WP_080672513.1|126523_127537_-|ATP-binding-protein
MKIISKAYLSLYRTRWPELLPGFNEDTLQVWTLGKDKKDAGCLDPFRISATIEDAKSLALEILTFLSDVGLEDIRYDYLYKAIERVAKKEDACLTLVRKELEEMKKEPNLLPTELERLNALTNRLATLEGIQLGDLLFGRPGQDYRVLSLERPLQVLQIQHLRIPKSEEKNESVTDKLSRSILIALAAFGKSLMHSDRSIFKVYLQDEASSILKNKEGAASSDKIIREGRYHNIGLYLGTQNASDYQSENKEVANVGMKFCFALKYDKEAEEMLRYYNLPVTEENILMLRQLRRGEALFQDIFGRTAVVEIDPVFQELKTAFDSSTKTDEERAQQLA
>NC_022882.1|WP_023523916.1|127620_129447_-|group-II-intron-reverse-transcriptase/maturase
MLKKTKLRHNEYYDTQKVYDNLYSNSLNGNNFYKLTELIGSEDNIRLAYRNIKTNKGSKTAGVDGLTIKDVRQLNDFQVINQVRKRLMNYRPSPVRRVYIPKEGSDKKRPLGIPTIWDRLVQQCILQVLEPICEAKFHNHNYGFRPNRSTHHALSRMVSLINVGKHHYCVDIDIKGFFDNVQHGKLLKQMWAIGIRDKRLLSIISNLLKAEIIGEGIPSKGTPQGGILSPLLSNIVLNELDWWISNQWETYKPHRFKDGPNGFTTYARKYTNLKGGYIVRYADDFKIMCRTYEEVQRFYHATVDFLKARLGLEINPEKSKVVHLKKNSSDFLGFKIKVVPQKKAKFGFIAKTSMSNKALKRVQRTLKERIKEIQHNPTSDMVLRFNITLIGIQNYYKYATTIYLDLTEIHYILYKIIRARLRENAKVVTLTQTSATFRKKAKGIRANTKIYMVQNTPLLPTTCVHHKNPWNFSQSICNYTEKGRQKIHRELQAIPRDVLNQVKRTYSRNRSIEYNDNRISKFIAQYGRCYVLNEEIGIDRVRCHHLKPLRFGGEDNYQNLVIVDELIHRLIHMTNPNRIQKTVHFLSLNTKQLTKLNHLRICAGNEPI
>NC_022882.1|WP_023523914.1|131745_132297_-|transposase
MKEKESKSIIVYCFGSYMNYMRRQYEIMGYRLPRAVTWRALGYFAAVEAGLVAFRFLPPFKWIFGDMIDQVWLMYYGVIPLFLVWGADKYKTDGKSLFSFVRSWVTFRLRKHQSSRLVTLSKLKKHVIRGHVCVQYDVKDIPIVHVASEEEEKDIYAYNLTFLPQKEEIKDVENDEQITIKAR
>NC_022882.1|WP_000281809.1|132324_132576_-|hypothetical-protein
MYMFNINHFVLGIGLEGFFEMMKTQGTYALYCAFIIVILIVAAKRAWGKAITLIVGGGIVVFFINKPDALKTIGTWLGGLFGV
>NC_022882.1|WP_023523913.1|132585_133563_-|conjugal-transfer-protein
MFQKVKQWFAKTFESKQGKARKATRIPSYKGRLIGKWAFWLLFCWMLIVSVTTVVKGKGDTQAKASTTPKEVTQKQNLASRPEAIEFARGFAKEYFIWQRGDEGKKKRSERLHPYIPKTFDPQVGLDFVSMQWDSNFLYATVLKVDEVTEKEANVIFKVKYKLSRMKADNSGPEDKEVIQQVSVPVQSDGKAFVISGFPQIVKVNEKAEVPEGKEEKDREEVHELAVKEDIREFLPTFFKSYTTATQKELAYVLANTDIKGLEGAMKFENVLSSKIYPGKTKGTYEVQTEVSMIDPHSETKMKTGYTLFVKQDGKQWVVKDLKTK
>NC_022882.1|WP_023524037.1|133576_133831_-|hypothetical-protein
MDTLEGLEFVREFRATDGASFEVGRDTGKRYVVHARFPYITGSQTKLNNFINYARNEIKDESTAVGMASFACDCYERSLRHYRN
>NC_022882.1|WP_023524038.1|134059_134902_-|replication-relaxation-family-protein
MGNILFQTSDEQLLMSLHTHIYLDIEYIHQKVYVDYTKKSVTNRLYKLEQAGYIRYEYLPITSPRNQKRKFAKPQRIYTLTPEGVEMVRGFRGEVHWKNSWSKRSASFVYHSLMLAKIECAMTLISKREGKLELKEWINEPRATFQYAKGKNRVIRPDGVAVIGLKEAIDKNIGVFMEMERSYGSKEVLEKKIIRYNDFMTQEGKKADYRIHAGMGYEIPIWRLVFVAGSESREKELIRYLKRVSSPEIPVYITLFQDILQDPFGNIYRNIQNPNEKVRF
>NC_022882.1|WP_023523909.1|134907_135843_-|hypothetical-protein
MGKEDTLLTVGYICNQYHRIAQQRPHGSKLHLGVIDEAHDVPVPVLPKIIAKDRKHGFGLWVITQQVSGQLDRELTDMLTEAGGNYFVCRQGHNSAKTLEGIMQKQFRTEYLQNLPNLVVAIQTQDYIRSEAKNVWCTIRVPPLDRYLPNGKAANYKNEKEIHASNEWTRAKIHSLEQQNGKAGLEIDKEIDEFLYGKGKYQQAEKVNLTKEEPVVTSGLDELEEKAPSNEEVKEPVSETKPVEPTHQAQIIPFRTQATTTIEVKKEDKPVKEPITTIEKEQTVSIETENVEIKEDTPQEEVSIFDMWEKE
>NC_022882.1|WP_023523908.1|135969_137859_-|group-II-intron-reverse-transcriptase/maturase
MTQKLRLLDTEIQLKQTFDELYFKASCEKPKIKDLYEIICSKANILYAIRAMKSNKGSKTAGVDSLTINDILQADEEKVIHLITNTIRDYTPSMVRRVWIPKAGKKELRPLGIPTILDRIIQQCVKQVIEPICEAQFFPYSFGFRPYRDGHMAIERVGSLIHKTKYHWIVEGDIRKFFDKVNHNILLKNCFKIGIQDKRVLMLIKAMLKAGVMHENTKTTLGTPQGGIISPILANIYLHDFDMWVYNQWQNKKTRKNYANKHSRTTTLKRTTKLKQGYLIRYADDWVIVTNSKTNAIKWKKAVSHYLKDKLKLELSEEKTKITNVRKKNIEFLGFKLFVKYKGVKDKKTKRYIPYRIPNEKRIEDKVKELKKHLRIIKRLSNKKKLIHEINVYNTKIRGLINYYSYATLVNITFSRFSHRLRKAEWYALKKYGGKWFKMNECDNIKQWYPNRTEGTPTIEYNESKIGIWKLNLATWDSSKCIQKNQNETPYTSQGRGLIFKRRNKRSTLSRLDEITSLNLSEKISQGLTGEKYNFEYFMNRASAFNRDKGQCNVTKVPLSKENLHVHHKNPRLPINEINKVHNLVCVSKEIHQLIHNNEPLNQISWLNKKQIAKVERYRRQLIIINSNN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Identity
NC_022882_1	1.1\|123801\|26\|NC_022882\|CRISPRCasFinder	123801-123826	26	NC_022877.1	108315-108340	1.0
NC_022882_1	1.2\|123861\|38\|NC_022882\|CRISPRCasFinder	123861-123898	38	NC_022877.1	108243-108280	1.0
NC_022882_1	1.3\|123933\|38\|NC_022882\|CRISPRCasFinder	123933-123970	38	NC_022877.1	108171-108208	1.0
NC_022882_1	1.4\|124005\|23\|NC_022882\|CRISPRCasFinder	124005-124027	23	NC_022877.1	108114-108136	1.0

1. spacer 1.1|123801|26|NC_022882|CRISPRCasFinder matches to position: 108315-108340, mismatch: 0, identity: 1.0

gttgaaatgtcctgttctgactggat	CRISPR spacer
gttgaaatgtcctgttctgactggat	Protospacer
**************************

2. spacer 1.2|123861|38|NC_022882|CRISPRCasFinder matches to position: 108243-108280, mismatch: 0, identity: 1.0

gatgggatttcttcaaatgtttcatgatttgctgatac	CRISPR spacer
gatgggatttcttcaaatgtttcatgatttgctgatac	Protospacer
**************************************

3. spacer 1.3|123933|38|NC_022882|CRISPRCasFinder matches to position: 108171-108208, mismatch: 0, identity: 1.0

gtctggatttcttcatatacttccatatcgtttggaac	CRISPR spacer
gtctggatttcttcatatacttccatatcgtttggaac	Protospacer
**************************************

4. spacer 1.4|124005|23|NC_022882|CRISPRCasFinder matches to position: 108114-108136, mismatch: 0, identity: 1.0

tgttgtacatcttcatgtacttc	CRISPR spacer
tgttgtacatcttcatgtacttc	Protospacer
***********************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_022882_1	1.1\|123801\|26\|NC_022882\|CRISPRCasFinder	123801-123826	26	NC_022877	Bacillus thuringiensis YBT-1518 plasmid pBMB0232, complete sequence	108315-108340	0	1.0
NC_022882_1	1.1\|123801\|26\|NC_022882\|CRISPRCasFinder	123801-123826	26	NZ_CP033793	Bacillus sp. FDAARGOS_527 plasmid unnamed6, complete sequence	15158-15183	0	1.0
NC_022882_1	1.1\|123801\|26\|NC_022882\|CRISPRCasFinder	123801-123826	26	NC_022882	Bacillus thuringiensis YBT-1518 plasmid pBMB0233, complete sequence	123801-123826	0	1.0
NC_022882_1	1.2\|123861\|38\|NC_022882\|CRISPRCasFinder	123861-123898	38	NC_022877	Bacillus thuringiensis YBT-1518 plasmid pBMB0232, complete sequence	108243-108280	0	1.0
NC_022882_1	1.2\|123861\|38\|NC_022882\|CRISPRCasFinder	123861-123898	38	NC_022882	Bacillus thuringiensis YBT-1518 plasmid pBMB0233, complete sequence	123861-123898	0	1.0
NC_022882_1	1.3\|123933\|38\|NC_022882\|CRISPRCasFinder	123933-123970	38	NC_022882	Bacillus thuringiensis YBT-1518 plasmid pBMB0233, complete sequence	123933-123970	0	1.0
NC_022882_1	1.3\|123933\|38\|NC_022882\|CRISPRCasFinder	123933-123970	38	NC_022877	Bacillus thuringiensis YBT-1518 plasmid pBMB0232, complete sequence	108171-108208	0	1.0
NC_022882_1	1.4\|124005\|23\|NC_022882\|CRISPRCasFinder	124005-124027	23	NC_022882	Bacillus thuringiensis YBT-1518 plasmid pBMB0233, complete sequence	124005-124027	0	1.0
NC_022882_1	1.4\|124005\|23\|NC_022882\|CRISPRCasFinder	124005-124027	23	NC_022877	Bacillus thuringiensis YBT-1518 plasmid pBMB0232, complete sequence	108114-108136	0	1.0
NC_022882_1	1.4\|124005\|23\|NC_022882\|CRISPRCasFinder	124005-124027	23	NC_022782	Bacillus toyonensis BCT-7112 plasmid pBCT77, complete sequence	35113-35135	0	1.0
NC_022882_1	1.2\|123861\|38\|NC_022882\|CRISPRCasFinder	123861-123898	38	NC_022782	Bacillus toyonensis BCT-7112 plasmid pBCT77, complete sequence	34897-34934	1	0.974
NC_022882_1	1.3\|123933\|38\|NC_022882\|CRISPRCasFinder	123933-123970	38	NC_022782	Bacillus toyonensis BCT-7112 plasmid pBCT77, complete sequence	34969-35006	1	0.974
NC_022882_1	1.4\|124005\|23\|NC_022882\|CRISPRCasFinder	124005-124027	23	NC_018685	Bacillus thuringiensis MC28 plasmid pMC95, complete sequence	36860-36882	1	0.957
NC_022882_1	1.4\|124005\|23\|NC_022882\|CRISPRCasFinder	124005-124027	23	NZ_CP033793	Bacillus sp. FDAARGOS_527 plasmid unnamed6, complete sequence	14945-14967	1	0.957
NC_022882_1	1.4\|124005\|23\|NC_022882\|CRISPRCasFinder	124005-124027	23	MN549361	Rhizobium phage RL2RES, complete genome	47354-47376	2	0.913
NC_022882_1	1.4\|124005\|23\|NC_022882\|CRISPRCasFinder	124005-124027	23	NC_025429	Rhizobium phage vB_RleM_P10VF, complete genome	99313-99335	2	0.913
NC_022882_1	1.4\|124005\|23\|NC_022882\|CRISPRCasFinder	124005-124027	23	MT778839	Rhizobium phage P9VFCI, complete genome	73066-73088	2	0.913
NC_022882_1	1.4\|124005\|23\|NC_022882\|CRISPRCasFinder	124005-124027	23	MN549360	Rhizobium phage RL38J1, complete genome	148128-148150	2	0.913
NC_022882_1	1.1\|123801\|26\|NC_022882\|CRISPRCasFinder	123801-123826	26	NC_022782	Bacillus toyonensis BCT-7112 plasmid pBCT77, complete sequence	34810-34835	3	0.885
NC_022882_1	1.2\|123861\|38\|NC_022882\|CRISPRCasFinder	123861-123898	38	NZ_CP033793	Bacillus sp. FDAARGOS_527 plasmid unnamed6, complete sequence	15059-15096	4	0.895

1. spacer 1.1|123801|26|NC_022882|CRISPRCasFinder matches to NC_022877 (Bacillus thuringiensis YBT-1518 plasmid pBMB0232, complete sequence) position: , mismatch: 0, identity: 1.0

gttgaaatgtcctgttctgactggat	CRISPR spacer
gttgaaatgtcctgttctgactggat	Protospacer
**************************

2. spacer 1.1|123801|26|NC_022882|CRISPRCasFinder matches to NZ_CP033793 (Bacillus sp. FDAARGOS_527 plasmid unnamed6, complete sequence) position: , mismatch: 0, identity: 1.0

gttgaaatgtcctgttctgactggat	CRISPR spacer
gttgaaatgtcctgttctgactggat	Protospacer
**************************

3. spacer 1.1|123801|26|NC_022882|CRISPRCasFinder matches to NC_022882 (Bacillus thuringiensis YBT-1518 plasmid pBMB0233, complete sequence) position: , mismatch: 0, identity: 1.0

gttgaaatgtcctgttctgactggat	CRISPR spacer
gttgaaatgtcctgttctgactggat	Protospacer
**************************

4. spacer 1.2|123861|38|NC_022882|CRISPRCasFinder matches to NC_022877 (Bacillus thuringiensis YBT-1518 plasmid pBMB0232, complete sequence) position: , mismatch: 0, identity: 1.0

gatgggatttcttcaaatgtttcatgatttgctgatac	CRISPR spacer
gatgggatttcttcaaatgtttcatgatttgctgatac	Protospacer
**************************************

5. spacer 1.2|123861|38|NC_022882|CRISPRCasFinder matches to NC_022882 (Bacillus thuringiensis YBT-1518 plasmid pBMB0233, complete sequence) position: , mismatch: 0, identity: 1.0

gatgggatttcttcaaatgtttcatgatttgctgatac	CRISPR spacer
gatgggatttcttcaaatgtttcatgatttgctgatac	Protospacer
**************************************

6. spacer 1.3|123933|38|NC_022882|CRISPRCasFinder matches to NC_022882 (Bacillus thuringiensis YBT-1518 plasmid pBMB0233, complete sequence) position: , mismatch: 0, identity: 1.0

gtctggatttcttcatatacttccatatcgtttggaac	CRISPR spacer
gtctggatttcttcatatacttccatatcgtttggaac	Protospacer
**************************************

7. spacer 1.3|123933|38|NC_022882|CRISPRCasFinder matches to NC_022877 (Bacillus thuringiensis YBT-1518 plasmid pBMB0232, complete sequence) position: , mismatch: 0, identity: 1.0

gtctggatttcttcatatacttccatatcgtttggaac	CRISPR spacer
gtctggatttcttcatatacttccatatcgtttggaac	Protospacer
**************************************

8. spacer 1.4|124005|23|NC_022882|CRISPRCasFinder matches to NC_022882 (Bacillus thuringiensis YBT-1518 plasmid pBMB0233, complete sequence) position: , mismatch: 0, identity: 1.0

tgttgtacatcttcatgtacttc	CRISPR spacer
tgttgtacatcttcatgtacttc	Protospacer
***********************

9. spacer 1.4|124005|23|NC_022882|CRISPRCasFinder matches to NC_022877 (Bacillus thuringiensis YBT-1518 plasmid pBMB0232, complete sequence) position: , mismatch: 0, identity: 1.0

tgttgtacatcttcatgtacttc	CRISPR spacer
tgttgtacatcttcatgtacttc	Protospacer
***********************

10. spacer 1.4|124005|23|NC_022882|CRISPRCasFinder matches to NC_022782 (Bacillus toyonensis BCT-7112 plasmid pBCT77, complete sequence) position: , mismatch: 0, identity: 1.0

tgttgtacatcttcatgtacttc	CRISPR spacer
tgttgtacatcttcatgtacttc	Protospacer
***********************

11. spacer 1.2|123861|38|NC_022882|CRISPRCasFinder matches to NC_022782 (Bacillus toyonensis BCT-7112 plasmid pBCT77, complete sequence) position: , mismatch: 1, identity: 0.974

gatgggatttcttcaaatgtttcatgatttgctgatac	CRISPR spacer
gatgggatttcttcaaatgtttcatgatctgctgatac	Protospacer
****************************.*********

12. spacer 1.3|123933|38|NC_022882|CRISPRCasFinder matches to NC_022782 (Bacillus toyonensis BCT-7112 plasmid pBCT77, complete sequence) position: , mismatch: 1, identity: 0.974

gtctggatttcttcatatacttccatatcgtttggaac	CRISPR spacer
gtctggatttcttcatatacttccatatcgcttggaac	Protospacer
******************************.*******

13. spacer 1.4|124005|23|NC_022882|CRISPRCasFinder matches to NC_018685 (Bacillus thuringiensis MC28 plasmid pMC95, complete sequence) position: , mismatch: 1, identity: 0.957

tgttgtacatcttcatgtacttc	CRISPR spacer
tgttgtacctcttcatgtacttc	Protospacer
******** **************

14. spacer 1.4|124005|23|NC_022882|CRISPRCasFinder matches to NZ_CP033793 (Bacillus sp. FDAARGOS_527 plasmid unnamed6, complete sequence) position: , mismatch: 1, identity: 0.957

tgttgtacatcttcatgtacttc	CRISPR spacer
tgttgtacctcttcatgtacttc	Protospacer
******** **************

15. spacer 1.4|124005|23|NC_022882|CRISPRCasFinder matches to MN549361 (Rhizobium phage RL2RES, complete genome) position: , mismatch: 2, identity: 0.913

tgttgtacatcttcatgtacttc	CRISPR spacer
tgttgtacttcttcaggtacttc	Protospacer
******** ****** *******

16. spacer 1.4|124005|23|NC_022882|CRISPRCasFinder matches to NC_025429 (Rhizobium phage vB_RleM_P10VF, complete genome) position: , mismatch: 2, identity: 0.913

tgttgtacatcttcatgtacttc	CRISPR spacer
tgttgtacttcttcaggtacttc	Protospacer
******** ****** *******

17. spacer 1.4|124005|23|NC_022882|CRISPRCasFinder matches to MT778839 (Rhizobium phage P9VFCI, complete genome) position: , mismatch: 2, identity: 0.913

tgttgtacatcttcatgtacttc	CRISPR spacer
tgttgtacttcttcaggtacttc	Protospacer
******** ****** *******

18. spacer 1.4|124005|23|NC_022882|CRISPRCasFinder matches to MN549360 (Rhizobium phage RL38J1, complete genome) position: , mismatch: 2, identity: 0.913

tgttgtacatcttcatgtacttc	CRISPR spacer
tgttgtacttcttcaggtacttc	Protospacer
******** ****** *******

19. spacer 1.1|123801|26|NC_022882|CRISPRCasFinder matches to NC_022782 (Bacillus toyonensis BCT-7112 plasmid pBCT77, complete sequence) position: , mismatch: 3, identity: 0.885

gttgaaatgtcctgttctgactggat	CRISPR spacer
gttgaaatgtcctgttctgattttat	Protospacer
********************.*  **

20. spacer 1.2|123861|38|NC_022882|CRISPRCasFinder matches to NZ_CP033793 (Bacillus sp. FDAARGOS_527 plasmid unnamed6, complete sequence) position: , mismatch: 4, identity: 0.895

gatgggatttcttcaaatgtttcatgatttgctgatac	CRISPR spacer
gattggatttcttcaaatgtttcatgatctgctgacat	Protospacer
*** ************************.******.*.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

237 : 64637

Bacillus_phage(35.71%)

transposase,integrase

attL 17517:17571|attR 45709:45763

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023523974.1\|237_1125_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_023523975.1\|1302_1989_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.1e-71	59.8
WP_080672514.1\|2606_3050_-	replication-relaxation family protein	H0USY2	Bacillus_phage	3.5e-24	45.9
WP_023523978.1\|2988_3261_-	hypothetical protein	H0USY1	Bacillus_phage	2.5e-12	50.0
WP_175056344.1\|3630_3828_-	hypothetical protein	NA	NA	NA	NA
WP_023523981.1\|4018_5077_-	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_167332627.1\|6838_8416_+	hypothetical protein	NA	NA	NA	NA
WP_099046450.1\|8724_9514_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_000410775.1\|9912_10116_+	cold-shock protein	Q9AZD3	Lactococcus_phage	1.5e-17	63.6
WP_142322468.1\|11164_11284_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_023523987.1\|11577_11799_-	hypothetical protein	NA	NA	NA	NA
WP_023523988.1\|12036_12213_-	hypothetical protein	NA	NA	NA	NA
WP_000157958.1\|12209_12449_-	DUF2187 family protein	NA	NA	NA	NA
WP_023523989.1\|12438_12675_-	hypothetical protein	A0A1B1P789	Bacillus_phage	4.2e-08	36.7
WP_023523990.1\|12750_12978_-	hypothetical protein	NA	NA	NA	NA
WP_023523991.1\|13170_13320_+	hypothetical protein	NA	NA	NA	NA
WP_023523992.1\|13380_13710_+	hypothetical protein	NA	NA	NA	NA
WP_023523993.1\|14012_15761_-	sulfate permease	A0A2H4J153	uncultured_Caudovirales_phage	1.6e-40	26.4
WP_023523994.1\|15788_16364_-	carbonic anhydrase	NA	NA	NA	NA
WP_023523995.1\|16996_17473_+	hypothetical protein	NA	NA	NA	NA
17517:17571	attL	NA	NA	NA	NA
WP_023520903.1\|18976_19846_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_023523998.1\|20246_20951_-	endonuclease	NA	NA	NA	NA
WP_023523999.1\|21006_21546_-	spermidine N1-acetyltransferase	NA	NA	NA	NA
WP_023524001.1\|22817_24671_-	ABC transporter permease	NA	NA	NA	NA
WP_043924996.1\|24687_25449_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-33	39.5
WP_023524003.1\|25803_26868_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	4.7e-22	27.7
WP_023524004.1\|26864_27551_-	response regulator transcription factor	W8CYM9	Bacillus_phage	5.3e-43	39.1
WP_099046451.1\|27997_28787_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_023524007.1\|29444_30035_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_023524010.1\|31784_32753_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_023524011.1\|32801_33011_-	hypothetical protein	NA	NA	NA	NA
WP_023524012.1\|33360_33600_-	hypothetical protein	NA	NA	NA	NA
WP_023524013.1\|34625_35234_-	hypothetical protein	NA	NA	NA	NA
WP_023524014.1\|35367_35979_-	hypothetical protein	A0A2I7SCF1	Paenibacillus_phage	7.0e-31	49.2
WP_004409736.1\|36520_37030_-	hypothetical protein	NA	NA	NA	NA
WP_000744474.1\|37946_39230_+	HBL/NHE enterotoxin family protein	NA	NA	NA	NA
WP_023524015.1\|39281_40484_+	HBL/NHE enterotoxin family protein	NA	NA	NA	NA
WP_000616859.1\|40667_41762_+	HBL/NHE enterotoxin family protein	NA	NA	NA	NA
WP_001097548.1\|41937_43050_+	HBL/NHE enterotoxin family protein	NA	NA	NA	NA
WP_023524017.1\|44078_45191_-	helix-turn-helix domain-containing protein	A0A288TXV8	Enterococcus_phage	3.3e-79	47.1
WP_000762754.1\|45202_45601_-\|transposase	IS200/IS605 family transposase	A0A286QN76	Streptococcus_phage	6.8e-51	68.2
WP_099046452.1\|46023_46813_-\|transposase	IS5 family transposase	NA	NA	NA	NA
45709:45763	attR	NA	NA	NA	NA
WP_023524020.1\|48045_48213_+	hypothetical protein	NA	NA	NA	NA
WP_157412330.1\|48216_48342_+	hypothetical protein	NA	NA	NA	NA
WP_080672498.1\|48326_48890_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_023523578.1\|49519_49735_-	hypothetical protein	NA	NA	NA	NA
WP_001065234.1\|51160_51772_+	recombinase family protein	A0A1V0E035	Clostridioides_phage	6.4e-16	32.0
WP_023523749.1\|52548_52884_+	DUF4257 domain-containing protein	NA	NA	NA	NA
WP_023524022.1\|53118_53739_+	hypothetical protein	NA	NA	NA	NA
WP_023524023.1\|54124_54736_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_023524024.1\|56228_56591_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_023524026.1\|57695_57956_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_157762876.1\|58044_58221_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_023520826.1\|58654_59929_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.7e-32	32.2
WP_023524027.1\|60440_61451_-	hypothetical protein	NA	NA	NA	NA
WP_023524028.1\|63020_63308_+	hypothetical protein	NA	NA	NA	NA
WP_099046435.1\|63848_64637_+\|transposase	IS5 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

72648 : 156881

Bacillus_phage(28.57%)

transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142307242.1\|72648_72822_+\|transposase	transposase	NA	NA	NA	NA
WP_099046449.1\|74320_75110_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_023523959.1\|75536_76748_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	4.3e-64	35.9
WP_023523958.1\|76966_77815_-	ADP-ribosyltransferase	Q331X8	Clostridium_botulinum_C_phage	1.2e-17	33.3
WP_099046434.1\|79993_80782_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_023523954.1\|82779_83004_-	hypothetical protein	A0A0S2GLK0	Bacillus_phage	8.0e-25	70.3
WP_043924954.1\|83695_84565_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_023523945.1\|91577_91898_+	DUF4183 domain-containing protein	NA	NA	NA	NA
WP_023520826.1\|92856_94131_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.7e-32	32.2
WP_023523943.1\|96282_96507_+	hemolysin XhlA family protein	H0USX6	Bacillus_phage	1.1e-21	78.9
WP_023523942.1\|96587_96941_+\|holin	phage holin family protein	A0A1B1P787	Bacillus_phage	1.2e-35	67.5
WP_023523940.1\|97480_97627_+	N-acetylmuramoyl-L-alanine amidase	A0A2P1JUJ2	Bacillus_phage	3.1e-09	55.3
WP_023523939.1\|98617_98848_+	hypothetical protein	NA	NA	NA	NA
WP_023523938.1\|98973_99843_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_157762875.1\|99993_100152_+	hypothetical protein	NA	NA	NA	NA
WP_023523936.1\|100978_102169_-	C1 family peptidase	A0A2K9L9R4	Tupanvirus	1.2e-15	26.0
WP_099046435.1\|102488_103278_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_023523935.1\|103768_104767_+	glycosyltransferase family 1 protein	NA	NA	NA	NA
WP_023523934.1\|104729_105827_+	polysaccharide pyruvyl transferase family protein	NA	NA	NA	NA
WP_023523933.1\|108054_108795_+	glucose-1-phosphate cytidylyltransferase	NA	NA	NA	NA
WP_023523932.1\|108814_110929_+	hypothetical protein	NA	NA	NA	NA
WP_023523931.1\|110961_111930_+	SDR family NAD(P)-dependent oxidoreductase	J7Q7J8	Aeropyrum_coil-shaped_virus	4.0e-20	28.6
WP_023523930.1\|111945_113022_+	CDP-glucose 4,6-dehydratase	J7Q7J8	Aeropyrum_coil-shaped_virus	4.4e-12	37.3
WP_023523929.1\|113182_113989_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_023523928.1\|115375_115777_-\|transposase	IS200/IS605 family transposase	Q332K6	Clostridium_botulinum_C_phage	1.9e-48	68.2
WP_023523927.1\|116183_116396_-	hypothetical protein	NA	NA	NA	NA
WP_023523925.1\|117080_118310_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.4e-80	47.5
WP_023523922.1\|119233_119818_-	hypothetical protein	NA	NA	NA	NA
WP_023523921.1\|119842_120970_-	peptidoglycan DD-metalloendopeptidase family protein	A0A2D0ZM66	Rhodococcus_phage	1.1e-16	39.8
WP_023520826.1\|121233_122508_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.7e-32	32.2
WP_023524036.1\|125955_126465_-	hypothetical protein	NA	NA	NA	NA
WP_080672513.1\|126523_127537_-	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	2.0e-38	34.7
WP_023523916.1\|127620_129447_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.5e-31	27.0
WP_023523914.1\|131745_132297_-\|transposase	transposase	NA	NA	NA	NA
WP_000281809.1\|132324_132576_-	hypothetical protein	NA	NA	NA	NA
WP_023523913.1\|132585_133563_-	conjugal transfer protein	NA	NA	NA	NA
WP_023524037.1\|133576_133831_-	hypothetical protein	NA	NA	NA	NA
WP_023524038.1\|134059_134902_-	replication-relaxation family protein	NA	NA	NA	NA
WP_023523909.1\|134907_135843_-	hypothetical protein	NA	NA	NA	NA
WP_023523908.1\|135969_137859_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	7.0e-29	28.8
WP_000517898.1\|140522_140762_-	hypothetical protein	NA	NA	NA	NA
WP_023523906.1\|140821_141004_-	hypothetical protein	NA	NA	NA	NA
WP_023523905.1\|141064_141601_-	type IV secretion system DNA-binding domain-containing protein	NA	NA	NA	NA
WP_023523904.1\|141633_141819_-	hypothetical protein	NA	NA	NA	NA
WP_023524039.1\|141853_144118_-	Cys-Gln thioester bond-forming surface protein	NA	NA	NA	NA
WP_023524040.1\|144299_144533_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_023524041.1\|144650_144995_+	helix-turn-helix domain-containing protein	A0A0A7RUJ5	Clostridium_phage	6.6e-10	41.7
WP_000728845.1\|145008_145164_-	hypothetical protein	NA	NA	NA	NA
WP_023524042.1\|145435_146560_-	helix-turn-helix transcriptional regulator	D2XQ10	Bacillus_virus	2.1e-52	34.1
WP_023524043.1\|147088_148093_+	hypothetical protein	NA	NA	NA	NA
WP_023524046.1\|150476_151637_+	ParM/StbA family protein	NA	NA	NA	NA
WP_023524047.1\|151636_152020_+	hypothetical protein	NA	NA	NA	NA
WP_023524048.1\|152128_152686_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_023524049.1\|152704_153175_-	DUF559 domain-containing protein	NA	NA	NA	NA
WP_000466107.1\|153554_153776_+	helix-turn-helix transcriptional regulator	A0A0S2GLH4	Bacillus_phage	3.8e-11	50.7
WP_043924984.1\|153804_154458_-	replication-relaxation family protein	A0A1B1P7T2	Bacillus_phage	7.0e-77	63.9
WP_023524052.1\|155375_156881_+\|transposase	IS21 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

167103 : 237614

Bacillus_phage(33.33%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085962062.1\|167103_167893_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_023524062.1\|168404_168803_+\|transposase	IS200/IS605 family transposase	A0A286QN76	Streptococcus_phage	5.4e-48	65.2
WP_085962062.1\|170022_170811_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_157762877.1\|171267_171858_+	hypothetical protein	NA	NA	NA	NA
WP_023524060.1\|171994_173350_+	DUF393 domain-containing protein	NA	NA	NA	NA
WP_023524059.1\|173647_174070_+	hypothetical protein	NA	NA	NA	NA
WP_000425127.1\|175781_176117_-	DUF4257 domain-containing protein	NA	NA	NA	NA
WP_023520826.1\|177522_178797_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.7e-32	32.2
WP_023524063.1\|179060_180173_+	peptidoglycan DD-metalloendopeptidase family protein	A0A2D0ZM66	Rhodococcus_phage	9.5e-18	41.0
WP_023524068.1\|182324_183908_-	amidase	NA	NA	NA	NA
WP_023524062.1\|186486_186885_-\|transposase	IS200/IS605 family transposase	A0A286QN76	Streptococcus_phage	5.4e-48	65.2
WP_000862390.1\|187239_187797_+	hypothetical protein	NA	NA	NA	NA
WP_080672520.1\|187834_188302_+\|protease	protease inhibitor I42 family protein	NA	NA	NA	NA
WP_023524071.1\|189923_190631_-\|transposase	IS6 family transposase	A0A1X9I6E7	Streptococcus_phage	9.0e-38	42.5
WP_023524072.1\|190789_191215_-	hypothetical protein	NA	NA	NA	NA
WP_043924989.1\|191443_194164_-	collagenase	NA	NA	NA	NA
WP_157762878.1\|195247_196447_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_023524077.1\|196785_197079_-	hypothetical protein	NA	NA	NA	NA
WP_142322459.1\|197264_197525_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_001256731.1\|197909_198101_-	hypothetical protein	NA	NA	NA	NA
WP_023524078.1\|198951_199140_-	DUF2187 family protein	NA	NA	NA	NA
WP_000991919.1\|199388_199706_+	hypothetical protein	A0A2H4JAV2	uncultured_Caudovirales_phage	4.3e-16	43.0
WP_052364214.1\|199943_200387_-	hypothetical protein	NA	NA	NA	NA
WP_099046454.1\|201001_202051_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A1P8DJG9	Virus_Rctr71	1.8e-18	38.5
WP_023524081.1\|202086_202488_-\|transposase	IS200/IS605 family transposase	Q332K6	Clostridium_botulinum_C_phage	3.8e-49	68.9
WP_023524082.1\|202801_203245_+	hypothetical protein	NA	NA	NA	NA
WP_000872573.1\|203774_205373_-	hypothetical protein	NA	NA	NA	NA
WP_023520826.1\|208030_209305_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.7e-32	32.2
WP_023524087.1\|209935_211006_+	hypothetical protein	NA	NA	NA	NA
WP_023524089.1\|212587_213769_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_023524090.1\|213867_215085_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_023524091.1\|215119_216193_-	glycosyltransferase	NA	NA	NA	NA
WP_023524092.1\|216189_217143_-	hypothetical protein	NA	NA	NA	NA
WP_023524093.1\|217165_218425_-	S-adenosylmethionine synthetase	NA	NA	NA	NA
WP_023524094.1\|218408_219434_-	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_023524095.1\|219750_220617_+	shikimate dehydrogenase	NA	NA	NA	NA
WP_023524096.1\|220613_221480_+	TIM barrel protein	NA	NA	NA	NA
WP_023524097.1\|221469_222273_+	coenzyme F420-0:L-glutamate ligase	NA	NA	NA	NA
WP_023524098.1\|222394_223717_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	5.0e-90	40.4
WP_023524099.1\|223785_224331_+	topology modulation protein	A0A097BYE2	Leuconostoc_phage	6.7e-33	42.1
WP_023524100.1\|224597_226382_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.8e-51	29.7
WP_097984874.1\|226374_228087_-	ABC transporter ATP-binding protein	A0A1V0SJ29	Klosneuvirus	2.3e-18	25.6
WP_023524102.1\|229174_229993_-	5'-nucleotidase, lipoprotein e(P4) family	NA	NA	NA	NA
WP_000540299.1\|230454_231141_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	4.1e-72	60.3
WP_023524103.1\|231629_231926_+	hypothetical protein	H0USY0	Bacillus_phage	1.2e-12	45.1
WP_000152452.1\|231927_232113_+	hypothetical protein	NA	NA	NA	NA
WP_023524104.1\|232213_233395_+	cell division protein FtsK	A0A288WGQ0	Bacillus_phage	7.0e-120	54.0
WP_043924990.1\|233333_233951_+	replication-relaxation family protein	Q2LIA9	Bacillus_phage	6.4e-40	48.1
WP_023524106.1\|234029_234257_-	helix-turn-helix transcriptional regulator	A0A0S2MVM0	Bacillus_phage	1.1e-13	50.0
WP_023524107.1\|234614_235619_-	hypothetical protein	NA	NA	NA	NA
WP_099046453.1\|236824_237614_-\|transposase	IS5 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage