CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_021744	Lactobacillus helveticus CNRZ32, complete sequence	1 crisprs	cas14j,cas14k,csa3,Cas14u_CAS-V,DEDDh,cas3,DinG,cas2	0	0	19	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_021744_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_021744_1

711731-711910

TypeV

Consensus_repeat	Method
ATGTGGGATTTGAACCCACGC	PILER-CR

2 spacers

cas14j,cas14k

The CRISPR arrays of NC_021744_1

>merge|NC_021744|1|711731-711910|PILER-CR
ATGTGGGATTCGAACCCACGCATGCTGGATCCACAAACCAGTGTGTTAACCCCTTCACCAATTCCGCCATAAACGGTCCATGTGGGATTTGAACCCACGATCTCCTCCGTGACAGGGAGGCGAGATAAACCACTGCTCCAATGGACCAATCAGAGGAGGATGTGGGATTTGAACCCACGC

>NC_021744|1|1|711731-711910|PILER-CR
ATGTGGGATTCGAACCCACGC	ATGCTGGATCCACAAACCAGTGTGTTAACCCCTTCACCAATTCCGCCATAAACGGTCC
ATGTGGGATTTGAACCCACGA	TCTCCTCCGTGACAGGGAGGCGAGATAAACCACTGCTCCAATGGACCAATCAGAGGAGG
ATGTGGGATTTGAACCCACGC

Protein	Signature genes	Signature genes Name	Protein_function
NC_021744.1\|WP_003627960.1\|713667_714276_-\|IS607-family-transposase	unknown	unknown	gnl\|CDD\|239738
NC_021744.1\|WP_020829063.1\|703653_704859_+\|multidrug-efflux-MFS-transporter	unknown	unknown	gnl\|CDD\|340949
NC_021744.1\|WP_020829064.1\|704882_706352_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341045
NC_021744.1\|WP_003633105.1\|707185_708514_+\|uracil-transporter	unknown	unknown	gnl\|CDD\|236744
NC_021744.1\|WP_041806186.1\|715089_716496_-\|ISLre2-like-element-ISLhe10-family-transposase	unknown	unknown	gnl\|CDD\|284250
NC_021744.1\|WP_020829062.1\|700717_702340_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|237894
NC_021744.1\|WP_003633120.1\|698226_699045_+\|transporter-substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|270407
NC_021744.1\|WP_012211524.1\|719959_720916_+\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NC_021744.1\|WP_003633076.1\|721772_722024_-\|PspC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377200
NC_021744.1\|WP_003633113.1\|702444_703527_-\|M42-family-peptidase	unknown	unknown	gnl\|CDD\|349906
NC_021744.1\|WP_041806185.1\|712312_713638_-\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	cas14k	-	gnl\|CDD\|223747
NC_021744.1\|WP_035509267.1\|717767_718196_-\|hypothetical-protein	unknown	unknown	unknown
NC_021744.1\|WP_020829066.1\|714378_714879_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NC_021744.1\|WP_003626854.1\|699769_700441_-\|hypothetical-protein	unknown	unknown	unknown
NC_021744.1\|WP_003633083.1\|718404_718605_+\|cold-shock-protein	unknown	unknown	gnl\|CDD\|224197
NC_021744.1\|WP_020829061.1\|699087_699756_-\|type-1-glutamine-amidotransferase	unknown	unknown	gnl\|CDD\|153212
NC_021744.1\|WP_020829065.1\|706642_707173_+\|bifunctional-pyr-operon-transcriptional-regulator/uracil-phosphoribosyltransferase-PyrR	unknown	unknown	gnl\|CDD\|235365
NC_021744.1\|WP_096001369.1\|709436_710666_-\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	cas14j	-	gnl\|CDD\|223747
NC_021744.1\|WP_003633078.1\|721033_721591_-\|YdhK-family-protein	unknown	unknown	gnl\|CDD\|369427
NC_021744.1\|WP_003633074.1\|722069_722417_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224609

Protein	Function_ID	Function_description	E-value
NC_021744.1\|WP_003627960.1\|713667_714276_-\|IS607-family-transposase	gnl\|CDD\|239738	cd03769, SR_IS607_transposase_like, Serine Recombinase (SR) family, IS607-like transposase subfamily, catalytic domain; members contain a DNA binding domain with homology to MerR/SoxR located N-terminal to the catalytic domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. This subfamily is composed of proteins that catalyze the transposition of insertion sequence (IS) elements such as IS607 from Helicobacter and IS1535 from Mycobacterium, and similar proteins from other bacteria and several archaeal species. IS elements are DNA segments that move to new sites in prokaryotic and eukaryotic genomes causing insertion mutations and gene rearrangements.	5.78857e-48
NC_021744.1\|WP_020829063.1\|703653_704859_+\|multidrug-efflux-MFS-transporter	gnl\|CDD\|340949	cd17391, MFS_MdtG_MDR_like, Multidrug resistance protein MdtG and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli multidrug resistance protein MdtG, Streptococcus pneumoniae multidrug resistance efflux pump PmrA, and similar multidrug resistance (MDR) transporters from bacteria. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtG confers resistance to fosfomycin and deoxycholate. PmrA serves as an efflux pump for various substrates and is associated with fluoroquinolone resistance. MdtG-like MDR transporters belong to the bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.00067e-154
NC_021744.1\|WP_020829064.1\|704882_706352_-\|MFS-transporter	gnl\|CDD\|341045	cd17502, MFS_Azr1_MDR_like, Saccharomyces cerevisiae Azole resistance protein 1 (Azr1p), and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of multidrug resistance (MDR) transporters including various Saccharomyces cerevisiae proteins such as azole resistance protein 1 (Azr1p), vacuolar basic amino acid transporter 1 (Vba1p), vacuolar basic amino acid transporter 5 (Vba5p), and Sge1p (also known as Nor1p, 10-N-nonyl acridine orange resistance protein, and crystal violet resistance protein). MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.99366e-46
NC_021744.1\|WP_003633105.1\|707185_708514_+\|uracil-transporter	gnl\|CDD\|236744	PRK10720, PRK10720, uracil transporter; Provisional.	2.42621e-145
NC_021744.1\|WP_041806186.1\|715089_716496_-\|ISLre2-like-element-ISLhe10-family-transposase	gnl\|CDD\|284250	pfam06782, UPF0236, Uncharacterized protein family (UPF0236).	1.66924e-26
NC_021744.1\|WP_020829062.1\|700717_702340_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|237894	PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional.	0
NC_021744.1\|WP_003633120.1\|698226_699045_+\|transporter-substrate-binding-domain-containing-protein	gnl\|CDD\|270407	cd13689, PBP2_BsGlnH, Substrate binding domain of ABC glutamine transporter from Bacillus subtilis; the type 2 periplasmic-bindig protein fold. This group includes periplasmic glutamine-binding domain GlnP from Bacillus subtilis and its related proteins. The GlnP domain belongs to the type 2 periplasmic binding protein fold superfamily (PBP2), whose many members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.60945e-76
NC_021744.1\|WP_012211524.1\|719959_720916_+\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	1.18527e-69
NC_021744.1\|WP_003633076.1\|721772_722024_-\|PspC-domain-containing-protein	gnl\|CDD\|377200	pfam04024, PspC, PspC domain. This family includes Phage shock protein C (PspC) that is thought to be a transcriptional regulator. The presumed domain is 60 amino acid residues in length.	8.8979e-16
NC_021744.1\|WP_003633113.1\|702444_703527_-\|M42-family-peptidase	gnl\|CDD\|349906	cd05656, M42_Frv, M42 Peptidase, endoglucanases. Peptidase M42 family, Frv (Frv Operon Protein; Endo-1 4-Beta-Glucanase; Cellulase Protein; Endoglucanase; Endo-1 4-Beta-Glucanase Homolog; Glucanase; EC. 3.2.1.4) subfamily. Frv is a co-catalytic metallopeptidase, found in archaea and bacteria, including Pyrococcus horikoshii tetrahedral shaped phTET1 (DAPPh1; FrvX; PhDAP aminopeptidase; PhTET aminopeptidase; deblocking aminopeptidase), phTET2 (DAPPh2) and phTET3 (DAPPh3), Haloarcula marismortui TET (HmTET) as well as Bacillus subtilis YsdC. All of these exhibit aminopeptidase and deblocking activities. The HmTET is a broad substrate aminopeptidase capable of degrading large peptides. PhTET2, which shares 24% identity with HmTET, is a cobalt-activated peptidase and possibly a deblocking aminopeptidase, assembled as a 12-subunit tetrahedral dodecamer, while PhTET1 can be alternatively assembled as a tetrahedral dodecamer or as an octahedral tetracosameric structure. The active site in such a self-compartmentalized complex is located on the inside such that substrate sizes are limited, indicating function as possible peptide scavengers. PhTET2 cleaves polypeptides by a nonprocessive mechanism, preferring N-terminal hydrophobic or uncharged polar amino acids. Streptococcus pneumoniae PepA (SpPepA) also forms dodecamer with tetrahedral architecture, and exhibits selective substrate specificity to acidic amino acids with the preference to glutamic acid, with the substrate binding S1 pocket containing an Arg allows electrostatic interactions with the N-terminal acidic residue in the substrate. The YsdC gene is conserved in a number of thermophiles, archaea and pathogenic bacterial species; the closest structural homolog is Thermotoga maritima FrwX (34% identity), which is annotated as either a cellulase or an endoglucanase, and is possibly involved in polysaccharide biosynthesis or degradation.	2.57949e-100
NC_021744.1\|WP_041806185.1\|712312_713638_-\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	gnl\|CDD\|223747	COG0675, COG0675, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	4.839e-18
NC_021744.1\|WP_020829066.1\|714378_714879_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	4.46798e-13
NC_021744.1\|WP_003633083.1\|718404_718605_+\|cold-shock-protein	gnl\|CDD\|224197	COG1278, CspC, Cold shock proteins [Transcription].	1.28077e-33
NC_021744.1\|WP_020829061.1\|699087_699756_-\|type-1-glutamine-amidotransferase	gnl\|CDD\|153212	cd01741, GATase1_1, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. This group contains a subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. GATase activity catalyses the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate. Glutamine amidotransferases (GATase) includes the triad family of amidotransferases which have a conserved Cys-His-Glu catalytic triad in the glutaminase active site. In this subgroup this triad is conserved. GATase activity can be found in a range of biosynthetic enzymes, including: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase , anthranilate synthase component II, glutamine-dependent carbamoyl phosphate synthase, cytidine triphosphate synthetase, gamma-glutamyl hydrolase, imidazole glycerol phosphate synthase and, cobyric acid synthase. Glutamine amidotransferase (GATase) domains can occur either as single polypeptides, as in glutamine amidotransferases, or as domains in a much larger multifunctional synthase protein, such as CPSase.	2.46916e-54
NC_021744.1\|WP_020829065.1\|706642_707173_+\|bifunctional-pyr-operon-transcriptional-regulator/uracil-phosphoribosyltransferase-PyrR	gnl\|CDD\|235365	PRK05205, PRK05205, bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR.	2.39737e-98
NC_021744.1\|WP_096001369.1\|709436_710666_-\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	gnl\|CDD\|223747	COG0675, COG0675, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	4.88705e-46
NC_021744.1\|WP_003633078.1\|721033_721591_-\|YdhK-family-protein	gnl\|CDD\|369427	pfam07563, DUF1541, Protein of unknown function (DUF1541). This family consists of several hypothetical bacterial and occurs as a tandem repeat.	4.07677e-19
NC_021744.1\|WP_003633074.1\|722069_722417_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224609	COG1695, COG1695, Predicted transcriptional regulators [Transcription].	1.2106e-16

>NC_021744.1|WP_096001369.1|709436_710666_-|IS200/IS605-family-element-transposase-accessory-protein-TnpB
MFDIILKRKEGTNVLKGIKLRLYPNRTQQNQLEQMFGNDRFVWNQMLAMMNERYQNNKDLPFLGKFKLNYLLKPLKKEYPFLKNSDSSSLQVVNEFLTQSWKNFFQDKTGQIGKPRFHSRKYLKKSYTGKSIIKTAGKRYLKIPKLGYVKTSKTGVLQNTKVKRYTVVLEPTGKYYLSLQVEISEPEKYSLTGKRVGIDVGAADLAILSNGLKYPSFNSSYFEKKAKVWQRKYARRRHLAKLLVLQDRNKKVPCPRSLESFTNWQKAQKSKAKCQAKAANQRRDYLHKLTTHLVKQYDVIAIEDLKTKNLQKNHHLAKSIANASWRMFRQMLEYKCEWYGKKLIAVDPKNTSRICSKCGYNSGAKPLEIREWTCSKCQTKHDRDINAAVNILHKGSTKLNGQGLAMVTS
>NC_021744.1|WP_003633105.1|707185_708514_+|uracil-transporter
MSKKENFRNPDAILDVYEKPEFGQGVLLSLQHTFAMFGSTVLVPILIGINPSIALLSSGIGTLVHMILTHFKIPAYLGSSFAFVATMQALMKADGYPAVAQGAIASGLVYVIVALIIAKVGSGWVNKVLPPIVVGPIIIVIGLSLATTAANDAMMNNQKYDLTYFGVAIFTLVMTLVFQMCFKGFTSLVSIMLGIICGYVLACFLGIVDFSGVEKAAWFSIPSLDVMGISYHFKWYPAAILAMAPIAFVTMTEHMGHIMVLNSLTKRNFFKNPGLHRTMMGDGISTIIAGFIGGPPTTSYGENIGVLAMTKVHSVWVLAGAAVCAIIFSFVGKLAALIESIPMPVIGGISFLLFGTIASNGLKILVDDKVDFGEKRNMLIASVILVIGIGGAYLQLGNFQLTSVALSTIIGMILNWVLPKKAASEKALEEKNKQKQDGKIYQ
>NC_021744.1|WP_020829065.1|706642_707173_+|bifunctional-pyr-operon-transcriptional-regulator/uracil-phosphoribosyltransferase-PyrR
MAKEIIDAIGMKRALMRMTYEIVERNKGTENLVLVGIKTRGLYLAQRIAANLKKLEDVEISVGAIDVLQYRDDLPESKKEKMIHNQQLDFDITDKNVVLVDDVLFTGRTIRAALDALMDQGRPAKINLAVLVDRGHRELPIRPDFIGKNIPTAMNEEVKVSMTEVDDKDSIELINK
>NC_021744.1|WP_020829064.1|704882_706352_-|MFS-transporter
MNKKQLFMVTLALLLANIMSGLDATIINTAIPAIVSDLHGIQYMGWIVACFLLGMSVSVPIWGKLGERMGNKFAFELSLALFILGSLLEGIALDIYFFLIARILMGVGAGGMGSLPYVIVGYIYPNIKRRTVILGYIAASFSAASIAGPLVGGWIVDTLSWHWVFYINVPLGLIAIILSFVYYKGIRKPNKNTQFDKLGAFTLIAGLTSFLIGIQLLGMVSLPVVLGFIILSILLLVVFIRAERKAKSPVVPLSVFTNKALVGDFLIFALAWGSSIAVNTYLPMWAQTILGASALVGGMTLIPNSIVDIVGSQTAPYFLRHVNNYRLLIANLTIMAITAVGLIFAPISTPYQILALIAAFSGFGVGSIFVILQIKVQVDASEKDMAPATSLSFLIRILALTIMAAIYGVIMNLALGRGIAGHPGITMTMMNKLSDAESAKSLPVQLLPTMRKIFYGGIREIMIVSLVLLVAAYVVNYLYNRHEAKIIAE
>NC_021744.1|WP_020829063.1|703653_704859_+|multidrug-efflux-MFS-transporter
MKEKPIWKKNLFVLSIAVFIAGIAFSEVMPFLPLYIDTLGKFSHQQLNFWSGFIYSGTYLVSALISPWWGKLADKKGRKPMTLRASLGMAIVIGCMGLVTNVYQLFILRMLQGVFAGFVSNSNALIATETPKEKSGQALGTMASSFTAGNLLGPFIGGALASIFSYRVTFFITGGLLLISFFLSLFFVHETDFKPVTEKKLDKASGIIKELRSPQLIFGLLLTTLIIQAANNSINPIVSLYVKQLMANHGNVVFISGVIAALPGIATFLAASRFGALGDRIGTHKIIVGGFIGATILFFLTAFVQNTVELGILRFLVGFTDACLFPQVQTLLTKNTPAKITGRIFSWNQSAMYVGNIFGPLLGSTISGLTSYSIVFIVTTIIVVFNLILFKFNVINNLRQK
>NC_021744.1|WP_003633113.1|702444_703527_-|M42-family-peptidase
MQKEQEIQMLKEFSDANSTSGFEEEFVKLFTSYAEKTANIEVDGMLNVYASKKENKGDRPVIQLDAHSDAVGFITQAVRPNGLIKFVPLGGWVKYNIPALKVKVRNRDGEYIPGVVATKPPHFMTAAERNNVPDVVDMSIDVGSSSREETIKDYKIDTGCPIFVDVKCEYHEKSGLFFGKDFDDRFGAGAMIDVLDNLKGEETNFDVVAALSSQEEVGLRGAYVTARKVKPDLCLVLESCPADDTFTPDWLSQTGLKRGPMLRDMDTTFLPNPKFQQYACDLADKNNIPYTRSVRTGGGQDGAAIYYENGAPTIVIGIPVRYEHSPYCFSSYKDFKASVDLATAIIRDITQEKLDSFKKF
>NC_021744.1|WP_020829062.1|700717_702340_-|ATP-binding-cassette-domain-containing-protein
MITVSDLSLKFGGRTLYEDVNLKFTPGNCYGVIGANGAGKSTFLKLLEGKLEPTTGSISIDPNERMSSLNQDHFAFEDFTVMDTVIQGHKELYQVMKEKDALYAKPDFGDEDGIKAAELESKFAELDGWNAEANASKLLQSLDIPESEHQMLMKELPESEKVKVLLAQALFGNPDILLLDEPTNGLDVHTVEWLENFLADYPNIVIVVSHDRHFLNQVCTEMCDVDRGKIQLYVGNYDFWYESSKLANELVANQNAKKEEKIKQLQEFIARFSANASKSRQATSRKKQLDKITLDDIKPSSRKYPFVKFEMHRDLGNDLVKVENVSYSVDGEKILDNVSFIVRPGDKVAFLSRNALATTALLDIIAGKIKPDTGTVTWGQTTAFNYMSRDLNANFNNDDLTILDWLRQYATKEQDDNTFLRGFLGRMLFSGEEIEKKIKVLSGGEKVRCQLSRMMLESANVLIMDDPTNHLDLESITALNDALVAYPGSILFTSHDHEFIQTIANHIIEVGPKGIVSRQDTTYDEFLDKESIQDQVEKIY
>NC_021744.1|WP_003626854.1|699769_700441_-|hypothetical-protein
MDNLPFSSVTDKLDNIPFNYDHAGTKEVVVNNVIGDYFNPVTKKYEISDHTFVVGYIKDSNLDQDIAIEQMQQAAMNIINELNKRQMPPHMVMPHLLTDVEKAKQVVTDDDVKISQLSKETGISEEILSDYRENPVTLKKASNSTIERLITKYYEKYFNRNEIEKFRFMLIKTVMAYLKENKKDEIDYDPVYELYKLCQQADWHRLARMEEIWRAFYTVDNQH
>NC_021744.1|WP_020829061.1|699087_699756_-|type-1-glutamine-amidotransferase
MRVNVLQHAPNEGPGSIQDWCHEHNHEMFVYYPTDFGILPTIDETDLLVILGSPNSPNDKLDWIKNERVLIKQMLKANKPILGICFGSQQSAKTLGYEVLDAPAKEVGWAPVYLQDHTIENIPKKLTALHWHQQMSEIPEDAKLLFSSDLVKNQGYLLGNNVIGLQFHFEPKEDNVREIAINDGAYALENNDLHQTPQEIIAHGVPKENKDVMFVLLDYITK
>NC_021744.1|WP_003633120.1|698226_699045_+|transporter-substrate-binding-domain-containing-protein
MKKRFFLSTLLIGIALFTLSACSQNKKQNVYQTVKSTKTINWGVKADTPLFGSMNIKTGKINGFEIDLAKALTKEMLGKNAKANFVTTTANTKIQLLKNRNVDAVIAAMTITPEREKQVNFSKPYFPAGQSIMVAKNNKIKNVKDLNNKKVLVVKGTTAADAVKKFAPKAEILQFDDYGQAFTALKAGQGDAFVTDNGILVGILRDSSGYKLVGGNFTNQPYGIAVNKGQTEMDKQINLALTKLEKDGTYNRLLKKWFGNIPGFNVKTAEKY
>NC_021744.1|WP_041806185.1|712312_713638_-|IS200/IS605-family-element-transposase-accessory-protein-TnpB
MRKKVVPRNKAKYEHLASEYLVAGNSKLDQCSHASHDLYNRDLYDLRQGFFKRNYVKGYCDLDQRFKKRYSARESMLYHSLFYVQSAQQTLKEVNTIWSAWLKALKAYQANPGKFTGRPRMPKYLAKGQRHVFFVTNQNAKVKDDYLIIPKLGFKLKLTPHLKAIQRVAFKPVYGGYKAIVQYKTNRDIDYLPDNGRYMGIDPGVDNAFACVANIQKAPLLVNGRAIKSVNQYYNKERSRLKALQARYHQLESIVDTQQGKKPVYRETKAMRRITAWRNRKIRQFAHKASKRIVDYALSCGANTIVIGNNKSWKRSSDMGRKNNQNFIGIPHKVMIDMIQYKANLAGISVIRTNESYTSQTSALDHEKPCWENGSQSRKRQGKTPINRRIHRGLFQSNNGRLVNADITGALQIIRKVFPKFSLDEGIEDAVLHPVKWSPLI
>NC_021744.1|WP_003627960.1|713667_714276_-|IS607-family-transposase
MKAGKVMDLLQISRSTLKRYREKGILEAKKLPTGQYDFDDDSVFLLKNKHSKRLTVLYGRVSTYKQKADLANQMQELSDFAQSKGFQANDSFQDIASGISFKNRKQFFKMLDLILAGKVKRVIITRKDRLSRVGFELFEYLFQNYGTEIDVISDEMNPKTDEQELFEEIISLLHCFSMREYSHRRAERKLFEATLNQKEKTK
>NC_021744.1|WP_020829066.1|714378_714879_-|GNAT-family-N-acetyltransferase
MIIKPLISEDEAKETSRLFQKCWQNTYKDILPDVFLDNIPENAWVKRLNESGRHNLIFIDDDNKIRAAVSYGRPRDTRMLGCGELMALYVEPDFQGFNIGKTLLNAAENELKKMGYGKIYLWCIDGDENARQFFEHFGWVNNATEKFVEIAGKEYKYLLYSHKLLV
>NC_021744.1|WP_041806186.1|715089_716496_-|ISLre2-like-element-ISLhe10-family-transposase
MESIIADIVKIIKSENNVIAREKALMCYFFDLIRELMTAALEEVDAGLVEETKKQGYQIEKKNKRSVVTAFGEISYWRRRYVCPGKKAQYPLDKLMGYDKYKRYSVLAVKDVLQVSAVATYRNTALAVNTLSCFKISHSQVGKLIVQAGKQIKAQQQSEERYDGITQKKKAPVLYLEGDGVVIKGTKKRLEFHRYQVCEDIINLSKTRRKRVQAKEFVSLSRLDALQEIKAYLANAYDLSDTLIISNADGGAGYAKKDFDEIVGYCRQHEHFLDVFHLNKKIKDRLGFMPAMQSKLISAVEFKYDRHLTDVILDTIESNLVDELNTPENHENLRRLRSYLHRRWVDIKPFKMRHLSVIKAIGCCESNHRKYTYRVKGQGKYWSEDGAEGILRVLTCIKNNELEYWLSSEFAGGQLDIGDQEDLKGAVRASLRKTHGVHLGIHHGAIESLTAGHSYLDDFSRKINQINI
>NC_021744.1|WP_035509267.1|717767_718196_-|hypothetical-protein
MINNWVSSSKELQLLVDDYLLMVNYRSVIENDLVNYTQGIESYFRNERLTLRDKINKFIEELPKSYRELLSEHVGNTDYWIGKLVSTRVFLTHGDRENMAVSNPYKLVQMTKIFGFMVRIFILQKLGITIDKPKILNKDQNV
>NC_021744.1|WP_003633083.1|718404_718605_+|cold-shock-protein
MQTGTVKWFNADKGFGFITGSDNKDVFVHFSAIKTDGFKSLEEGQKVSYDVEQGGRGPQATNVVPQ
>NC_021744.1|WP_012211524.1|719959_720916_+|IS30-family-transposase
MKWAVSNSKWESLIPRAVVVPKPLCHEKLNATAVGGAYSAVKAQQNYQQRRLKSRRLRVLENLKLRDFVLHCILQRQWSPEQIAGRLSLENSNWHISYNTIYRGIERNNLGVKRKRHGARGFARKLRHRGKTRKVKGTVNERRGRFNNVPSVHERPVSCENRTRFGHWEGDTVRGKIGRSGLVSLVDRKSRYLLSERVPKVNAKNVTQAMIDLLHTVTPKRVRTLTPDRGTEFAGYREVGKELGISVYFPDLHAPQQRGTNENTNGLIREYFSKGNDLDELTDQDIAKFVKDLNNRPHKVLVWKTPSEVFFGKKLHLI
>NC_021744.1|WP_003633078.1|721033_721591_-|YdhK-family-protein
MKKLVWYVCAVVAMLFLVAGCSSNSTQKEGSSTHSHSSEKTEMHEHTGSKKVHGLKKAEQPKYKAGTKVKLTADHMKGMKDANATIVNAYDSKLYAVDYKSTSDKKMVKDHKWVTINEIEGNRKEYKKGDKVTLKADHMAGMKNSSATIVEIQKGPAYMVNYQPTNGGKQVTNHKWVAEDEIEKR
>NC_021744.1|WP_003633076.1|721772_722024_-|PspC-domain-containing-protein
MTKKKLTKSSDKIVSGVFGGIAEYFGWDKAIVRIIGAFLIIFPGNIIGGAILYAVTALVMTDPTQGDHCDDGDSVIKGEFREK
>NC_021744.1|WP_003633074.1|722069_722417_-|helix-turn-helix-transcriptional-regulator
MKIQVTADLLDGLVLALLNREDYYGYALTQEMQKAISISESTMYPVLRRLKKEGYLTTYDQPFQGRNRRYYQITSDGEQHLEQVYKMWTDYKESLDQVFIPDKEHDLTHKNDIEA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

10519 : 139803

106

Streptococcus_phage(11.11%)

transposase,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041806241.1\|10519_11698_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_101812846.1\|15291_15978_-	hypothetical protein	NA	NA	NA	NA
WP_020828862.1\|18767_18926_-	hypothetical protein	NA	NA	NA	NA
WP_003631389.1\|20737_22759_+	DHH family phosphoesterase	NA	NA	NA	NA
WP_003624877.1\|22770_23226_+	50S ribosomal protein L9	NA	NA	NA	NA
WP_003624875.1\|23256_24651_+	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	3.7e-120	50.6
WP_003624873.1\|24887_25817_+	phosphate/phosphite/phosphonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_020828865.1\|28423_29302_+	ROK family protein	NA	NA	NA	NA
WP_003624867.1\|29453_29624_+	CsbD family protein	NA	NA	NA	NA
WP_003631749.1\|29675_29936_+	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_041806154.1\|30096_31818_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	1.4e-87	36.7
WP_003624862.1\|31809_33039_-	DUF2974 domain-containing protein	NA	NA	NA	NA
WP_020828866.1\|33122_33827_-	MgtC/SapB family protein	G3MA03	Bacillus_virus	1.6e-18	43.6
WP_020828867.1\|34264_35029_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003624857.1\|35234_35678_+	hypothetical protein	NA	NA	NA	NA
WP_035504224.1\|35695_36247_+	hypothetical protein	NA	NA	NA	NA
WP_003624855.1\|36236_37031_+	cell division protein FtsK	A0A1S5SFB5	Streptococcus_phage	3.9e-13	27.3
WP_003624854.1\|37117_37939_+	replication initiation factor domain-containing protein	NA	NA	NA	NA
WP_003624852.1\|37938_38322_+	hypothetical protein	NA	NA	NA	NA
WP_003624850.1\|38323_38503_+	DNA-binding protein	NA	NA	NA	NA
WP_003624843.1\|41027_41231_+	hypothetical protein	NA	NA	NA	NA
WP_003624842.1\|41243_41603_+	hypothetical protein	NA	NA	NA	NA
WP_003624840.1\|41848_42085_+	hypothetical protein	NA	NA	NA	NA
WP_003624837.1\|42671_42872_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_041806155.1\|43049_44228_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_003624835.1\|44418_45057_+	ATP-binding cassette domain-containing protein	F2Y302	Organic_Lake_phycodnavirus	7.6e-20	31.8
WP_003624831.1\|45053_45812_+	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
WP_020828872.1\|47073_47661_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_020828873.1\|47764_49066_+	restriction endonuclease	NA	NA	NA	NA
WP_035509017.1\|50645_52046_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_012211216.1\|52142_52916_+	putative ABC transporter permease	NA	NA	NA	NA
WP_003624806.1\|52954_53515_-	cob(I)yrinic acid a,c-diamide adenosyltransferase	NA	NA	NA	NA
WP_003624803.1\|53515_54040_-	ECF transporter S component	NA	NA	NA	NA
WP_003628011.1\|54041_54452_-	DUF4430 domain-containing protein	NA	NA	NA	NA
WP_003624800.1\|54471_56706_-	ribonucleoside-triphosphate reductase, adenosylcobalamin-dependent	A0A222ZQ84	Mycobacterium_phage	6.5e-90	33.2
WP_003624796.1\|56960_57995_+	AI-2E family transporter	NA	NA	NA	NA
WP_003624794.1\|57991_58564_+	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_003624790.1\|58592_58775_-	hypothetical protein	NA	NA	NA	NA
WP_020828876.1\|58952_59237_-	hypothetical protein	NA	NA	NA	NA
WP_003624787.1\|59610_60372_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	6.5e-18	28.6
WP_003628104.1\|60379_61264_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_020828877.1\|61260_62253_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003628105.1\|62600_63308_+	noncanonical pyrimidine nucleotidase, YjjG family	NA	NA	NA	NA
WP_158648608.1\|63564_63819_+	hypothetical protein	NA	NA	NA	NA
WP_041806156.1\|63948_65133_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q5ULQ4	Lactobacillus_virus	3.5e-127	60.4
WP_158648592.1\|65361_65469_+	hypothetical protein	NA	NA	NA	NA
WP_158648609.1\|65492_65690_+	hypothetical protein	NA	NA	NA	NA
WP_003628107.1\|67052_67910_+	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	5.0e-59	43.1
WP_003628108.1\|71188_72202_-	D-2-hydroxyacid dehydrogenase	M1H502	Paramecium_bursaria_Chlorella_virus	1.3e-50	35.6
WP_003624755.1\|72328_73171_+	fructosamine kinase family protein	NA	NA	NA	NA
WP_003624751.1\|73625_74453_+	exodeoxyribonuclease III	M1PSC0	Streptococcus_phage	3.4e-97	63.5
WP_020828879.1\|75470_78302_+	DEAD/DEAH box helicase	A0A0K2CZF8	Paenibacillus_phage	1.6e-29	24.9
WP_003624746.1\|78341_79352_-	serine hydrolase	NA	NA	NA	NA
WP_003624744.1\|80501_80915_+	peptide deformylase	E3SLL2	Synechococcus_phage	1.0e-09	38.9
WP_187289109.1\|80974_81115_+	hypothetical protein	NA	NA	NA	NA
WP_023192402.1\|87121_88171_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	4.7e-51	35.9
WP_003627959.1\|89289_90627_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	7.4e-49	34.4
WP_003627958.1\|90601_90832_-\|transposase	transposase	NA	NA	NA	NA
WP_143441508.1\|90871_91222_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_023060818.1\|91215_91392_-	hypothetical protein	NA	NA	NA	NA
WP_020828880.1\|91456_92065_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_023060818.1\|92221_92398_+	hypothetical protein	NA	NA	NA	NA
WP_143441508.1\|92391_92742_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_003627958.1\|92781_93012_+\|transposase	transposase	NA	NA	NA	NA
WP_003627959.1\|92986_94324_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	7.4e-49	34.4
WP_003625317.1\|94486_94705_-	steroid-binding protein	NA	NA	NA	NA
WP_003628365.1\|94793_95663_-	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_020828881.1\|96626_97583_-	glycosyltransferase family 8 protein	NA	NA	NA	NA
WP_003625326.1\|97601_98438_-	glycosyl transferase	NA	NA	NA	NA
WP_003625329.1\|99445_99613_+	hypothetical protein	NA	NA	NA	NA
WP_003628375.1\|99770_100160_+	hypothetical protein	NA	NA	NA	NA
WP_003628377.1\|100209_100968_-	hypothetical protein	NA	NA	NA	NA
WP_020828882.1\|101096_102218_+	SLAP domain-containing protein	NA	NA	NA	NA
WP_020828883.1\|102277_103015_-	SLAP domain-containing protein	NA	NA	NA	NA
WP_003625340.1\|104160_104310_+	hypothetical protein	NA	NA	NA	NA
WP_020828886.1\|106943_107660_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.0e-40	38.8
WP_020828887.1\|107726_109583_+	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	3.0e-32	31.6
WP_003628552.1\|109572_110922_+	hypothetical protein	NA	NA	NA	NA
WP_003625350.1\|110924_111749_+	two-component system regulatory protein YycI	NA	NA	NA	NA
WP_003625352.1\|111764_112562_+	MBL fold metallo-hydrolase	A0A2I7SDH3	Paenibacillus_phage	2.0e-30	34.6
WP_003625355.1\|112648_113890_+	trypsin-like peptidase domain-containing protein	A0A1B1IT49	uncultured_Mediterranean_phage	1.1e-17	29.4
WP_003628556.1\|114355_114835_+	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
WP_023192402.1\|114936_115986_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	4.7e-51	35.9
WP_003625363.1\|117573_118458_-	proline iminopeptidase-family hydrolase	NA	NA	NA	NA
WP_003625366.1\|118466_119120_-	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_020828891.1\|119123_120473_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.3e-12	28.1
WP_003628663.1\|120631_121573_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_023192429.1\|122661_123150_-	helix-turn-helix domain-containing protein	A0A0C5AJ29	Paenibacillus_phage	2.2e-11	34.4
WP_003625376.1\|123241_124138_-\|protease	zinc metalloprotease HtpX	NA	NA	NA	NA
WP_020828893.1\|124152_124713_-	LemA family protein	A0A1X9IGG1	Lactococcus_phage	2.1e-13	33.7
WP_020828894.1\|124779_125886_-	anion permease	NA	NA	NA	NA
WP_003625382.1\|126063_126468_+	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
WP_003548644.1\|126801_126942_+	hypothetical protein	NA	NA	NA	NA
WP_003625387.1\|127046_127907_+	hypothetical protein	NA	NA	NA	NA
WP_003625394.1\|130090_130417_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_003629452.1\|130391_130625_-	hypothetical protein	NA	NA	NA	NA
WP_041806157.1\|130683_131541_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_003625398.1\|131762_132410_+	HD domain-containing protein	NA	NA	NA	NA
WP_003629454.1\|132410_133328_+	HNH endonuclease	NA	NA	NA	NA
WP_003625404.1\|133380_134136_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-28	37.2
WP_003629455.1\|134135_135749_-	ABC transporter substrate-binding protein/permease	NA	NA	NA	NA
WP_020828897.1\|136076_136709_-	DNA-3-methyladenine glycosylase	NA	NA	NA	NA
WP_003625411.1\|136778_137141_+	DUF488 family protein	NA	NA	NA	NA
WP_003625412.1\|137177_137966_-	DUF475 domain-containing protein	A0A068EP98	Bacillus_phage	1.0e-37	40.8
WP_003625413.1\|137952_138471_-	methylated-DNA--[protein]-cysteine S-methyltransferase	A0A1S5V092	Saudi_moumouvirus	3.9e-14	42.2
WP_041806158.1\|138945_139803_+\|transposase	IS982 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

280811 : 339134

Streptococcus_phage(25.0%)

integrase,holin,transposase

attL 317601:317616|attR 334980:334995

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_107504371.1\|280811_280901_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_003625174.1\|281310_282660_+	FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	1.4e-124	50.3
WP_035509442.1\|284319_285546_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.6e-37	29.0
WP_012212328.1\|285889_286408_+	N-acetyltransferase	NA	NA	NA	NA
WP_020828940.1\|286872_289140_+	copper-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	2.1e-59	30.1
WP_020828941.1\|291423_292311_-	GRP family sugar transporter	NA	NA	NA	NA
WP_143441533.1\|293963_294410_-	recombinase family protein	A0A0A8WIK3	Clostridium_phage	1.4e-23	43.7
WP_002831196.1\|294911_295160_+	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_172756900.1\|295302_296379_+	thymidine phosphorylase	A0A0H3UZD4	Geobacillus_virus	6.7e-85	49.9
WP_003625233.1\|296862_297309_+	3-hydroxyacyl-ACP dehydratase FabZ	NA	NA	NA	NA
WP_003625235.1\|297338_297806_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_003625237.1\|297802_298786_+	ketoacyl-ACP synthase III	NA	NA	NA	NA
WP_003625239.1\|298844_299087_+	acyl carrier protein	NA	NA	NA	NA
WP_003625242.1\|299096_300014_+	ACP S-malonyltransferase	NA	NA	NA	NA
WP_003625244.1\|300013_300745_+	3-oxoacyl-ACP reductase FabG	Q06VL0	Trichoplusia_ni_ascovirus	1.2e-13	30.0
WP_003625246.1\|300766_301996_+	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_003625248.1\|301999_302470_+	acetyl-CoA carboxylase biotin carboxyl carrier protein	NA	NA	NA	NA
WP_003625250.1\|302474_302891_+	beta-hydroxyacyl-ACP dehydratase	NA	NA	NA	NA
WP_012212319.1\|302904_304284_+	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
WP_003625253.1\|304264_305107_+	acetyl-CoA carboxylase carboxyltransferase subunit beta	NA	NA	NA	NA
WP_020828944.1\|305099_305870_+	acetyl-CoA carboxyltransferase subunit alpha	NA	NA	NA	NA
WP_020828945.1\|305928_306687_+	enoyl-ACP reductase FabI	NA	NA	NA	NA
WP_003625259.1\|306734_307724_+	biotin--[acetyl-CoA-carboxylase] ligase	NA	NA	NA	NA
WP_003625260.1\|307797_308340_+	biotin transporter BioY	NA	NA	NA	NA
WP_143441532.1\|308285_308675_-	hypothetical protein	NA	NA	NA	NA
WP_013854585.1\|309223_310453_-\|transposase	IS110-like element ISLhe4 family transposase	A0A1X9I619	Streptococcus_phage	1.8e-65	38.4
WP_003625261.1\|312131_312689_-	adenine phosphoribosyltransferase	NA	NA	NA	NA
WP_080516443.1\|315006_315912_-	methylenetetrahydrofolate reductase [NAD(P)H]	NA	NA	NA	NA
WP_003625266.1\|315889_318175_-	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	NA	NA	NA	NA
317601:317616	attL	NA	NA	NA	NA
WP_003625268.1\|318328_318802_-	S-ribosylhomocysteine lyase	NA	NA	NA	NA
WP_014562912.1\|318916_320323_-\|transposase	ISLre2 family transposase	NA	NA	NA	NA
WP_003625273.1\|321638_322094_+	hypothetical protein	NA	NA	NA	NA
WP_044000216.1\|322144_322477_-	hypothetical protein	NA	NA	NA	NA
WP_003625277.1\|322427_323036_-\|integrase	site-specific integrase	D2XR58	Bacillus_phage	1.2e-17	31.2
WP_003625288.1\|323139_323418_+	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_003572735.1\|323407_323710_+	type II toxin-antitoxin system YafQ family toxin	NA	NA	NA	NA
WP_003633334.1\|325508_325685_+	hypothetical protein	NA	NA	NA	NA
WP_143441508.1\|325678_326029_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_003627958.1\|326068_326299_+\|transposase	transposase	NA	NA	NA	NA
WP_003627959.1\|326273_327611_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	7.4e-49	34.4
WP_003625293.1\|328076_328220_+	hypothetical protein	NA	NA	NA	NA
WP_041806161.1\|328297_328480_+	hypothetical protein	NA	NA	NA	NA
WP_041806162.1\|330445_331615_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_003625300.1\|332191_333208_+	ThiF family adenylyltransferase	A0A1V0SCZ9	Indivirus	2.0e-06	37.8
WP_020807709.1\|333240_334083_+	hypothetical protein	NA	NA	NA	NA
WP_020828948.1\|334093_335680_+	ABC transporter ATP-binding protein	A0A076FI99	Aureococcus_anophage	4.1e-14	21.8
334980:334995	attR	NA	NA	NA	NA
WP_020828949.1\|335686_337258_+	ABC transporter ATP-binding protein	A0A076FI99	Aureococcus_anophage	4.5e-13	23.6
WP_041806162.1\|337964_339134_+\|transposase	IS256 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

349851 : 418863

Bacillus_phage(16.67%)

bacteriocin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041806163.1\|349851_351552_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	1.7e-87	37.1
WP_020828952.1\|355713_356070_-	hypothetical protein	NA	NA	NA	NA
WP_023192509.1\|357546_358710_-	MFS transporter	NA	NA	NA	NA
WP_020828954.1\|358860_359841_+	hypothetical protein	NA	NA	NA	NA
WP_003627391.1\|359904_360264_-	hypothetical protein	A0A0E3XCL7	Enterococcus_phage	1.5e-20	67.1
WP_003627390.1\|360470_363005_+	M1 family metallopeptidase	A0A0P0IY26	Acinetobacter_phage	1.9e-69	25.9
WP_003627386.1\|364782_365427_-	hypothetical protein	NA	NA	NA	NA
WP_003627385.1\|365485_366247_+	peroxide stress protein YaaA	NA	NA	NA	NA
WP_020828958.1\|366243_366999_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_020828959.1\|367142_367742_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_003630236.1\|367852_368380_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_003627381.1\|368380_369442_+	ABC transporter permease	NA	NA	NA	NA
WP_003630234.1\|369443_370118_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.7e-33	39.4
WP_003627379.1\|370162_371575_-	C69 family dipeptidase	NA	NA	NA	NA
WP_003630233.1\|371676_371919_+	hypothetical protein	NA	NA	NA	NA
WP_003627375.1\|372045_372669_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_041806164.1\|372878_374285_+\|transposase	ISLre2 family transposase	NA	NA	NA	NA
WP_003627373.1\|374440_375739_+	MFS transporter	NA	NA	NA	NA
WP_003627371.1\|376210_376750_+	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_003627370.1\|376763_377312_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	1.1e-27	38.8
WP_003630226.1\|377404_378196_+	tyrosine-protein phosphatase	NA	NA	NA	NA
WP_003627368.1\|378204_379134_+	FAD:protein FMN transferase	NA	NA	NA	NA
WP_003627367.1\|379175_379712_-	CvpA family protein	NA	NA	NA	NA
WP_003627366.1\|379873_380596_+	16S rRNA (guanine(527)-N(7))-methyltransferase RsmG	NA	NA	NA	NA
WP_003630225.1\|380610_381450_+	nucleoid occlusion protein	S5VSZ7	Leptospira_phage	2.1e-17	42.5
WP_003627364.1\|381465_382245_+	ParA family protein	Q8JL10	Natrialba_phage	4.3e-25	31.5
WP_003627363.1\|382222_383107_+	ParB/RepB/Spo0J family partition protein	S5VTK0	Leptospira_phage	5.1e-14	29.5
WP_003627362.1\|383099_383363_+	DUF951 domain-containing protein	NA	NA	NA	NA
WP_003627361.1\|383412_384513_+	redox-regulated ATPase YchF	NA	NA	NA	NA
WP_003627359.1\|384521_385304_+	DUF1129 domain-containing protein	NA	NA	NA	NA
WP_020828961.1\|385418_387143_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.9e-39	27.1
WP_020828962.1\|387152_389012_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	6.2e-46	26.0
WP_003627353.1\|389189_389876_+	response regulator transcription factor	W8CYM9	Bacillus_phage	9.6e-37	37.6
WP_003627352.1\|389879_391028_+	HAMP domain-containing histidine kinase	A0A1V0SGX0	Hokovirus	2.0e-18	31.7
WP_003627351.1\|391078_392650_+	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase	NA	NA	NA	NA
WP_003627350.1\|392658_393408_+	aspartate/glutamate racemase family protein	NA	NA	NA	NA
WP_035505054.1\|395009_395321_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003627960.1\|395577_396186_+\|transposase	IS607 family transposase	A0A1V0SJI5	Klosneuvirus	1.5e-33	43.2
WP_041806165.1\|396215_397541_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	G3MB42	Bacillus_virus	2.0e-54	35.8
WP_003630198.1\|397768_397996_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003630196.1\|397985_398207_+	hypothetical protein	NA	NA	NA	NA
WP_014919460.1\|398505_398697_+	hypothetical protein	NA	NA	NA	NA
WP_003627337.1\|398967_399276_+	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_003627335.1\|399256_399424_+	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_003630188.1\|399777_400533_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	5.0e-18	27.8
WP_020828964.1\|400532_401447_+	1-phosphofructokinase	NA	NA	NA	NA
WP_096001360.1\|401550_402780_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q5ULQ4	Lactobacillus_virus	8.9e-126	58.7
WP_020828965.1\|402892_404890_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_003630183.1\|405093_405366_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003630181.1\|406576_407224_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	7.5e-15	29.3
WP_003627328.1\|407223_408018_+	metal ABC transporter permease	NA	NA	NA	NA
WP_020828966.1\|408452_409835_+	cation:dicarboxylase symporter family transporter	NA	NA	NA	NA
WP_020828967.1\|411944_412217_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003627319.1\|413114_414911_-	oligoendopeptidase F	NA	NA	NA	NA
WP_041806167.1\|415091_415949_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_003627318.1\|416044_417286_+	LCP family protein	NA	NA	NA	NA
WP_187289103.1\|417633_418863_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q5ULQ4	Lactobacillus_virus	1.7e-121	56.9

DBSCAN-SWA_4

424412 : 483079

Clostridioides_phage(14.29%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041806170.1\|424412_425654_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0P0IJS6	Lactobacillus_phage	2.5e-120	57.1
WP_012212258.1\|425893_426430_+	hypothetical protein	NA	NA	NA	NA
WP_020828973.1\|426542_426887_+	hypothetical protein	NA	NA	NA	NA
WP_003630140.1\|428626_429268_+	hypothetical protein	NA	NA	NA	NA
WP_003627301.1\|429282_430788_-	O-antigen ligase family protein	NA	NA	NA	NA
WP_003627299.1\|430880_431180_-	DUF2187 domain-containing protein	NA	NA	NA	NA
WP_020828975.1\|431274_431820_+	AAA family ATPase	A0A218KC48	Bacillus_phage	7.2e-11	31.7
WP_003627296.1\|432009_432561_+	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	1.2e-18	44.4
WP_003627295.1\|432654_432924_+	hypothetical protein	NA	NA	NA	NA
WP_096001362.1\|433013_434237_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q5ULQ4	Lactobacillus_virus	3.0e-121	57.7
WP_023192438.1\|434331_434541_+	Protein of unknown function	NA	NA	NA	NA
WP_023062121.1\|434588_434909_+	hypothetical protein	NA	NA	NA	NA
WP_014919431.1\|434974_435625_+\|transposase	IS607 family transposase	A0A7Q0	Microcystis_virus	5.2e-40	45.2
WP_051356298.1\|435557_437141_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	NA	NA	NA	NA
WP_035509074.1\|437477_437840_+	ATPase	NA	NA	NA	NA
WP_014919428.1\|438057_438834_+	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	1.3e-18	47.2
WP_020828976.1\|439864_440797_+	C40 family peptidase	M9MUG9	Rhodococcus_phage	1.6e-13	36.9
WP_020828977.1\|441007_442021_-	CAP domain-containing protein	NA	NA	NA	NA
WP_020828978.1\|442042_443308_-	GTPase HflX	NA	NA	NA	NA
WP_020828979.1\|443783_444842_+	LCP family protein	A0A1X9I5X1	Streptococcus_phage	1.4e-15	31.1
WP_020828980.1\|444853_445738_+	Tyrosine-protein kinase modulator Wzd	NA	NA	NA	NA
WP_020828981.1\|445748_446537_+	CpsD/CapB family tyrosine-protein kinase	NA	NA	NA	NA
WP_020828982.1\|446536_447307_+	protein-tyrosine-phosphatase	NA	NA	NA	NA
WP_035509081.1\|447426_448077_+	sugar transferase	NA	NA	NA	NA
WP_187289104.1\|448274_449345_+	hypothetical protein	NA	NA	NA	NA
WP_020828985.1\|449313_450477_+	glycosyltransferase family 1 protein	NA	NA	NA	NA
WP_020828986.1\|450478_451333_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_020828987.1\|451329_452436_+	glycosyltransferase	NA	NA	NA	NA
WP_020828988.1\|452438_453440_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_020828989.1\|453441_454242_+	LicD family protein	A0A1V0SAS8	Catovirus	5.8e-09	36.1
WP_020828990.1\|454280_455144_+	glycosyltransferase	NA	NA	NA	NA
WP_020828991.1\|455154_455976_+	glycosyl transferase	NA	NA	NA	NA
WP_035509085.1\|456124_457492_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	6.0e-38	27.4
WP_148286624.1\|459138_459330_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_080669045.1\|459362_459560_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_020828992.1\|459553_459730_-	hypothetical protein	NA	NA	NA	NA
WP_041806173.1\|460101_461283_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_020828993.1\|462319_463813_+	flippase	NA	NA	NA	NA
WP_020828994.1\|465515_466445_+	NTP transferase domain-containing protein	NA	NA	NA	NA
WP_020828995.1\|466492_468262_+	phosphotransferase	NA	NA	NA	NA
WP_020828996.1\|468276_469761_+	APC family permease	NA	NA	NA	NA
WP_020828997.1\|469773_470052_+	hypothetical protein	NA	NA	NA	NA
WP_023192710.1\|470093_470393_+	hypothetical protein	NA	NA	NA	NA
WP_020828999.1\|470580_470763_+	hypothetical protein	NA	NA	NA	NA
WP_020829000.1\|471303_471903_+	hypothetical protein	NA	NA	NA	NA
WP_020829001.1\|472051_473227_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_014919383.1\|473312_474350_+	dTDP-glucose 4,6-dehydratase	A0A291LAD7	Escherichia_phage	9.0e-87	47.4
WP_020829002.1\|474354_475239_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	1.2e-92	57.5
WP_020829004.1\|475884_476871_+	dTDP-4-dehydrorhamnose reductase	I7HXC9	Enterobacteria_phage	3.7e-29	37.3
WP_003627373.1\|478892_480191_+	MFS transporter	NA	NA	NA	NA
WP_020829005.1\|480694_481045_+	hypothetical protein	NA	NA	NA	NA
WP_020829006.1\|481243_481408_+	hypothetical protein	NA	NA	NA	NA
WP_096001364.1\|481849_483079_-\|transposase	IS110-like element ISLhe4 family transposase	A0A1X9I619	Streptococcus_phage	1.5e-64	37.9

DBSCAN-SWA_5

498807 : 646771

115

Lactobacillus_virus(11.76%)

bacteriocin,protease,transposase,tRNA,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020829017.1\|498807_499494_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_020829018.1\|499643_501953_+	AAA family ATPase	NA	NA	NA	NA
WP_003627820.1\|502392_503040_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_003627821.1\|503055_503676_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.4e-28	38.7
WP_003627822.1\|503679_504483_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003627823.1\|504486_504933_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003627824.1\|504929_505490_-	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_023192120.1\|505548_506463_+	type I pantothenate kinase	A0A1B1ISL9	uncultured_Mediterranean_phage	9.5e-32	33.6
WP_020829019.1\|506497_507070_+	elongation factor P	NA	NA	NA	NA
WP_035509935.1\|507122_508403_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_003629973.1\|508593_509013_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_003629972.1\|509094_509271_-	hypothetical protein	NA	NA	NA	NA
WP_003627831.1\|509421_509925_-	nucleoside 2-deoxyribosyltransferase	C1KFI2	Lactobacillus_virus	5.4e-13	31.2
WP_003627832.1\|509972_510974_-	adenosine deaminase	NA	NA	NA	NA
WP_003627833.1\|511063_511978_-	prolyl aminopeptidase	NA	NA	NA	NA
WP_003627836.1\|514107_514848_+	nicotinamide mononucleotide transporter	A0A0A7NTY4	Lactobacillus_phage	1.1e-121	83.5
WP_052317678.1\|515523_516681_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0P0IJS6	Lactobacillus_phage	4.2e-117	57.8
WP_023192200.1\|516774_516933_+	hypothetical protein	NA	NA	NA	NA
WP_003627839.1\|516947_517769_+	hypothetical protein	NA	NA	NA	NA
WP_003627840.1\|517777_518731_+	ribonuclease H-like domain-containing protein	A0A0K2SUJ2	Clostridium_phage	1.5e-11	33.1
WP_003627841.1\|518821_519676_+	DNA/RNA non-specific endonuclease	NA	NA	NA	NA
WP_003627842.1\|519717_521145_+	C69 family dipeptidase	NA	NA	NA	NA
WP_041806175.1\|521367_522225_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_003629946.1\|522368_523454_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.2e-26	33.2
WP_020829021.1\|523453_524320_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_003629944.1\|524323_525148_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_003627846.1\|525131_526427_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_003627847.1\|526478_527780_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_041806176.1\|527918_528836_+	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_003629940.1\|528848_529799_+	serine hydrolase	NA	NA	NA	NA
WP_003627850.1\|529934_530507_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_020829023.1\|530511_534120_+	MMPL family transporter	NA	NA	NA	NA
WP_020829024.1\|534277_535312_+	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_020829025.1\|535357_536740_-	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_003627854.1\|536823_537525_-	hypothetical protein	NA	NA	NA	NA
WP_020829026.1\|537680_538478_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_020829027.1\|538607_539216_+	TVP38/TMEM64 family protein	M1Q152	Streptococcus_phage	3.6e-35	39.1
WP_020829028.1\|539215_539767_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_020829029.1\|539990_541298_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	6.2e-93	44.1
WP_023192538.1\|548118_548316_+	GH36 C-terminal domain-containing protein	NA	NA	NA	NA
WP_003627006.1\|548378_549398_+	PTS mannose transporter subunit IIAB	NA	NA	NA	NA
WP_020829030.1\|549434_550247_+	PTS mannose/fructose/sorbose transporter subunit IIC	NA	NA	NA	NA
WP_003627003.1\|550275_551196_+	PTS mannose/fructose/sorbose transporter family subunit IID	NA	NA	NA	NA
WP_012211481.1\|551199_551568_+	DUF956 family protein	NA	NA	NA	NA
WP_020829031.1\|551612_552443_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003626993.1\|553156_554530_-	amino acid permease	NA	NA	NA	NA
WP_003626990.1\|554843_557468_+	bifunctional acetaldehyde-CoA/alcohol dehydrogenase	NA	NA	NA	NA
WP_003626989.1\|557663_559475_+	glutamine--fructose-6-phosphate transaminase (isomerizing)	Q76DQ7	Chlorella_virus	1.6e-91	37.4
WP_003626988.1\|559548_559842_+	hypothetical protein	NA	NA	NA	NA
WP_023061029.1\|560025_560139_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_003626986.1\|560925_561309_+	hypothetical protein	NA	NA	NA	NA
WP_003626983.1\|562711_563896_+	acetate kinase	NA	NA	NA	NA
WP_003626981.1\|563999_564731_+	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_003626979.1\|564817_565045_+	hypothetical protein	NA	NA	NA	NA
WP_003626977.1\|565206_565620_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_096001365.1\|567238_568468_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q5ULQ4	Lactobacillus_virus	1.3e-124	57.7
WP_003626968.1\|568736_569108_+	hypothetical protein	NA	NA	NA	NA
WP_003626966.1\|569125_569875_-	TIGR02452 family protein	NA	NA	NA	NA
WP_003626965.1\|570076_570376_+\|transposase	PD-(D/E)XK nuclease family transposase	NA	NA	NA	NA
WP_003627960.1\|570483_571092_+\|transposase	IS607 family transposase	A0A1V0SJI5	Klosneuvirus	1.5e-33	43.2
WP_041806178.1\|571121_572447_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	G3MB42	Bacillus_virus	2.1e-56	36.3
WP_051349531.1\|572657_572921_+	hypothetical protein	NA	NA	NA	NA
WP_023192402.1\|573221_574271_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	4.7e-51	35.9
WP_003626963.1\|575144_575858_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_020829034.1\|575874_577029_+	N-acetylglucosamine-6-phosphate deacetylase	NA	NA	NA	NA
WP_041806179.1\|577294_578536_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0P0IJS6	Lactobacillus_phage	4.3e-120	57.5
WP_003626961.1\|578841_579240_-	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
WP_003626960.1\|579338_579539_-	hypothetical protein	NA	NA	NA	NA
WP_003626959.1\|579649_580042_+	hypothetical protein	NA	NA	NA	NA
WP_041806180.1\|581211_582594_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	4.0e-58	46.7
WP_003626950.1\|583185_583881_+	SLAP domain-containing protein	A0A249XZV3	Enterococcus_phage	4.9e-12	50.7
WP_023192357.1\|584018_585077_+	SEC10/PgrA surface exclusion domain-containing protein	NA	NA	NA	NA
WP_003626946.1\|585146_585725_+	histidine phosphatase family protein	A0A1X9IGJ2	Lactococcus_phage	1.1e-22	37.1
WP_003626945.1\|585725_586943_+	histidine phosphatase family protein	A0A1X9IGJ2	Lactococcus_phage	1.8e-14	37.3
WP_003626944.1\|586993_587689_+	glycerophosphoryl diester phosphodiesterase	M1ICP4	Paramecium_bursaria_Chlorella_virus	1.4e-14	25.8
WP_003626939.1\|592545_593661_+	hypothetical protein	NA	NA	NA	NA
WP_003633005.1\|593749_594451_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003633007.1\|594514_594901_-	glycerol-3-phosphate cytidylyltransferase	A0A0F7LBI5	uncultured_marine_virus	7.1e-13	47.2
WP_187289105.1\|595011_596241_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q5ULQ4	Lactobacillus_virus	8.7e-121	56.4
WP_020829039.1\|596451_597180_+	WecB/TagA/CpsF family glycosyltransferase	NA	NA	NA	NA
WP_003633019.1\|597187_598288_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_003633021.1\|598375_599854_+	nicotinate phosphoribosyltransferase	G3MA18	Bacillus_virus	1.3e-115	47.6
WP_003626929.1\|599850_600681_+	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	1.3e-67	51.1
WP_041806182.1\|600877_602119_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0P0IJS6	Lactobacillus_phage	5.3e-118	57.4
WP_003633044.1\|605112_606267_+	CDP-glycerol--glycerophosphate glycerophosphotransferase	NA	NA	NA	NA
WP_003633045.1\|606271_607702_+	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_003626913.1\|607704_608403_+	glycosyl transferase	L7RBS6	Acanthamoeba_polyphaga_moumouvirus	2.1e-07	27.6
WP_003626912.1\|608390_608861_+	SprT family protein	NA	NA	NA	NA
WP_003633047.1\|609098_609746_+	glycoside hydrolase family 73 protein	S5M633	Brevibacillus_phage	1.0e-27	47.7
WP_003633049.1\|609831_612069_+	DNA helicase PcrA	A7KV33	Bacillus_phage	5.2e-132	41.5
WP_012211516.1\|612109_614116_+	NAD-dependent DNA ligase LigA	A0A0K2QQN8	Ralstonia_phage	7.1e-104	36.1
WP_020829042.1\|614128_615277_+	CamS family sex pheromone protein	NA	NA	NA	NA
WP_020829043.1\|615290_615599_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_003626902.1\|615598_617038_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_003626901.1\|617042_618473_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_003633052.1\|618497_619418_+	diacylglycerol kinase family lipid kinase	A0A1V0SBJ0	Catovirus	2.7e-18	25.8
WP_003633053.1\|620211_620916_-	Bax inhibitor-1/YccA family protein	NA	NA	NA	NA
WP_041806167.1\|621060_621918_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_020829045.1\|622114_622693_-	recombinase family protein	A0A0A8WIK3	Clostridium_phage	6.7e-31	39.9
WP_041806246.1\|623012_624191_+\|transposase	IS256-like element IS1201 family transposase	NA	NA	NA	NA
WP_003630841.1\|624545_624755_-	hypothetical protein	NA	NA	NA	NA
WP_020829047.1\|626460_627255_+	Fe-S cluster assembly ATPase SufC	A0A1M7XV31	Cedratvirus	7.3e-12	27.6
WP_003626809.1\|627266_628544_+	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_003626808.1\|628518_629757_+	SufS family cysteine desulfurase	Q2XUY6	environmental_halophage	1.0e-97	41.8
WP_003626807.1\|629743_630205_+	SUF system NifU family Fe-S cluster assembly protein	NA	NA	NA	NA
WP_003626806.1\|630197_631601_+	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
WP_003626804.1\|631600_631924_+	metal-sulfur cluster assembly factor	NA	NA	NA	NA
WP_020829049.1\|632010_632376_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003633240.1\|633442_635842_+	phosphoketolase family protein	NA	NA	NA	NA
WP_003626797.1\|635909_636758_+	patatin family protein	NA	NA	NA	NA
WP_023192377.1\|636920_637709_+	hypothetical protein	NA	NA	NA	NA
WP_158648818.1\|637760_638003_+	GHKL domain-containing protein	NA	NA	NA	NA
WP_003631137.1\|640314_641163_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_181414318.1\|642454_643684_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q5ULQ4	Lactobacillus_virus	1.7e-124	57.9
WP_096001367.1\|645472_646771_+\|transposase	ISLre2 family transposase	NA	NA	NA	NA

DBSCAN-SWA_6

659400 : 720916

Bacillus_phage(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003627958.1\|659400_659631_+\|transposase	transposase	NA	NA	NA	NA
WP_003627959.1\|659605_660943_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	7.4e-49	34.4
WP_020829054.1\|662741_663284_-	GtrA family protein	NA	NA	NA	NA
WP_003626773.1\|663276_663723_-	flavodoxin	NA	NA	NA	NA
WP_003633294.1\|663865_664693_+	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_012211577.1\|664701_665625_+	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_003626768.1\|665686_666586_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	6.4e-73	48.1
WP_023192390.1\|666650_667979_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A286QMQ9	Streptococcus_phage	2.7e-59	41.3
WP_003633307.1\|668212_669373_+	thiolase family protein	NA	NA	NA	NA
WP_003626761.1\|669372_670584_+	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
WP_020829055.1\|670583_671747_+	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
WP_003626759.1\|671785_672070_-	hypothetical protein	NA	NA	NA	NA
WP_003633232.1\|673405_674224_+	HAD family hydrolase	NA	NA	NA	NA
WP_003633228.1\|674288_674612_-	AAC(3) family N-acetyltransferase	NA	NA	NA	NA
WP_003633207.1\|676019_676235_-	transcriptional regulator	NA	NA	NA	NA
WP_003626821.1\|677012_677939_-	nucleoside hydrolase	NA	NA	NA	NA
WP_020829057.1\|678054_680070_-	KUP/HAK/KT family potassium transporter	M1HZV6	Acanthocystis_turfacea_Chlorella_virus	5.0e-65	34.6
WP_003633200.1\|680130_680823_-	ribose-5-phosphate isomerase RpiA	NA	NA	NA	NA
WP_003633198.1\|680822_681749_-	ribokinase	A0A2H4N7X4	Lake_Baikal_phage	6.3e-07	37.5
WP_003626825.1\|681832_682636_-	DUF4931 domain-containing protein	NA	NA	NA	NA
WP_003633177.1\|684398_684668_+	ACT domain-containing protein	NA	NA	NA	NA
WP_020829058.1\|684686_686030_+	PFL family protein	NA	NA	NA	NA
WP_020829059.1\|686178_687480_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_003626838.1\|689479_690133_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_003626839.1\|690147_690789_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_003626841.1\|690788_691607_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_003626843.1\|691617_692358_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.2e-38	41.4
WP_003626847.1\|693404_693983_-	ECF transporter S component	NA	NA	NA	NA
WP_020829060.1\|694145_695915_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.2e-54	28.5
WP_003633124.1\|695914_697645_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.1e-28	25.9
WP_012211536.1\|697623_698085_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_003633120.1\|698226_699045_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_020829061.1\|699087_699756_-	type 1 glutamine amidotransferase	NA	NA	NA	NA
WP_003626854.1\|699769_700441_-	hypothetical protein	NA	NA	NA	NA
WP_020829062.1\|700717_702340_-	ATP-binding cassette domain-containing protein	A0A1V0SKJ1	Klosneuvirus	1.1e-54	27.6
WP_003633113.1\|702444_703527_-	M42 family peptidase	NA	NA	NA	NA
WP_020829063.1\|703653_704859_+	multidrug efflux MFS transporter	NA	NA	NA	NA
WP_020829064.1\|704882_706352_-	MFS transporter	NA	NA	NA	NA
WP_020829065.1\|706642_707173_+	bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR	NA	NA	NA	NA
WP_003633105.1\|707185_708514_+	uracil transporter	Q9KX94	Enterobacteria_phage	2.0e-62	35.9
WP_096001369.1\|709436_710666_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q5ULQ4	Lactobacillus_virus	9.3e-123	57.4
WP_041806185.1\|712312_713638_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	G3MB42	Bacillus_virus	4.0e-55	35.8
WP_003627960.1\|713667_714276_-\|transposase	IS607 family transposase	A0A1V0SJI5	Klosneuvirus	1.5e-33	43.2
WP_020829066.1\|714378_714879_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_041806186.1\|715089_716496_-\|transposase	ISLre2-like element ISLhe10 family transposase	NA	NA	NA	NA
WP_035509267.1\|717767_718196_-	hypothetical protein	NA	NA	NA	NA
WP_003633083.1\|718404_718605_+	cold-shock protein	Q9AZD3	Lactococcus_phage	2.4e-20	71.4
WP_012211524.1\|719959_720916_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.9e-39	37.0

DBSCAN-SWA_7

732826 : 775294

Streptococcus_phage(28.57%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041806167.1\|732826_733684_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_020829069.1\|733753_734980_-	MFS transporter	NA	NA	NA	NA
WP_020829070.1\|735131_735770_+	deoxynucleoside kinase	NA	NA	NA	NA
WP_003626752.1\|735805_737080_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_003627959.1\|740543_741881_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	7.4e-49	34.4
WP_003627958.1\|741855_742086_-\|transposase	transposase	NA	NA	NA	NA
WP_143441508.1\|742125_742476_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_003633334.1\|742469_742646_-	hypothetical protein	NA	NA	NA	NA
WP_041806187.1\|742710_743799_-\|transposase	IS110 family transposase	A0A1X9I5Z0	Streptococcus_phage	8.4e-51	38.2
WP_003627796.1\|744152_744422_+	hypothetical protein	NA	NA	NA	NA
WP_012211582.1\|744425_744881_+\|transposase	transposase	NA	NA	NA	NA
WP_003627794.1\|744929_745514_+\|transposase	transposase	NA	NA	NA	NA
WP_003627793.1\|746225_747608_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	3.9e-69	33.2
WP_020829071.1\|747729_748545_+	recombination regulator RecX	NA	NA	NA	NA
WP_003627790.1\|748555_749038_+	hypothetical protein	NA	NA	NA	NA
WP_003627789.1\|749039_749501_-	hypothetical protein	NA	NA	NA	NA
WP_003627788.1\|749608_750481_+	HlyC/CorC family transporter	NA	NA	NA	NA
WP_003633365.1\|750480_752052_+	peptide chain release factor 3	A0A1S5SF82	Streptococcus_phage	7.1e-35	26.0
WP_003627786.1\|752119_752401_-	DUF1827 family protein	NA	NA	NA	NA
WP_041806188.1\|752552_754742_-\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A1C3S747	Escherichia_phage	2.3e-124	40.6
WP_014919161.1\|756526_756709_+	hypothetical protein	NA	NA	NA	NA
WP_003627782.1\|756822_757089_+	phosphocarrier protein HPr	NA	NA	NA	NA
WP_003627781.1\|757088_758822_+	phosphoenolpyruvate--protein phosphotransferase	NA	NA	NA	NA
WP_003627780.1\|759053_759452_+	transcriptional regulator Spx	NA	NA	NA	NA
WP_003633395.1\|759543_760284_+	adaptor protein MecA	NA	NA	NA	NA
WP_041806241.1\|761056_762235_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_020829073.1\|762595_763213_-	DsbA family protein	NA	NA	NA	NA
WP_003633400.1\|763291_763906_-	CYTH domain-containing protein	NA	NA	NA	NA
WP_003627775.1\|764029_764662_+	GTP pyrophosphokinase family protein	NA	NA	NA	NA
WP_003627773.1\|764658_765471_+	NAD kinase	NA	NA	NA	NA
WP_020829074.1\|765454_766351_+	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	2.3e-06	30.1
WP_003633403.1\|766469_768245_+	oleate hydratase	NA	NA	NA	NA
WP_003625976.1\|768279_768972_-	VTT domain-containing protein	NA	NA	NA	NA
WP_003625978.1\|769078_770107_-	lactonase family protein	NA	NA	NA	NA
WP_003633405.1\|770259_773016_+	cation-transporting P-type ATPase	A0A1J0FA34	Only_Syngen_Nebraska_virus	6.1e-74	28.7
WP_020829076.1\|773483_774683_+	AI-2E family transporter	NA	NA	NA	NA
WP_003625990.1\|774733_775294_+\|tRNA	tRNA (cytidine(34)-2'-O)-methyltransferase	NA	NA	NA	NA

DBSCAN-SWA_8

870619 : 916009

Lactobacillus_phage(16.67%)

integrase,tRNA,transposase

attL 870526:870549|attR 907572:907595

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
870526:870549	attL	NA	NA	NA	NA
WP_041806190.1\|870619_871477_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_003628016.1\|871650_872664_-	serine hydrolase	A0A1D8EXR7	Mycobacterium_phage	1.8e-07	27.0
WP_165709581.1\|873225_873594_+	hypothetical protein	NA	NA	NA	NA
WP_020829092.1\|874214_875015_-	hypothetical protein	NA	NA	NA	NA
WP_020829093.1\|875380_876727_-	VirE family protein	U3PCP1	Lactobacillus_phage	1.2e-91	44.2
WP_003631016.1\|877024_877300_-	hypothetical protein	NA	NA	NA	NA
WP_003631017.1\|877302_877530_-	hypothetical protein	NA	NA	NA	NA
WP_003631018.1\|877533_877752_-	hypothetical protein	NA	NA	NA	NA
WP_020829094.1\|877744_877984_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_020829095.1\|878119_878653_+	helix-turn-helix transcriptional regulator	Q9T1H4	Lactobacillus_phage	4.3e-16	63.2
WP_020829096.1\|878791_879949_+\|integrase	site-specific integrase	P97010	Streptococcus_pyogenes_phage	4.9e-57	38.2
WP_020829097.1\|880126_881479_-	Mur ligase family protein	NA	NA	NA	NA
WP_003626146.1\|881628_882228_+	thymidine kinase	C1KFH3	Lactobacillus_virus	2.4e-47	50.8
WP_003626148.1\|882244_883333_+	peptide chain release factor 1	W8EDB3	Pseudomonas_phage	1.4e-05	44.6
WP_003626150.1\|883325_884168_+	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_003628018.1\|884173_885175_+	threonylcarbamoyl-AMP synthase	S4VW33	Pandoravirus	1.2e-48	38.1
WP_003626154.1\|885258_885888_+	uracil phosphoribosyltransferase	NA	NA	NA	NA
WP_003626156.1\|886011_886725_+	F0F1 ATP synthase subunit A	NA	NA	NA	NA
WP_061287255.1\|886753_886978_+	F0F1 ATP synthase subunit C	NA	NA	NA	NA
WP_003628019.1\|887029_887539_+	F0F1 ATP synthase subunit B	NA	NA	NA	NA
WP_020829098.1\|887538_888087_+	F0F1 ATP synthase subunit delta	NA	NA	NA	NA
WP_020829099.1\|888101_889613_+	F0F1 ATP synthase subunit alpha	NA	NA	NA	NA
WP_012211672.1\|889623_890586_+	F0F1 ATP synthase subunit gamma	NA	NA	NA	NA
WP_003628021.1\|890608_892048_+	F0F1 ATP synthase subunit beta	NA	NA	NA	NA
WP_012211673.1\|892059_892500_+	F0F1 ATP synthase subunit epsilon	NA	NA	NA	NA
WP_003626167.1\|892563_892794_+	DUF1146 domain-containing protein	NA	NA	NA	NA
WP_003626168.1\|892877_893867_+	rod shape-determining protein	NA	NA	NA	NA
WP_003628023.1\|893880_894174_+	membrane protein insertion efficiency factor YidD	NA	NA	NA	NA
WP_003626171.1\|894182_894410_+	DUF2969 domain-containing protein	NA	NA	NA	NA
WP_003626172.1\|894431_895625_+	rod shape-determining protein RodA	NA	NA	NA	NA
WP_041806191.1\|895784_897518_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	3.0e-87	36.6
WP_003626174.1\|897498_897963_-	universal stress protein	NA	NA	NA	NA
WP_003628024.1\|898611_899925_-	replication-associated recombination protein A	A0A127AWE7	Bacillus_phage	4.8e-101	49.3
WP_003626181.1\|899924_900392_-	YueI family protein	NA	NA	NA	NA
WP_003628026.1\|900481_901093_-	30S ribosomal protein S4	NA	NA	NA	NA
WP_014563861.1\|901375_903085_+	septation ring formation regulator EzrA	NA	NA	NA	NA
WP_003626187.1\|903176_904337_+	cysteine desulfurase	A0A1X6WFP1	Pacmanvirus	6.0e-39	32.6
WP_003628027.1\|904336_905554_+\|tRNA	tRNA 4-thiouridine(8) synthase ThiI	NA	NA	NA	NA
WP_003628028.1\|905688_905862_+	hypothetical protein	NA	NA	NA	NA
WP_110554682.1\|906042_906264_-	DUF3232 domain-containing protein	NA	NA	NA	NA
WP_035509928.1\|906574_907267_+	pseudouridine synthase	NA	NA	NA	NA
WP_080669029.1\|909277_909700_+	SLAP domain-containing protein	NA	NA	NA	NA
907572:907595	attR	NA	NA	NA	NA
WP_020829106.1\|909854_910436_+	DUF3232 domain-containing protein	NA	NA	NA	NA
WP_035509155.1\|910452_911262_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_023192402.1\|911570_912620_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	4.7e-51	35.9
WP_023060818.1\|913906_914083_+	hypothetical protein	NA	NA	NA	NA
WP_143441508.1\|914076_914427_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_003627958.1\|914466_914697_+\|transposase	transposase	NA	NA	NA	NA
WP_003627959.1\|914671_916009_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	7.4e-49	34.4

DBSCAN-SWA_9

987128 : 1055083

Bacillus_virus(33.33%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003627951.1\|987128_988403_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	2.3e-132	55.6
WP_003627952.1\|988392_988983_+	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_003628082.1\|990654_991659_-	diaminopimelate epimerase	NA	NA	NA	NA
WP_020829126.1\|991651_993025_-	aspartate kinase	NA	NA	NA	NA
WP_003626731.1\|995094_996411_+	diaminopimelate decarboxylase	NA	NA	NA	NA
WP_003626729.1\|996430_997141_+	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase	NA	NA	NA	NA
WP_020829127.1\|997143_998298_+	N-acetyldiaminopimelate deacetylase	NA	NA	NA	NA
WP_003626725.1\|998299_999235_+	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_003626724.1\|999227_1000007_+	4-hydroxy-tetrahydrodipicolinate reductase	NA	NA	NA	NA
WP_003626723.1\|1000027_1001194_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_003626722.1\|1001205_1002264_+	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_080669031.1\|1002470_1003736_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	5.2e-52	43.0
WP_003628084.1\|1003837_1004938_+	serine hydrolase	NA	NA	NA	NA
WP_080669032.1\|1004994_1005570_+	NUDIX hydrolase	NA	NA	NA	NA
WP_003626719.1\|1005613_1007224_-	DUF2974 domain-containing protein	NA	NA	NA	NA
WP_003626716.1\|1007830_1008346_+	hypothetical protein	NA	NA	NA	NA
WP_003626714.1\|1008408_1009338_-	nucleoside hydrolase	NA	NA	NA	NA
WP_003626713.1\|1009476_1010397_+	aldo/keto reductase	NA	NA	NA	NA
WP_041806193.1\|1010565_1012272_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	6.0e-88	36.7
WP_003626706.1\|1013852_1014488_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003626700.1\|1016629_1017184_-	cysteine hydrolase	G3MA16	Bacillus_virus	4.7e-34	41.8
WP_003626697.1\|1017180_1018620_-	nicotinate phosphoribosyltransferase	G3MA18	Bacillus_virus	1.5e-95	41.8
WP_003626695.1\|1020337_1021042_+	NUDIX hydrolase	G3MA14	Bacillus_virus	1.6e-07	25.5
WP_003628093.1\|1022066_1022789_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_012212259.1\|1023543_1024785_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0P0IJS6	Lactobacillus_phage	2.8e-119	56.6
WP_023192487.1\|1024944_1025883_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003626688.1\|1025882_1027259_-	glycoside hydrolase family 1 protein	NA	NA	NA	NA
WP_003626685.1\|1028420_1028909_+	nitroreductase family protein	NA	NA	NA	NA
WP_003626684.1\|1029060_1029663_+	DUF4767 domain-containing protein	NA	NA	NA	NA
WP_003626683.1\|1029738_1031025_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	2.3e-108	51.7
WP_041806194.1\|1032248_1033976_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	1.2e-88	37.1
WP_003628100.1\|1033941_1034517_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_003626673.1\|1036469_1037426_+	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	3.6e-114	60.5
WP_020829131.1\|1037440_1037959_+	dihydrofolate reductase	G3MBI7	Bacillus_virus	7.6e-26	40.1
WP_023191133.1\|1039354_1039510_+	hypothetical protein	NA	NA	NA	NA
WP_003628116.1\|1039548_1041966_+	HAD-IC family P-type ATPase	E4ZFI9	Streptococcus_phage	1.6e-17	20.2
WP_020829132.1\|1042317_1043178_+	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003626662.1\|1043190_1044252_+	methionine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-29	35.2
WP_003628117.1\|1044244_1044946_+	ABC transporter permease	NA	NA	NA	NA
WP_003626652.1\|1046409_1046634_-	hypothetical protein	NA	NA	NA	NA
WP_003628120.1\|1046821_1048225_+	class II fumarate hydratase	NA	NA	NA	NA
WP_003628121.1\|1048236_1049613_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	5.8e-57	32.3
WP_003628122.1\|1049907_1050099_+	hypothetical protein	NA	NA	NA	NA
WP_157999344.1\|1050026_1050227_+	hypothetical protein	NA	NA	NA	NA
WP_023192591.1\|1050223_1050910_+	mucus-binding protein	NA	NA	NA	NA
WP_003628125.1\|1050896_1051199_+	hypothetical protein	NA	NA	NA	NA
WP_003626645.1\|1051246_1051414_+	hypothetical protein	NA	NA	NA	NA
WP_023192590.1\|1051448_1052528_+	YSIRK-type signal peptide-containing protein	NA	NA	NA	NA
WP_023192589.1\|1052596_1052974_+	hypothetical protein	NA	NA	NA	NA
WP_023192588.1\|1052980_1053481_+	hypothetical protein	NA	NA	NA	NA
WP_023192587.1\|1053487_1053832_+	hypothetical protein	NA	NA	NA	NA
WP_096001372.1\|1053898_1055083_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q5ULQ4	Lactobacillus_virus	5.4e-112	55.9

DBSCAN-SWA_10

1066082 : 1109533

Planktothrix_phage(12.5%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041806251.1\|1066082_1067237_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_003626617.1\|1067383_1068850_+	DASS family sodium-coupled anion symporter	NA	NA	NA	NA
WP_003626616.1\|1068928_1069720_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_003628156.1\|1069810_1070863_+	[citrate (pro-3S)-lyase] ligase	NA	NA	NA	NA
WP_003628158.1\|1070852_1071146_+	citrate lyase acyl carrier protein	NA	NA	NA	NA
WP_003626613.1\|1071146_1072061_+	citrate (pro-3S)-lyase subunit beta	NA	NA	NA	NA
WP_035509333.1\|1072032_1073592_+	citrate lyase subunit alpha	NA	NA	NA	NA
WP_020829134.1\|1073998_1074817_+	hypothetical protein	NA	NA	NA	NA
WP_003628182.1\|1077136_1077592_+	DUF441 domain-containing protein	NA	NA	NA	NA
WP_003626603.1\|1077622_1077781_+	hypothetical protein	NA	NA	NA	NA
WP_003628184.1\|1077802_1078636_-	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_020829135.1\|1078628_1080338_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.9e-18	32.1
WP_003628186.1\|1080350_1080908_-	ECF-type riboflavin transporter substrate-binding protein	NA	NA	NA	NA
WP_020829136.1\|1081038_1081419_+	DUF1828 domain-containing protein	NA	NA	NA	NA
WP_003626591.1\|1081674_1082007_-	hypothetical protein	A0A0P0I7G8	Lactobacillus_phage	1.1e-17	43.6
WP_020829137.1\|1082008_1082962_-	transcription regulator	NA	NA	NA	NA
WP_020829138.1\|1083131_1084478_+	threonine/serine exporter family protein	NA	NA	NA	NA
WP_003628193.1\|1084580_1085087_+	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_096001364.1\|1086735_1087965_+\|transposase	IS110-like element ISLhe4 family transposase	A0A1X9I619	Streptococcus_phage	1.5e-64	37.9
WP_012211785.1\|1088445_1088955_-\|tRNA	aminoacyl-tRNA deacylase	NA	NA	NA	NA
WP_003628222.1\|1089015_1089963_+	50S ribosomal protein L11 methyltransferase	NA	NA	NA	NA
WP_020829139.1\|1090018_1090381_+	hypothetical protein	NA	NA	NA	NA
WP_003628226.1\|1090395_1092636_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2I2L310	Orpheovirus	1.3e-10	38.0
WP_003628228.1\|1092635_1093073_+\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
WP_003628230.1\|1093363_1094650_+\|tRNA	histidine--tRNA ligase	A0A2K9L0H9	Tupanvirus	2.1e-21	25.9
WP_020829140.1\|1094655_1096509_+\|tRNA	aspartate--tRNA ligase	A0A1V0SAC0	Catovirus	1.3e-11	24.4
WP_041806197.1\|1096528_1097386_-\|transposase	IS982-like element ISLh1 family transposase	NA	NA	NA	NA
WP_020829141.1\|1097568_1098753_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_020829142.1\|1100792_1101986_+	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	3.3e-40	32.2
WP_035164034.1\|1102101_1102959_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_003628261.1\|1103127_1103964_+	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	2.0e-36	35.9
WP_020829143.1\|1105910_1107296_-	amino acid permease	NA	NA	NA	NA
WP_080669025.1\|1108140_1109097_-\|transposase	transposase	NA	NA	NA	NA
WP_187289107.1\|1109050_1109533_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_11

1204535 : 1294338

Lactobacillus_prophage(12.5%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041806167.1\|1204535_1205393_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_003626440.1\|1205891_1207505_+	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_035509761.1\|1207657_1208143_+	hypothetical protein	NA	NA	NA	NA
WP_003626438.1\|1211261_1213196_-	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_003626436.1\|1213391_1214117_+	trehalose operon repressor	NA	NA	NA	NA
WP_020829171.1\|1214127_1215789_+	alpha,alpha-phosphotrehalase	NA	NA	NA	NA
WP_003626433.1\|1215835_1217416_-	SH3-like domain-containing protein	NA	NA	NA	NA
WP_003626431.1\|1217564_1218002_+	hypothetical protein	NA	NA	NA	NA
WP_003626428.1\|1218162_1218732_+	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_003626425.1\|1218731_1219100_+	ASCH domain-containing protein	NA	NA	NA	NA
WP_003626419.1\|1221871_1222477_+	DUF1819 family protein	NA	NA	NA	NA
WP_014918809.1\|1222476_1223076_+	DUF1788 domain-containing protein	NA	NA	NA	NA
WP_148286622.1\|1229042_1231367_+	BREX-1 system adenine-specific DNA-methyltransferase PglX	NA	NA	NA	NA
WP_020829172.1\|1231552_1234039_+	BREX-1 system phosphatase PglZ type A	NA	NA	NA	NA
WP_020829173.1\|1234098_1235991_+	TerB N-terminal domain-containing protein	Q6SEF9	Lactobacillus_prophage	2.6e-15	50.5
WP_143441652.1\|1236258_1236906_+\|transposase	transposase	NA	NA	NA	NA
WP_041806199.1\|1236997_1238698_-\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	6.0e-88	37.1
WP_051355179.1\|1238925_1239270_-	hypothetical protein	NA	NA	NA	NA
WP_020829174.1\|1240199_1245560_+	S8 family serine peptidase	A0A1B0T6A2	Bacillus_phage	4.6e-17	32.8
WP_020829176.1\|1246137_1247328_+	glycosyltransferase	NA	NA	NA	NA
WP_020829177.1\|1247324_1248182_+	hypothetical protein	NA	NA	NA	NA
WP_035509466.1\|1248339_1248753_+	hypothetical protein	NA	NA	NA	NA
WP_023192019.1\|1248724_1249009_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	7.1e-18	47.3
WP_020829179.1\|1250825_1252232_+	ATP-binding protein	NA	NA	NA	NA
WP_020829180.1\|1252308_1253763_+	DUF3387 domain-containing protein	A0A2H4PQP4	Staphylococcus_phage	4.2e-05	40.0
WP_020829181.1\|1253782_1255561_+	DUF262 domain-containing protein	NA	NA	NA	NA
WP_023192022.1\|1255620_1257306_-	hypothetical protein	NA	NA	NA	NA
WP_012211889.1\|1258790_1260737_-	M13 family metallopeptidase	E3T4I7	Cafeteria_roenbergensis_virus	1.8e-59	29.3
WP_003628612.1\|1260946_1261312_+	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_035509473.1\|1261586_1262933_+	amino acid permease	NA	NA	NA	NA
WP_020829184.1\|1262964_1264152_+	amidohydrolase	NA	NA	NA	NA
WP_080669038.1\|1265144_1265471_+	homocysteine S-methyltransferase family protein	NA	NA	NA	NA
WP_165709012.1\|1265485_1265677_+	hypothetical protein	NA	NA	NA	NA
WP_020829185.1\|1266851_1268126_+	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_020829186.1\|1269926_1270460_+	hypoxanthine phosphoribosyltransferase	NA	NA	NA	NA
WP_003626377.1\|1270616_1270847_+	replication initiator protein A	NA	NA	NA	NA
WP_012211896.1\|1270981_1271533_+	metal-dependent hydrolase	NA	NA	NA	NA
WP_096001373.1\|1271648_1272878_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q5ULQ4	Lactobacillus_virus	2.0e-125	58.7
WP_003626373.1\|1273066_1273306_+	hypothetical protein	NA	NA	NA	NA
WP_003626368.1\|1274338_1274674_+	SLAP domain-containing protein	NA	NA	NA	NA
WP_020829187.1\|1275056_1276436_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_003626366.1\|1277793_1279197_-	dipeptidase PepV	NA	NA	NA	NA
WP_035509361.1\|1279400_1280414_+	serine hydrolase	NA	NA	NA	NA
WP_014563554.1\|1284160_1284373_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_020829189.1\|1285848_1286343_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003626357.1\|1286378_1286792_-	DUF3021 domain-containing protein	NA	NA	NA	NA
WP_012211907.1\|1286793_1287231_-	LytTR family transcriptional regulator	NA	NA	NA	NA
WP_003628700.1\|1287408_1287684_+	hypothetical protein	NA	NA	NA	NA
WP_003626351.1\|1287749_1288403_-	endonuclease III	NA	NA	NA	NA
WP_003614991.1\|1288842_1289193_+	dihydroneopterin aldolase	NA	NA	NA	NA
WP_020829190.1\|1289189_1290263_+	GTP cyclohydrolase I FolE	A0A0P0HSD2	Acinetobacter_phage	2.3e-37	42.3
WP_003628708.1\|1290246_1291584_+	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_003628709.1\|1291573_1292665_+	dihydropteroate synthase	NA	NA	NA	NA
WP_003621227.1\|1292676_1293213_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_081371216.1\|1293633_1293801_-\|transposase	transposase	NA	NA	NA	NA
WP_023192527.1\|1294092_1294338_-\|transposase	IS5 family transposase	NA	NA	NA	NA

DBSCAN-SWA_12

1298699 : 1356006

unidentified_phage(12.5%)

integrase,tRNA,transposase

attL 1302808:1302867|attR 1316840:1318026

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003627959.1\|1298699_1300037_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	7.4e-49	34.4
WP_003627958.1\|1300011_1300242_-\|transposase	transposase	NA	NA	NA	NA
WP_143441508.1\|1300281_1300632_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_003633334.1\|1300625_1300802_-	hypothetical protein	NA	NA	NA	NA
WP_023192585.1\|1301507_1302539_+\|transposase	IS3 family transposase	A0A0C5AC89	Paenibacillus_phage	1.4e-34	39.2
1302808:1302867	attL	NA	NA	NA	NA
WP_023192402.1\|1302911_1303961_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	4.7e-51	35.9
WP_023061119.1\|1304674_1305313_+	hypothetical protein	NA	NA	NA	NA
WP_003626321.1\|1305429_1306050_+\|integrase	tyrosine-type recombinase/integrase	E2ELN7	Clostridium_phage	4.3e-20	36.4
WP_023190388.1\|1306306_1306585_-	Na+/H+ antiporter family protein	NA	NA	NA	NA
WP_003626318.1\|1306882_1308223_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_020829194.1\|1308387_1308906_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003628750.1\|1309053_1309878_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_003628753.1\|1309874_1310225_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_014563530.1\|1310381_1311140_+	NADPH-dependent oxidoreductase	NA	NA	NA	NA
WP_003628763.1\|1311295_1311604_+	ACT domain-containing protein	NA	NA	NA	NA
WP_003628764.1\|1311687_1312170_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_003628766.1\|1312189_1312780_-	hypothetical protein	NA	NA	NA	NA
WP_023192470.1\|1312834_1313248_-	hypothetical protein	NA	NA	NA	NA
WP_003628771.1\|1313256_1313553_-	hypothetical protein	NA	NA	NA	NA
WP_020829195.1\|1313545_1314406_-	hypothetical protein	NA	NA	NA	NA
WP_003628775.1\|1314619_1315138_+	N-acetyltransferase GCN5	M1PSC3	Streptococcus_phage	5.1e-22	38.4
WP_003626288.1\|1315226_1315694_+	DNA starvation/stationary phase protection protein	NA	NA	NA	NA
WP_023192402.1\|1315745_1316795_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	4.7e-51	35.9
WP_020829196.1\|1318543_1319161_-	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
1316840:1318026	attR	NA	NA	NA	NA
WP_023192732.1\|1319257_1321204_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	3.5e-116	41.0
WP_020829198.1\|1321220_1323677_+	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	3.0e-96	31.3
WP_023192733.1\|1323827_1324790_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003626273.1\|1324822_1325758_+	manganese-dependent inorganic pyrophosphatase	NA	NA	NA	NA
WP_003626271.1\|1325842_1326427_+	peptidylprolyl isomerase	A0A1V0S9I2	Catovirus	6.3e-29	44.6
WP_003626270.1\|1326456_1326810_-	transcriptional regulator	NA	NA	NA	NA
WP_023061618.1\|1329286_1329541_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_003626263.1\|1331095_1331299_+	SLAP domain-containing protein	NA	NA	NA	NA
WP_003628839.1\|1331363_1331720_+	hypothetical protein	NA	NA	NA	NA
WP_003626259.1\|1331926_1332535_+	DUF5052 family protein	A0A2K9VCV0	Lactobacillus_phage	4.8e-40	44.2
WP_003626255.1\|1333088_1333544_-	hypothetical protein	NA	NA	NA	NA
WP_014563506.1\|1334058_1335141_+	tyrosine recombinase XerS	NA	NA	NA	NA
WP_020829202.1\|1335343_1336225_-	DegV family protein	A0A0N9SI50	Staphylococcus_phage	4.4e-10	35.9
WP_003627403.1\|1336299_1336716_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_003628850.1\|1336864_1338559_+	NFACT family protein	Q84500	Paramecium_bursaria_Chlorella_virus	3.2e-09	40.0
WP_020829203.1\|1338626_1341818_-	carbamoyl phosphate synthase large subunit	NA	NA	NA	NA
WP_020829204.1\|1341821_1342877_-	carbamoyl phosphate synthase small subunit	NA	NA	NA	NA
WP_020829205.1\|1342879_1343791_-	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	2.1e-10	28.9
WP_003627408.1\|1343783_1344248_-	signal peptidase II	NA	NA	NA	NA
WP_003628852.1\|1344254_1345931_-	formate--tetrahydrofolate ligase	NA	NA	NA	NA
WP_051355169.1\|1345927_1346212_-	hypothetical protein	NA	NA	NA	NA
WP_020829206.1\|1347513_1348638_-	class I SAM-dependent RNA methyltransferase	NA	NA	NA	NA
WP_003627414.1\|1349099_1349516_-	DivIVA domain-containing protein	NA	NA	NA	NA
WP_003627415.1\|1349606_1350176_-	DUF1273 domain-containing protein	NA	NA	NA	NA
WP_003628860.1\|1350239_1350872_+	Holliday junction resolvase RecU	A0A1B1P798	Bacillus_phage	1.6e-17	31.2
WP_020829207.1\|1350868_1353148_+	penicillin-binding protein	NA	NA	NA	NA
WP_020829208.1\|1353355_1353976_-	endonuclease III	NA	NA	NA	NA
WP_003627421.1\|1353977_1354622_-	DnaD domain protein	A0A0N7AE27	Bacillus_phage	4.2e-10	36.0
WP_003627422.1\|1354707_1356006_-\|tRNA	asparagine--tRNA ligase	M1PB22	Moumouvirus	1.8e-47	27.8

DBSCAN-SWA_13

1374478 : 1477665

111

Lactobacillus_phage(69.81%)

head,terminase,tail,plate,capsid,portal,integrase,tRNA,transposase

attL 1374382:1374408|attR 1463058:1463084

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1374382:1374408	attL	NA	NA	NA	NA
WP_041806202.1\|1374478_1375336_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_003627439.1\|1375393_1375585_+	hypothetical protein	NA	NA	NA	NA
WP_020829214.1\|1376850_1377609_-	hypothetical protein	NA	NA	NA	NA
WP_020829215.1\|1377652_1378483_-	hypothetical protein	NA	NA	NA	NA
WP_020829216.1\|1378493_1379339_-	hypothetical protein	NA	NA	NA	NA
WP_003627445.1\|1379338_1380046_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.7e-15	26.9
WP_003627446.1\|1380047_1380413_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003628899.1\|1380687_1381929_-	peptidase T	NA	NA	NA	NA
WP_003628901.1\|1381948_1382746_-	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
WP_003628903.1\|1382738_1383425_-	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_003627455.1\|1383924_1384581_+	M23 family metallopeptidase	NA	NA	NA	NA
WP_020829217.1\|1384630_1385743_-	RNA polymerase sigma factor RpoD	M4SMP8	Cyanophage	3.2e-37	34.8
WP_020829218.1\|1385759_1387595_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	4.5e-57	34.8
WP_003628907.1\|1387620_1389684_-\|tRNA	glycine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_003627460.1\|1389676_1390594_-\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
WP_003627462.1\|1390847_1391600_-	DNA repair protein RecO	NA	NA	NA	NA
WP_003627464.1\|1391600_1392506_-	GTPase Era	NA	NA	NA	NA
WP_003628912.1\|1392505_1393030_-	rRNA maturation RNase YbeY	NA	NA	NA	NA
WP_020829219.1\|1393032_1393992_-	PhoH family protein	W8D063	Erwinia_phage	2.2e-47	46.1
WP_003628914.1\|1394017_1394461_-	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	2.0e-11	32.9
WP_002880182.1\|1394571_1394748_-	30S ribosomal protein S21	NA	NA	NA	NA
WP_003628916.1\|1395003_1395840_+	kinase/pyrophosphorylase	NA	NA	NA	NA
WP_020829220.1\|1396211_1396643_+	M23 family metallopeptidase	NA	NA	NA	NA
WP_020829221.1\|1397192_1398314_-	lysin	Q71JA9	Lactobacillus_phage	1.3e-200	95.2
WP_035509854.1\|1398376_1398766_-	hypothetical protein	L0P6Z4	Lactobacillus_phage	9.6e-58	96.1
WP_020829223.1\|1398774_1399011_-	hypothetical protein	L0P6E4	Lactobacillus_phage	2.8e-28	82.3
WP_020829224.1\|1398994_1399204_-	hypothetical protein	L0P8N8	Lactobacillus_phage	1.3e-08	93.5
WP_023192647.1\|1399223_1399628_-	hypothetical protein	NA	NA	NA	NA
WP_020829225.1\|1399587_1399779_-	XkdX family protein	NA	NA	NA	NA
WP_020829226.1\|1399795_1400401_-	hypothetical protein	NA	NA	NA	NA
WP_020829228.1\|1400776_1401172_-	hypothetical protein	NA	NA	NA	NA
WP_023192643.1\|1401168_1401597_-	hypothetical protein	NA	NA	NA	NA
WP_020829230.1\|1401607_1403524_-	hypothetical protein	L0P6E1	Lactobacillus_phage	4.5e-108	43.9
WP_020829231.1\|1403541_1404111_-	DUF2313 domain-containing protein	L0P8N4	Lactobacillus_phage	7.6e-96	96.3
WP_020829232.1\|1404103_1405249_-\|plate	baseplate J/gp47 family protein	L0P7C2	Lactobacillus_phage	9.3e-202	91.6
WP_035509842.1\|1405238_1405652_-	DUF2634 domain-containing protein	L0P6H1	Lactobacillus_phage	4.6e-66	94.9
WP_020829234.1\|1405677_1406022_-	DUF2577 domain-containing protein	L0P6Y6	Lactobacillus_phage	5.1e-55	91.2
WP_020829235.1\|1405994_1407062_-	hypothetical protein	L0P6D8	Lactobacillus_phage	2.0e-190	95.8
WP_051356301.1\|1407058_1407757_-	hypothetical protein	L0P8M9	Lactobacillus_phage	4.8e-116	95.2
WP_035509839.1\|1407763_1408237_-	hypothetical protein	L0P7B8	Lactobacillus_phage	4.1e-55	91.7
WP_020829238.1\|1411042_1411459_-	hypothetical protein	L0P6Y3	Lactobacillus_phage	1.9e-67	98.6
WP_020829239.1\|1411471_1411948_-	hypothetical protein	L0P6D4	Lactobacillus_phage	1.5e-81	97.4
WP_020829240.1\|1411961_1413422_-\|tail	phage tail sheath subtilisin-like domain-containing protein	L0P8M7	Lactobacillus_phage	5.3e-250	90.5
WP_020829241.1\|1413425_1413629_-	hypothetical protein	L0P7B3	Lactobacillus_phage	1.7e-21	80.6
WP_023192641.1\|1413597_1414023_-	hypothetical protein	L0P6G4	Lactobacillus_phage	6.7e-73	93.6
WP_020829242.1\|1414019_1414421_-	HK97 gp10 family phage protein	X2CXN4	Lactobacillus_phage	7.9e-39	55.6
WP_020829243.1\|1414417_1414780_-	hypothetical protein	A9D9T8	Lactobacillus_prophage	2.4e-39	68.3
WP_020829244.1\|1414776_1415148_-\|head,tail	phage head-tail connector protein	L0P6D1	Lactobacillus_phage	2.2e-59	94.3
WP_020829245.1\|1415165_1416242_-\|capsid	phage capsid protein	L0P8M2	Lactobacillus_phage	7.0e-191	95.0
WP_020829246.1\|1416256_1416796_-	phage scaffolding protein	L0P7B0	Lactobacillus_phage	3.2e-88	97.2
WP_020829247.1\|1417320_1418394_-\|capsid	minor capsid protein	A9D9S7	Lactobacillus_prophage	3.5e-118	58.9
WP_023192640.1\|1418396_1419848_-\|portal	phage portal protein	X2CY64	Lactobacillus_phage	1.1e-183	69.3
WP_020829249.1\|1419853_1421083_-\|terminase	PBSX family phage terminase large subunit	A9D9R9	Lactobacillus_prophage	2.0e-181	71.9
WP_020829250.1\|1421072_1421588_-\|terminase	terminase small subunit	Q20DD9	Lactobacillus_phage	2.9e-30	46.3
WP_035509820.1\|1422192_1422636_-	hypothetical protein	Q6SEE2	Lactobacillus_prophage	6.2e-45	62.9
WP_020829252.1\|1422768_1423314_-	hypothetical protein	L0P8Q7	Lactobacillus_phage	1.6e-05	62.2
WP_020829253.1\|1423319_1423670_-	VRR-NUC domain-containing protein	L0P7E5	Lactobacillus_phage	3.2e-52	83.3
WP_020829254.1\|1423825_1424059_-	hypothetical protein	NA	NA	NA	NA
WP_023192634.1\|1424111_1424291_-	hypothetical protein	NA	NA	NA	NA
WP_035509817.1\|1424291_1424495_-	hypothetical protein	Q9T1H0	Lactobacillus_phage	3.9e-18	62.3
WP_020829255.1\|1424481_1424655_-	hypothetical protein	L0P706	Lactobacillus_phage	1.7e-19	81.8
WP_020829256.1\|1424684_1424957_-	hypothetical protein	NA	NA	NA	NA
WP_020829257.1\|1424949_1425222_-	DUF1599 domain-containing protein	F8J1G5	Lactobacillus_phage	2.2e-13	48.8
WP_023192633.1\|1425221_1425665_-	hypothetical protein	NA	NA	NA	NA
WP_020829258.1\|1425654_1426140_-	hypothetical protein	NA	NA	NA	NA
WP_020829259.1\|1426382_1427696_-	virulence-associated protein E	U3PCP1	Lactobacillus_phage	2.1e-128	53.7
WP_020829260.1\|1427688_1428489_-	bifunctional DNA primase/polymerase	U3PBE3	Lactobacillus_phage	1.3e-88	65.5
WP_020829261.1\|1428566_1428875_-	hypothetical protein	NA	NA	NA	NA
WP_020829262.1\|1428890_1429475_-	hypothetical protein	U3PDN3	Lactobacillus_phage	2.4e-44	49.2
WP_020829263.1\|1429474_1430239_-	AAA family ATPase	U3PIS9	Lactobacillus_phage	2.7e-72	59.2
WP_020829264.1\|1430240_1430414_-	sporulation protein Cse60	NA	NA	NA	NA
WP_020829265.1\|1430410_1431682_-	DEAD/DEAH box helicase	U3PFS7	Lactobacillus_phage	2.2e-135	58.9
WP_020829266.1\|1431799_1432159_-	hypothetical protein	NA	NA	NA	NA
WP_020829267.1\|1432161_1432512_-	hypothetical protein	NA	NA	NA	NA
WP_020829268.1\|1432508_1432985_-	siphovirus Gp157 family protein	A0A0A1EL06	Lactobacillus_phage	1.6e-22	40.3
WP_020829270.1\|1433194_1433494_-	hypothetical protein	NA	NA	NA	NA
WP_020829271.1\|1433499_1433709_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_020829272.1\|1433998_1434343_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_020829273.1\|1434335_1434737_+	ImmA/IrrE family metallo-endopeptidase	X2CXW8	Lactobacillus_phage	1.6e-20	36.8
WP_020829274.1\|1434805_1435645_+	hypothetical protein	NA	NA	NA	NA
WP_020829275.1\|1435682_1435904_+	hypothetical protein	E9LUL0	Lactobacillus_phage	3.9e-16	61.3
WP_020829276.1\|1436093_1437215_+\|integrase	site-specific integrase	A0A0M9JJ77	Lactobacillus_phage	4.0e-72	42.2
WP_012211982.1\|1437316_1438195_+	YitT family protein	NA	NA	NA	NA
WP_035509283.1\|1442289_1442574_-	hypothetical protein	NA	NA	NA	NA
WP_003628930.1\|1442785_1443391_-	LysR family transcriptional regulator substrate-binding protein	NA	NA	NA	NA
WP_003627475.1\|1443393_1443555_-	hypothetical protein	NA	NA	NA	NA
WP_003628932.1\|1443570_1444737_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003627477.1\|1444857_1445394_-	citrate lyase holo-[acyl-carrier protein] synthase	NA	NA	NA	NA
WP_020829277.1\|1448696_1449551_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_020829278.1\|1449679_1451953_+	HAD-IC family P-type ATPase	A7IUR5	Paramecium_bursaria_Chlorella_virus	1.8e-42	24.3
WP_003627493.1\|1452021_1452522_-	SLAP domain-containing protein	NA	NA	NA	NA
WP_041806204.1\|1453211_1454069_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_012211991.1\|1455239_1456034_+	homoserine O-succinyltransferase	NA	NA	NA	NA
WP_003628968.1\|1457147_1457675_-	adenine phosphoribosyltransferase	NA	NA	NA	NA
WP_012211993.1\|1457779_1460053_-	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	3.7e-77	35.9
WP_003627502.1\|1460173_1460863_-	class A sortase	NA	NA	NA	NA
WP_020829279.1\|1460865_1462704_-	elongation factor 4	E4ZFJ7	Streptococcus_phage	5.2e-21	24.1
WP_003628994.1\|1462872_1463088_+	hypothetical protein	NA	NA	NA	NA
1463058:1463084	attR	NA	NA	NA	NA
WP_003629004.1\|1463942_1465097_-	molecular chaperone DnaJ	A0A0P0YNN4	Yellowstone_lake_phycodnavirus	2.8e-20	29.9
WP_003627506.1\|1465178_1467005_-	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	5.4e-143	49.3
WP_020829280.1\|1467022_1467640_-	nucleotide exchange factor GrpE	NA	NA	NA	NA
WP_003627509.1\|1467655_1468705_-	heat-inducible transcriptional repressor HrcA	NA	NA	NA	NA
WP_003629011.1\|1468874_1469837_-	riboflavin biosynthesis protein RibF	A0A1V0SD03	Indivirus	6.1e-05	30.1
WP_003629013.1\|1469842_1470736_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_003627512.1\|1470787_1471153_-	ribosome-binding factor A	NA	NA	NA	NA
WP_020829281.1\|1471172_1473785_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	9.7e-21	24.5
WP_003627514.1\|1473789_1474101_-	ribosomal L7Ae/L30e/S12e/Gadd45 family protein	NA	NA	NA	NA
WP_003629016.1\|1474103_1474400_-	YlxR family protein	NA	NA	NA	NA
WP_020829283.1\|1474409_1475591_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_003629018.1\|1475610_1476087_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_041806186.1\|1476258_1477665_-\|transposase	ISLre2-like element ISLhe10 family transposase	NA	NA	NA	NA

DBSCAN-SWA_14

1482119 : 1545400

Prochlorococcus_phage(13.33%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003627521.1\|1482119_1483817_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_020829285.1\|1483859_1485116_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_003629019.1\|1485126_1485942_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_003627524.1\|1485943_1486678_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	2.5e-22	39.0
WP_003627525.1\|1486680_1487238_-	ribosome recycling factor	NA	NA	NA	NA
WP_003629020.1\|1487237_1487963_-	UMP kinase	NA	NA	NA	NA
WP_003627529.1\|1488101_1489127_-	elongation factor Ts	NA	NA	NA	NA
WP_003627530.1\|1489160_1489934_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_003629021.1\|1490095_1491127_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_003629022.1\|1491192_1491807_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_020829286.1\|1491861_1493043_+	class I SAM-dependent methyltransferase	A0A2K9L4K8	Tupanvirus	4.7e-47	36.1
WP_003629024.1\|1493101_1495045_-	M13 family metallopeptidase	E3T4I7	Cafeteria_roenbergensis_virus	1.2e-60	28.4
WP_080669031.1\|1496624_1497890_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	5.2e-52	43.0
WP_096001374.1\|1499454_1500684_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q5ULQ4	Lactobacillus_virus	3.5e-122	57.7
WP_096001375.1\|1503240_1504470_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	1.5e-64	37.9
WP_003627540.1\|1504768_1504987_-	YneF family protein	NA	NA	NA	NA
WP_003627541.1\|1505049_1505313_-	DUF896 domain-containing protein	NA	NA	NA	NA
WP_020829287.1\|1505464_1506091_+	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	8.9e-13	53.6
WP_020829288.1\|1506119_1506905_-	SGNH/GDSL hydrolase family protein	Q6SEC0	Lactobacillus_prophage	2.0e-06	24.0
WP_003629071.1\|1507945_1508293_-	50S ribosomal protein L19	NA	NA	NA	NA
WP_003629072.1\|1508405_1509125_-\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_003629074.1\|1509114_1509630_-	ribosome maturation factor RimM	NA	NA	NA	NA
WP_003627549.1\|1509698_1509971_-	30S ribosomal protein S16	NA	NA	NA	NA
WP_003627550.1\|1510061_1511492_-	signal recognition particle protein	NA	NA	NA	NA
WP_003627552.1\|1511496_1511838_-	transcriptional regulator	NA	NA	NA	NA
WP_080516431.1\|1511952_1512909_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	8.2e-26	32.0
WP_020829289.1\|1513034_1514462_+	amino acid permease	NA	NA	NA	NA
WP_025283681.1\|1514528_1514819_-	hypothetical protein	NA	NA	NA	NA
WP_003627558.1\|1515015_1516437_-	C69 family dipeptidase	NA	NA	NA	NA
WP_003627559.1\|1516479_1517772_-	signal recognition particle-docking protein FtsY	NA	NA	NA	NA
WP_020829290.1\|1517772_1521342_-	chromosome segregation protein SMC	NA	NA	NA	NA
WP_003627561.1\|1521357_1522044_-	ribonuclease III	M1HR51	Paramecium_bursaria_Chlorella_virus	8.2e-20	30.6
WP_035504770.1\|1522153_1523917_-	oligopeptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_020829291.1\|1524128_1525880_-	oligopeptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003627565.1\|1526084_1527014_-	ABC transporter permease	NA	NA	NA	NA
WP_012212411.1\|1527028_1527988_-	ABC transporter permease	NA	NA	NA	NA
WP_003629095.1\|1527990_1528977_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.7e-13	28.1
WP_020829292.1\|1528980_1530015_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.0e-14	28.2
WP_003627571.1\|1530135_1530378_-	acyl carrier protein	E3SSM9	Prochlorococcus_phage	8.1e-07	56.1
WP_020829293.1\|1530408_1531410_-	phosphate acyltransferase PlsX	NA	NA	NA	NA
WP_012212019.1\|1531430_1533461_-	ATP-dependent DNA helicase RecG	NA	NA	NA	NA
WP_003627574.1\|1533462_1535124_-	DAK2 domain-containing protein	NA	NA	NA	NA
WP_003547910.1\|1535145_1535508_-	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_003627575.1\|1536523_1536709_+	50S ribosomal protein L28	NA	NA	NA	NA
WP_003627577.1\|1536815_1537121_-	hypothetical protein	NA	NA	NA	NA
WP_003627578.1\|1537162_1537849_-	thiamine diphosphokinase	NA	NA	NA	NA
WP_003627579.1\|1537848_1538499_-	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
WP_003627580.1\|1538511_1539402_-	ribosome small subunit-dependent GTPase A	NA	NA	NA	NA
WP_003627581.1\|1539402_1541418_-	Stk1 family PASTA domain-containing Ser/Thr kinase	Q8QNG7	Ectocarpus_siliculosus_virus	1.8e-19	29.2
WP_003629102.1\|1541407_1542163_-	Stp1/IreP family PP2C-type Ser/Thr phosphatase	NA	NA	NA	NA
WP_041806167.1\|1543086_1543944_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_020829295.1\|1544455_1545400_-\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	6.2e-10	30.2

DBSCAN-SWA_15

1555204 : 1617559

unidentified_phage(14.29%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041806207.1\|1555204_1556254_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	5.8e-49	36.0
WP_003627597.1\|1556391_1557240_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase	A0A249XZQ2	Enterococcus_phage	1.9e-42	43.1
WP_020829298.1\|1557298_1557691_-	transcription antitermination factor NusB	NA	NA	NA	NA
WP_003629148.1\|1557698_1558124_-	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_003627601.1\|1558141_1558711_-	elongation factor P	NA	NA	NA	NA
WP_003629150.1\|1558794_1559904_-	aminopeptidase P family protein	NA	NA	NA	NA
WP_003629151.1\|1560013_1560304_-	50S ribosomal protein L27	NA	NA	NA	NA
WP_003629152.1\|1560322_1560634_-	50S ribosomal protein L21	NA	NA	NA	NA
WP_020829299.1\|1560800_1562168_-	DUF2325 domain-containing protein	NA	NA	NA	NA
WP_003629154.1\|1562306_1563332_+	branched-chain amino acid aminotransferase	NA	NA	NA	NA
WP_003627607.1\|1563375_1564053_-	hypothetical protein	NA	NA	NA	NA
WP_003547962.1\|1564118_1564298_-	4-oxalocrotonate tautomerase	NA	NA	NA	NA
WP_023192520.1\|1566809_1567025_-	hypothetical protein	NA	NA	NA	NA
WP_003629190.1\|1568827_1569724_+	alpha/beta hydrolase	L7RDF8	Acanthamoeba_polyphaga_moumouvirus	1.8e-11	26.6
WP_003627613.1\|1569732_1570089_+	arsenate reductase family protein	M1PLC0	Streptococcus_phage	5.0e-13	38.6
WP_003629197.1\|1570803_1573185_+	Xaa-Pro dipeptidyl-peptidase	NA	NA	NA	NA
WP_003627616.1\|1573236_1573662_-	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_003627617.1\|1573654_1573936_-	hypothetical protein	NA	NA	NA	NA
WP_003629199.1\|1574050_1574914_-	sugar transporter	NA	NA	NA	NA
WP_003627621.1\|1575087_1575258_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_003627622.1\|1575236_1576199_-	mucus-binding protein	NA	NA	NA	NA
WP_020829301.1\|1577560_1580749_-	carbamoyl-phosphate synthase large subunit	NA	NA	NA	NA
WP_003627625.1\|1580741_1581827_-	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	2.5e-55	35.5
WP_003623962.1\|1581826_1583104_-	dihydroorotase	NA	NA	NA	NA
WP_020829302.1\|1583103_1584060_-	aspartate carbamoyltransferase catalytic subunit	M1HGA5	Paramecium_bursaria_Chlorella_virus	1.6e-26	34.1
WP_003627628.1\|1584204_1584747_-	bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR	NA	NA	NA	NA
WP_003627629.1\|1584913_1585837_-	dihydroorotate dehydrogenase	NA	NA	NA	NA
WP_003629217.1\|1586091_1586796_+	orotidine-5'-phosphate decarboxylase	NA	NA	NA	NA
WP_003627631.1\|1586797_1587421_+	orotate phosphoribosyltransferase	A0A0B5IW17	Pandoravirus	9.1e-26	32.9
WP_023191716.1\|1587645_1587924_-	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_003627637.1\|1589837_1592474_+	cation-translocating P-type ATPase	M1IAU8	Acanthocystis_turfacea_Chlorella_virus	1.1e-83	30.0
WP_041806208.1\|1592668_1593928_+\|transposase	ISL3 family transposase	A0A2D1GQC1	Lysinibacillus_phage	1.1e-09	21.3
WP_096001376.1\|1594165_1595395_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	4.7e-66	38.6
WP_023192018.1\|1595670_1596903_-	MFS transporter	NA	NA	NA	NA
WP_041806210.1\|1597274_1598600_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	G3MB42	Bacillus_virus	1.2e-56	36.3
WP_003627960.1\|1598629_1599238_-\|transposase	IS607 family transposase	A0A1V0SJI5	Klosneuvirus	1.5e-33	43.2
WP_044000222.1\|1600783_1601440_-	hypothetical protein	NA	NA	NA	NA
WP_041806212.1\|1604135_1604993_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_096001393.1\|1605087_1605183_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_035509557.1\|1607290_1607587_+	metal-sulfur cluster assembly factor	NA	NA	NA	NA
WP_003627897.1\|1607633_1608494_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_020829309.1\|1608506_1609247_-	amino acid ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.1e-25	30.8
WP_014563318.1\|1609256_1609931_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_003627894.1\|1609911_1610571_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_014918531.1\|1610723_1610957_+	hypothetical protein	NA	NA	NA	NA
WP_004561246.1\|1611344_1611512_-	hypothetical protein	NA	NA	NA	NA
WP_014918530.1\|1611610_1613356_-	oligopeptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003627889.1\|1613704_1614214_-	hypothetical protein	NA	NA	NA	NA
WP_003627890.1\|1614253_1614601_-	SLAP domain-containing protein	NA	NA	NA	NA
WP_146211640.1\|1614673_1614889_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_003633334.1\|1614882_1615059_-	hypothetical protein	NA	NA	NA	NA
WP_096001377.1\|1615137_1616307_-	MFS transporter	NA	NA	NA	NA
WP_041806214.1\|1616533_1617559_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	6.5e-45	34.3

DBSCAN-SWA_16

1628152 : 1783097

111

Lactobacillus_phage(12.12%)

tRNA,bacteriocin,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041806162.1\|1628152_1629322_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_003629407.1\|1629666_1630173_+	hypothetical protein	NA	NA	NA	NA
WP_041806215.1\|1632231_1633626_-\|transposase	ISLre2 family transposase	NA	NA	NA	NA
WP_020829317.1\|1633751_1634462_-	oxidoreductase	NA	NA	NA	NA
WP_003629414.1\|1634481_1634889_-	OsmC family protein	NA	NA	NA	NA
WP_020829318.1\|1634907_1636080_-	MFS transporter	NA	NA	NA	NA
WP_020829319.1\|1638620_1639220_-	SLAP domain-containing protein	NA	NA	NA	NA
WP_020829320.1\|1639276_1639759_-	SLAP domain-containing protein	NA	NA	NA	NA
WP_020829321.1\|1639879_1640875_-	galactose mutarotase	NA	NA	NA	NA
WP_020829322.1\|1640994_1642458_-	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
WP_020829323.1\|1642479_1643646_-	galactokinase	NA	NA	NA	NA
WP_020829324.1\|1651811_1653041_-	MFS transporter	NA	NA	NA	NA
WP_110549469.1\|1655031_1655118_+	type I toxin-antitoxin system Fst family toxin	NA	NA	NA	NA
WP_020829325.1\|1657850_1658936_+	BMP family protein	A0A0A7DN02	Lactobacillus_phage	4.0e-77	49.0
WP_020829326.1\|1659004_1660549_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.0e-14	26.9
WP_020829327.1\|1660529_1661693_+	ABC transporter permease	NA	NA	NA	NA
WP_003627726.1\|1661682_1662639_+	ABC transporter permease	NA	NA	NA	NA
WP_023192402.1\|1663794_1664844_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	4.7e-51	35.9
WP_041806216.1\|1664909_1666187_+\|transposase	ISL3 family transposase	Q6V7R1	Burkholderia_virus	1.7e-10	23.2
WP_003627020.1\|1666389_1667646_-	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
WP_012212085.1\|1667658_1669794_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	5.6e-75	46.3
WP_003627023.1\|1669790_1670840_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F0L1	Synechococcus_phage	9.2e-63	43.9
WP_003627024.1\|1670871_1672305_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	5.3e-61	35.1
WP_012212086.1\|1672280_1674512_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	7.8e-144	38.9
WP_003627026.1\|1674508_1675180_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003627027.1\|1675179_1675431_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_003629554.1\|1675430_1676147_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A1D7SPE1	Cyanophage	3.7e-39	38.7
WP_023060818.1\|1676351_1676528_+	hypothetical protein	NA	NA	NA	NA
WP_143441508.1\|1676521_1676872_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_003627958.1\|1676911_1677142_+\|transposase	transposase	NA	NA	NA	NA
WP_003627959.1\|1677116_1678454_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	7.4e-49	34.4
WP_003629555.1\|1678614_1679751_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003627031.1\|1679743_1680232_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	4.8e-22	45.1
WP_020829328.1\|1680242_1681904_-	formate--tetrahydrofolate ligase	NA	NA	NA	NA
WP_003627036.1\|1682293_1683052_-	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	2.2e-21	29.7
WP_020829329.1\|1683067_1684213_-	MFS transporter	NA	NA	NA	NA
WP_035508929.1\|1684349_1685222_-	shikimate dehydrogenase	NA	NA	NA	NA
WP_041806217.1\|1687459_1688695_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.5e-56	47.7
WP_003627055.1\|1694982_1695990_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_003627056.1\|1696216_1698103_+	beta-galactosidase	L0N6M2	Herpes_simplex_virus	4.8e-94	33.6
WP_003629579.1\|1698086_1699043_+	beta-galactosidase	NA	NA	NA	NA
WP_003627059.1\|1699147_1700140_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	5.3e-52	38.4
WP_035509062.1\|1701713_1702712_-	hypothetical protein	NA	NA	NA	NA
WP_003629591.1\|1702808_1703714_-	hypothetical protein	NA	NA	NA	NA
WP_003627065.1\|1703851_1704571_-	hypothetical protein	NA	NA	NA	NA
WP_003627067.1\|1704826_1706164_-	type I glutamate--ammonia ligase	NA	NA	NA	NA
WP_003627072.1\|1707924_1708845_-\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_003627073.1\|1708923_1709325_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_003627075.1\|1709383_1709611_-	YqgQ family protein	NA	NA	NA	NA
WP_003629612.1\|1709611_1710292_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_003627079.1\|1710312_1710873_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_003548272.1\|1710935_1711085_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_003629615.1\|1711160_1713269_-	penicillin-binding protein 2	NA	NA	NA	NA
WP_020829334.1\|1713359_1715951_+	YfhO family protein	NA	NA	NA	NA
WP_003627087.1\|1716058_1716982_+	N-acetylglucosamine kinase	NA	NA	NA	NA
WP_096001395.1\|1717194_1718460_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.8e-52	43.4
WP_003627088.1\|1718515_1718812_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_020829335.1\|1718780_1719122_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_003627090.1\|1719308_1720223_-	L-lactate dehydrogenase	NA	NA	NA	NA
WP_003627091.1\|1720286_1720763_-	transcription elongation factor GreA	NA	NA	NA	NA
WP_003627092.1\|1720839_1723254_-\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_003627093.1\|1723257_1724307_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2K9L3A8	Tupanvirus	5.3e-34	37.3
WP_003629630.1\|1724591_1724942_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003627096.1\|1725053_1725821_-	RNA methyltransferase	NA	NA	NA	NA
WP_003627098.1\|1725918_1726191_+	acylphosphatase	NA	NA	NA	NA
WP_023192386.1\|1726237_1727200_+	membrane protein insertase YidC	NA	NA	NA	NA
WP_012212116.1\|1727247_1727736_+\|tRNA	aminoacyl-tRNA deacylase	NA	NA	NA	NA
WP_012212117.1\|1727772_1729341_-	HAMP domain-containing protein	NA	NA	NA	NA
WP_003627105.1\|1729318_1730035_-	response regulator transcription factor	NA	NA	NA	NA
WP_041806219.1\|1730197_1730728_-	DUF177 domain-containing protein	NA	NA	NA	NA
WP_003627109.1\|1731613_1732765_-	nucleotidyltransferase	NA	NA	NA	NA
WP_003627111.1\|1732770_1733118_-	ribosome silencing factor	NA	NA	NA	NA
WP_003627112.1\|1733139_1733733_-	bis(5'-nucleosyl)-tetraphosphatase (symmetrical) YqeK	NA	NA	NA	NA
WP_003627113.1\|1733713_1734370_-	nicotinate-nucleotide adenylyltransferase	NA	NA	NA	NA
WP_003627114.1\|1734380_1735490_-	ribosome biogenesis GTPase YqeH	NA	NA	NA	NA
WP_003627115.1\|1735482_1736007_-	YqeG family HAD IIIA-type phosphatase	NA	NA	NA	NA
WP_003627118.1\|1736152_1736509_-	50S ribosomal protein L20	NA	NA	NA	NA
WP_003627120.1\|1736552_1736753_-	50S ribosomal protein L35	NA	NA	NA	NA
WP_080543081.1\|1736774_1737308_-	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	5.2e-14	37.8
WP_003627127.1\|1739283_1740534_-	DUF389 domain-containing protein	NA	NA	NA	NA
WP_012212124.1\|1740540_1740834_-	ACT domain-containing protein	NA	NA	NA	NA
WP_012212288.1\|1742041_1743367_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	G3MB42	Bacillus_virus	2.1e-56	36.3
WP_003627960.1\|1743396_1744005_-\|transposase	IS607 family transposase	A0A1V0SJI5	Klosneuvirus	1.5e-33	43.2
WP_023192349.1\|1744195_1744726_-	hypothetical protein	NA	NA	NA	NA
WP_003627133.1\|1744877_1745399_-	hypothetical protein	NA	NA	NA	NA
WP_003627134.1\|1745556_1747491_-\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	1.6e-97	33.4
WP_012212130.1\|1747781_1748690_-	primosomal protein DnaI	S5MU12	Brevibacillus_phage	9.2e-27	28.1
WP_003627136.1\|1748721_1750053_-	DnaD domain protein	NA	NA	NA	NA
WP_003627138.1\|1750055_1750523_-	transcriptional repressor NrdR	NA	NA	NA	NA
WP_003627139.1\|1750525_1751128_-	dephospho-CoA kinase	NA	NA	NA	NA
WP_003627142.1\|1751124_1751955_-	DNA-formamidopyrimidine glycosylase	A0A127AWE5	Bacillus_phage	7.1e-18	25.9
WP_020829340.1\|1751963_1754627_-	DNA polymerase I	F8WQ35	Bacillus_phage	2.9e-60	31.0
WP_023192420.1\|1755100_1756150_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	6.0e-46	35.1
WP_006351611.1\|1756198_1756666_-	hypothetical protein	NA	NA	NA	NA
WP_003630969.1\|1758638_1760114_-	FAD-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	1.2e-20	24.2
WP_051356297.1\|1760131_1760812_-	FMN-binding protein	A0A2P0ZL82	Lactobacillus_phage	9.7e-05	33.0
WP_158648811.1\|1760804_1761593_-	FAD-binding protein	NA	NA	NA	NA
WP_003630977.1\|1761546_1761963_-	FAD-binding protein	NA	NA	NA	NA
WP_020829343.1\|1761975_1763796_-	FAD-dependent oxidoreductase	M1HTN0	Paramecium_bursaria_Chlorella_virus	4.9e-11	23.0
WP_080669027.1\|1763902_1764340_-	LysR family transcriptional regulator substrate-binding protein	NA	NA	NA	NA
WP_003630753.1\|1764356_1764764_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	3.9e-09	35.1
WP_020829345.1\|1764807_1768260_-	DEAD/DEAH box helicase family protein	A0A2K5B2B9	Erysipelothrix_phage	1.6e-34	24.5
WP_023192424.1\|1768259_1771736_-	hypothetical protein	A0A1B1IUC6	uncultured_Mediterranean_phage	3.7e-15	21.5
WP_006351623.1\|1771871_1773233_-	hypothetical protein	NA	NA	NA	NA
WP_003631453.1\|1773306_1773636_-	hypothetical protein	NA	NA	NA	NA
WP_003629695.1\|1776227_1776881_-	flavodoxin	NA	NA	NA	NA
WP_041806220.1\|1776973_1778680_-\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	4.6e-88	36.9
WP_013854585.1\|1779003_1780233_+\|transposase	IS110-like element ISLhe4 family transposase	A0A1X9I619	Streptococcus_phage	1.8e-65	38.4
WP_003629702.1\|1780499_1781381_-	SPFH domain-containing protein	NA	NA	NA	NA
WP_003629705.1\|1781398_1781713_-	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_003627170.1\|1782119_1783097_-\|bacteriocin	class III bacteriocin	NA	NA	NA	NA

DBSCAN-SWA_17

1833610 : 1906473

Staphylococcus_phage(26.67%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041806265.1\|1833610_1834780_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_012212173.1\|1834990_1835791_-	ABC-2 family transporter protein	NA	NA	NA	NA
WP_080669039.1\|1835771_1836470_-	ABC-2 family transporter protein	NA	NA	NA	NA
WP_041806223.1\|1836588_1837767_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_003629872.1\|1837944_1838928_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	4.8e-13	26.8
WP_020829361.1\|1838927_1839539_-	WbqC family protein	NA	NA	NA	NA
WP_003629876.1\|1839528_1839801_-	hypothetical protein	NA	NA	NA	NA
WP_003629878.1\|1839948_1840218_-	hypothetical protein	NA	NA	NA	NA
WP_020829363.1\|1840220_1840739_-	NUDIX hydrolase	NA	NA	NA	NA
WP_003627244.1\|1840811_1841723_-	class II fructose-bisphosphate aldolase family protein	NA	NA	NA	NA
WP_020829364.1\|1841833_1843519_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	3.5e-72	31.4
WP_003629886.1\|1843858_1844038_-	hypothetical protein	NA	NA	NA	NA
WP_020829365.1\|1844050_1844662_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_035509258.1\|1844729_1845284_+	phenolic acid decarboxylase	NA	NA	NA	NA
WP_020829367.1\|1845330_1845828_+	PadR family transcriptional regulator	NA	NA	NA	NA
WP_003627252.1\|1845901_1846576_-	L,D-transpeptidase	NA	NA	NA	NA
WP_003627254.1\|1846702_1847551_-	NAD(P)H-hydrate dehydratase	NA	NA	NA	NA
WP_003627256.1\|1847552_1848848_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	2.5e-17	28.0
WP_003629897.1\|1849147_1849456_+	PspC domain-containing protein	NA	NA	NA	NA
WP_003629909.1\|1850004_1850304_+	hypothetical protein	NA	NA	NA	NA
WP_023192483.1\|1850364_1850718_-	DsbA family protein	NA	NA	NA	NA
WP_080543082.1\|1851025_1851973_-	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	5.7e-80	49.2
WP_035164034.1\|1852101_1852959_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_003627267.1\|1853033_1853684_-	metalloregulator ArsR/SmtB family transcription factor	NA	NA	NA	NA
WP_003629914.1\|1853673_1854006_-	thiol reductase thioredoxin	NA	NA	NA	NA
WP_012212186.1\|1853992_1854145_-	hypothetical protein	NA	NA	NA	NA
WP_023192452.1\|1854305_1854980_-	hypothetical protein	NA	NA	NA	NA
WP_003627272.1\|1855016_1855640_-	hypothetical protein	NA	NA	NA	NA
WP_023192453.1\|1855782_1856466_-	hypothetical protein	NA	NA	NA	NA
WP_172412565.1\|1856538_1856934_-	hypothetical protein	NA	NA	NA	NA
WP_023192454.1\|1857845_1858301_-	SLAP domain-containing protein	NA	NA	NA	NA
WP_020829370.1\|1859568_1861215_-	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_172644374.1\|1861308_1863726_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	65.9
WP_003627284.1\|1864011_1864674_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_041806224.1\|1865342_1866584_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0P0IJS6	Lactobacillus_phage	1.7e-119	57.5
WP_020829372.1\|1867352_1868813_-	MFS transporter	S4TR35	Salmonella_phage	4.9e-06	24.2
WP_003629925.1\|1868831_1870031_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	1.8e-139	67.0
WP_020829373.1\|1870447_1871371_-	zinc ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_187289108.1\|1876918_1877089_-	hypothetical protein	NA	NA	NA	NA
WP_003627921.1\|1877340_1877799_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	2.1e-43	57.4
WP_003627920.1\|1877811_1880151_-	ribonuclease R	Q0GXV6	Lactococcus_phage	2.1e-83	35.6
WP_003632304.1\|1880225_1880459_-	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_003627918.1\|1880525_1882583_-	LTA synthase family protein	W6LM83	Streptococcus_phage	7.9e-143	45.7
WP_020829374.1\|1882658_1883702_-	flippase-like domain-containing protein	NA	NA	NA	NA
WP_003632302.1\|1883701_1884745_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_003627915.1\|1884758_1885922_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_080669028.1\|1895462_1896416_+	NAD(P)/FAD-dependent oxidoreductase	A0A2K9L162	Tupanvirus	2.0e-16	28.6
WP_012211470.1\|1896424_1897075_+	VTT domain-containing protein	NA	NA	NA	NA
WP_003632181.1\|1897088_1897697_-	TIGR01906 family membrane protein	NA	NA	NA	NA
WP_003632178.1\|1897693_1898473_-	TIGR01457 family HAD-type hydrolase	NA	NA	NA	NA
WP_003627734.1\|1898469_1899096_-	YutD family protein	NA	NA	NA	NA
WP_003627735.1\|1899079_1900471_-	bifunctional metallophosphatase/5'-nucleotidase	S4VPC4	Pandoravirus	9.5e-07	22.6
WP_003632174.1\|1900485_1900806_-	hypothetical protein	NA	NA	NA	NA
WP_003627739.1\|1902349_1903351_-	substrate-binding domain-containing protein	C6ZCU4	Enterobacteria_phage	1.8e-20	26.3
WP_003627740.1\|1903497_1904604_+	aminopeptidase P family protein	NA	NA	NA	NA
WP_041806225.1\|1904769_1906473_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	1.3e-87	36.7

DBSCAN-SWA_18

1927177 : 2003549

uncultured_virus(11.11%)

integrase,tRNA,transposase

attL 1928303:1928319|attR 1976570:1976586

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003627765.1\|1927177_1928194_-	Holliday junction branch migration DNA helicase RuvB	B3GAM6	uncultured_virus	7.4e-09	32.5
WP_003627766.1\|1928242_1928833_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
1928303:1928319	attL	NA	NA	NA	NA
WP_020829378.1\|1928833_1930744_-	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	3.4e-55	29.7
WP_003627768.1\|1930743_1933341_-	DNA mismatch repair protein MutS	F2QAF7	Pyramimonas_orientalis_virus	7.1e-40	25.2
WP_003627769.1\|1933501_1935124_-	chaperonin GroEL	A0A240F766	uncultured_virus	2.9e-156	53.8
WP_003627770.1\|1935177_1935462_-	co-chaperone GroES	A0A221S304	uncultured_virus	1.2e-12	40.7
WP_080669033.1\|1935698_1936307_-\|integrase	site-specific integrase	Q938N9	Temperate_phage	5.9e-30	41.8
WP_035509739.1\|1937395_1938151_-	hypothetical protein	NA	NA	NA	NA
WP_020829381.1\|1938537_1943514_-	S8 family serine peptidase	A0A1B0T6A2	Bacillus_phage	6.6e-18	27.5
WP_044000225.1\|1945474_1946491_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.3e-45	35.2
WP_035509743.1\|1946712_1947252_-	hypothetical protein	NA	NA	NA	NA
WP_003631549.1\|1947787_1948081_-	hypothetical protein	NA	NA	NA	NA
WP_003631547.1\|1950263_1951010_-	hypothetical protein	NA	NA	NA	NA
WP_003631546.1\|1951006_1951465_-	LytTR family transcriptional regulator	NA	NA	NA	NA
WP_003625963.1\|1951604_1952252_-	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_020829385.1\|1952426_1954340_+	ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	3.5e-60	30.7
WP_003630831.1\|1957508_1958696_+	CoA transferase	NA	NA	NA	NA
WP_003625939.1\|1960764_1961475_-	GntR family transcriptional regulator	A0A291LID1	Streptomyces_phage	6.3e-07	39.4
WP_003631340.1\|1961467_1962439_-	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_023191613.1\|1962448_1962637_-	deoxyribose-phosphate aldolase	NA	NA	NA	NA
WP_096001379.1\|1962774_1963788_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q5ULQ4	Lactobacillus_virus	1.1e-84	45.4
WP_023061461.1\|1964489_1965539_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.1e-50	35.2
WP_003631539.1\|1965562_1966135_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_003625928.1\|1966118_1966853_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_003625927.1\|1966877_1967396_-	folate family ECF transporter S component	NA	NA	NA	NA
WP_003625925.1\|1967437_1968172_-	acyl-ACP thioesterase	NA	NA	NA	NA
WP_003625923.1\|1968174_1969029_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	2.3e-64	47.7
WP_012211424.1\|1969030_1969381_-	DNA replication initiation control protein YabA	NA	NA	NA	NA
WP_003625921.1\|1969391_1970249_-	DNA polymerase III subunit delta	M1NSC1	Streptococcus_phage	3.9e-19	29.2
WP_003631537.1\|1970249_1970570_-	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_003631536.1\|1970581_1971220_-	dTMP kinase	M1PSC7	Streptococcus_phage	3.6e-54	51.0
WP_003631535.1\|1971323_1971569_-	YaaL family protein	NA	NA	NA	NA
WP_003631534.1\|1971568_1972168_-	recombination protein RecR	NA	NA	NA	NA
WP_003625916.1\|1972168_1972504_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_020829387.1\|1972536_1974324_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	2.0e-49	39.7
WP_003631532.1\|1974518_1975025_-	nucleoside deaminase	S4VYZ2	Pandoravirus	1.2e-07	39.5
WP_003631531.1\|1975014_1975644_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_003625909.1\|1976545_1976908_-	50S ribosomal protein L7/L12	NA	NA	NA	NA
1976570:1976586	attR	NA	NA	NA	NA
WP_003625908.1\|1976958_1977471_-	50S ribosomal protein L10	NA	NA	NA	NA
WP_003625900.1\|1979065_1979743_-	phosphate signaling complex protein PhoU	NA	NA	NA	NA
WP_003625899.1\|1979759_1980515_-	phosphate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.0e-15	27.5
WP_003625897.1\|1980516_1981311_-	phosphate ABC transporter ATP-binding protein	F2Y302	Organic_Lake_phycodnavirus	1.0e-13	33.5
WP_003625895.1\|1981321_1982209_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_003625892.1\|1982210_1983206_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_012211417.1\|1983209_1984076_-	phosphate ABC transporter substrate-binding protein	M1PR58	Cyanophage	4.2e-05	22.6
WP_041806228.1\|1985159_1986413_+\|transposase	ISL3 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.0e-08	21.6
WP_003625887.1\|1986554_1987247_-	50S ribosomal protein L1	NA	NA	NA	NA
WP_003625885.1\|1987329_1987755_-	50S ribosomal protein L11	NA	NA	NA	NA
WP_003625883.1\|1987882_1988440_-	transcription termination/antitermination protein NusG	F5B3X4	Synechococcus_phage	2.3e-12	31.3
WP_003625881.1\|1988547_1988715_-	preprotein translocase subunit SecE	NA	NA	NA	NA
WP_012211413.1\|1988722_1988872_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_003625869.1\|1990797_1992294_-	gluconokinase	NA	NA	NA	NA
WP_003549087.1\|1992405_1992624_-	hypothetical protein	NA	NA	NA	NA
WP_003631508.1\|1992698_1993244_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_003631507.1\|1993386_1994139_-	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	NA	NA	NA	NA
WP_003625863.1\|1994125_1994569_-	hypothetical protein	NA	NA	NA	NA
WP_020829388.1\|1994561_1995992_-\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	1.1e-45	29.2
WP_020829389.1\|1996084_1997584_-\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_003631505.1\|1997659_1999036_-	DNA repair protein RadA	A0A2I7QPS8	Vibrio_phage	8.8e-05	24.6
WP_003625858.1\|1999035_1999587_-	dUTP diphosphatase	J9PV85	Bacillus_phage	3.1e-38	48.6
WP_003625857.1\|1999721_2000024_+	hypothetical protein	NA	NA	NA	NA
WP_187289101.1\|2000168_2001428_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q5ULQ4	Lactobacillus_virus	1.7e-119	56.2
WP_041806230.1\|2001791_2003549_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	1.3e-88	37.1

DBSCAN-SWA_19

2057731 : 2149970

Lactobacillus_virus(13.64%)

tRNA,bacteriocin,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003625768.1\|2057731_2060212_-\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A223W0B1	Agrobacterium_phage	1.6e-118	33.4
WP_003625767.1\|2060316_2060772_-	GAF domain-containing protein	NA	NA	NA	NA
WP_003625766.1\|2061137_2061620_-	hypothetical protein	NA	NA	NA	NA
WP_003631243.1\|2061931_2063482_-\|tRNA	lysine--tRNA ligase	A0A2K9L3L6	Tupanvirus	1.2e-82	35.6
WP_003625761.1\|2063497_2064523_-\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_003625760.1\|2064600_2065491_-	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_003631240.1\|2065543_2067709_-\|protease	ATP-dependent zinc metalloprotease FtsH	A0A0P0BXI2	Ostreococcus_lucimarinus_virus	1.1e-107	41.0
WP_003631238.1\|2067803_2069060_-\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_003625754.1\|2069100_2069463_-	S1 RNA-binding domain-containing protein	NA	NA	NA	NA
WP_003631236.1\|2069462_2069840_-	septum formation initiator family protein	NA	NA	NA	NA
WP_003625749.1\|2069905_2070148_-	RNA-binding S4 domain-containing protein	NA	NA	NA	NA
WP_003625747.1\|2070159_2073657_-	transcription-repair coupling factor	NA	NA	NA	NA
WP_003625746.1\|2073658_2074216_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_003625743.1\|2074350_2075322_+	L-lactate dehydrogenase	NA	NA	NA	NA
WP_020829408.1\|2075499_2076198_+	CBS domain-containing protein	NA	NA	NA	NA
WP_023060818.1\|2076276_2076453_+	hypothetical protein	NA	NA	NA	NA
WP_143441508.1\|2076446_2076797_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_003627958.1\|2076836_2077067_+\|transposase	transposase	NA	NA	NA	NA
WP_003627959.1\|2077041_2078379_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	7.4e-49	34.4
WP_035509290.1\|2078528_2079014_-	hypothetical protein	NA	NA	NA	NA
WP_003631231.1\|2079259_2080390_-	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	1.6e-28	27.7
WP_003625735.1\|2080392_2080749_-	holo-ACP synthase	NA	NA	NA	NA
WP_003625732.1\|2080831_2082343_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	8.6e-70	39.1
WP_003625729.1\|2082356_2083724_-	UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase	NA	NA	NA	NA
WP_003625728.1\|2083850_2084096_-	type B 50S ribosomal protein L31	NA	NA	NA	NA
WP_014562912.1\|2084258_2085665_-\|transposase	ISLre2 family transposase	NA	NA	NA	NA
WP_003625726.1\|2085888_2086719_+	HAD family hydrolase	NA	NA	NA	NA
WP_096001381.1\|2086905_2088135_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q5ULQ4	Lactobacillus_virus	4.3e-120	56.2
WP_023192599.1\|2088434_2089511_-	SLAP domain-containing protein	NA	NA	NA	NA
WP_158648612.1\|2089606_2090563_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_035509730.1\|2090951_2091815_+	Rgg/GadR/MutR family transcriptional regulator	NA	NA	NA	NA
WP_187289102.1\|2091822_2091975_-	hypothetical protein	NA	NA	NA	NA
WP_003625618.1\|2095161_2096397_-	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	1.2e-101	53.2
WP_041806233.1\|2096767_2097625_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_013854585.1\|2097720_2098950_-\|transposase	IS110-like element ISLhe4 family transposase	A0A1X9I619	Streptococcus_phage	1.8e-65	38.4
WP_041806234.1\|2099273_2100980_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	1.2e-88	37.1
WP_020829412.1\|2101259_2102285_-	hypothetical protein	NA	NA	NA	NA
WP_020829413.1\|2102899_2103532_-	hypothetical protein	NA	NA	NA	NA
WP_041806235.1\|2103642_2104500_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_020829414.1\|2104617_2110149_-	S8 family serine peptidase	A0A217EQY2	Bacillus_phage	1.3e-09	31.9
WP_020829415.1\|2110500_2111406_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_003625614.1\|2112789_2114367_-	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	6.3e-23	34.1
WP_003625612.1\|2114563_2114716_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003625610.1\|2114758_2115052_+	hypothetical protein	NA	NA	NA	NA
WP_096001382.1\|2115551_2116811_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q5ULQ4	Lactobacillus_virus	2.7e-125	57.9
WP_035504367.1\|2117096_2117699_+	hypothetical protein	NA	NA	NA	NA
WP_003625603.1\|2117972_2118551_+	xanthine phosphoribosyltransferase	NA	NA	NA	NA
WP_020829418.1\|2118554_2119829_+	purine permease	Q9KX94	Enterobacteria_phage	1.1e-28	27.9
WP_012211345.1\|2119928_2120753_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003630880.1\|2120833_2122258_+	C69 family dipeptidase	NA	NA	NA	NA
WP_080669042.1\|2122313_2122703_-	HAD-IA family hydrolase	NA	NA	NA	NA
WP_023191958.1\|2122709_2122931_-	HAD hydrolase-like protein	NA	NA	NA	NA
WP_020829419.1\|2123054_2124350_-	UDP-N-acetylglucosamine 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_003625589.1\|2124479_2126099_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	5.6e-136	47.2
WP_003625588.1\|2126216_2126774_-	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
WP_003625587.1\|2126820_2127222_-	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_003625586.1\|2127335_2128700_+	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	1.4e-31	33.1
WP_003630873.1\|2128727_2129003_+	hypothetical protein	NA	NA	NA	NA
WP_020829420.1\|2130031_2131006_-	ribose-phosphate diphosphokinase	A0A2K9L2G2	Tupanvirus	6.6e-47	36.8
WP_003630871.1\|2131246_2132641_-	SLAP domain-containing protein	NA	NA	NA	NA
WP_020829421.1\|2132776_2133793_-	SLAP domain-containing protein	NA	NA	NA	NA
WP_096001383.1\|2134110_2135106_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q5ULQ4	Lactobacillus_virus	6.2e-93	48.9
WP_023191386.1\|2135161_2135593_-	SLAP domain-containing protein	NA	NA	NA	NA
WP_003625577.1\|2136381_2137767_-	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A0G2Y8M0	Acanthamoeba_polyphaga_mimivirus	7.9e-30	34.0
WP_003625576.1\|2137813_2138644_-	pur operon repressor	NA	NA	NA	NA
WP_003625575.1\|2138744_2139002_-	Veg family protein	NA	NA	NA	NA
WP_020829424.1\|2139082_2139958_-	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_003625573.1\|2139947_2140514_-	ribonuclease M5	NA	NA	NA	NA
WP_003625572.1\|2140500_2141268_-	TatD family hydrolase	NA	NA	NA	NA
WP_003625571.1\|2141267_2143244_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	1.1e-98	39.0
WP_020829425.1\|2143336_2146000_-	magnesium-translocating P-type ATPase	M1HXH2	Paramecium_bursaria_Chlorella_virus	6.8e-38	24.6
WP_020829426.1\|2146298_2146907_-	TPM domain-containing protein	NA	NA	NA	NA
WP_003625568.1\|2146896_2147376_-	hypothetical protein	A7KUY9	Bacillus_phage	5.2e-37	59.0
WP_003625567.1\|2147400_2148423_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_003630784.1\|2148547_2149147_+	SOS response-associated peptidase family protein	NA	NA	NA	NA
WP_020829427.1\|2149307_2149970_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_021744

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection