CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_021362	Bacillus paralicheniformis ATCC 9945a, complete sequence	4 crisprs	csa3,WYL,DinG,cas3,DEDDh	2	28	5	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_021362_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_021362_1

57447-57528

Unclear

Consensus_repeat	Method
TGCACGGGCGCATGCATTTGTAC	CRISPRCasFinder

1 spacers

cas3

The CRISPR arrays of NC_021362_1

>merge|NC_021362|1|57447-57528|CRISPRCasFinder
TGCACGGGCGCATGCATTTGTACTTGTAAGGATGACCGCATGCTAAAGGCGCGGCGTCCTGCGCGGGCGCATGCATTTGTAC

>NC_021362|1|1|57447-57528|CRISPRCasFinder
TGCACGGGCGCATGCATTTGTAC	TTGTAAGGATGACCGCATGCTAAAGGCGCGGCGTCC
TGCGCGGGCGCATGCATTTGTAC

Protein	Signature genes	Signature genes Name	Protein_function
NC_021362.1\|WP_020449800.1\|51623_52391_+\|TatD-family-hydrolase	unknown	unknown	gnl\|CDD\|223162
NC_021362.1\|WP_020449806.1\|58520_59354_+\|pur-operon-repressor	unknown	unknown	gnl\|CDD\|236414
NC_021362.1\|WP_003178198.1\|59929_60223_+\|septation-regulator-SpoVG	unknown	unknown	gnl\|CDD\|237321
NC_021362.1\|WP_020449809.1\|61915_62866_+\|ribose-phosphate-diphosphokinase	unknown	unknown	gnl\|CDD\|234929
NC_021362.1\|WP_020449801.1\|52635_53832_+\|G5-and-3D-domain-containing-protein	unknown	unknown	gnl\|CDD\|226111
NC_021362.1\|WP_020449802.1\|53999_54560_+\|ribonuclease-M5	unknown	unknown	gnl\|CDD\|273019
NC_021362.1\|WP_025809574.1\|57594_58464_+\|4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol-kinase	unknown	unknown	gnl\|CDD\|234652
NC_021362.1\|WP_003178189.1\|57113_57299_+\|small,-acid-soluble-spore-protein,-alpha/beta-type	unknown	unknown	gnl\|CDD\|365990
NC_021362.1\|WP_020449807.1\|59371_59749_+\|RidA-family-protein	unknown	unknown	gnl\|CDD\|129116
NC_021362.1\|WP_020449799.1\|49551_51540_+\|methionine--tRNA-ligase	unknown	unknown	gnl\|CDD\|237028
NC_021362.1\|WP_020449811.1\|63689_64256_+\|aminoacyl-tRNA-hydrolase	unknown	unknown	gnl\|CDD\|235457
NC_021362.1\|WP_020449810.1\|62946_63573_+\|50S-ribosomal-protein-L25/general-stress-protein-Ctc	unknown	unknown	gnl\|CDD\|235534
NC_021362.1\|WP_020449808.1\|60524_61895_+\|bifunctional-UDP-N-acetylglucosamine-diphosphorylase/glucosamine-1-phosphate-N-acetyltransferase-GlmU	unknown	unknown	gnl\|CDD\|184643
NC_021362.1\|WP_041817399.1\|47828_48704_+\|16S-rRNA-(cytidine(1402)-2'-O)-methyltransferase	unknown	unknown	gnl\|CDD\|223390
NC_021362.1\|WP_003178210.1\|64312_64543_+\|anti-sigma-F-factor-Fin-family-protein	unknown	unknown	gnl\|CDD\|371314
NC_021362.1\|WP_003178187.1\|56696_56957_+\|Veg-family-protein	unknown	unknown	gnl\|CDD\|226872
NC_021362.1\|WP_020449803.1\|54552_55431_+\|16S-rRNA-(adenine(1518)-N(6)/adenine(1519)-N(6))--dimethyltransferase-RsmA	unknown	unknown	gnl\|CDD\|234708
NC_021362.1\|WP_023855980.1\|55590_56472_+\|sporulation-peptidase-YabG	unknown	unknown	gnl\|CDD\|274322
NC_021362.1\|WP_020449812.1\|64607_68141_+\|transcription-repair-coupling-factor	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|224118
NC_021362.1\|WP_085959887.1\|48753_49044_-\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|224913

Protein	Function_ID	Function_description	E-value
NC_021362.1\|WP_020449800.1\|51623_52391_+\|TatD-family-hydrolase	gnl\|CDD\|223162	COG0084, TatD, Mg-dependent DNase [DNA replication, recombination, and repair].	8.52027e-134
NC_021362.1\|WP_020449806.1\|58520_59354_+\|pur-operon-repressor	gnl\|CDD\|236414	PRK09213, PRK09213, pur operon repressor; Provisional.	0
NC_021362.1\|WP_003178198.1\|59929_60223_+\|septation-regulator-SpoVG	gnl\|CDD\|237321	PRK13259, PRK13259, septation regulator SpoVG.	4.50746e-59
NC_021362.1\|WP_020449809.1\|61915_62866_+\|ribose-phosphate-diphosphokinase	gnl\|CDD\|234929	PRK01259, PRK01259, ribose-phosphate diphosphokinase.	0
NC_021362.1\|WP_020449801.1\|52635_53832_+\|G5-and-3D-domain-containing-protein	gnl\|CDD\|226111	COG3583, COG3583, Uncharacterized protein conserved in bacteria [Function unknown].	3.09343e-88
NC_021362.1\|WP_020449802.1\|53999_54560_+\|ribonuclease-M5	gnl\|CDD\|273019	TIGR00334, Ribonuclease_M5, ribonuclease M5. This family of orthologous proteins shows a weak but significant similarity to the central region of the DnaG-type DNA primase. The region of similarity is termed the Toprim (topoisomerase-primase) domain and is also shared by RecR, OLD family nucleases, and type IA and II topoisomerases. [Transcription, RNA processing].	2.76855e-74
NC_021362.1\|WP_025809574.1\|57594_58464_+\|4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol-kinase	gnl\|CDD\|234652	PRK00128, ipk, 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional.	0
NC_021362.1\|WP_003178189.1\|57113_57299_+\|small,-acid-soluble-spore-protein,-alpha/beta-type	gnl\|CDD\|365990	pfam00269, SASP, Small, acid-soluble spore proteins, alpha/beta type.	8.31803e-05
NC_021362.1\|WP_020449807.1\|59371_59749_+\|RidA-family-protein	gnl\|CDD\|129116	TIGR00004, RutC_family_protein, reactive intermediate/imine deaminase. This protein was described initially as an inhibitor of protein synthesis intiation, then as an endoribonuclease active on single-stranded mRNA, endoribonuclease L-PSP. Members of this family, conserved in all domains of life and often with several members per bacterial genome, appear to catalyze a reaction that minimizes toxic by-products from reactions catalyzed by pyridoxal phosphate-dependent enzymes. [Cellular processes, Other].	2.44736e-69
NC_021362.1\|WP_020449799.1\|49551_51540_+\|methionine--tRNA-ligase	gnl\|CDD\|237028	PRK12267, PRK12267, methionyl-tRNA synthetase; Reviewed.	0
NC_021362.1\|WP_020449811.1\|63689_64256_+\|aminoacyl-tRNA-hydrolase	gnl\|CDD\|235457	PRK05426, PRK05426, peptidyl-tRNA hydrolase; Provisional.	1.45189e-100
NC_021362.1\|WP_020449810.1\|62946_63573_+\|50S-ribosomal-protein-L25/general-stress-protein-Ctc	gnl\|CDD\|235534	PRK05618, PRK05618, 50S ribosomal protein L25/general stress protein Ctc; Reviewed.	3.34025e-67
NC_021362.1\|WP_020449808.1\|60524_61895_+\|bifunctional-UDP-N-acetylglucosamine-diphosphorylase/glucosamine-1-phosphate-N-acetyltransferase-GlmU	gnl\|CDD\|184643	PRK14354, glmU, bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU.	0
NC_021362.1\|WP_041817399.1\|47828_48704_+\|16S-rRNA-(cytidine(1402)-2'-O)-methyltransferase	gnl\|CDD\|223390	COG0313, COG0313, Predicted methyltransferases [General function prediction only].	1.06463e-135
NC_021362.1\|WP_003178210.1\|64312_64543_+\|anti-sigma-F-factor-Fin-family-protein	gnl\|CDD\|371314	pfam10955, DUF2757, Protein of unknown function (DUF2757). Members in this family of proteins are annotated as YabK however currently no function is known.	8.40804e-42
NC_021362.1\|WP_003178187.1\|56696_56957_+\|Veg-family-protein	gnl\|CDD\|226872	COG4466, Veg, Uncharacterized protein conserved in bacteria [Function unknown].	6.55438e-39
NC_021362.1\|WP_020449803.1\|54552_55431_+\|16S-rRNA-(adenine(1518)-N(6)/adenine(1519)-N(6))--dimethyltransferase-RsmA	gnl\|CDD\|234708	PRK00274, ksgA, 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase RsmA.	1.39153e-140
NC_021362.1\|WP_023855980.1\|55590_56472_+\|sporulation-peptidase-YabG	gnl\|CDD\|274322	TIGR02855, Sporulation-specific_protease_YabG, sporulation peptidase YabG. Members of this family are the protein YabG, demonstrated for Bacillus subtilis to be an endopeptidase able to release N-terminal peptides from a number of sporulation proteins, including CotT, CotF, and SpoIVA. It appears to be expressed under control of sigma-K. [Cellular processes, Sporulation and germination].	0
NC_021362.1\|WP_020449812.1\|64607_68141_+\|transcription-repair-coupling-factor	gnl\|CDD\|224118	COG1197, Mfd, Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription].	0
NC_021362.1\|WP_085959887.1\|48753_49044_-\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	gnl\|CDD\|224913	COG2002, AbrB, Regulators of stationary/sporulation gene expression [Transcription].	7.65552e-20

>NC_021362.1|WP_003178189.1|57113_57299_+|small,-acid-soluble-spore-protein,-alpha/beta-type
MGRRRSIMSEEFKNELAKDLGFYDTVKTEGWGGIRARDAGNMVKRAIELAEQHMAQNQQNH
>NC_021362.1|WP_003178187.1|56696_56957_+|Veg-family-protein
MAKTLSDIKRSLDGHLGKRLTLKANGGRRKTIERSGILAETYPSVFVIQLDQDENSFERVSYSYADILTETVELRFSDDKTSSVAL
>NC_021362.1|WP_023855980.1|55590_56472_+|sporulation-peptidase-YabG
MQFKIGDMVVRKSYRRDILFRIIRIDQSANGEPVAVLHGDEVRLIADAYLTDLEMVREAERQMRKREEESRMKESLDLLRQDYKLLHNKHEYRATNQYNNQQQYFHMPGRVLHLDGDSAYLKKCLALYEKIGVPVYGIHCYEKKMSSVIEELIDEYRPDLLVITGHDAYSKQKGDINNLDAYRHSKDFIETVQKARKKIPHLDQLVIFAGACQSHFESLIRAGANFASSPSRVNIHALDPVYIVAKISFTPFMDRINVWEVLRNTLTREKGLGGIETRGVLRIGMPYKTKEND
>NC_021362.1|WP_020449803.1|54552_55431_+|16S-rRNA-(adenine(1518)-N(6)/adenine(1519)-N(6))--dimethyltransferase-RsmA
MNKDIATPIRTKEILNKYGFSFKKSLGQNFLIDTNILDRIVDHAGVTERTGVIEIGPGIGALTEQLAKRAKKVTAFEIDQRLLPILKDTLSPYDNVTVIHQDVLKADVRAVMDEQFQDCDEVMVVANLPYYVTTPIIMKLLEENLPLKGIVVMLQKEVADRMAAKPSTKEYGSLSIAVQFYTEAKTVMNVPKTVFVPQPNVDSAVIRLTLRGEPAVAVQDEAFFFQVVKSSFAQRRKTLFNNLVNNLPNGKENKSKIERALQDSQIDGKRRGESLSIEEFAVLSDRLRAVLL
>NC_021362.1|WP_020449802.1|53999_54560_+|ribonuclease-M5
MKIKEIIVVEGRDDTAKIKSAVDADTIETNGSAIGEDVIKRIRLAQETRGVIILTDPDFPGEKIRKTIAEKVPGCKHAFLPKHLAKPKNKRGIGVEHASLEAIRECLKTVQEEMEATEPEIEARDLIEAGLIGGPLAKQRRERLGEILNIGYTNGKQLQKRLQMFQIKKSDYLSALDVVLREEEHE
>NC_021362.1|WP_020449801.1|52635_53832_+|G5-and-3D-domain-containing-protein
MKKLFSVKLSKSRWILIAAGLLVAGSGTAYGAHELAKQQVTISINGKKQDVRTNAETVGELLKSLDIETRKEDHISPAEDTKLTANTNVEYVAAKPVHFAVDGQEKEIWTTAGTVGKLLKDLNLELAEHDQIEPSVDKEITKDMKLTLQRAFKVTVKDAGKDKDIWTTSTTVADFLKHHKISIKGDDEVKPALDKKLTKDQAIHITRIKKVTDVVEENIPFEVRKKEDDSLEKGKEKVVRDGKHGKLKKHYAVVMKNGKEVSRELVKEETAAESKAKIIAVGTKQAAVATVSANVSRGNQSSGKEFYVSSTAYTASCNGCSGHTATGVNLKNNPGAKVIAVDPSVIPLGSKVHVEGYGYAVAADTGSAIKGRKIDVFFPSKSTAYRWGNKRVKIKVLN
>NC_021362.1|WP_020449800.1|51623_52391_+|TatD-family-hydrolase
MLFDTHAHLNAEQFNEDLEEVIARAKEEKVEHIVVVGFDRPTIKRAMELIEAYDFIYAAIGWHPVDAIDMTDEDLAWIKDLSAHEKVVAIGEMGLDYHWDKSPKDVQKEVFRKQIALAKEVGLPIVIHNRDATEDVVSILREEGAEEVGGIMHCYTGSAEIAQECINMNFYLSFGGPVTFKNAKKPKEVVKQIPNDRLLIETDCPYLTPHPYRGKRNEPSYVKLVAEQIAELKGMTYEEIAAITTENAKKLFGIS
>NC_021362.1|WP_020449799.1|49551_51540_+|methionine--tRNA-ligase
MPQEKNTFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRLRGFDVRYLTGTDEHGQKIQQTAEKENITPQELVDRAAEDIQQLWKKLDISNDDFIRTTEERHKNVIEKVFQKLLDNGDIYLDEYEGWYSIPDETFYTETQLVDVERNEKGEVIGGKSPDSGHPVELIKEESYFFRMGKYADRLLAFYEENPEFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGNPKHVIYVWIDALFNYITALGFNTANDENYQKYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKKVFAHGWLLMKDGKMSKSKGNVVDPVTLIDKYGLDALRYYLLREVPFGSDGVFTPEGFVERINYDLANDLGNLLNRTVAMVNKYFDGRVQSYEGPVTAFDEQLSSFSQKTIEAYEQAIENMEFSVALSSLWQFVSRTNKYIDETAPWVLAKDKDKEKDLQSVMYHLAESLRITAVLLQPFLTQTPEKIFAQLGVTDASLKTWDSIKSFGQLKSVKVQKGEPLFPRLEAEDEVAYIKSKMQGTAPKEEPKQEEKATERLPEITIDDFMSTELRVAEVIHAEPVKKADRLLKLQLDLGFEKRQVVSGIAKHYKPEELVGRKVICVTNLKPVKLRGELSQGMILAGEDNGVLSLAAVDSSLSNGTRIK
>NC_021362.1|WP_085959887.1|48753_49044_-|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein
MNMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQVTGEVSDDNLKLAGGKLVLSPEGAEQIINEIQAQLQSQK
>NC_021362.1|WP_041817399.1|47828_48704_+|16S-rRNA-(cytidine(1402)-2'-O)-methyltransferase
MINRQKSFDQKSDMGMLYLVPTPIGNLEDMTFRAVSVLKEADIIAAEDTRQTKKLCHVYEIETQLVSYHEHNKESSGHKILEWLKEGKNVALVSDAGMPTISDPGAEIVRDFIEMGGYVVPLPGANAALTALIASGIAPQPFFFFGFLDRNKRERKKQLEALKNRHETMIFYESPHRLKETLSAIREVFGNRQIALTRELTKKFEEFIRGSIEEALTWAEQEQVRGEFCLVIEGSREETIEESFWWEHLSEKEHVEHYISEGYHSKEAIKKTAVDRGVPKRKIYDAYHIQN
>NC_021362.1|WP_025809574.1|57594_58464_+|4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol-kinase
MRILEKAPAKINLSLDVRRKRPDGYHEVEMVMTTIDLADRIELTELAEDKVTVSSHNRFVPDDQRNLAYQAAMLMKERYGIKKGVSIFITKVIPVAAGLAGGSSDAAAVFRGLNRLWDLKLSMNELAELGAEIGSDVSFCVHGGTALATGRGEKIRHIETPPHCWVVLAKPTIGVSTAEVYKQLKVDEIEHPDVQGMISAIEEKNFQKMCDKLGNVLESVTLNMHPEVAMIKNQMKRFGADAVLMSGSGPTVFGLVQYESKVQRIYNGLRGFCDQVYAVRMIGEQNELD
>NC_021362.1|WP_020449806.1|58520_59354_+|pur-operon-repressor
MKFRRSGRLVDLTNYLLTHPHVLVPLTFFSERYQSAKSSISEDLTIIKQTFEQQGIGTLQTVPGAAGGVKYIPKVKRDEAEEFVKSLGESLIDSERILPGGYLYLTDILGKPSVLTKAGKIFASAFSDREIDVVMTVATKGIPLAYAVASYLDVPTVVVRKDNKVTEGSTVSINYVSGSSNRIQTMSLAKRNLQTGSRVLIIDDFMKAGGTINGMINLLEEFNAHVAGIGVLVEAQGVKERLVDEYMSLLTLSEIDMKEKKVEIQNGNFQRFFADNE
>NC_021362.1|WP_020449807.1|59371_59749_+|RidA-family-protein
MTKVVQTKEAPAAIGPYSQGIVVNNMFYSSGQIPLTPSGEMVTGDITEQTHQVFRNLKAVLKEANASLETVVKATVFLADMNQFAEVNEVYGQYFDTHKPARSCVEVARLPKDALVEIEVVALVK
>NC_021362.1|WP_003178198.1|59929_60223_+|septation-regulator-SpoVG
MEVTDVRLRRVNTDGRMRAIASITLDHEFVVHDIRVIDGNNGLFVAMPSKRTPDGEFRDIAHPINSSTRGKIQDAVLNEYHRLGDVEEIEYEEAGAS
>NC_021362.1|WP_020449808.1|60524_61895_+|bifunctional-UDP-N-acetylglucosamine-diphosphorylase/glucosamine-1-phosphate-N-acetyltransferase-GlmU
MDKRFAVVLAAGQGTRMKSKLYKVLHPVCGKPMVEHVVDEARKLSLEKLVTIVGHGAEDVKKHLGEKSEYALQAEQLGTAHAVKQAKSILGSEKGTTIVICGDTPLLTAETMEAMLNEHQKKAAKVTILTAVAEDPTGYGRVIRNENGDVAKIVEHKDATDEERLVKEINTGTYCFDNEALFQTIEQVSNDNVQGEYYLPDVIEILKNQGETVAAYQTGNFQETLGVNDRVALSQAEIYMKQRINKRHMGNGVSLIDPDNTYISPEAVIGRDTVIYPGTVIKGRVVIGEDAVIGQNSELENSTIGSRTVIKQSVVVNSEVGDDVTIGPFAHIRPDSKIGNEVRIGNFVEVKKSEFGDRSKASHLSYIGDAEIGTDVNLGCGSITVNYDGKHKFKTKIENGAFIGCNSNLVAPVTIGEGAYVAAGSTITDDVPGRALSIARARQVNKEDYAENIHKK
>NC_021362.1|WP_020449809.1|61915_62866_+|ribose-phosphate-diphosphokinase
MSKYEDDNLKIFSLNSNPGLAKEIADIVGVELGKSSVKRFSDGEVQINIEESIRGCDCYVIQSTSAPVNEHIMELLIMVDALKRASAKTINIVMPYYGYARQDRKARSREPITAKLVANLLETAGATRVIALDLHAPQIQGFFDIPIDHLMGVPILGNYFEEKNFKDVVIVSPDHGGVTRARKLADRLKAPIAIIDKRRPKPNVAEVMNIIGHIEGKTAILIDDIIDTAGTITLAANALVESGAEEVYACCTHPVLSGPAIERIDNSKIKELVVTNSIELPEEKKIAKFKQLSVAPLLAEAIIRVHEKQSVSFLFD
>NC_021362.1|WP_020449810.1|62946_63573_+|50S-ribosomal-protein-L25/general-stress-protein-Ctc
MAILKAEERTDSRRSSLRKIRQSGYVPGVIYGRNLENKSVALDSIELLKILRAEGKNTIINLDINGDQHSVMVTELQTDPLKDSIVHADFKVVDMEAEMEATVPVNLTGEAEGIKQGGVLQQPLYELSVTAKPKNIPQTIEVDISSLEVNDVLTVGDIPSKGDYSYNHEPDEVVASILPPQKQEETEAESAAQDVEEPEKGTEEEKEE
>NC_021362.1|WP_020449811.1|63689_64256_+|aminoacyl-tRNA-hydrolase
MLVFAGLGNPGKTYENTRHNVGFMTIDELSKEWNIPLDKTKFNGQYGIGFVSGKKVLLVKPLTYMNLSGECLRPLLDYYEIPVDNLKVIYDDLDLPTGRIRLRTKGSAGGHNGIKSMIQHLGTTEFNRIRIGIGRPVNGMKIVDYVLGAFTDEEEPVIQEAVRQSAKACEASLEKPFLEVMNEFNAKV
>NC_021362.1|WP_003178210.1|64312_64543_+|anti-sigma-F-factor-Fin-family-protein
MALHYYCRHCGVKVGSLDHSYVNSEQLGFNHLTNDERNDMISYMDNGDLHVKTICEDCQEALERNPDYHQYHSFIQ
>NC_021362.1|WP_020449812.1|64607_68141_+|transcription-repair-coupling-factor
MNNIQSYITKSDDFKSIVNGLNEGLKEQLLAGLSGSARSLFTAALTKETRRPVFLITHNLYQAQKITDDLTGLIKDQPVLLYPVNELISSEIAVASPELRSQRLDVLNRLASGETPIVIAPAAAVRRMLPPVEVWQNSQIRIETGRDIDPEQLLQKLVQMGYERTDMVAAPGEFSIRGGIIDVYSLTEENPVRIELFDTEVDSIRIFNTDDQRSLETRDEVTIGPAKELIVRDEDRQRALEQIDKGLANSLKKLKLDKQKEILDQNIAEDKERLKEGHIGQEMVKYLSYFYERPASLLDYFPKNTLLILDEISRIHEMEDQLQKEEAEWITSLLEEGKILHDTAMSFPFHSLISKQSRPILYYSLFLRHVQHTSPQNIVNVSSKQMQSFHGQMNVLKNEIERFKKSKYTTVFLGDSKERVEKLASVLSDYEIEAAQADQDAALAQGQIYIMEGGLQSGFELPMIKLAVITEEELFKKRVKKQARKQKLTNAERIKSYSELQIGDYVVHVNHGIGKYLGIETLEINGIHKDYLNIHYQGSDKLYVPVDQIDQVQKYVGSEGKEPKLYKLGGSEWKRVKKKVESSVQDIADDLIKLYAEREASKGYAFSPDHEMQREFEAAFPYQETEDQLRSIHEIKRDMEKERPMDRLLCGDVGYGKTEVAIRAAFKAIADGKQVAILVPTTILAQQHYETILERFQDYPINIGLLSRFRTRKEANETIKGLKNGTIDIVIGTHRLLSKDVVYKDLGLLIIDEEQRFGVTHKEKIKRIKANVDVLTLTATPIPRTLHMSMLGVRDLSVIETPPENRFPVQTYVVEYNGALVREAIERELARGGQVYFLYNRVEDIERKAEEVSMLVPDAKVTYAHGKMTENELESVMLNFLEGESDVLVSTTIIETGVDIPNVNTLIVFDADKMGLSQLYQLRGRVGRSNRVAYAYFTYRKDKVLTEVAEKRLQAIKEFTELGSGFKIAMRDLTIRGAGNLLGAQQHGFIDSVGFDLYSQMLKEAIEARKGDVPQAEKFEPEIDLELDAYIPQTYVTDGKQKIDMYKRFRAISTIEEKSELQDEMIDRFGEYPKEVEYLFAIAEAKVYAITERVELIKQDKDAVRLTIDEKASAEIDGQKLFELGSKYGRQIGLGMEGKKLKISIQVKNRNPEEWLETLLEILKGLQNVKKQTIASS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_021362_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_021362_2

897415-902123

Orphan

Consensus_repeat	Method
ACNGGNCCAACNGGNGCNAC	CRT

63 spacers

The CRISPR arrays of NC_021362_2

>merge|NC_021362|2|897415-902123|CRT
ACAGGTCCTACGGGAGCAACAGGTCCAACAGGAGCCACCGGAGCGACAGGACCGACGGGAGCAACCGGAGCGACAGGCCCAACGGGAGCAACTGGTCCAACAGGAGCCACCGGAGCGACAGGCCCAACAGGTCCGACAGGAGCAACAGGCCCAACAGGTCCGACAGGAGCAACAGGCCCAACAGGTCCGACAGGAGCAACAGGAGCAACCGGCCCGACAGGCGCAACTGGATCAACCGGAGCGACAGGTCCAACAGGAGCGACAGGCCCAACCGGGGCAACAGGAGCAACCGGAGTAACAGGTCCAACGGGTTCAACCGGTCCAACCGGAGTAACAGGTCCGACAGGAGCAACAGGCCCAACAGGTCCGACAGGAGCAACAGGCCCAACAGGTCCGACAGGAGCAACAGGAGCAACCGGCCCGACAGGCGCAACTGGATCAACCGGAGCGACAGGTCCAACAGGAGCGACAGGCCCAACCGGGGCAACAGGAGCAACCGGAGTAACAGGCCCAACGGGTTCAACCGGTCCAACCGGAGTAACAGGTCCAACCGGAGTAACAGGTCCAACCGGAGTAACAGGTCCAACCGGAGTAACAGGTCCGACAGGAGCGACAGGCCCGACAGGAGCAACCGGCGCAACGGGAGCGATGGGTCCAACAGGGGCGACAGGACCAACGGGTCCAACCGGAGCCACAGGTCCAACAGGAGTAACCGGGGCAACAGGAGCAACCGGAGCCACAGGCGCAACGGGTCCGACAGGAGCCACAGGAGCGACAGGCCCAACGGGATCAACCGGCCCGACAGGAGCCACAGGCGCAACGGGTCCAACTGGATCAACAGGTCCGACGGGAGCAACCGGGGCAACAGGCGCAACTGGATCAACAGGTCCAACAGGAGTAACCGGGGCAACAGGCGCAACCGGAGTAACTGGTCCAACGGGTCCAACAGGAGTAACCGGAGCCACAGGCGCAACGGGTCCGACAGGAGCAACAGGAGCGACAGGCCCAACGGGATCAACCGGCCCGACCGGAGCAACGGGTCCAACAGGGGCAACAGGCCCAACGGGATCAACCGGAGCGACGGGTCCAACAGGAGCAACCGGTCCGACGGGAGCAACCGGGGCAACAGGAGCAACCGGAGCCACAGGCCCGACGGGATCAACCGGAGCCACAGGCCCAACAGGTCCAACGGGAGCCACAGGCGCAACGGGAGCAACCGGAGCGACAGGCGCAACGGGTCCAACAGGGGCGACAGGACCAACGGGTCCGACAGGAGCGACAGGTCCGACCGGAGTAACCGGGGCAACCGGAGCAACGGGTCCAACAGGAGCAACCGGTGCAACCGGAGCGACAGGTCCAACAGGAGCAACAGGAGCAACCGGAGCCACAGGCCCGACGGGATCAACCGGAGCCACAGGCCCAACAGGTCCAACGGGAGCCACAGGCGCAACGGGAGCGACAGGCGCAACCGGAGTAACTGGTCCAACGGGAGTGACAGGCCCGACAGGAGCAACCGGCGCAACGGGAGCGACGGGTCCAACAGGGGCGACAGGACCAACGGGTCCAACAGGGGCAACAGGCCCAACGGGAGCAACCGGAGCGACGGGTCCAACAGGAGCAACCGGTCCGACGGGAGCAACCGGGGCAACAGGAGCAATCGGAGCCACAGGCCCGACGGGATCAACCGGAGCCACAGGCCCAACAGGTCCAACGGGAGCGACAGGCGCAACGGGAGCAACCGGAGCGACGGGAGCGACAGGCGCAACGGGTCCAACAGGGGCGACAGGACCAACGGGTCCGACAGGAGCGACAGGTCCGACCGGAGTAACCGGGGCAACCGGAGCAACGGGTCCAACAGGAGCAACCGGTGCAACCGGAGCGACAGGTCCAACAGGAGCAACAGGAGCAACCGGAGCCACAGGCCCGACGGGATCAACCGGAGCCACAGGCCCAACAGGTCCAACGGGAGCCACAGGCGCAACGGGAGCGACAGGCGCAACCGGAGTAACTGGTCCAACGGGAGTGACAGGCCCGACAGGAGCAACCGGCGCAACGGGAGCGACGGGTCCAACAGGGGCGACAGGACCAACGGGTCCAACCGGAGCCACAGGTCCAACAGGAGTAACCGGCCCAACAGGAGCAACGGGTCCAACTGGATCAACAGGTCCGACGGGGGCAACCGGGGCCACAGGCGCAACTGGATCAACAGGTCCGACGGGAGCGACAGGTCCAACAGGAGTAACCGGGGCCACAGGCGCAACCGGAGTAACTGGTCCAACGGGTCCAACAGGAGTAACCGGAGCCACGGGAGCGACAGGTCCAACAGGAGCGACGGGAGCCACAGGAGCAACGGGTCCGACAGGAACAACCGGCCCGACCGGAGCAACGGGTCCAACAGGGGCAACAGGCCCAACGGGAGCAACCGGAGCCACAGGCCCAACAGGTCCAACGGGAGCCACAGGCGCAACGGGAGCAACCGGAGCGACGGGAGCGACAGGCGCAACGGGTCCAACAGGGGCGACAGGACCAACGGGTCCGACAGGAGCAACAGGAGCAACCGGAGCAACCGGAGCCACAGGCCCAACAGGTCCAACGGGAGCCACAGGCGCAACGGGAGCGACAGGCGCAACCGGAGTAACTGGTCCAACGGGAGTGACAGGCCCGACAGGAGCAACCGGCGCAACGGGAGCGACGGGTCCAACAGGGGCGACAGGACCAACGGGTCCAACCGGAGCCACAGGTCCAACAGGGGCGACAGGACCAACGGGTCCAACTGGATCAACAGGTCCGACGGGAGCAACCGGGGCCACAGGCGCAACTGGATCAACAGGTCCGACGGGAGCGACAGGTCCAACAGGAGTAACCGGGGCCACAGGCGCAACCGGAGTAACTGGTCCAACGGGTCCAACAGGAGTAACCGGAGCCACGGGAGCGACAGGTCCAACAGGAGCGACGGGAGCCACAGGAGCAACGGGTCCGACAGGAACAACCGGCCCGACCGGAGCAACGGGTCCAACAGGGGCAACAGGCCCAACGGGAGCAACCGGAGCGACGGGTCCAACAGGAGCAACCGGTCCGACGGGAGCAACCGGGGCAACAGGTGCAACTGGATCAACAGGTCCGACGGGAGCGACAGGTCCAATAGGAGCCACGGGAGCGACAGGTCCAACAGGAGCCACGGGAGCGACAGGCCCAACAGGAGCGACAGGCGCAACTGGCCCAACGGGAGCCACAGGCCCAACAGGTCCAACGGGAGCCACAGGCGCAACGGGAGCCACCGGAGCGACGGGAGCGACCGGAGCAACGGGTCCAACAGGGGCAACAGGCCCAACGGGAGCCACCGGAGCGACGGGTCCAACAGGAGCAACCGGTCCGACGGGAGCAACCGGGGCAACAGGTGCAACTGGATCAACAGGTCCGACGGGAGCGACAGGTCCAATAGGAGCCACGGGAGCGACAGGTCCAACGGGTCCAACGGGAGCGACAGGCTCAACAGGCCCAACAGGAGCAACTGGTGCAACCGGAGCGACCGGACCGACGGGAGCGACAGGTCCAACGGGAGCGACAGGACCGACGGGTCCAACGGGAGTGACGGGAGCGACCGGAGCCACCGGCCCGACCGGAGCGACAGGTCCAACAGGAGCAACCGGAGCCACAGGCCCGACGGGATCAACCGGAGCGACAGGCCCAACAGGTCCAACGGGAGCCACAGGTGCAACGGGAGCAACCGGAGCGACCGGAGCAACGGGTCCAACAGGAGCGACAGGTCCGACCGGTCCGACCGGAGTAACCGGGGCAACCGGAGCAACGGGTCCAACAGGAGCGACAGGTCCGACCGGAGTAACCGGGGCAACCGGAGCAACGGGTCCAACAGGACCAACGGGAGCCACAGGAGCAACCGGCCCGACAGGAGCAGCGGGTCCAACAGGACCAACGGGAGCCACAGGAGCAACCGGCCCGACAGGAGCAGCGGGTCCAACCGGAGCGACAGGCCCAACGGGAGCAACCGGCCCGACAGGAGCAACGGGTCCAACCGGAGCCACAGGTCCAACAGGAGTAACCGACCCAACAGGAGCAACCGGTCCAACAGGAGTAACCGGGGCAACGGGAGCCACCGGAGCGACGGGAGCCACAGGCGCAACGGGTCCAACAGGGGCGACAGGAGCAACGGGTCCAACCGGAGCGACAGGTCCAACAGGAGTAACCGGGGCAACGGGAGCGACGGGTCCAACAGGGGCAACCGGAGCAACGGGTCCAACCGGAGCGACAGGTCCAACAGGAGTAACCGGGGCAACGGGAGCCACCGGAGCGACGGGAGCCACAGGCGCAACGGGAGCGACGGGTCCAACAGGGGCGACAGGACCAACGGGTCCAACCGGAGCGACAGGTCCAACAGGAGTAACCGGGGCAACGGGAGCGACGGGTCCAACAGGGGCGACAGGAGCAACGGGTCCAACCGGAGCGACAGGTCCAACAGGAGTAACCGGGGCGACAGGAGCAACGGGTCCAACAGGGGCAACAGGACCAACGGGTCCAACAGGAGCCACAGGTCCAACAGGAGTAACCGGGGCAACCGGAGCAACGGGTCCAACCGGAGCAACGGGAGCGACAGGTCCAACAGGAGCAACCGGCCCAACAGGTCCACAGGGTCCGACGGGTCCGCCGGGTGAAGTAGGAGTAATGGTAGTAGCTGGTCCAACCGGCCCAAC

>NC_021362|2|1|897415-902123|CRT
ACAGGTCCTACGGGAGCAAC	AGGTCCAACAGGAGCCACCGGAGCGACAGGACCGACGGGAGCAACCGGAGCGACAGGCCCAACGGGAGCAACTGGTCCAACAGGAGCCACCGGAGCGACAGGCCCA
ACAGGTCCGACAGGAGCAAC	AGGCCCAACAGGTCCGACAGGAGCAACAGGCCCAACAGGTCCGACAGGAGCAACAGGAGCAACCGGCCCGACAGGCGCAACTGGATCAACCGGAGCGACAGGTCCAACAGGAGCGACAGGCCCA
ACCGGGGCAACAGGAGCAAC	CGGAGTAACAGGTCCAACGGGTTCAACCGGTCCAACCGGAGTAACAGGTCCGACAGGAGCAACAGGCCCAACAGGTCCGACAGGAGCAACAGGCCCAACAGGTCCG
ACAGGAGCAACAGGAGCAAC	CGGCCCGACAGGCGCAACTGGATCAACCGGAGCGACAGGTCCAACAGGAGCGACAGGCCCAACCGGGGCAACAGGAGCAACCGGAGTAACAGGCCCAACGGGTTCAACCGGTCCA
ACCGGAGTAACAGGTCCAAC	CGGAGTAACAGGTCCAACCGGAGTAACAGGTCCAACCGGAGTAACAGGTCCGACAGGAGCGACAGGCCCGACAGGAGCAACCGGCGCAACGGGAGCGATGGGTCCAACAGGGGCG
ACAGGACCAACGGGTCCAAC	CGGAGCCACAGGTCCAACAGGAGTAACCGGGGCAACAGGAGCAACCGGAGCCACAGGCGCAACGGGTCCGACAGGAGCCACAGGAGCG
ACAGGCCCAACGGGATCAAC	CGGCCCGACAGGAGCCACAGGCGCAACGGGTCCAACTGGATCAACAGGTCCGACGGGAGCAACCGGGGCAACAGGCGCAACTGGATCA
ACAGGTCCAACAGGAGTAAC	CGGGGCAACAGGCGCAACCGGAGTAACTGGTCCAACGGGTCCAACAGGAGTAACCGGAGCCACAGGCGCA
ACGGGTCCGACAGGAGCAAC	AGGAGCGACAGGCCCAACGGGATCAACCGGCCCGACCGGAGCAACGGGTCCAACAGGGGCAACAGGCCCAACGGGATCAACCGGAGCG
ACGGGTCCAACAGGAGCAAC	CGGTCCGACGGGAGCAACCGGGGCAACAGGAGCAACCGGAGCCACAGGCCCGACGGGATCAACCGGAGCCACAGGCCCA
ACAGGTCCAACGGGAGCCAC	AGGCGCAACGGGAGCAACCGGAGCGACAGGCGCAACGGGTCCAACAGGGGCGACAGGACCA
ACGGGTCCGACAGGAGCGAC	AGGTCCGACCGGAGTAACCGGGGCAACCGGAGCAACGGGTCCAACAGGAGCAACCGGTGCAACCGGAGCG
ACAGGTCCAACAGGAGCAAC	AGGAGCAACCGGAGCCACAGGCCCGACGGGATCAACCGGAGCC
ACAGGCCCAACAGGTCCAAC	GGGAGCCACAGGCGCAACGGGAGCGACAGGCGCAACCGGAGTAACTGGTCCAACGGGAGTG
ACAGGCCCGACAGGAGCAAC	CGGCGCAACGGGAGCGACGGGTCCAACAGGGGCGACAGGACCA
ACGGGTCCAACAGGGGCAAC	AGGCCCAACGGGAGCAACCGGAGCGACGGGTCCAACAGGAGCAACCGGTCCG
ACGGGAGCAACCGGGGCAAC	AGGAGCAATCGGAGCCACAGGCCCGACGGGATCAACCGGAGCCACAGGCCCAACAGGTCCA
ACGGGAGCGACAGGCGCAAC	GGGAGCAACCGGAGCGACGGGAGCGACAGGCGCAACGGGTCCAACAGGGGCGACAGGACCAACGGGTCCG
ACAGGAGCGACAGGTCCGAC	CGGAGTAACCGGGGCAACCGGAGCAACGGGTCCAACAGGAGCAACCGGTGCA
ACCGGAGCGACAGGTCCAAC	AGGAGCAACAGGAGCAACCGGAGCCACAGGCCCGACGGGATCA
ACCGGAGCCACAGGCCCAAC	AGGTCCAACGGGAGCCACAGGCGCAACGGGAGCGACAGGCGCA
ACCGGAGTAACTGGTCCAAC	GGGAGTGACAGGCCCGACAGGAGCAACCGGCGCAACGGGAGCGACGGGTCCAACAGGGGCG
ACAGGACCAACGGGTCCAAC	CGGAGCCACAGGTCCAACAGGAGTAACCGGCCCAACAGGAGCAACGGGTCCA
ACTGGATCAACAGGTCCGAC	GGGGGCAACCGGGGCCACAGGCGCAACTGGATCAACAGGTCCGACGGGAGCGACAGGTCCAACAGGAGTAACCGGGGCCACAGGCGCA
ACCGGAGTAACTGGTCCAAC	GGGTCCAACAGGAGTAACCGGAGCCACGGGAGCGACAGGTCCAACAGGAGCGACGGGAGCC
ACAGGAGCAACGGGTCCGAC	AGGAACAACCGGCCCGACCGGAGCAACGGGTCCAACAGGGGCAACAGGCCCAACGGGAGCAACCGGAGCC
ACAGGCCCAACAGGTCCAAC	GGGAGCCACAGGCGCAACGGGAGCAACCGGAGCGACGGGAGCG
ACAGGCGCAACGGGTCCAAC	AGGGGCGACAGGACCAACGGGTCCGACAGGAGCAACAGGAGCAACCGGAGCAACCGGAGCC
ACAGGCCCAACAGGTCCAAC	GGGAGCCACAGGCGCAACGGGAGCGACAGGCGCAACCGGAGTAACTGGTCCAACGGGAGTG
ACAGGCCCGACAGGAGCAAC	CGGCGCAACGGGAGCGACGGGTCCA
ACAGGGGCGACAGGACCAAC	GGGTCCAACCGGAGCCACAGGTCCAACAGGGGCGACAGGACCAACGGGTCCAACTGGATCA
ACAGGTCCGACGGGAGCAAC	CGGGGCCACAGGCGCAACTGGATCAACAGGTCCGACGGGAGCG
ACAGGTCCAACAGGAGTAAC	CGGGGCCACAGGCGCAACCGGAGTAACTGGTCCA
ACGGGTCCAACAGGAGTAAC	CGGAGCCACGGGAGCGACAGGTCCAACAGGAGCG
ACGGGAGCCACAGGAGCAAC	GGGTCCGACAGGAACAACCGGCCCGACCGGAGCAACGGGTCCAACAGGGGCA
ACAGGCCCAACGGGAGCAAC	CGGAGCGACGGGTCCAACAGGAGCA
ACCGGTCCGACGGGAGCAAC	CGGGGCAACAGGTGCAACTGGATCA
ACAGGTCCGACGGGAGCGAC	AGGTCCAATAGGAGCCACGGGAGCG
ACAGGTCCAACAGGAGCCAC	GGGAGCGACAGGCCCAACAGGAGCGACAGGCGCA
ACTGGCCCAACGGGAGCCAC	AGGCCCAACAGGTCCAACGGGAGCC
ACAGGCGCAACGGGAGCCAC	CGGAGCGACGGGAGCGACCGGAGCAACGGGTCCAACAGGGGCA
ACAGGCCCAACGGGAGCCAC	CGGAGCGACGGGTCCAACAGGAGCA
ACCGGTCCGACGGGAGCAAC	CGGGGCAACAGGTGCAACTGGATCA
ACAGGTCCGACGGGAGCGAC	AGGTCCAATAGGAGCCACGGGAGCGACAGGTCCA
ACGGGTCCAACGGGAGCGAC	AGGCTCAACAGGCCCAACAGGAGCA
ACTGGTGCAACCGGAGCGAC	CGGACCGACGGGAGCGACAGGTCCAACGGGAGCGACAGGACCG
ACGGGTCCAACGGGAGTGAC	GGGAGCGACCGGAGCCACCGGCCCGACCGGAGCG
ACAGGTCCAACAGGAGCAAC	CGGAGCCACAGGCCCGACGGGATCAACCGGAGCGACAGGCCCA
ACAGGTCCAACGGGAGCCAC	AGGTGCAACGGGAGCAACCGGAGCGACCGGAGCA
ACGGGTCCAACAGGAGCGAC	AGGTCCGACCGGTCCGACCGGAGTAACCGGGGCAACCGGAGCA
ACGGGTCCAACAGGAGCGAC	AGGTCCGACCGGAGTAACCGGGGCAACCGGAGCA
ACGGGTCCAACAGGACCAAC	GGGAGCCACAGGAGCAACCGGCCCGACAGGAGCA
GCGGGTCCAACAGGACCAAC	GGGAGCCACAGGAGCAACCGGCCCGACAGGAGCA
GCGGGTCCAACCGGAGCGAC	AGGCCCAACGGGAGCAACCGGCCCGACAGGAGCA
ACGGGTCCAACCGGAGCCAC	AGGTCCAACAGGAGTAACCGACCCAACAGGAGCA
ACCGGTCCAACAGGAGTAAC	CGGGGCAACGGGAGCCACCGGAGCGACGGGAGCCACAGGCGCA
ACGGGTCCAACAGGGGCGAC	AGGAGCAACGGGTCCAACCGGAGCGACAGGTCCAACAGGAGTAACCGGGGCAACGGGAGCG
ACGGGTCCAACAGGGGCAAC	CGGAGCAACGGGTCCAACCGGAGCG
ACAGGTCCAACAGGAGTAAC	CGGGGCAACGGGAGCCACCGGAGCGACGGGAGCCACAGGCGCAACGGGAGCG
ACGGGTCCAACAGGGGCGAC	AGGACCAACGGGTCCAACCGGAGCGACAGGTCCAACAGGAGTAACCGGGGCAACGGGAGCG
ACGGGTCCAACAGGGGCGAC	AGGAGCAACGGGTCCAACCGGAGCGACAGGTCCAACAGGAGTAACCGGGGCGACAGGAGCA
ACGGGTCCAACAGGGGCAAC	AGGACCAACGGGTCCAACAGGAGCCACAGGTCCAACAGGAGTAACCGGGGCAACCGGAGCA
ACGGGTCCAACCGGAGCAAC	GGGAGCGACAGGTCCAACAGGAGCAACCGGCCCAACAGGTCCACAGGGTCCGACGGGTCCGCCGGGTGAAGTAGGAGTAATGGTAGTA
GCTGGTCCAACCGGCCCAAC

Protein	Signature genes	Signature genes Name	Protein_function
NC_021362.1\|WP_020450556.1\|911729_912812_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133005
NC_021362.1\|WP_020450539.1\|884873_885029_-\|hypothetical-protein	unknown	unknown	unknown
NC_021362.1\|WP_020450540.1\|885112_885865_-\|type-I-methionyl-aminopeptidase	unknown	unknown	gnl\|CDD\|237252
NC_021362.1\|WP_020450544.1\|890262_891675_+\|PTS-system-trehalose-specific-EIIBC-component	unknown	unknown	gnl\|CDD\|273916
NC_021362.1\|WP_020450555.1\|909292_911536_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133055
NC_021362.1\|WP_020450558.1\|914039_915104_+\|Gfo/Idh/MocA-family-oxidoreductase	unknown	unknown	gnl\|CDD\|223745
NC_021362.1\|WP_020450548.1\|895098_896703_+\|collagen-like-protein	unknown	unknown	gnl\|CDD\|236090
NC_021362.1\|WP_020450554.1\|907765_909139_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|223515
NC_021362.1\|WP_020450541.1\|885989_887951_-\|LTA-synthase-family-protein	unknown	unknown	gnl\|CDD\|224287
NC_021362.1\|WP_020450553.1\|906724_907699_-\|NAD-dependent-epimerase/dehydratase-family-protein	unknown	unknown	gnl\|CDD\|187566
NC_021362.1\|WP_023855753.1\|894279_894972_+\|N-acetyltransferase	unknown	unknown	gnl\|CDD\|100048
NC_021362.1\|WP_020450557.1\|912933_914043_+\|DegT/DnrJ/EryC1/StrS-family-aminotransferase	unknown	unknown	gnl\|CDD\|99740
NC_021362.1\|WP_020450545.1\|891747_893436_+\|alpha,alpha-phosphotrehalase	unknown	unknown	gnl\|CDD\|274115
NC_021362.1\|WP_020450546.1\|893457_894174_+\|trehalose-operon-repressor	unknown	unknown	gnl\|CDD\|274116
NC_021362.1\|WP_020450551.1\|905076_906168_-\|DegT/DnrJ/EryC1/StrS-family-aminotransferase	unknown	unknown	gnl\|CDD\|99740
NC_021362.1\|WP_041817164.1\|916566_917478_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223999
NC_021362.1\|WP_035339210.1\|906164_906707_-\|transferase	unknown	unknown	gnl\|CDD\|100047
NC_021362.1\|WP_020450543.1\|888661_890074_+\|sodium:alanine-symporter-family-protein	unknown	unknown	gnl\|CDD\|224040
NC_021362.1\|WP_020450542.1\|888213_888591_+\|DUF1992-domain-containing-protein	unknown	unknown	gnl\|CDD\|378159
NC_021362.1\|WP_020450559.1\|915189_916485_+\|nucleotide-sugar-dehydrogenase	unknown	unknown	gnl\|CDD\|274399

Protein	Function_ID	Function_description	E-value
NC_021362.1\|WP_020450556.1\|911729_912812_+\|glycosyltransferase	gnl\|CDD\|133005	cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.	1.16222e-45
NC_021362.1\|WP_041817164.1\|916566_917478_+\|alpha/beta-hydrolase	gnl\|CDD\|223999	COG1073, COG1073, Hydrolases of the alpha/beta superfamily [General function prediction only].	5.52671e-17
NC_021362.1\|WP_020450540.1\|885112_885865_-\|type-I-methionyl-aminopeptidase	gnl\|CDD\|237252	PRK12896, PRK12896, methionine aminopeptidase; Reviewed.	3.57483e-142
NC_021362.1\|WP_020450544.1\|890262_891675_+\|PTS-system-trehalose-specific-EIIBC-component	gnl\|CDD\|273916	TIGR01992, phosphotransferase_system_trehalose_permease, PTS system, trehalose-specific IIBC component. This model represents the fused enzyme II B and C components of the trehalose-specific PTS sugar transporter system. Trehalose is converted to trehalose-6-phosphate in the process of translocation into the cell. These transporters lack their own IIA domains and instead use the glucose IIA protein (IIAglc or Crr). The exceptions to this rule are Staphylococci and Streptococci which contain their own A domain as a C-terminal fusion. This family is closely related to the sucrose transporting PTS IIBC enzymes and the B and C domains of each are described by subfamily-domain level TIGRFAMs models (TIGR00826 and TIGR00852, respectively). In E. coli, B. subtilis and P. fluorescens the presence of this gene is associated with the presence of trehalase which degrades T6P to glucose and glucose-6-P. Trehalose may also be transported (in Salmonella) via the mannose PTS or galactose permease systems, or (in Sinorhizobium, Thermococcus and Sulfolobus, for instance) by ABC transporters.	0
NC_021362.1\|WP_020450555.1\|909292_911536_-\|glycosyltransferase	gnl\|CDD\|133055	cd06433, GT_2_WfgS_like, WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	2.08505e-23
NC_021362.1\|WP_020450558.1\|914039_915104_+\|Gfo/Idh/MocA-family-oxidoreductase	gnl\|CDD\|223745	COG0673, MviM, Predicted dehydrogenases and related proteins [General function prediction only].	9.63477e-70
NC_021362.1\|WP_020450548.1\|895098_896703_+\|collagen-like-protein	gnl\|CDD\|236090	PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated.	2.1221e-09
NC_021362.1\|WP_020450554.1\|907765_909139_-\|glycosyltransferase	gnl\|CDD\|223515	COG0438, RfaG, Glycosyltransferase [Cell envelope biogenesis, outer membrane].	1.94637e-16
NC_021362.1\|WP_020450541.1\|885989_887951_-\|LTA-synthase-family-protein	gnl\|CDD\|224287	COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane].	0
NC_021362.1\|WP_020450553.1\|906724_907699_-\|NAD-dependent-epimerase/dehydratase-family-protein	gnl\|CDD\|187566	cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-epimerase, extended (e) SDRs. This subgroup contains UDP-N-acetylglucosamine 4-epimerase of Pseudomonas aeruginosa, WbpP, an extended SDR, that catalyzes the NAD+ dependent conversion of UDP-GlcNAc and UDPGalNA to UDP-Glc and UDP-Gal. This subgroup has the characteristic active site tetrad and NAD-binding motif of the extended SDRs. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	4.44726e-69
NC_021362.1\|WP_023855753.1\|894279_894972_+\|N-acetyltransferase	gnl\|CDD\|100048	cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain. WcxM is thought to be bifunctional, catalyzing both the isomerization and transacetylation reactions of keto-hexoses. It contains an N-terminal LbH domain responsible for the transacetylation function and a C-terminal isomerase domain. The LbH domain contains imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X), typical of enzymes with acyltransferase activity.	2.25112e-50
NC_021362.1\|WP_020450557.1\|912933_914043_+\|DegT/DnrJ/EryC1/StrS-family-aminotransferase	gnl\|CDD\|99740	cd00616, AHBA_syn, 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn). AHBA_syn family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The members of this CD are involved in various biosynthetic pathways for secondary metabolites. Some well studied proteins in this CD are AHBA_synthase, protein product of pleiotropic regulatory gene degT, Arnb aminotransferase and pilin glycosylation protein. The prototype of this family, the AHBA_synthase, is a dimeric PLP dependent enzyme. AHBA_syn is the terminal enzyme of 3-amino-5-hydroxybenzoic acid (AHBA) formation which is involved in the biosynthesis of ansamycin antibiotics, including rifamycin B. Some members of this CD are involved in 4-amino-6-deoxy-monosaccharide D-perosamine synthesis. Perosamine is an important element in the glycosylation of several cell products, such as antibiotics and lipopolysaccharides of gram-positive and gram-negative bacteria. The pilin glycosylation protein encoded by gene pglA, is a galactosyltransferase involved in pilin glycosylation. Additionally, this CD consists of ArnB (PmrH) aminotransferase, a 4-amino-4-deoxy-L-arabinose lipopolysaccharide-modifying enzyme. This CD also consists of several predicted pyridoxal phosphate-dependent enzymes apparently involved in regulation of cell wall biogenesis. The catalytic lysine which is present in all characterized PLP dependent enzymes is replaced by histidine in some members of this CD.	1.60954e-169
NC_021362.1\|WP_020450545.1\|891747_893436_+\|alpha,alpha-phosphotrehalase	gnl\|CDD\|274115	TIGR02403, Trehalose-6-phosphate_hydrolase, alpha,alpha-phosphotrehalase. Trehalose is a glucose disaccharide that serves in many biological systems as a compatible solute for protection against hyperosmotic and thermal stress. This family describes trehalose-6-phosphate hydrolase, product of the treC (or treA) gene, which is often found together with a trehalose uptake transporter and a trehalose operon repressor.	0
NC_021362.1\|WP_020450546.1\|893457_894174_+\|trehalose-operon-repressor	gnl\|CDD\|274116	TIGR02404, Trehalose_operon_transcriptional_repressor, trehalose operon repressor, B. subtilis-type. This family consists of repressors of the GntR family typically associated with trehalose utilization operons. Trehalose is imported as trehalose-6-phosphate and then hydrolyzed by alpha,alpha-phosphotrehalase to glucose and glucose-6-P. This family includes repressors mostly from Gram-positive lineages and does not include the TreR from E. coli. [Regulatory functions, DNA interactions].	2.87712e-117
NC_021362.1\|WP_020450551.1\|905076_906168_-\|DegT/DnrJ/EryC1/StrS-family-aminotransferase	gnl\|CDD\|99740	cd00616, AHBA_syn, 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn). AHBA_syn family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The members of this CD are involved in various biosynthetic pathways for secondary metabolites. Some well studied proteins in this CD are AHBA_synthase, protein product of pleiotropic regulatory gene degT, Arnb aminotransferase and pilin glycosylation protein. The prototype of this family, the AHBA_synthase, is a dimeric PLP dependent enzyme. AHBA_syn is the terminal enzyme of 3-amino-5-hydroxybenzoic acid (AHBA) formation which is involved in the biosynthesis of ansamycin antibiotics, including rifamycin B. Some members of this CD are involved in 4-amino-6-deoxy-monosaccharide D-perosamine synthesis. Perosamine is an important element in the glycosylation of several cell products, such as antibiotics and lipopolysaccharides of gram-positive and gram-negative bacteria. The pilin glycosylation protein encoded by gene pglA, is a galactosyltransferase involved in pilin glycosylation. Additionally, this CD consists of ArnB (PmrH) aminotransferase, a 4-amino-4-deoxy-L-arabinose lipopolysaccharide-modifying enzyme. This CD also consists of several predicted pyridoxal phosphate-dependent enzymes apparently involved in regulation of cell wall biogenesis. The catalytic lysine which is present in all characterized PLP dependent enzymes is replaced by histidine in some members of this CD.	1.12451e-105
NC_021362.1\|WP_035339210.1\|906164_906707_-\|transferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	6.8726e-37
NC_021362.1\|WP_020450543.1\|888661_890074_+\|sodium:alanine-symporter-family-protein	gnl\|CDD\|224040	COG1115, AlsT, Na+/alanine symporter [Amino acid transport and metabolism].	0
NC_021362.1\|WP_020450542.1\|888213_888591_+\|DUF1992-domain-containing-protein	gnl\|CDD\|378159	pfam09350, DUF1992, Domain of unknown function (DUF1992). This family of proteins are functionally uncharacterized.	9.13129e-19
NC_021362.1\|WP_020450559.1\|915189_916485_+\|nucleotide-sugar-dehydrogenase	gnl\|CDD\|274399	TIGR03026, NDP-sugDHase, nucleotide sugar dehydrogenase. Enzymes in this family catalyze the NAD-dependent alcohol-to-acid oxidation of nucleotide-linked sugars. Examples include UDP-glucose 6-dehydrogenase (1.1.1.22), GDP-mannose 6-dehydrogenase (1.1.1.132), UDP-N-acetylglucosamine 6-dehydrogenase (1.1.1.136), UDP-N-acetyl-D-galactosaminuronic acid dehydrogenase, and UDP-N-acetyl-D-mannosaminuronic acid dehydrogenase. These enzymes are most often involved in the biosynthesis of polysaccharides and are often found in operons devoted to that purpose. All of these enzymes contain three Pfam domains, pfam03721, pfam00984, and pfam03720 for the N-terminal, central, and C-terminal regions respectively.	0

>NC_021362.1|WP_020450548.1|895098_896703_+|collagen-like-protein
MSIQNAVMNGGFETGAFSPWVGINASVTSQFSHSGFFSARFLGGTATSYIAQFVPARAGEGSEFIVSLAKAGFLPAPSITIQVTYFDSQFNFLEYGLFATVPSSRIPAAENGTWLEVYQTTSPAPPGTTQAFILINNIPQAGTASVLVDDVALLSVEGGGGPTGATGPTGATGPTGPTGPTGATGATGPTGSTGPTGATGSTGPTGSTGPTGSTGPTGATGPTGSTGPTGATGATGPTGSTGPTGATGPTGATGPTGVTGPTGSTGATGSTGPTGATGSTGPTGATGATGPTGVTGPTGATGATGSTGPTGATGSTGATGPTGATGATGATGPTGVTGPTGATGPTGATGATGATGPTGATGPTGATGPTGPTGATGPTGVTGPTGATGPTGATGPTGPGSLLGTPAQSTDPVSLTVGSETPILTTTVTSSAGQNIKLDSMAEVDIIIGPATTFEYSIIFTLYRNDVAIAQVSVDSQDEKSAGSVRVYGDIPNLTWVDTPGAGTQTYEVRINVTGTNLLAANVNTRALNAVIFD
>NC_021362.1|WP_023855753.1|894279_894972_+|N-acetyltransferase
MIHETVKIGKNVVLGEQAVIEENVVIGDNVTIGHHAIIKKDTQIGSGVKIGDLAVLGKAASSNKKMARQPKQAGAPLRIEDDAVVGASAVIYRDVLLEKGVFVGDMASIRENVAIGRESIIGRNAMVENNTKIGKRVTIQTGCYITADMTIEDEVFIGPCCSTSNDKYMGMGNYPYQGPTIKRGAKIGNNATLLPAVVIGEHAVIGAGAVITKDVPAGKTAVGNPGRLLK
>NC_021362.1|WP_020450546.1|893457_894174_+|trehalose-operon-repressor
MKINKYMMIYKQIAEQIDQSILNAGDILPSENDLAEQHDTSRETVRKALNVLAQNGYIQKIKGKGSVVLHREKMQFPVSGLVSFKELSETLGKETSTTVHEFGLTHPDAYIQKQLRTSGDEEVWRVVRSRNINGERIILDKDYFIRKHVPLLTKEICEDSIYQYLEGECGLVISYAHKEIVVEPCTAEDQEYLDLNGYEHIVVVKNFVFLDDTTLFQYTESRHRLDKFRFVDFARREK
>NC_021362.1|WP_020450545.1|891747_893436_+|alpha,alpha-phosphotrehalase
METKENPWWKKAVVYQIYPKSFKDTTGNGVGDIRGIIEKLDYIKELACDVIWLTPIYQSPQNDNGYDISDYYNIHEEYGTMADFEELLEEAHKRGIKVIMDLVVNHTSTEHKWFKEAASGKENPYRDFYIWKDMKPDGAPPTNWESKFGGSAWEFHEETGQYYLHLYDVTQADLNWENDEVRKKVYEMMHFWFEKGIDGFRLDVINVISKDQRFPDDDEGDGRRFYTDGPRVHEFLNEMNREVFSKYDSMTVGEMSSTTIADCIRYTNPESRELDMVFNFHHLKADYPNGEKWALADFDFLKLKKILSEWQTEMHKGGGWNALFWCNHDQPRIVSRYGDDGKYRIKSAKMLATAIHMLQGTPYIYQGEELGMTNPKFDDISLYRDVESLNMYRLLKEAGKPEAEIIEILKAKSRDNSRTPVQWNGEKNAGFTTGTPWISVPANYKEINAEKALSDPDSIFYHYKKLNKLRKEFDIITTGDYQLILEDDQALYAYLRNGADEKLLVINNFYGKETEFQLPDDIDIDGYDAKVLISNDTDLPESFTRFKVKPYQSIVYHLAKPC
>NC_021362.1|WP_020450544.1|890262_891675_+|PTS-system-trehalose-specific-EIIBC-component
MTDLNQSARRIVDAVGGADNIAAVTHCVTRLRFALLDESKVNQEVLEQIDVVKGSFSTNGQFQVVIGQGTVNNVYAELVKATGIGESSKDDVKKASEKNMNPLQRAVKTLADIFIPILPAIVTAGLLMGINNILTAQDIFFSGKSIVEVYPEWADLANMINLIAGTAFAFLPALIGWSAVKRFGGNPLLGIVLGVMLVHPDLLNAWGYGAAEQSGEIPVWNLFGLEVQKVGYQGQVLPILLASYLLAKIERFLTKRTPESIQLLVVAPITLLVTGFASFIVIGPVTFAIGNVLTSGLIAVFEQFAVLGGLLYGGLYAALVITGMHHTFLAVDLQLIGSKLGGTFLWPMLALSNIAQGSAALAMMFIVKDEKQKGLSLTSGISAYLGITEPALFGVNLRYRFPFVIAMISSGIAGMFISSQGVLASSVGVGGVPGIFSIMSQYWGAFAIGMAIVLIAPFAGTYLYAKLKMK
>NC_021362.1|WP_020450543.1|888661_890074_+|sodium:alanine-symporter-family-protein
MERLLNWVEYISDWLWGPPLIILLTGTGVYLTILLKFFQFRYPLYIFKQTIGSVGKKPKGEGTVTPLQALTSALSSTVGAANIVGVPAAIMFGGPGAVFWMWLVALFAMAIKFSESVLAVHYREKNEEGEYVGGPMYYITKGLSMKWLGVFFSVALMIELVPSIMVQGNSVSASLAESFSFNRLYTGIGIAFLIGLVVIGGIKRIGKVTELAVPLMAGAYIGAGFLIVVMNLSSVPAFFSLIFSNAFTSSSAFGGFAGAAVAETVRWGFARGLYSNEAGMGTAPIAHAAAMTDHPVRQGFWAVIGIVVDTLLICTTTAFVVLASGVWTAENAASNPGALAAAAFRSYFGPVGGYFVSVSLVFFVLSTITVVIFYGVKQAEFLFGRLAGHMIKFVYLGAVIIGAAGGAKAIWGFLDLALVFILIPNILAVLLLSKKVRSLYDEFFTSEKYYLKDIGQQDCADERDEKVNNL
>NC_021362.1|WP_020450542.1|888213_888591_+|DUF1992-domain-containing-protein
MDFSSIVSEDKIKRAIKDGEFEGLPGMGKPLKKDDAAHVPEHLRMAYRVMKNAGMTGDEGALKKELMTIDDLIAKCADEDERDRLIERKTETRLRLDRLADKKGMFSKPASAFYKEKVYRRLSGK
>NC_021362.1|WP_020450541.1|885989_887951_-|LTA-synthase-family-protein
MKRFIKERGLAFFLIAAILLWLKTYAAYVIEFNLGITNTVQQILLFVNPISSSLFFLGLGLLFKKKIQQTAIIVIHFLMSFLLYANVVYYRFFSDFITLPTIMQAKTNGGQLGDSIFSLMHPLDVLYFIDTFILIGLAVFYNRPSETTTKRPFKIVMGTSVLVFLVNLAVAEIDRPELLTRSFDRNYLVKYLGTYNFTIYDAVQNIKSNSQRALASSSDVTEVENYIKANHDKPNAEYFGKAKGMNVVYISLESLQTFAIDYKIDGKEVTPFLNSLAHDNETFYFDNFFHQTGQGKTSDAEFMMDNSLYPLSQGSVFINKAQNTLQSAPAILKSQGYTSAAFHGNYKTFWNRNEMYKAIGYDKFFDATYYDMSEDKTKNYGLKDKPFFEESMPLLKSLKQPFYTKFITLSNHFPFEMDEGDTDFPAGDTGDSVVDHYFQSANYMDQAIEQFFNDLKKSGLYDNTIVVMYGDHYGISENHNKAMAKVLGKDITPYENAQLQRVPLFIHAPGVKGIKSNKYGGEVDVAPTLLHLMGVNTKDYLMSGSDLLSPEHREIIPFRNGDFVSPEYTKTNGNYYDTKTGELLNEKDIDPNIDESVKKELEMSDKIVDGDLLRFYKPKGFKAINPSDYDYTNHNPKTSESDAAQTTKSDSGQ
>NC_021362.1|WP_020450540.1|885112_885865_-|type-I-methionyl-aminopeptidase
MIVTNDQELEGLKKIGRIVALAREEMKAKAAPGMSTKELDLIGKEVLEAHGAASAPEKEYDFPGTTCISVNDEVAHGIPSESTILKEGDLINIDISAEFGGYYSDTGISFVLGKGDETLHKLCQSAESAFQKGLLQARAGKKQNQIGRAVYNEAKANGFTVIKNLTGHGIGKNLHEAPNHILNYYDPFDNALFKNGTVIALEPFVSTKAEHTIEAGDGWTFKTPDGSFVAQIEHTIVITKNEPIILTQLD
>NC_021362.1|WP_020450539.1|884873_885029_-|hypothetical-protein
MLFAIIGLIFFIESILLIVYAHKKKNGFLKYIGIVLSISIIVMIVTSLTHG
>NC_021362.1|WP_020450551.1|905076_906168_-|DegT/DnrJ/EryC1/StrS-family-aminotransferase
MIRLIEPYITFEEVEAELKEIFSSGILTKGPYVRTFADHIKQYVSAKHAFLTTSATTALSMCLKSLNVQPGDEVIVSDFSFPATVNVIEDLGAKPIFADVDLETFNMLPEELESQITSRTKAVLFVDALGNPTGITNIKHICEAYGLPLVDDAACAMGSSEYGCKSGKIADLTCFSFHPRKLLTTGEGGAITTDREELKDWFSVKLNHGAAISDGQLDFMDFGYNYRLSDIQAALGIKQLQKLDDIIHRRNLQQKAYSEQLEPLGFQSQKIGPDVVHNTQSAVFKIPKNIVRDELIQYLSDCHIESTFGTYCLSGTTYYRRKYRQIKPNSIFLEQNTITLPCHDQVNVEQVVSAIQSFSQRKV
>NC_021362.1|WP_035339210.1|906164_906707_-|transferase
MKQWKSEGKGEFTLSQLGGCGENVVIEDGVRIFHPENIYIGDNVYIGHDTILKGYYKHDLIIGSNSWIGQQCFIHGAGGVTIGEFAGIGPNVRIHAAYHTDPDIPDSTILFSPLTFAPIHIEENCNIGIGASILAGVTIGAHSKIGANAVVNRHIPPYSIAVGVPAKVIKNRRMKDEEPS
>NC_021362.1|WP_020450553.1|906724_907699_-|NAD-dependent-epimerase/dehydratase-family-protein
MSDMTELSGQHIFITGGAGFIGSSLIGKLIERNSVTVYDNFSRDSLRYKPYRDHPHLKVVQGDILDVNTLKKAIQGASHIVHAAGIAGIDTVIQNPVKTMQVNMIGSANLLEAAAGLTECKRVVCFSTSEVFGQIAFRARETSHTVLGAVGEARWTYAVSKLAEEHMAYAYFKKLGLPTVTVRPFNVYGPEQVGEGAIKTMVHRALLDEPIYIHGDGTQIRAWCYVDDMIDGILRCLTMKEAIGESFNIGNERTVITVYGLASTIIRVLGSKSQIIFGEKKEADIELRIPQVNKAKEMLGFSAKVDLEEGITRTAESIRKNLDQ
>NC_021362.1|WP_020450554.1|907765_909139_-|glycosyltransferase
MKDFKSDIIHCLEQKDWNKAMKRLKEWEADGSHNEPDFYFFQASLSVYLGHDHNAWLWLWRGLDLFPDNRSLNLLMGKVCLRTGREKESAAYLQKGDGAETESGPKLDLPVHEKTEPPAGQIRVLQGTMEIANQMNTLAKGLSQHGALAHTLNYYPYYLNYAADYTWSLLKERNTPAMNAKLRRLASDLLPSYDLFHFHFGTSFTLDMSDYPILKQAGKPMIMHHWGSDVRLYSTLAKTNPYAVVKTKNEALIRYHLKRISQYVQHCIVADMELYEYVKDYYEHIHMIPTMIQLDRYIPDYRSNEKPLIVHAPTSPGIKGTRHILKAVESLKEKYDFHFHLVRGVSHEQAKKIYQKADLIIDQLHIGSYGLFAVESMAMGKPVICWVSDFMKEHYPSELPLIRANPDNITEVIENVLKNRDMLPEIGQKGRKYAEVHHDMVKNSKKMLAVYQALLSG
>NC_021362.1|WP_020450555.1|909292_911536_-|glycosyltransferase
MDNELEYLLDSVGLSWRETEISQLIFQHKWHDAAQKLEERLEAAPFDPGLLISAAFVYEKKQQVQRASELYDDALLFVRSEHQHRLMKEKEDLFKKMVRRPKIIFFVKPDLDRFLNAVVERLSGTYRTRKIAVHDLNQIDTGMQWADICWFEWCDDLLIHGSKVPSAAAKTLICRLHSYEAFTFYIKKVYWQAVDQVIFDGEHMREYVLDQVKSLKKEKTAVVPNGINLDEYTFQQRQKGFHIAYVGYINYKKGPMLLLQAFKALIDKDSRYKLFIAGTFQDARYQLYFKQMIDELRLTDSVQFDGWQDDMNQYLEDKHYLICTSLLESQHMSAMEAMAKGIKPLIHNFYGAKTIYDESVVWNTIDEFVAMITSGDYTSLHYRSFIEEHYSYDLSMRKIEEMISGFAKQSELTVMPNPPLITVGIINYNYSNFIDECLQSVLNQLYPNIDILIVDDHSTDDSMQKISSYQKTHPHIRTICHSENTKLPDLAFKEIFQEAKGEYVLLLSADDFLPHNLVLHDFMQCFFGEEGLDYVYGDLLLVDQHGKNAGLWTYQEYGDEELVRTIFQRGGSGIVPMVGMFKASYYQQKGFTWLVDPQKPLAGDVLNCLANTKRGWKRRYLRKPVLCYRRHQNNISYQLHKRIQSLVYVIDYIVKEFDESVYFPHIKWKELEENQRQSLKYFSIGKTFWRMARRYAQNGYTRHLDQDAKKECIQPLLDKMDEYFLLSLASDNQYERYMKNIKKIQLI
>NC_021362.1|WP_020450556.1|911729_912812_+|glycosyltransferase
MVTISLCMIVKNEEEVLARCLDTVKDIVDEINIVDTGSTDQTVEIAKRYTDRVFFFEWIGDFAAARNESFKHATKDYILYLDADDVLLEKDQKKLKELKETLDPSVDSVSMYYDAGTDEFGNVTLRYRRNRLVKREKNFKWKGDCHQYLEVFGNIINADISVTHKKIRHSVGRNLNIYQKKIDRGDTFTPRDYFYYGNELRENRHYEKAIESYNKNIEMKEGWIEDKVYACINKADCHRFLGDLDNELRSLFQSFEFSKTPRAETCSRIGYNFQRRREYNAAIYWYELATTLVPDSNKWSFTYPAYYTWYPHLQMCVCYYNLGDFEKSYQHNEEARKYRPDDKSVLHNKQLLEGKLGINK
>NC_021362.1|WP_020450557.1|912933_914043_+|DegT/DnrJ/EryC1/StrS-family-aminotransferase
MIPLINLKRQFQTVKEDILQEFEHVLDSGQYILGPKVEELEKRIAEKLGVKEAVAVANGTDALVLTLEAFGIGKGDEVITTPFTFFATAEAVSRVGAKPVFADVDRETCNLDPEEIEENITSATKAIIPVHIFGQPADMDEIMAIAKKHGLLVIEDACQAFGASYKGRPVGSIGDAACFSFFPTKNLGTLGDGGMVTISDPDAARQLRTLRTHGTSKKYFHDKIGFNSRLDELHAAALLILLEKIDGWNEQRRKVASRYKKGLKTAEHLTLPAEKEDRTHIYHLYCIGAKDRDEFIQSLKEQNIHSGVYYPCCLHLQTVYSSLQYKKGDFPIAESLSETLFAIPMDPFLAAEEQEQIISALLKKGGGGK
>NC_021362.1|WP_020450558.1|914039_915104_+|Gfo/Idh/MocA-family-oxidoreductase
MTVHFGLIGCGYMSRKHLQALAGCGDAKLSAVSDLQEERMKEAEQYYASFAGDESRMTRYQQYQALLSDSKIEAVIIAAVSGLHAEMAKAALQAGKHVIVEKPMTLSLQDADELIELAEQNGLKLMVCHQMRHRPIMKKLKGTIERGKLGRIYLGTVSLRLNRSPAYYEAATWRGSWEKDGGMLVNQGIHLIDLLQWFLGDVKGVYGDILGGSGAKETEDVAVGVLTFASQAKGVVEANIVTQPNNIGSSLSIFGEHGTISLEGPALNRISRWYIHGEKDAAEEAAQLIDLGGEQTVMYQNFISAVKRQDTLLVDGYEGKKAIETIFGIYQSVLQKQPVQLPLSSFQTSDMKNK
>NC_021362.1|WP_020450559.1|915189_916485_+|nucleotide-sugar-dehydrogenase
MSKQEMHNETIAVIGLGFVGLPLAMLLISKGIRVIGVDLDKKKVEALRKGNSYISDINDQAVQDGIGTGFFRPVSDYGLIGEADAVIICVPTPLNDDAGPDLTYVKRAAQSIGGHLKKGQLVVLESSTYPGTTRDIVKPILEESGLVCGKDFYLAYSPERVDPGNQFPIEVVPKVVGGTTEACLEKVHQLYSGIYEEVVPVTSPETAELTKLLENTYRFINISFINEFAMICDKLGVNVWEVIEAASTKPYGFAAFYPGPGIGGHCIPVDPLYLQFVMKQSGLSSDFIELSEATNDRIVRYIAERSLQLAGKDKATDARILIYGVTYKRNIADVRESKSLDIIEKLIGMGADVSYHDPHVPELDLSGKKLASMPIDSEMLKAYDCVVVLTDHDALPKELLLNHATVIFDTRGVLREAAGKAKVIQLGNGCS
>NC_021362.1|WP_041817164.1|916566_917478_+|alpha/beta-hydrolase
MWIGVLLMVFGIGISIFAVSLIVSYLFVMPNRSTYEETFFSGLKHGEIIDDVFESHDKEELFLTAGDGCRLHALLFPVQKSRKAVIVSHGIKWSLFGGYKYVELFQSIGYNVLLCDSRCHGLSGGSHVSYGFYEKDDLARWADELENRFGKDLWIGVLGESLGAAAAIELMKQDRRIKFCIADSCFSDLTELCRFQLKAAVKLSVPFLIPLASGLIKRRHGWSLADISPVSNLEQSDTPLLIIHGTNDQLVPPEMAKSLYNRKKGIKKLYLIEGAGHVGGFRHDPEEYLSRIKDFLLKIEPAN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_021362_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_021362_3

903268-904858

Orphan

Consensus_repeat	Method
CNACNGGNNCNACNGGNNCAACNGG	CRT

23 spacers

The CRISPR arrays of NC_021362_3

>merge|NC_021362|3|903268-904858|CRT
GAACAGGTCCAACCGGCCCGACAGGTCCAACAGGTCCAACCGGCCCGACTGGAGCAACCGGCCCAACAGGAGCAACCGGCCCGACCGGAGCAACCGGCCCAACAGGAGCAACCGGCCCGACGGGAGCAACCGGCCCAACAGGAGCAACCGGTCCGACGGGAGCAACCGGCCCAACAGGAGCAACCGGCCCGACGGGAGCAACCGGCCCAACAGGTCCAACCGGTCCGACGGGAGCAACCGGTCCGACGGGAGCAACCGGCCCAACAGGTCCAACAGGCGCAACCGGAGCAACAGGCGCAACGGGAGCGACGGGAGCAACCGGCCCAACAGGAGCAACCGGCCCGACGGGAGCAACCGGCCCAACAGGTCCAACAGGCGCAACCGGAGCAACAGGCGCAACGGGAGCGACGGGAGCAACCGGTCCGACGGGAGCAACGGGAGCGACAGGCGCAACCGGAGCAACCGGCCCGACGGGAGCAACCGGCCCGACGGGAGCAACGGGAGCGACAGGCGCAACCGGAGCAACCGGCCCGACAGGCCCAACCGGAGCGACAGGAGCAACCGGTCCGACGGGAGCAACCGGCCCGACAGGAGCAACGGGAGCGACAGGCGCAACAGGTCCGACGGGAGCAACGGGAGCGACAGGCGCAACAGGTCCGACGGGAGCAACCGGCCCAACAGGTCCAACAGGCGCAACCGGAGCGACAGGCGCAACAGGTCCGACGGGAGCAACCGGAGCGACAGGCGCAACCGGAGCGACAGGAGCAACCGGTCCGACAGGAGCAACCGGAGCGACAGGCGCAACCGGAGCGACAGGCGCAACGGGAGCGACAGGCGCAACGGGAGCGACAGGCGCAACGGGAGCGACAGGCGCAACGGGAGCGACAGGAGCAACCGGTCCGACGGGAGCAACGGGAGCGACAGGAGCAACCGGCCCAACAGGTCCGACGGGAGCAACGGGAGCGATAGGAGCAACCGGCCCAACGGGAGCAACGGGAGCGACAGGAGCAACCGGTCCGACGGGAGCAACCGGCCCGACAGGAGCAACGGGAGCGACAGGAGCAACGGGAGCGACAGGAGCAACAGGAGCGACAGGAGCAACCGGCCCAACAGGAGCAACAGGTCCAACAGGAGCAACAGGAGCGACAGGCCCAACAGGTCCGACGGGAGCAACTGGCCCGACAGGAGCAACCGGGGCAACCGGTCCGACAGGAGCAACCGGTCCGACAGGCCCAACCGGAGCAACGGGAGCAACCGGCCCAACGGGAGCAACCGGCCCGACGGGAGCAACAGGTCCGACGGGAGCAACCGGGGCAACCGGAGCAACGGGAGCAACCGGCCCGACGGGAGCAACCGGTCCAACCGGAGCAACGGGAGCGACAGGCGCAACCGGTCCAACAGGTCCAACCGGAGCGACAGGTCCAACCGGCCCAACAGGTCCGACGGGAGCAACCGGTCCAACCGGAGCAACGGGAGCGACAGGTCCAACAGGTCCAACCGGAGCGACAGGTCCAACTGGCCCGACAGGTCCAACTGGCCCGACAGGTCCAACTGGCCCGACGGGTCCAACTGGCCCGACAGGTCCAACTGG

>NC_021362|3|2|903268-904858|CRT
GAACAGGTCCAACCGGCCCGACAGG	TCCAACAGGTCCAACCGGCC
CGACTGGAGCAACCGGCCCAACAGG	AGCAACCGGCCCGACCGGAGCAACCGGCCCAACAGGAGCAACCGGCC
CGACGGGAGCAACCGGCCCAACAGG	AGCAACCGGTCCGACGGGAGCAACCGGCCCAACAGGAGCAACCGGCC
CGACGGGAGCAACCGGCCCAACAGG	TCCAACCGGTCCGACGGGAGCAACCGGTC
CGACGGGAGCAACCGGCCCAACAGG	TCCAACAGGCGCAACCGGAGCAACAGGCGCAACGGGAG
CGACGGGAGCAACCGGCCCAACAGG	AGCAACCGGCCCGACGGGAG
CAACCGGCCCAACAGGTCCAACAGG	CGCAACCGGAGCAACAGGCGCAACGGGAGCGACGGGAG
CAACCGGTCCGACGGGAGCAACGGG	AGCGACAGGCGCAACCGGAGCAACCGGCCCGACGGGAG
CAACCGGCCCGACGGGAGCAACGGG	AGCGACAGGCGCAACCGGAGCAACCGGCCCGACAGGCCCAACCGGAGCGACAGGAG
CAACCGGTCCGACGGGAGCAACCGG	CCCGACAGGAGCAACGGGAGCGACAGGCGCAACAGGTCCGACGGGAGCAACGGGAGCGACAGGCG
CAACAGGTCCGACGGGAGCAACCGG	CCCAACAGGTCCAACAGGCGCAACCGGAGCGACAGGCG
CAACAGGTCCGACGGGAGCAACCGG	AGCGACAGGCGCAACCGGAGCGACAGGAG
CAACCGGTCCGACAGGAGCAACCGG	AGCGACAGGCGCAACCGGAGCGACAGGCG
CAACGGGAGCGACAGGCGCAACGGG	AGCGACAGGCGCAACGGGAGCGACAGGCG
CAACGGGAGCGACAGGAGCAACCGG	TCCGACGGGAGCAACGGGAGCGACAGGAGCAACCGGCCCAACAGGTCCGACGGGAG
CAACGGGAGCGATAGGAGCAACCGG	CCCAACGGGAGCAACGGGAGCGACAGGAGCAACCGGTCCGACGGGAGCAACCGGCCCGACAGGAG
CAACGGGAGCGACAGGAGCAACGGG	AGCGACAGGAGCAACAGGAGCGACAGGAGCAACCGGCCCAACAGGAGCAACAGGTC
CAACAGGAGCAACAGGAGCGACAGG	CCCAACAGGTCCGACGGGAGCAACTGGCCCGACAGGAGCAACCGGGGCAACCGGTC
CGACAGGAGCAACCGGTCCGACAGG	CCCAACCGGAGCAACGGGAGCAACCGGCCCAACGGGAGCAACCGGCC
CGACGGGAGCAACAGGTCCGACGGG	AGCAACCGGGGCAACCGGAGCAACGGGAGCAACCGGCC
CGACGGGAGCAACCGGTCCAACCGG	AGCAACGGGAGCGACAGGCGCAACCGGTCCAACAGGTC
CAACCGGAGCGACAGGTCCAACCGG	CCCAACAGGTCCGACGGGAGCAACCGGTCCAACCGGAGCAACGGGAGCGACAGGTCCAACAGGTC
CAACCGGAGCGACAGGTCCAACTGG	CCCGACAGGTCCAACTGGCCCGACAGGTCCAACTGGCCCGACGGGTC
CAACTGGCCCGACAGGTCCAACTGG

Protein	Signature genes	Signature genes Name	Protein_function
NC_021362.1\|WP_020450556.1\|911729_912812_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133005
NC_021362.1\|WP_041817164.1\|916566_917478_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223999
NC_021362.1\|WP_020450540.1\|885112_885865_-\|type-I-methionyl-aminopeptidase	unknown	unknown	gnl\|CDD\|237252
NC_021362.1\|WP_020450544.1\|890262_891675_+\|PTS-system-trehalose-specific-EIIBC-component	unknown	unknown	gnl\|CDD\|273916
NC_021362.1\|WP_020450555.1\|909292_911536_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133055
NC_021362.1\|WP_020450558.1\|914039_915104_+\|Gfo/Idh/MocA-family-oxidoreductase	unknown	unknown	gnl\|CDD\|223745
NC_021362.1\|WP_020450548.1\|895098_896703_+\|collagen-like-protein	unknown	unknown	gnl\|CDD\|236090
NC_021362.1\|WP_020450554.1\|907765_909139_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|223515
NC_021362.1\|WP_020450541.1\|885989_887951_-\|LTA-synthase-family-protein	unknown	unknown	gnl\|CDD\|224287
NC_021362.1\|WP_020450553.1\|906724_907699_-\|NAD-dependent-epimerase/dehydratase-family-protein	unknown	unknown	gnl\|CDD\|187566
NC_021362.1\|WP_023855753.1\|894279_894972_+\|N-acetyltransferase	unknown	unknown	gnl\|CDD\|100048
NC_021362.1\|WP_020450557.1\|912933_914043_+\|DegT/DnrJ/EryC1/StrS-family-aminotransferase	unknown	unknown	gnl\|CDD\|99740
NC_021362.1\|WP_020450545.1\|891747_893436_+\|alpha,alpha-phosphotrehalase	unknown	unknown	gnl\|CDD\|274115
NC_021362.1\|WP_020450546.1\|893457_894174_+\|trehalose-operon-repressor	unknown	unknown	gnl\|CDD\|274116
NC_021362.1\|WP_051143316.1\|896928_902553_+\|NTTRR-F1-domain	unknown	unknown	gnl\|CDD\|223021
NC_021362.1\|WP_020450551.1\|905076_906168_-\|DegT/DnrJ/EryC1/StrS-family-aminotransferase	unknown	unknown	gnl\|CDD\|99740
NC_021362.1\|WP_035339210.1\|906164_906707_-\|transferase	unknown	unknown	gnl\|CDD\|100047
NC_021362.1\|WP_020450543.1\|888661_890074_+\|sodium:alanine-symporter-family-protein	unknown	unknown	gnl\|CDD\|224040
NC_021362.1\|WP_020450542.1\|888213_888591_+\|DUF1992-domain-containing-protein	unknown	unknown	gnl\|CDD\|378159
NC_021362.1\|WP_020450559.1\|915189_916485_+\|nucleotide-sugar-dehydrogenase	unknown	unknown	gnl\|CDD\|274399

Protein	Function_ID	Function_description	E-value
NC_021362.1\|WP_020450556.1\|911729_912812_+\|glycosyltransferase	gnl\|CDD\|133005	cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.	1.16222e-45
NC_021362.1\|WP_041817164.1\|916566_917478_+\|alpha/beta-hydrolase	gnl\|CDD\|223999	COG1073, COG1073, Hydrolases of the alpha/beta superfamily [General function prediction only].	5.52671e-17
NC_021362.1\|WP_020450540.1\|885112_885865_-\|type-I-methionyl-aminopeptidase	gnl\|CDD\|237252	PRK12896, PRK12896, methionine aminopeptidase; Reviewed.	3.57483e-142
NC_021362.1\|WP_020450544.1\|890262_891675_+\|PTS-system-trehalose-specific-EIIBC-component	gnl\|CDD\|273916	TIGR01992, phosphotransferase_system_trehalose_permease, PTS system, trehalose-specific IIBC component. This model represents the fused enzyme II B and C components of the trehalose-specific PTS sugar transporter system. Trehalose is converted to trehalose-6-phosphate in the process of translocation into the cell. These transporters lack their own IIA domains and instead use the glucose IIA protein (IIAglc or Crr). The exceptions to this rule are Staphylococci and Streptococci which contain their own A domain as a C-terminal fusion. This family is closely related to the sucrose transporting PTS IIBC enzymes and the B and C domains of each are described by subfamily-domain level TIGRFAMs models (TIGR00826 and TIGR00852, respectively). In E. coli, B. subtilis and P. fluorescens the presence of this gene is associated with the presence of trehalase which degrades T6P to glucose and glucose-6-P. Trehalose may also be transported (in Salmonella) via the mannose PTS or galactose permease systems, or (in Sinorhizobium, Thermococcus and Sulfolobus, for instance) by ABC transporters.	0
NC_021362.1\|WP_020450555.1\|909292_911536_-\|glycosyltransferase	gnl\|CDD\|133055	cd06433, GT_2_WfgS_like, WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	2.08505e-23
NC_021362.1\|WP_020450558.1\|914039_915104_+\|Gfo/Idh/MocA-family-oxidoreductase	gnl\|CDD\|223745	COG0673, MviM, Predicted dehydrogenases and related proteins [General function prediction only].	9.63477e-70
NC_021362.1\|WP_020450548.1\|895098_896703_+\|collagen-like-protein	gnl\|CDD\|236090	PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated.	2.1221e-09
NC_021362.1\|WP_020450554.1\|907765_909139_-\|glycosyltransferase	gnl\|CDD\|223515	COG0438, RfaG, Glycosyltransferase [Cell envelope biogenesis, outer membrane].	1.94637e-16
NC_021362.1\|WP_020450541.1\|885989_887951_-\|LTA-synthase-family-protein	gnl\|CDD\|224287	COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane].	0
NC_021362.1\|WP_020450553.1\|906724_907699_-\|NAD-dependent-epimerase/dehydratase-family-protein	gnl\|CDD\|187566	cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-epimerase, extended (e) SDRs. This subgroup contains UDP-N-acetylglucosamine 4-epimerase of Pseudomonas aeruginosa, WbpP, an extended SDR, that catalyzes the NAD+ dependent conversion of UDP-GlcNAc and UDPGalNA to UDP-Glc and UDP-Gal. This subgroup has the characteristic active site tetrad and NAD-binding motif of the extended SDRs. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	4.44726e-69
NC_021362.1\|WP_023855753.1\|894279_894972_+\|N-acetyltransferase	gnl\|CDD\|100048	cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain. WcxM is thought to be bifunctional, catalyzing both the isomerization and transacetylation reactions of keto-hexoses. It contains an N-terminal LbH domain responsible for the transacetylation function and a C-terminal isomerase domain. The LbH domain contains imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X), typical of enzymes with acyltransferase activity.	2.25112e-50
NC_021362.1\|WP_020450557.1\|912933_914043_+\|DegT/DnrJ/EryC1/StrS-family-aminotransferase	gnl\|CDD\|99740	cd00616, AHBA_syn, 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn). AHBA_syn family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The members of this CD are involved in various biosynthetic pathways for secondary metabolites. Some well studied proteins in this CD are AHBA_synthase, protein product of pleiotropic regulatory gene degT, Arnb aminotransferase and pilin glycosylation protein. The prototype of this family, the AHBA_synthase, is a dimeric PLP dependent enzyme. AHBA_syn is the terminal enzyme of 3-amino-5-hydroxybenzoic acid (AHBA) formation which is involved in the biosynthesis of ansamycin antibiotics, including rifamycin B. Some members of this CD are involved in 4-amino-6-deoxy-monosaccharide D-perosamine synthesis. Perosamine is an important element in the glycosylation of several cell products, such as antibiotics and lipopolysaccharides of gram-positive and gram-negative bacteria. The pilin glycosylation protein encoded by gene pglA, is a galactosyltransferase involved in pilin glycosylation. Additionally, this CD consists of ArnB (PmrH) aminotransferase, a 4-amino-4-deoxy-L-arabinose lipopolysaccharide-modifying enzyme. This CD also consists of several predicted pyridoxal phosphate-dependent enzymes apparently involved in regulation of cell wall biogenesis. The catalytic lysine which is present in all characterized PLP dependent enzymes is replaced by histidine in some members of this CD.	1.60954e-169
NC_021362.1\|WP_020450545.1\|891747_893436_+\|alpha,alpha-phosphotrehalase	gnl\|CDD\|274115	TIGR02403, Trehalose-6-phosphate_hydrolase, alpha,alpha-phosphotrehalase. Trehalose is a glucose disaccharide that serves in many biological systems as a compatible solute for protection against hyperosmotic and thermal stress. This family describes trehalose-6-phosphate hydrolase, product of the treC (or treA) gene, which is often found together with a trehalose uptake transporter and a trehalose operon repressor.	0
NC_021362.1\|WP_020450546.1\|893457_894174_+\|trehalose-operon-repressor	gnl\|CDD\|274116	TIGR02404, Trehalose_operon_transcriptional_repressor, trehalose operon repressor, B. subtilis-type. This family consists of repressors of the GntR family typically associated with trehalose utilization operons. Trehalose is imported as trehalose-6-phosphate and then hydrolyzed by alpha,alpha-phosphotrehalase to glucose and glucose-6-P. This family includes repressors mostly from Gram-positive lineages and does not include the TreR from E. coli. [Regulatory functions, DNA interactions].	2.87712e-117
NC_021362.1\|WP_051143316.1\|896928_902553_+\|NTTRR-F1-domain	gnl\|CDD\|223021	PHA03247, PHA03247, large tegument protein UL36; Provisional.	2.57303e-06
NC_021362.1\|WP_020450551.1\|905076_906168_-\|DegT/DnrJ/EryC1/StrS-family-aminotransferase	gnl\|CDD\|99740	cd00616, AHBA_syn, 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn). AHBA_syn family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The members of this CD are involved in various biosynthetic pathways for secondary metabolites. Some well studied proteins in this CD are AHBA_synthase, protein product of pleiotropic regulatory gene degT, Arnb aminotransferase and pilin glycosylation protein. The prototype of this family, the AHBA_synthase, is a dimeric PLP dependent enzyme. AHBA_syn is the terminal enzyme of 3-amino-5-hydroxybenzoic acid (AHBA) formation which is involved in the biosynthesis of ansamycin antibiotics, including rifamycin B. Some members of this CD are involved in 4-amino-6-deoxy-monosaccharide D-perosamine synthesis. Perosamine is an important element in the glycosylation of several cell products, such as antibiotics and lipopolysaccharides of gram-positive and gram-negative bacteria. The pilin glycosylation protein encoded by gene pglA, is a galactosyltransferase involved in pilin glycosylation. Additionally, this CD consists of ArnB (PmrH) aminotransferase, a 4-amino-4-deoxy-L-arabinose lipopolysaccharide-modifying enzyme. This CD also consists of several predicted pyridoxal phosphate-dependent enzymes apparently involved in regulation of cell wall biogenesis. The catalytic lysine which is present in all characterized PLP dependent enzymes is replaced by histidine in some members of this CD.	1.12451e-105
NC_021362.1\|WP_035339210.1\|906164_906707_-\|transferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	6.8726e-37
NC_021362.1\|WP_020450543.1\|888661_890074_+\|sodium:alanine-symporter-family-protein	gnl\|CDD\|224040	COG1115, AlsT, Na+/alanine symporter [Amino acid transport and metabolism].	0
NC_021362.1\|WP_020450542.1\|888213_888591_+\|DUF1992-domain-containing-protein	gnl\|CDD\|378159	pfam09350, DUF1992, Domain of unknown function (DUF1992). This family of proteins are functionally uncharacterized.	9.13129e-19
NC_021362.1\|WP_020450559.1\|915189_916485_+\|nucleotide-sugar-dehydrogenase	gnl\|CDD\|274399	TIGR03026, NDP-sugDHase, nucleotide sugar dehydrogenase. Enzymes in this family catalyze the NAD-dependent alcohol-to-acid oxidation of nucleotide-linked sugars. Examples include UDP-glucose 6-dehydrogenase (1.1.1.22), GDP-mannose 6-dehydrogenase (1.1.1.132), UDP-N-acetylglucosamine 6-dehydrogenase (1.1.1.136), UDP-N-acetyl-D-galactosaminuronic acid dehydrogenase, and UDP-N-acetyl-D-mannosaminuronic acid dehydrogenase. These enzymes are most often involved in the biosynthesis of polysaccharides and are often found in operons devoted to that purpose. All of these enzymes contain three Pfam domains, pfam03721, pfam00984, and pfam03720 for the N-terminal, central, and C-terminal regions respectively.	0

>NC_021362.1|WP_051143316.1|896928_902553_+|NTTRR-F1-domain
MENRIINGGFETGSLPPWTGFNAVVTSNFSHSGIYSVNLVTSSIGILAQSFLVNPGENFEFVISISKASSAPSPAIVITVDYYNSSFDFLSQGLSLTIPVNRLSAVNVWNEIYATTNSAPPGTVIGVVTIQKLPLSGGAPILIDDVAMITIDQPGATGPTGATGPTGATGPTGATGATGPTGATGATGPTGATGPTGATGATGPTGPTGATGPTGPTGATGPTGPTGATGATGPTGATGSTGATGPTGATGPTGATGATGVTGPTGSTGPTGVTGPTGATGPTGPTGATGPTGPTGATGATGPTGATGSTGATGPTGATGPTGATGATGVTGPTGSTGPTGVTGPTGVTGPTGVTGPTGVTGPTGATGPTGATGATGAMGPTGATGPTGPTGATGPTGVTGATGATGATGATGPTGATGATGPTGSTGPTGATGATGPTGSTGPTGATGATGATGSTGPTGVTGATGATGVTGPTGPTGVTGATGATGPTGATGATGPTGSTGPTGATGPTGATGPTGSTGATGPTGATGPTGATGATGATGATGPTGSTGATGPTGPTGATGATGATGATGATGPTGATGPTGPTGATGPTGVTGATGATGPTGATGATGATGPTGATGATGATGPTGSTGATGPTGPTGATGATGATGATGVTGPTGVTGPTGATGATGATGPTGATGPTGPTGATGPTGATGATGPTGATGPTGATGATGAIGATGPTGSTGATGPTGPTGATGATGATGATGATGATGPTGATGPTGPTGATGPTGVTGATGATGPTGATGATGATGPTGATGATGATGPTGSTGATGPTGPTGATGATGATGATGVTGPTGVTGPTGATGATGATGPTGATGPTGPTGATGPTGVTGPTGATGPTGSTGPTGATGATGATGSTGPTGATGPTGVTGATGATGVTGPTGPTGVTGATGATGPTGATGATGATGPTGTTGPTGATGPTGATGPTGATGATGPTGPTGATGATGATGATGATGATGPTGATGPTGPTGATGATGATGATGPTGPTGATGATGATGATGVTGPTGVTGPTGATGATGATGPTGATGPTGPTGATGPTGATGPTGPTGSTGPTGATGATGATGSTGPTGATGPTGVTGATGATGVTGPTGPTGVTGATGATGPTGATGATGATGPTGTTGPTGATGPTGATGPTGATGATGPTGATGPTGATGATGATGSTGPTGATGPIGATGATGPTGATGATGPTGATGATGPTGATGPTGPTGATGATGATGATGATGATGPTGATGPTGATGATGPTGATGPTGATGATGATGSTGPTGATGPIGATGATGPTGPTGATGSTGPTGATGATGATGPTGATGPTGATGPTGPTGVTGATGATGPTGATGPTGATGATGPTGSTGATGPTGPTGATGATGATGATGATGPTGATGPTGPTGVTGATGATGPTGATGPTGVTGATGATGPTGPTGATGATGPTGAAGPTGPTGATGATGPTGAAGPTGATGPTGATGPTGATGPTGATGPTGVTDPTGATGPTGVTGATGATGATGATGATGPTGATGATGPTGATGPTGVTGATGATGPTGATGATGPTGATGPTGVTGATGATGATGATGATGATGPTGATGPTGPTGATGPTGVTGATGATGPTGATGATGPTGATGPTGVTGATGATGPTGATGPTGPTGATGPTGVTGATGATGPTGATGATGPTGATGPTGPQGPTGPPGEVGVMVVAGPTGPTGPASPQTAIFFNNLFGSTTVYNPPTIPLNTEVTVVSVPNVSVTSGQNIKVDYALAIEAVNTANSNIIFEIRLYRGGTLVQTRIFNRSLAAAGTQRFPLASTIVDTIPATATVEYSVRVAVTMASNVTSAAAFNRNLNLIRFP
>NC_021362.1|WP_020450548.1|895098_896703_+|collagen-like-protein
MSIQNAVMNGGFETGAFSPWVGINASVTSQFSHSGFFSARFLGGTATSYIAQFVPARAGEGSEFIVSLAKAGFLPAPSITIQVTYFDSQFNFLEYGLFATVPSSRIPAAENGTWLEVYQTTSPAPPGTTQAFILINNIPQAGTASVLVDDVALLSVEGGGGPTGATGPTGATGPTGPTGPTGATGATGPTGSTGPTGATGSTGPTGSTGPTGSTGPTGATGPTGSTGPTGATGATGPTGSTGPTGATGPTGATGPTGVTGPTGSTGATGSTGPTGATGSTGPTGATGATGPTGVTGPTGATGATGSTGPTGATGSTGATGPTGATGATGATGPTGVTGPTGATGPTGATGATGATGPTGATGPTGATGPTGPTGATGPTGVTGPTGATGPTGATGPTGPGSLLGTPAQSTDPVSLTVGSETPILTTTVTSSAGQNIKLDSMAEVDIIIGPATTFEYSIIFTLYRNDVAIAQVSVDSQDEKSAGSVRVYGDIPNLTWVDTPGAGTQTYEVRINVTGTNLLAANVNTRALNAVIFD
>NC_021362.1|WP_023855753.1|894279_894972_+|N-acetyltransferase
MIHETVKIGKNVVLGEQAVIEENVVIGDNVTIGHHAIIKKDTQIGSGVKIGDLAVLGKAASSNKKMARQPKQAGAPLRIEDDAVVGASAVIYRDVLLEKGVFVGDMASIRENVAIGRESIIGRNAMVENNTKIGKRVTIQTGCYITADMTIEDEVFIGPCCSTSNDKYMGMGNYPYQGPTIKRGAKIGNNATLLPAVVIGEHAVIGAGAVITKDVPAGKTAVGNPGRLLK
>NC_021362.1|WP_020450546.1|893457_894174_+|trehalose-operon-repressor
MKINKYMMIYKQIAEQIDQSILNAGDILPSENDLAEQHDTSRETVRKALNVLAQNGYIQKIKGKGSVVLHREKMQFPVSGLVSFKELSETLGKETSTTVHEFGLTHPDAYIQKQLRTSGDEEVWRVVRSRNINGERIILDKDYFIRKHVPLLTKEICEDSIYQYLEGECGLVISYAHKEIVVEPCTAEDQEYLDLNGYEHIVVVKNFVFLDDTTLFQYTESRHRLDKFRFVDFARREK
>NC_021362.1|WP_020450545.1|891747_893436_+|alpha,alpha-phosphotrehalase
METKENPWWKKAVVYQIYPKSFKDTTGNGVGDIRGIIEKLDYIKELACDVIWLTPIYQSPQNDNGYDISDYYNIHEEYGTMADFEELLEEAHKRGIKVIMDLVVNHTSTEHKWFKEAASGKENPYRDFYIWKDMKPDGAPPTNWESKFGGSAWEFHEETGQYYLHLYDVTQADLNWENDEVRKKVYEMMHFWFEKGIDGFRLDVINVISKDQRFPDDDEGDGRRFYTDGPRVHEFLNEMNREVFSKYDSMTVGEMSSTTIADCIRYTNPESRELDMVFNFHHLKADYPNGEKWALADFDFLKLKKILSEWQTEMHKGGGWNALFWCNHDQPRIVSRYGDDGKYRIKSAKMLATAIHMLQGTPYIYQGEELGMTNPKFDDISLYRDVESLNMYRLLKEAGKPEAEIIEILKAKSRDNSRTPVQWNGEKNAGFTTGTPWISVPANYKEINAEKALSDPDSIFYHYKKLNKLRKEFDIITTGDYQLILEDDQALYAYLRNGADEKLLVINNFYGKETEFQLPDDIDIDGYDAKVLISNDTDLPESFTRFKVKPYQSIVYHLAKPC
>NC_021362.1|WP_020450544.1|890262_891675_+|PTS-system-trehalose-specific-EIIBC-component
MTDLNQSARRIVDAVGGADNIAAVTHCVTRLRFALLDESKVNQEVLEQIDVVKGSFSTNGQFQVVIGQGTVNNVYAELVKATGIGESSKDDVKKASEKNMNPLQRAVKTLADIFIPILPAIVTAGLLMGINNILTAQDIFFSGKSIVEVYPEWADLANMINLIAGTAFAFLPALIGWSAVKRFGGNPLLGIVLGVMLVHPDLLNAWGYGAAEQSGEIPVWNLFGLEVQKVGYQGQVLPILLASYLLAKIERFLTKRTPESIQLLVVAPITLLVTGFASFIVIGPVTFAIGNVLTSGLIAVFEQFAVLGGLLYGGLYAALVITGMHHTFLAVDLQLIGSKLGGTFLWPMLALSNIAQGSAALAMMFIVKDEKQKGLSLTSGISAYLGITEPALFGVNLRYRFPFVIAMISSGIAGMFISSQGVLASSVGVGGVPGIFSIMSQYWGAFAIGMAIVLIAPFAGTYLYAKLKMK
>NC_021362.1|WP_020450543.1|888661_890074_+|sodium:alanine-symporter-family-protein
MERLLNWVEYISDWLWGPPLIILLTGTGVYLTILLKFFQFRYPLYIFKQTIGSVGKKPKGEGTVTPLQALTSALSSTVGAANIVGVPAAIMFGGPGAVFWMWLVALFAMAIKFSESVLAVHYREKNEEGEYVGGPMYYITKGLSMKWLGVFFSVALMIELVPSIMVQGNSVSASLAESFSFNRLYTGIGIAFLIGLVVIGGIKRIGKVTELAVPLMAGAYIGAGFLIVVMNLSSVPAFFSLIFSNAFTSSSAFGGFAGAAVAETVRWGFARGLYSNEAGMGTAPIAHAAAMTDHPVRQGFWAVIGIVVDTLLICTTTAFVVLASGVWTAENAASNPGALAAAAFRSYFGPVGGYFVSVSLVFFVLSTITVVIFYGVKQAEFLFGRLAGHMIKFVYLGAVIIGAAGGAKAIWGFLDLALVFILIPNILAVLLLSKKVRSLYDEFFTSEKYYLKDIGQQDCADERDEKVNNL
>NC_021362.1|WP_020450542.1|888213_888591_+|DUF1992-domain-containing-protein
MDFSSIVSEDKIKRAIKDGEFEGLPGMGKPLKKDDAAHVPEHLRMAYRVMKNAGMTGDEGALKKELMTIDDLIAKCADEDERDRLIERKTETRLRLDRLADKKGMFSKPASAFYKEKVYRRLSGK
>NC_021362.1|WP_020450541.1|885989_887951_-|LTA-synthase-family-protein
MKRFIKERGLAFFLIAAILLWLKTYAAYVIEFNLGITNTVQQILLFVNPISSSLFFLGLGLLFKKKIQQTAIIVIHFLMSFLLYANVVYYRFFSDFITLPTIMQAKTNGGQLGDSIFSLMHPLDVLYFIDTFILIGLAVFYNRPSETTTKRPFKIVMGTSVLVFLVNLAVAEIDRPELLTRSFDRNYLVKYLGTYNFTIYDAVQNIKSNSQRALASSSDVTEVENYIKANHDKPNAEYFGKAKGMNVVYISLESLQTFAIDYKIDGKEVTPFLNSLAHDNETFYFDNFFHQTGQGKTSDAEFMMDNSLYPLSQGSVFINKAQNTLQSAPAILKSQGYTSAAFHGNYKTFWNRNEMYKAIGYDKFFDATYYDMSEDKTKNYGLKDKPFFEESMPLLKSLKQPFYTKFITLSNHFPFEMDEGDTDFPAGDTGDSVVDHYFQSANYMDQAIEQFFNDLKKSGLYDNTIVVMYGDHYGISENHNKAMAKVLGKDITPYENAQLQRVPLFIHAPGVKGIKSNKYGGEVDVAPTLLHLMGVNTKDYLMSGSDLLSPEHREIIPFRNGDFVSPEYTKTNGNYYDTKTGELLNEKDIDPNIDESVKKELEMSDKIVDGDLLRFYKPKGFKAINPSDYDYTNHNPKTSESDAAQTTKSDSGQ
>NC_021362.1|WP_020450540.1|885112_885865_-|type-I-methionyl-aminopeptidase
MIVTNDQELEGLKKIGRIVALAREEMKAKAAPGMSTKELDLIGKEVLEAHGAASAPEKEYDFPGTTCISVNDEVAHGIPSESTILKEGDLINIDISAEFGGYYSDTGISFVLGKGDETLHKLCQSAESAFQKGLLQARAGKKQNQIGRAVYNEAKANGFTVIKNLTGHGIGKNLHEAPNHILNYYDPFDNALFKNGTVIALEPFVSTKAEHTIEAGDGWTFKTPDGSFVAQIEHTIVITKNEPIILTQLD
>NC_021362.1|WP_020450551.1|905076_906168_-|DegT/DnrJ/EryC1/StrS-family-aminotransferase
MIRLIEPYITFEEVEAELKEIFSSGILTKGPYVRTFADHIKQYVSAKHAFLTTSATTALSMCLKSLNVQPGDEVIVSDFSFPATVNVIEDLGAKPIFADVDLETFNMLPEELESQITSRTKAVLFVDALGNPTGITNIKHICEAYGLPLVDDAACAMGSSEYGCKSGKIADLTCFSFHPRKLLTTGEGGAITTDREELKDWFSVKLNHGAAISDGQLDFMDFGYNYRLSDIQAALGIKQLQKLDDIIHRRNLQQKAYSEQLEPLGFQSQKIGPDVVHNTQSAVFKIPKNIVRDELIQYLSDCHIESTFGTYCLSGTTYYRRKYRQIKPNSIFLEQNTITLPCHDQVNVEQVVSAIQSFSQRKV
>NC_021362.1|WP_035339210.1|906164_906707_-|transferase
MKQWKSEGKGEFTLSQLGGCGENVVIEDGVRIFHPENIYIGDNVYIGHDTILKGYYKHDLIIGSNSWIGQQCFIHGAGGVTIGEFAGIGPNVRIHAAYHTDPDIPDSTILFSPLTFAPIHIEENCNIGIGASILAGVTIGAHSKIGANAVVNRHIPPYSIAVGVPAKVIKNRRMKDEEPS
>NC_021362.1|WP_020450553.1|906724_907699_-|NAD-dependent-epimerase/dehydratase-family-protein
MSDMTELSGQHIFITGGAGFIGSSLIGKLIERNSVTVYDNFSRDSLRYKPYRDHPHLKVVQGDILDVNTLKKAIQGASHIVHAAGIAGIDTVIQNPVKTMQVNMIGSANLLEAAAGLTECKRVVCFSTSEVFGQIAFRARETSHTVLGAVGEARWTYAVSKLAEEHMAYAYFKKLGLPTVTVRPFNVYGPEQVGEGAIKTMVHRALLDEPIYIHGDGTQIRAWCYVDDMIDGILRCLTMKEAIGESFNIGNERTVITVYGLASTIIRVLGSKSQIIFGEKKEADIELRIPQVNKAKEMLGFSAKVDLEEGITRTAESIRKNLDQ
>NC_021362.1|WP_020450554.1|907765_909139_-|glycosyltransferase
MKDFKSDIIHCLEQKDWNKAMKRLKEWEADGSHNEPDFYFFQASLSVYLGHDHNAWLWLWRGLDLFPDNRSLNLLMGKVCLRTGREKESAAYLQKGDGAETESGPKLDLPVHEKTEPPAGQIRVLQGTMEIANQMNTLAKGLSQHGALAHTLNYYPYYLNYAADYTWSLLKERNTPAMNAKLRRLASDLLPSYDLFHFHFGTSFTLDMSDYPILKQAGKPMIMHHWGSDVRLYSTLAKTNPYAVVKTKNEALIRYHLKRISQYVQHCIVADMELYEYVKDYYEHIHMIPTMIQLDRYIPDYRSNEKPLIVHAPTSPGIKGTRHILKAVESLKEKYDFHFHLVRGVSHEQAKKIYQKADLIIDQLHIGSYGLFAVESMAMGKPVICWVSDFMKEHYPSELPLIRANPDNITEVIENVLKNRDMLPEIGQKGRKYAEVHHDMVKNSKKMLAVYQALLSG
>NC_021362.1|WP_020450555.1|909292_911536_-|glycosyltransferase
MDNELEYLLDSVGLSWRETEISQLIFQHKWHDAAQKLEERLEAAPFDPGLLISAAFVYEKKQQVQRASELYDDALLFVRSEHQHRLMKEKEDLFKKMVRRPKIIFFVKPDLDRFLNAVVERLSGTYRTRKIAVHDLNQIDTGMQWADICWFEWCDDLLIHGSKVPSAAAKTLICRLHSYEAFTFYIKKVYWQAVDQVIFDGEHMREYVLDQVKSLKKEKTAVVPNGINLDEYTFQQRQKGFHIAYVGYINYKKGPMLLLQAFKALIDKDSRYKLFIAGTFQDARYQLYFKQMIDELRLTDSVQFDGWQDDMNQYLEDKHYLICTSLLESQHMSAMEAMAKGIKPLIHNFYGAKTIYDESVVWNTIDEFVAMITSGDYTSLHYRSFIEEHYSYDLSMRKIEEMISGFAKQSELTVMPNPPLITVGIINYNYSNFIDECLQSVLNQLYPNIDILIVDDHSTDDSMQKISSYQKTHPHIRTICHSENTKLPDLAFKEIFQEAKGEYVLLLSADDFLPHNLVLHDFMQCFFGEEGLDYVYGDLLLVDQHGKNAGLWTYQEYGDEELVRTIFQRGGSGIVPMVGMFKASYYQQKGFTWLVDPQKPLAGDVLNCLANTKRGWKRRYLRKPVLCYRRHQNNISYQLHKRIQSLVYVIDYIVKEFDESVYFPHIKWKELEENQRQSLKYFSIGKTFWRMARRYAQNGYTRHLDQDAKKECIQPLLDKMDEYFLLSLASDNQYERYMKNIKKIQLI
>NC_021362.1|WP_020450556.1|911729_912812_+|glycosyltransferase
MVTISLCMIVKNEEEVLARCLDTVKDIVDEINIVDTGSTDQTVEIAKRYTDRVFFFEWIGDFAAARNESFKHATKDYILYLDADDVLLEKDQKKLKELKETLDPSVDSVSMYYDAGTDEFGNVTLRYRRNRLVKREKNFKWKGDCHQYLEVFGNIINADISVTHKKIRHSVGRNLNIYQKKIDRGDTFTPRDYFYYGNELRENRHYEKAIESYNKNIEMKEGWIEDKVYACINKADCHRFLGDLDNELRSLFQSFEFSKTPRAETCSRIGYNFQRRREYNAAIYWYELATTLVPDSNKWSFTYPAYYTWYPHLQMCVCYYNLGDFEKSYQHNEEARKYRPDDKSVLHNKQLLEGKLGINK
>NC_021362.1|WP_020450557.1|912933_914043_+|DegT/DnrJ/EryC1/StrS-family-aminotransferase
MIPLINLKRQFQTVKEDILQEFEHVLDSGQYILGPKVEELEKRIAEKLGVKEAVAVANGTDALVLTLEAFGIGKGDEVITTPFTFFATAEAVSRVGAKPVFADVDRETCNLDPEEIEENITSATKAIIPVHIFGQPADMDEIMAIAKKHGLLVIEDACQAFGASYKGRPVGSIGDAACFSFFPTKNLGTLGDGGMVTISDPDAARQLRTLRTHGTSKKYFHDKIGFNSRLDELHAAALLILLEKIDGWNEQRRKVASRYKKGLKTAEHLTLPAEKEDRTHIYHLYCIGAKDRDEFIQSLKEQNIHSGVYYPCCLHLQTVYSSLQYKKGDFPIAESLSETLFAIPMDPFLAAEEQEQIISALLKKGGGGK
>NC_021362.1|WP_020450558.1|914039_915104_+|Gfo/Idh/MocA-family-oxidoreductase
MTVHFGLIGCGYMSRKHLQALAGCGDAKLSAVSDLQEERMKEAEQYYASFAGDESRMTRYQQYQALLSDSKIEAVIIAAVSGLHAEMAKAALQAGKHVIVEKPMTLSLQDADELIELAEQNGLKLMVCHQMRHRPIMKKLKGTIERGKLGRIYLGTVSLRLNRSPAYYEAATWRGSWEKDGGMLVNQGIHLIDLLQWFLGDVKGVYGDILGGSGAKETEDVAVGVLTFASQAKGVVEANIVTQPNNIGSSLSIFGEHGTISLEGPALNRISRWYIHGEKDAAEEAAQLIDLGGEQTVMYQNFISAVKRQDTLLVDGYEGKKAIETIFGIYQSVLQKQPVQLPLSSFQTSDMKNK
>NC_021362.1|WP_020450559.1|915189_916485_+|nucleotide-sugar-dehydrogenase
MSKQEMHNETIAVIGLGFVGLPLAMLLISKGIRVIGVDLDKKKVEALRKGNSYISDINDQAVQDGIGTGFFRPVSDYGLIGEADAVIICVPTPLNDDAGPDLTYVKRAAQSIGGHLKKGQLVVLESSTYPGTTRDIVKPILEESGLVCGKDFYLAYSPERVDPGNQFPIEVVPKVVGGTTEACLEKVHQLYSGIYEEVVPVTSPETAELTKLLENTYRFINISFINEFAMICDKLGVNVWEVIEAASTKPYGFAAFYPGPGIGGHCIPVDPLYLQFVMKQSGLSSDFIELSEATNDRIVRYIAERSLQLAGKDKATDARILIYGVTYKRNIADVRESKSLDIIEKLIGMGADVSYHDPHVPELDLSGKKLASMPIDSEMLKAYDCVVVLTDHDALPKELLLNHATVIFDTRGVLREAAGKAKVIQLGNGCS
>NC_021362.1|WP_041817164.1|916566_917478_+|alpha/beta-hydrolase
MWIGVLLMVFGIGISIFAVSLIVSYLFVMPNRSTYEETFFSGLKHGEIIDDVFESHDKEELFLTAGDGCRLHALLFPVQKSRKAVIVSHGIKWSLFGGYKYVELFQSIGYNVLLCDSRCHGLSGGSHVSYGFYEKDDLARWADELENRFGKDLWIGVLGESLGAAAAIELMKQDRRIKFCIADSCFSDLTELCRFQLKAAVKLSVPFLIPLASGLIKRRHGWSLADISPVSNLEQSDTPLLIIHGTNDQLVPPEMAKSLYNRKKGIKKLYLIEGAGHVGGFRHDPEEYLSRIKDFLLKIEPAN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_021362_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_021362_4

2265803-2265901

Orphan

Consensus_repeat	Method
TCAGGCAGCGATTCTTTTAGCGTT	CRISPRCasFinder

1 spacers

csa3,WYL

The CRISPR arrays of NC_021362_4

>merge|NC_021362|4|2265803-2265901|CRISPRCasFinder
TCAGGCAGCGATTCTTTTAGCGTTTCTACAACTGACCGCTCGACACTTTTCGTAGAGCCGGCGGCCGTCCCACTATCAGACAGCGATTCTTTTAGCGTT

>NC_021362|4|2|2265803-2265901|CRISPRCasFinder
TCAGGCAGCGATTCTTTTAGCGTT	TCTACAACTGACCGCTCGACACTTTTCGTAGAGCCGGCGGCCGTCCCACTA
TCAGACAGCGATTCTTTTAGCGTT

Protein	Signature genes	Signature genes Name	Protein_function
NC_021362.1\|WP_079289250.1\|2262840_2263539_+\|lysozyme-family-protein	unknown	unknown	gnl\|CDD\|381612
NC_021362.1\|WP_020451756.1\|2258008_2258944_-\|YafY-family-transcriptional-regulator	WYL	COG2378_WYL_CAS-I:CAS-III	gnl\|CDD\|225253
NC_021362.1\|WP_020451759.1\|2261460_2262798_+\|APC-family-permease	unknown	unknown	gnl\|CDD\|129987
NC_021362.1\|WP_011201670.1\|2276800_2277028_+\|YjfB-family-protein	unknown	unknown	gnl\|CDD\|379452
NC_021362.1\|WP_020451765.1\|2267656_2268190_-\|DUF420-domain-containing-protein	unknown	unknown	gnl\|CDD\|225204
NC_021362.1\|WP_020451766.1\|2268342_2269323_-\|hypothetical-protein	unknown	unknown	unknown
NC_021362.1\|WP_020451755.1\|2257670_2257955_-\|zinc-ribbon-domain-containing-protein	unknown	unknown	gnl\|CDD\|378913
NC_021362.1\|WP_020451771.1\|2273900_2275682_-\|DNA-helicase-RecQ	unknown	unknown	gnl\|CDD\|223588
NC_021362.1\|WP_041817222.1\|2257200_2257674_-\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|226231
NC_021362.1\|WP_033155124.1\|2259123_2259633_+\|hypothetical-protein	unknown	unknown	unknown
NC_021362.1\|WP_020451761.1\|2263672_2264659_-\|polysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|367154
NC_021362.1\|WP_003182557.1\|2259673_2260006_-\|Zn(II)-responsive-metalloregulatory-transcriptional-repressor-CzrA	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NC_021362.1\|WP_020451767.1\|2269553_2270063_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NC_021362.1\|WP_020451772.1\|2275865_2276387_-\|hypothetical-protein	unknown	unknown	unknown
NC_021362.1\|WP_020451770.1\|2272854_2273664_-\|LysM-peptidoglycan-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|226112
NC_021362.1\|WP_020451769.1\|2271104_2272694_-\|solute:sodium-symporter-family-transporter	unknown	unknown	gnl\|CDD\|236699
NC_021362.1\|WP_025811320.1\|2264697_2265345_-\|peptidase	unknown	unknown	gnl\|CDD\|370127
NC_021362.1\|WP_035338579.1\|2261056_2261461_-\|YnfE-family-protein	unknown	unknown	gnl\|CDD\|340167
NC_021362.1\|WP_020451768.1\|2270107_2271073_+\|LD-carboxypeptidase	unknown	unknown	gnl\|CDD\|132883
NC_021362.1\|WP_020451764.1\|2266269_2267487_-\|glycosyltransferase-family-4-protein	unknown	unknown	gnl\|CDD\|340831

Protein	Function_ID	Function_description	E-value
NC_021362.1\|WP_079289250.1\|2262840_2263539_+\|lysozyme-family-protein	gnl\|CDD\|381612	cd16891, CwlT-like, CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).	5.7057e-77
NC_021362.1\|WP_020451756.1\|2258008_2258944_-\|YafY-family-transcriptional-regulator	gnl\|CDD\|225253	COG2378, COG2378, Predicted transcriptional regulator [Transcription].	1.66695e-73
NC_021362.1\|WP_020451759.1\|2261460_2262798_+\|APC-family-permease	gnl\|CDD\|129987	TIGR00909, putative_amino_acid_transporter, amino acid transporter. [Transport and binding proteins, Amino acids, peptides and amines].	9.02e-37
NC_021362.1\|WP_011201670.1\|2276800_2277028_+\|YjfB-family-protein	gnl\|CDD\|379452	pfam14070, YjfB_motility, Putative motility protein. This family of proteins is regulated in B. subtilis by SigD, and is likely to be involved in motility or flagellin production, Proteins in this family are approximately 60 amino acids in length, and contain two highly conserved asparagine residues.	4.76798e-09
NC_021362.1\|WP_020451765.1\|2267656_2268190_-\|DUF420-domain-containing-protein	gnl\|CDD\|225204	COG2322, COG2322, Predicted membrane protein [Function unknown].	3.45867e-63
NC_021362.1\|WP_020451755.1\|2257670_2257955_-\|zinc-ribbon-domain-containing-protein	gnl\|CDD\|378913	pfam12674, Zn_ribbon_2, Putative zinc ribbon domain. This domain appears to be a zinc binding DNA-binding domain.	9.76662e-33
NC_021362.1\|WP_020451771.1\|2273900_2275682_-\|DNA-helicase-RecQ	gnl\|CDD\|223588	COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair].	0
NC_021362.1\|WP_041817222.1\|2257200_2257674_-\|AraC-family-transcriptional-regulator	gnl\|CDD\|226231	COG3708, COG3708, Uncharacterized protein conserved in bacteria [Function unknown].	1.34185e-24
NC_021362.1\|WP_020451761.1\|2263672_2264659_-\|polysaccharide-biosynthesis-protein	gnl\|CDD\|367154	pfam02719, Polysacc_synt_2, Polysaccharide biosynthesis protein. This is a family of diverse bacterial polysaccharide biosynthesis proteins including the CapD protein, WalL protein, mannosyl-transferase, and several putative epimerases (e.g. WbiI).	9.8559e-117
NC_021362.1\|WP_003182557.1\|2259673_2260006_-\|Zn(II)-responsive-metalloregulatory-transcriptional-repressor-CzrA	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	3.85328e-19
NC_021362.1\|WP_020451767.1\|2269553_2270063_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	0.0032594
NC_021362.1\|WP_020451770.1\|2272854_2273664_-\|LysM-peptidoglycan-binding-domain-containing-protein	gnl\|CDD\|226112	COG3584, COG3584, Uncharacterized protein conserved in bacteria [Function unknown].	6.1468e-46
NC_021362.1\|WP_020451769.1\|2271104_2272694_-\|solute:sodium-symporter-family-transporter	gnl\|CDD\|236699	PRK10484, PRK10484, putative transporter; Provisional.	0
NC_021362.1\|WP_025811320.1\|2264697_2265345_-\|peptidase	gnl\|CDD\|370127	pfam08795, DUF1796, Putative papain-like cysteine peptidase (DUF1796).	1.70321e-34
NC_021362.1\|WP_035338579.1\|2261056_2261461_-\|YnfE-family-protein	gnl\|CDD\|340167	pfam17452, YnfE, Uncharacterized protein YnfE. This is a family of unknown function found in Bacillus.	4.4206e-33
NC_021362.1\|WP_020451768.1\|2270107_2271073_+\|LD-carboxypeptidase	gnl\|CDD\|132883	cd07062, Peptidase_S66_mccF_like, Microcin C7 self-immunity protein determines resistance to exogenous microcin C7. Microcin C7 self-immunity protein (mccF): MccF, a homolog of the LD-carboxypeptidase family, mediates resistance against exogenously added microcin C7 (MccC7), a ribosomally-encoded peptide antibiotic that contains a phosphoramidate linkage to adenosine monophosphate at its C-terminus. The plasmid-encoded mccF gene is transcribed in the opposite direction to the other five genes (mccA-E) and is required for the full expression of immunity but not for production. The catalytic triad residues (Ser, His, Glu) of LD-carboxypeptidase are also conserved in MccF, strongly suggesting that MccF shares the hydrolytic activity with LD-carboxypeptidases. Substrates of MccF have not been deduced, but could likely be microcin C7 precursors. The possible role of MccF is to defend producer cells against exogenous microcin from re-entering after having been exported. It is suggested that MccF is involved in microcin degradation or sequestration in the periplasm.	1.49157e-107
NC_021362.1\|WP_020451764.1\|2266269_2267487_-\|glycosyltransferase-family-4-protein	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	5.41588e-63

>NC_021362.1|WP_025811320.1|2264697_2265345_-|peptidase
MNLKEIKGQYNAVFSLGHLCLTAIQLKNNDLRPFSGPLDWVTIHSLTDLNLLLRNRFTGFMEPKNLRVIGYNTGKKKEEGSTIYVSDDFYNIGSVHDFDANQNTLDHLATYPEVIEKYNRRIDRFIEKMSTSKRILFVRTEGEGSFKEAQELELVLSDLVQHDFSVLLVKHSKVNGIVEKNWPLEKTCTVELPDKEIWESNNDLWASLFKGITLV
>NC_021362.1|WP_020451761.1|2263672_2264659_-|polysaccharide-biosynthesis-protein
MFENKTIFITGGTGSWGQELILQLLSLNPKKLIVFSRNEERQVQMRRQIEDPRLTFFIGDIRDRKALNTGLKGVDYVFHLAALKHVPVCEEQPLEALKTNVTGTENVIEAAIENGVKKVINVSTDKAADPANFYGMTKAIGEKLIVYANHLYSDTDFICVRGGNVLGSSGSVLQLFKDQIRKKNQVSITDKRMTRFFLTKEKTIRLLLKAAESGQGGEIFIMNSPACRILDMAEVLIEAYGNEKTSIAETGARPGEKLHELLISPHERQHAVSFTNDLAVVLPAIKMPELHKKYADCQPLETDHLSSKDFLISKKEVKEMLKEGGFLE
>NC_021362.1|WP_079289250.1|2262840_2263539_+|lysozyme-family-protein
MRLYTVLHQGATEVKPLKKKKSGCLAGAGCLSFFVFVPLIIFFAISGLEQLKWLPLDTESNILERLKDYKPLVEEELDEQDLSQYTALLLGMMYQESKGRGGDPMQSSESLGMKRNEIDDPKASIKQGVRHFTAMYKKGQKKGVDIETIIQSYNMGSGYIDYVSKHGGKHSEKLAKAFSEEQVKKNPDLYNCGGDTNNFRYPYCYGDYSYTEKVMERTKKVEEHIEGLTLEH
>NC_021362.1|WP_020451759.1|2261460_2262798_+|APC-family-permease
MKNETALKRSLTLGPLVVIGLAYMDPLVVFDSYGVVAQLTKGHVPAAYIFTVAALLLTALSYGSMVKAYPKAGSVYTYAYESIHPHAGFLAGWTIMLDYLFLPMVNFAIGSAYLTAAFPEVPHGFWVVLLALSITVVNILGIRLTANITGLFVAFQVIVALTFAGFMIAGLADGLGTGELVSADPFFRSDIEPSLIVSGATILCFSFLGFDAISTMSEETINPKKNIPLAIFLTVAIGGTLFTAISYLMQQIYPSYDSFQHADSASLEIALYTGGAFLKSFFLAGTMVAVVSSSLSSHASASRLLYAMGRDSSLPKRFFGYVHPTLKTPVFNIMFIGLISLTAMIGELEVIYSFISFGALIGFIFVHLSVIGHYYIRKQERGFLKTLRYLVLPFLGASFCGWLLLSISKNALMIGAGWLIAGFIYFLFRIRTLPNVTFGFDRDPR
>NC_021362.1|WP_035338579.1|2261056_2261461_-|YnfE-family-protein
MTSKSPYVKNTEIKTYFICFFALEQLYKTSFFRIKIANVANPLKKGKEYEGMDILRGYVEAVKRNMETMNASDYDGKEEDLRRQQEELERYEQRLKEKNASADRFDQVVDAAVDCAAGDISFSQLEHMYQQEGS
>NC_021362.1|WP_003182557.1|2259673_2260006_-|Zn(II)-responsive-metalloregulatory-transcriptional-repressor-CzrA
MSEHNQETTEKQVRAELDEETLFLVSQTFKALSDPTRIKILHLLSQGEHSVNEIAEKLSLLQSTVSHQLRFLKNLRLVKSRRAGTSIFYSPEDQHVLDVLQQMIDHTQHD
>NC_021362.1|WP_033155124.1|2259123_2259633_+|hypothetical-protein
MYYFLQFFAIVSFVYIKFKRSVGYQPLKPARMLFRIILFSGIFVFLLTMSALHPLSYFYDLIGIALGLILTAYALKHVSIENRDGILYFRTHLWIELIVLLLFLYRFLYRIAEIGQLQTAVSNGGSAAYGALFAQDPATMIGFFVLAVYYVGFSFFVLKKGRNEEKRSA
>NC_021362.1|WP_020451756.1|2258008_2258944_-|YafY-family-transcriptional-regulator
MKIDRLLAIVILLINKRQVQAKELAGMFEVSVRTIYRDIEAINQAGIPIVTLQGAGGGISIMERFRLENKLLSADELAAITTALESVSSTYEVLHHGSALEKIRFLVSEEEMPEFRKKTEKWFVDISSWGESPVIKEKIRLLDEAADSTRAVSFTYVNREGQTGTRKAEPHTLVLKGRHWYLYAFCLKRQAFRFFKLLRMKDVQMLEEKFERKEVDLSSLPWETSWYKPDNMTELTLLIKPSGESLAREWFGSEALTYENGQCVATVSYPEDQWLYGFLLQFGTHIEVLTPPRIRQKIKNLANQIVHLYET
>NC_021362.1|WP_020451755.1|2257670_2257955_-|zinc-ribbon-domain-containing-protein
MEHHICQSCGMPMTSELFGTEKDGGKNRDYCMYCYENGAYTHPDATLKEMIDICVPYIKEEGKTEAEARSLMERTLPHLKRWASDTQTKGGQRR
>NC_021362.1|WP_041817222.1|2257200_2257674_-|AraC-family-transcriptional-regulator
MSFSHFEKQKAKLFSGISTVTSNRDEVSEKGKIPSMWSLYREKFPHTERQDIRRDTIALYSDYETDEHGTYTFSIGTFVDQQEKTANLISLPASEYAVFVSKRGRIAEVVFETWQEIWTWDEKNLRTYTGDFEVYDEQAENPENAQVAIYVAVDRKK
>NC_021362.1|WP_020451764.1|2266269_2267487_-|glycosyltransferase-family-4-protein
MKILLATYWSIPHVGGVWTYMVQLKEKLESLGHEVDLLGYGEENSIIHIVNENRSIAKDQLLPLVKAMMSEEDFPEIYANQLVSYTELQRNAYELGAAYLGLDKYDIIHAQDVISSACIKRIMPKDKVLVTSIHGSVTYEIRDQLNNIHRSPTSYIAKEYFDHLEHTGAMSAETVIVANNWLKDILTEEFAVPDGKIHVSQYGYDIDGFLARMNTKTADTPETDKKVILFTSRMIGNKGIHYLIEALSQLKDTRNDWVCWMAGEGEKLAGLKIQSEQLGLVDDVVFLKNREDVPYLLSLADIYVLPSLLDNQPLSLIEAQIAGVPAVVSDAGGLPEMVEHEETGLIVPKGDAAALSSSLERLLKDDDFRNKLGINAKEFAKKHWDMDQAVTRILDIYQNTNGKEE
>NC_021362.1|WP_020451765.1|2267656_2268190_-|DUF420-domain-containing-protein
MTHTQKNKNYTGIVVALTIIINGVIALLFFMPKSDKFAHLDLTFLPLLNAVCNSFTFIFLVAALIMIKQKNIKAHKRFIFAAFTTTFIFLVSYLTYHSLMPDTHFGGEGIIRPIYYFILITHIVLSALIVPLALFTLFRGLSMQVERHRKIARWTMPLWLYVSLTGVLVYMMISPYY
>NC_021362.1|WP_020451766.1|2268342_2269323_-|hypothetical-protein
MKKRIFSLLMLMSAFVLVLAACQQADPKGSYATAYKKLISAKSYEFSSDIGLKVDASNLGAEDKQVADMLNDATLTISGKTNAETKQSEAVIKAKLKVQNMSLDFDIPVYMDEKKQVGYIKIDSVLDSFGFFLGTAGMNFDSVKGKYLEFPLEDDKTSSQDTDELQKQLMESIKEAADNLPADKFEKADLTDKEKEQGAAQKVAFSFSDKEIKAAVVKFIEIAGKASGEAVPKSELNKIKDGLKDVTFKKFDVTSTIDDKENLLTENADISLSVDSKKAPQSLGITASTTYKNIDGDVKFEHKPNKEDIVTEEEFEKLMAKDAMNF
>NC_021362.1|WP_020451767.1|2269553_2270063_+|GNAT-family-N-acetyltransferase
MITDEEMQKDSSGLQKELNELQFQLFRMRENMKDISKDSRVLGIDQSKDDEWMIVHSIDDGRTCKIMLSDCQSPYRGRCDFSLVASYKEEKCAIHIGDIKGPAGYGYGSICMKYLKEKAREHNIPVITGDIAERDWDHVDRLIHFYEKHHFEVTIDPGLKSGEIQWQDL
>NC_021362.1|WP_020451768.1|2270107_2271073_+|LD-carboxypeptidase
MFPEKLQPGDEIRVIAPSRSLSLLNTDKIEKARTVLNNLGFRISFSAHANEIDECSSSSIQSRVSDLHDAFSDQRVKGILTVLGGYNSNQLLSHLNYELIKANPKVFCGFSDITALSAAIYAKTGLVTYSGPHFSSFSMGYGLNYMTDYFLKCCCASGVYDVEPSSMWCEEIETEECPKQNSGPVVINEGSADGKIIGGNLCTLNLLQGTEYFPDIKNAVLFLEDDWESPAAFFDRDLQSLLHLPDFSGVKAVLIGRFQTASAVTLERLKQIVQTKKELSQIPVIANIDFGHTTPFFTFPIGGRCRIDAQKEHVSLCITKH
>NC_021362.1|WP_020451769.1|2271104_2272694_-|solute:sodium-symporter-family-transporter
MLWIIMTFLLINAGIFIFSYLRTKDINLKTSDGYFLGGRSLTALYIGSSLLLTNLSTEQMVGLNGQSYSGTMSAMAWEVTAPLALIMLAFVFLPRYLSSGVTTIPDFLEKRYDQRTRQIVSILLLLGYATSFLPTVLYSGALVLDQVFNISSALGISTFATVFFISLVIGAASCCYIFFGGLKAAASADAIYGAGLILGGLFIFVLGIMAIGDGSLLNGYTELTSVHKEKLNAITADNAAEVPWPTIFTGLLVNNLFYWAVNQSIVQRALGAKNLAEGQKGALLAGVFKTIGVFYLVLPGVIAYHLYGGHIENADTVYPKLIVDLLPTALIGVFAAILFGAILSSFNGSLNSTITLFTLDLYKPIFKPEAKEEELVKTGRIFVVILAAVSIIIAPFILFAPSGLYNYLQEMFGFFNVPVLAAVVVGFFTKKVPALAVKWAIFAHIVLYTISKIYFGHIHFLYILAVLFPFSVLLMLFIGKLKPRPSEFKLEKNAKVDLRPWKHAKLASILVICLMACIYLLFSPWGLAK
>NC_021362.1|WP_020451770.1|2272854_2273664_-|LysM-peptidoglycan-binding-domain-containing-protein
MKKTFMSFVAVAALSSTAFGASASAKEVTVQKGDTLWGISQKQGVNLQDLKEWNQLSSDLIIPGQKLNVSEKQTEEKKQYTIKKGDTLWKIAQQFGVSVNDLKNWNNIKSDIIYPNTSITVDGQATVQAAAAQPAETKPAVQKEAKVEKAAPAPKQEKETASRSNKSQSSQSAAKELTVTATAYTANDGGMTGVTATGFDLNANKNAKIIAVDPNVIPLGSKVYVEGYGEATAADTGGAIKGNKIDVFVPSKSAAKNWGVKTVKVKVLK
>NC_021362.1|WP_020451771.1|2273900_2275682_-|DNA-helicase-RecQ
MLEKAEALLQHYYGYPSLRPGQKKAIQSVVSEKRDTACIMPTGGGKSICYQIPALLMEGTTIVISPLISLMKDQVDALNQLGIQAAYVNSSLGHGEIAERLSVLKEGGYKLFYVTPERLTSPDFIRVLSRIHIPLTAIDEAHCISQWGHDFRPSYRHIESFLNSLGTRPVVLALTATATPEVHEDICTQLGIEKESTVFTGFSRDNLTFKILKGENKDRFIESYVEKNRSEAGIIYTATRKEAERISSRLSQKGIAAGCYHGGMNDEERDRQQDLFLNDEISVMTATSAFGMGIDKSNIRYVIHAQIPKNMESYYQEAGRAGRDGLDSECILLFSPQDIRLQRFLIEQSTEDEDIRAQDVKKLRQMVDFCHTEGCLERFILSYFGEVSTEDCGRCSSCLDTRSITDVTKEAQMVLSCIIRMGERFGKTMVAQVLAGSKNKKVTENGFQQLSTYGILKNRSIADISDFIEFLIADEYIQMSDGTYPVLFVANKGRNVLLGREAVMRKEKMQTSQIVKDDELFERLRALRRKLAQEQGVPPFVIFSDETLREMSGKVPLTDEELLSVKGVGEQKRVKYGAVFLQELQAYKTEKEA
>NC_021362.1|WP_020451772.1|2275865_2276387_-|hypothetical-protein
MDWLEFVSATVQSLAWPATLMMCVLLLKEPLSERMKELIKLKYKDFELEFDKRLQKLVSVREKRLSGLTSVRSAPAGENMIESAWSDVHNVLRETASTFDQNAIRLEGDELIQMLHDRGMIQDDAASVLSELSALRRDASDRASITGALAYKTLCLEEAKRLQLLAEQQTAIK
>NC_021362.1|WP_011201670.1|2276800_2277028_+|YjfB-family-protein
MSKVLTSLTDTHVKEVVMLDIAVLSMAMSQAALYQNVQMSLTKTALDTAEQSAQQLVDMVQAPHPVSGHHIDLKG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_021362_2	2.46\|900945\|43\|NC_021362\|CRT	900945-900987	43	NC_021362.1	895803-895845	2	0.953
NC_021362_3	3.23\|904787\|47\|NC_021362\|CRT	904787-904833	47	NC_021362.1	904823-904869	2	0.957

1. spacer 2.46|900945|43|NC_021362|CRT matches to position: 895803-895845, mismatch: 2, identity: 0.953

cggaccgacgggagcgacaggtccaacgggagcgacaggaccg	CRISPR spacer
cggaccgacgggatcaacaggtccaacgggagcgacaggaccg	Protospacer
************* *.***************************

2. spacer 3.23|904787|47|NC_021362|CRT matches to position: 904823-904869, mismatch: 2, identity: 0.957

cccgacaggtccaactggcccgacaggtccaactggcccgacgggtc	CRISPR spacer
cccgacgggtccaactggcccgacaggtccaactggcccgacaggtc	Protospacer
******.***********************************.****

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_021362_2	2.49\|901125\|34\|NC_021362\|CRT	901125-901158	34	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71197-71230	1	0.971
NC_021362_2	2.37\|900504\|25\|NC_021362\|CRT	900504-900528	25	MN693189	Marine virus AFVG_25M326, complete genome	18873-18897	2	0.92
NC_021362_2	2.40\|900648\|25\|NC_021362\|CRT	900648-900672	25	NC_010180	Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence	116697-116721	2	0.92
NC_021362_2	2.40\|900648\|25\|NC_021362\|CRT	900648-900672	25	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125270-125294	2	0.92
NC_021362_2	2.43\|900801\|25\|NC_021362\|CRT	900801-900825	25	MN693189	Marine virus AFVG_25M326, complete genome	18873-18897	2	0.92
NC_021362_2	2.45\|900900\|25\|NC_021362\|CRT	900900-900924	25	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	244735-244759	2	0.92
NC_021362_2	2.45\|900900\|25\|NC_021362\|CRT	900900-900924	25	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125270-125294	2	0.92
NC_021362_2	2.45\|900900\|25\|NC_021362\|CRT	900900-900924	25	MG945435	UNVERIFIED: Microviridae sp. isolate 5111-1801, complete genome	1813-1837	2	0.92
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42516-42540	2	0.92
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	137917-137941	2	0.92
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179502-179526	2	0.92
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328208-328232	2	0.92
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4768-4792	2	0.92
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72756-72780	2	0.92
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53652-53676	2	0.92
NC_021362_3	3.4\|903482\|29\|NC_021362\|CRT	903482-903510	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72681-72709	2	0.931
NC_021362_3	3.13\|904058\|29\|NC_021362\|CRT	904058-904086	29	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3051385-3051413	2	0.931
NC_021362_3	3.13\|904058\|29\|NC_021362\|CRT	904058-904086	29	NC_021304	Streptomyces phage Sujidade, complete genome	17743-17771	2	0.931
NC_021362_2	2.30\|900090\|25\|NC_021362\|CRT	900090-900114	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73564-73588	3	0.88
NC_021362_2	2.36\|900459\|25\|NC_021362\|CRT	900459-900483	25	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321719-321743	3	0.88
NC_021362_2	2.36\|900459\|25\|NC_021362\|CRT	900459-900483	25	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321764-321788	3	0.88
NC_021362_2	2.36\|900459\|25\|NC_021362\|CRT	900459-900483	25	NZ_CP011146	Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence	35405-35429	3	0.88
NC_021362_2	2.36\|900459\|25\|NC_021362\|CRT	900459-900483	25	NZ_CP011146	Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence	35460-35484	3	0.88
NC_021362_2	2.36\|900459\|25\|NC_021362\|CRT	900459-900483	25	NZ_CP011146	Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence	35478-35502	3	0.88
NC_021362_2	2.36\|900459\|25\|NC_021362\|CRT	900459-900483	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	385-409	3	0.88
NC_021362_2	2.36\|900459\|25\|NC_021362\|CRT	900459-900483	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	430-454	3	0.88
NC_021362_2	2.36\|900459\|25\|NC_021362\|CRT	900459-900483	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72471-72495	3	0.88
NC_021362_2	2.36\|900459\|25\|NC_021362\|CRT	900459-900483	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72756-72780	3	0.88
NC_021362_2	2.40\|900648\|25\|NC_021362\|CRT	900648-900672	25	NC_010180	Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence	116733-116757	3	0.88
NC_021362_2	2.40\|900648\|25\|NC_021362\|CRT	900648-900672	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	161329-161353	3	0.88
NC_021362_2	2.42\|900756\|25\|NC_021362\|CRT	900756-900780	25	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321719-321743	3	0.88
NC_021362_2	2.42\|900756\|25\|NC_021362\|CRT	900756-900780	25	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321764-321788	3	0.88
NC_021362_2	2.42\|900756\|25\|NC_021362\|CRT	900756-900780	25	NZ_CP011146	Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence	35405-35429	3	0.88
NC_021362_2	2.42\|900756\|25\|NC_021362\|CRT	900756-900780	25	NZ_CP011146	Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence	35460-35484	3	0.88
NC_021362_2	2.42\|900756\|25\|NC_021362\|CRT	900756-900780	25	NZ_CP011146	Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence	35478-35502	3	0.88
NC_021362_2	2.42\|900756\|25\|NC_021362\|CRT	900756-900780	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	385-409	3	0.88
NC_021362_2	2.42\|900756\|25\|NC_021362\|CRT	900756-900780	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	430-454	3	0.88
NC_021362_2	2.42\|900756\|25\|NC_021362\|CRT	900756-900780	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72471-72495	3	0.88
NC_021362_2	2.42\|900756\|25\|NC_021362\|CRT	900756-900780	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72756-72780	3	0.88
NC_021362_2	2.45\|900900\|25\|NC_021362\|CRT	900900-900924	25	NC_006552	Pseudomonas phage F116, complete genome	32487-32511	3	0.88
NC_021362_2	2.45\|900900\|25\|NC_021362\|CRT	900900-900924	25	KC900378	Pseudomonas phage LKA5, complete genome	32179-32203	3	0.88
NC_021362_2	2.45\|900900\|25\|NC_021362\|CRT	900900-900924	25	MT118301	Pseudomonas phage Epa33, complete genome	30496-30520	3	0.88
NC_021362_2	2.45\|900900\|25\|NC_021362\|CRT	900900-900924	25	AY625898	Pseudomonas aeruginosa phage F116, complete genome	32487-32511	3	0.88
NC_021362_2	2.45\|900900\|25\|NC_021362\|CRT	900900-900924	25	LT603684	Pseudomonas phage phiC725A genome assembly	31810-31834	3	0.88
NC_021362_2	2.45\|900900\|25\|NC_021362\|CRT	900900-900924	25	MF490237	Pseudomonas phage vB_PaeP_E220, complete genome	41315-41339	3	0.88
NC_021362_2	2.45\|900900\|25\|NC_021362\|CRT	900900-900924	25	KM389216	UNVERIFIED: Pseudomonas phage F_ET605sp/Pa1651 clone contig00001 genomic sequence	34747-34771	3	0.88
NC_021362_2	2.45\|900900\|25\|NC_021362\|CRT	900900-900924	25	KM389247	UNVERIFIED: Pseudomonas phage JBD90 clone contig00001 genomic sequence	16331-16355	3	0.88
NC_021362_2	2.45\|900900\|25\|NC_021362\|CRT	900900-900924	25	MN693183	Marine virus AFVG_25M360, complete genome	15041-15065	3	0.88
NC_021362_2	2.54\|901404\|34\|NC_021362\|CRT	901404-901437	34	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73708-73741	3	0.912
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328190-328214	3	0.88
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4750-4774	3	0.88
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72588-72612	3	0.88
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	KY421186	Flavobacterium phage FL-1, complete genome	26692-26716	3	0.88
NC_021362_3	3.12\|904004\|29\|NC_021362\|CRT	904004-904032	29	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3051385-3051413	3	0.897
NC_021362_3	3.12\|904004\|29\|NC_021362\|CRT	904004-904032	29	NC_021304	Streptomyces phage Sujidade, complete genome	17743-17771	3	0.897
NC_021362_2	2.30\|900090\|25\|NC_021362\|CRT	900090-900114	25	MH727593	Acidovorax phage ACPWH, complete genome	3267-3291	4	0.84
NC_021362_2	2.36\|900459\|25\|NC_021362\|CRT	900459-900483	25	MT219824	Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence	246673-246697	4	0.84
NC_021362_2	2.36\|900459\|25\|NC_021362\|CRT	900459-900483	25	MT219824	Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence	246925-246949	4	0.84
NC_021362_2	2.36\|900459\|25\|NC_021362\|CRT	900459-900483	25	MT219824	Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence	246943-246967	4	0.84
NC_021362_2	2.37\|900504\|25\|NC_021362\|CRT	900504-900528	25	NZ_CP015065	Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence	553243-553267	4	0.84
NC_021362_2	2.37\|900504\|25\|NC_021362\|CRT	900504-900528	25	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	332707-332731	4	0.84
NC_021362_2	2.37\|900504\|25\|NC_021362\|CRT	900504-900528	25	MN693845	Marine virus AFVG_250M833, complete genome	16662-16686	4	0.84
NC_021362_2	2.37\|900504\|25\|NC_021362\|CRT	900504-900528	25	MN163280	Klebsiella phage KpGranit, complete genome	88472-88496	4	0.84
NC_021362_2	2.37\|900504\|25\|NC_021362\|CRT	900504-900528	25	NZ_CP032520	Cupriavidus oxalaticus strain T2 plasmid unnamed1, complete sequence	520599-520623	4	0.84
NC_021362_2	2.38\|900549\|25\|NC_021362\|CRT	900549-900573	25	MN693279	Marine virus AFVG_25M346, complete genome	16370-16394	4	0.84
NC_021362_2	2.40\|900648\|25\|NC_021362\|CRT	900648-900672	25	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125327-125351	4	0.84
NC_021362_2	2.40\|900648\|25\|NC_021362\|CRT	900648-900672	25	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125384-125408	4	0.84
NC_021362_2	2.40\|900648\|25\|NC_021362\|CRT	900648-900672	25	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125459-125483	4	0.84
NC_021362_2	2.40\|900648\|25\|NC_021362\|CRT	900648-900672	25	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125516-125540	4	0.84
NC_021362_2	2.40\|900648\|25\|NC_021362\|CRT	900648-900672	25	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125573-125597	4	0.84
NC_021362_2	2.40\|900648\|25\|NC_021362\|CRT	900648-900672	25	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125630-125654	4	0.84
NC_021362_2	2.40\|900648\|25\|NC_021362\|CRT	900648-900672	25	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125687-125711	4	0.84
NC_021362_2	2.40\|900648\|25\|NC_021362\|CRT	900648-900672	25	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125744-125768	4	0.84
NC_021362_2	2.40\|900648\|25\|NC_021362\|CRT	900648-900672	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	161167-161191	4	0.84
NC_021362_2	2.40\|900648\|25\|NC_021362\|CRT	900648-900672	25	NZ_CP044353	Xylella fastidiosa strain ATCC 35879 plasmid pXF879-41, complete sequence	29470-29494	4	0.84
NC_021362_2	2.42\|900756\|25\|NC_021362\|CRT	900756-900780	25	MT219824	Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence	246673-246697	4	0.84
NC_021362_2	2.42\|900756\|25\|NC_021362\|CRT	900756-900780	25	MT219824	Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence	246925-246949	4	0.84
NC_021362_2	2.42\|900756\|25\|NC_021362\|CRT	900756-900780	25	MT219824	Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence	246943-246967	4	0.84
NC_021362_2	2.43\|900801\|25\|NC_021362\|CRT	900801-900825	25	NZ_CP015065	Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence	553243-553267	4	0.84
NC_021362_2	2.43\|900801\|25\|NC_021362\|CRT	900801-900825	25	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	332707-332731	4	0.84
NC_021362_2	2.43\|900801\|25\|NC_021362\|CRT	900801-900825	25	MN693845	Marine virus AFVG_250M833, complete genome	16662-16686	4	0.84
NC_021362_2	2.43\|900801\|25\|NC_021362\|CRT	900801-900825	25	MN163280	Klebsiella phage KpGranit, complete genome	88472-88496	4	0.84
NC_021362_2	2.43\|900801\|25\|NC_021362\|CRT	900801-900825	25	NZ_CP032520	Cupriavidus oxalaticus strain T2 plasmid unnamed1, complete sequence	520599-520623	4	0.84
NC_021362_2	2.45\|900900\|25\|NC_021362\|CRT	900900-900924	25	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	253755-253779	4	0.84
NC_021362_2	2.45\|900900\|25\|NC_021362\|CRT	900900-900924	25	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	173348-173372	4	0.84
NC_021362_2	2.45\|900900\|25\|NC_021362\|CRT	900900-900924	25	MN693383	Marine virus AFVG_25M295, complete genome	21442-21466	4	0.84
NC_021362_2	2.45\|900900\|25\|NC_021362\|CRT	900900-900924	25	MN693263	Marine virus AFVG_25M296, complete genome	12050-12074	4	0.84
NC_021362_2	2.49\|901125\|34\|NC_021362\|CRT	901125-901158	34	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73555-73588	4	0.882
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42462-42486	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42534-42558	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42570-42594	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42606-42630	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42642-42666	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	137863-137887	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	137935-137959	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	137971-137995	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	138007-138031	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	138043-138067	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179448-179472	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179520-179544	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179556-179580	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179592-179616	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179628-179652	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	327938-327962	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	327974-327998	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328100-328124	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328136-328160	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328172-328196	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328280-328304	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328316-328340	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328352-328376	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4498-4522	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4534-4558	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4660-4684	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4696-4720	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4732-4756	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4840-4864	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4876-4900	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4912-4936	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53526-53550	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53562-53586	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53598-53622	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53634-53658	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53706-53730	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	179082-179106	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	270983-271007	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP011358	Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence	19889-19913	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP011358	Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence	20033-20057	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP013057	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence	16875-16899	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP013057	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence	17019-17043	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP013058	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence	80743-80767	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP013058	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence	80887-80911	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP011146	Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence	35405-35429	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP011146	Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence	35460-35484	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP011146	Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence	35478-35502	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP004875	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence	76830-76854	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP004875	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence	76974-76998	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP011357	Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence	8466-8490	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP011357	Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence	8610-8634	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	1388856-1388880	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP015155	Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence	23085-23109	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP015155	Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence	23229-23253	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP015156	Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence	88987-89011	4	0.84
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP015156	Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence	89131-89155	4	0.84
NC_021362_3	3.4\|903482\|29\|NC_021362\|CRT	903482-903510	29	NC_010180	Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence	116700-116728	4	0.862
NC_021362_3	3.12\|904004\|29\|NC_021362\|CRT	904004-904032	29	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3051349-3051377	4	0.862
NC_021362_3	3.13\|904058\|29\|NC_021362\|CRT	904058-904086	29	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3051349-3051377	4	0.862
NC_021362_3	3.13\|904058\|29\|NC_021362\|CRT	904058-904086	29	NC_048029	Sphingomonas phage Scott isolate SPS, complete genome	4951-4979	4	0.862
NC_021362_3	3.13\|904058\|29\|NC_021362\|CRT	904058-904086	29	NC_048029	Sphingomonas phage Scott isolate SPS, complete genome	4969-4997	4	0.862
NC_021362_3	3.14\|904112\|29\|NC_021362\|CRT	904112-904140	29	NZ_CP033971	Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence	251784-251812	4	0.862
NC_021362_3	3.20\|904571\|38\|NC_021362\|CRT	904571-904608	38	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251919-251956	4	0.895
NC_021362_2	2.37\|900504\|25\|NC_021362\|CRT	900504-900528	25	NZ_CP016367	Phaeobacter porticola strain P97 plasmid pP97_c, complete sequence	50653-50677	5	0.8
NC_021362_2	2.38\|900549\|25\|NC_021362\|CRT	900549-900573	25	NZ_CP018232	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed4, complete sequence	258268-258292	5	0.8
NC_021362_2	2.38\|900549\|25\|NC_021362\|CRT	900549-900573	25	NZ_CP016291	Rhizobium leguminosarum strain Vaf10 plasmid unnamed6, complete sequence	74695-74719	5	0.8
NC_021362_2	2.43\|900801\|25\|NC_021362\|CRT	900801-900825	25	NZ_CP016367	Phaeobacter porticola strain P97 plasmid pP97_c, complete sequence	50653-50677	5	0.8
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP053936	Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed4, complete sequence	11643-11667	5	0.8
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP053933	Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed2, complete sequence	41513-41537	5	0.8
NC_021362_2	2.58\|901656\|25\|NC_021362\|CRT	901656-901680	25	NZ_CP009718	Bacillus thuringiensis strain HD682 plasmid pBGN_2, complete sequence	15505-15529	5	0.8
NC_021362_3	3.4\|903482\|29\|NC_021362\|CRT	903482-903510	29	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	515451-515479	5	0.828
NC_021362_3	3.12\|904004\|29\|NC_021362\|CRT	904004-904032	29	NC_048029	Sphingomonas phage Scott isolate SPS, complete genome	4951-4979	5	0.828
NC_021362_3	3.12\|904004\|29\|NC_021362\|CRT	904004-904032	29	NC_048029	Sphingomonas phage Scott isolate SPS, complete genome	4969-4997	5	0.828
NC_021362_3	3.14\|904112\|29\|NC_021362\|CRT	904112-904140	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72411-72439	5	0.828
NC_021362_2	2.34\|900333\|34\|NC_021362\|CRT	900333-900366	34	MT219824	Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence	246943-246976	6	0.824
NC_021362_2	2.34\|900333\|34\|NC_021362\|CRT	900333-900366	34	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125468-125501	6	0.824
NC_021362_2	2.39\|900594\|34\|NC_021362\|CRT	900594-900627	34	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	17226-17259	6	0.824
NC_021362_2	2.39\|900594\|34\|NC_021362\|CRT	900594-900627	34	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	14826-14859	6	0.824
NC_021362_2	2.39\|900594\|34\|NC_021362\|CRT	900594-900627	34	AP013564	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, * SEQUENCING IN PROGRESS *, 4 ordered pieces	9269-9302	6	0.824
NC_021362_2	2.39\|900594\|34\|NC_021362\|CRT	900594-900627	34	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	9099-9132	6	0.824
NC_021362_2	2.39\|900594\|34\|NC_021362\|CRT	900594-900627	34	AP013943	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, * SEQUENCING IN PROGRESS *	9871-9904	6	0.824
NC_021362_2	2.39\|900594\|34\|NC_021362\|CRT	900594-900627	34	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	4568-4601	6	0.824
NC_021362_2	2.51\|901242\|34\|NC_021362\|CRT	901242-901275	34	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251907-251940	6	0.824
NC_021362_3	3.4\|903482\|29\|NC_021362\|CRT	903482-903510	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73702-73730	6	0.793
NC_021362_3	3.4\|903482\|29\|NC_021362\|CRT	903482-903510	29	NZ_CP053933	Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed2, complete sequence	41402-41430	6	0.793
NC_021362_3	3.4\|903482\|29\|NC_021362\|CRT	903482-903510	29	NZ_CP053936	Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed4, complete sequence	11750-11778	6	0.793
NC_021362_3	3.4\|903482\|29\|NC_021362\|CRT	903482-903510	29	NZ_CP009718	Bacillus thuringiensis strain HD682 plasmid pBGN_2, complete sequence	15394-15422	6	0.793
NC_021362_3	3.4\|903482\|29\|NC_021362\|CRT	903482-903510	29	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	545-573	6	0.793
NC_021362_3	3.4\|903482\|29\|NC_021362\|CRT	903482-903510	29	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	1166-1194	6	0.793
NC_021362_3	3.4\|903482\|29\|NC_021362\|CRT	903482-903510	29	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	648064-648092	6	0.793
NC_021362_3	3.12\|904004\|29\|NC_021362\|CRT	904004-904032	29	NZ_CP011054	Halomonas sp. KO116 plasmid unnamed2, complete sequence	48395-48423	6	0.793
NC_021362_3	3.13\|904058\|29\|NC_021362\|CRT	904058-904086	29	NZ_CP011054	Halomonas sp. KO116 plasmid unnamed2, complete sequence	48395-48423	6	0.793
NC_021362_3	3.14\|904112\|29\|NC_021362\|CRT	904112-904140	29	NZ_CP016082	Streptomyces sp. SAT1 plasmid unnamed2, complete sequence	220862-220890	6	0.793
NC_021362_3	3.14\|904112\|29\|NC_021362\|CRT	904112-904140	29	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	1460513-1460541	6	0.793
NC_021362_3	3.14\|904112\|29\|NC_021362\|CRT	904112-904140	29	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	671859-671887	6	0.793
NC_021362_2	2.49\|901125\|34\|NC_021362\|CRT	901125-901158	34	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72615-72648	7	0.794
NC_021362_2	2.52\|901296\|34\|NC_021362\|CRT	901296-901329	34	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	472754-472787	7	0.794
NC_021362_2	2.53\|901350\|34\|NC_021362\|CRT	901350-901383	34	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	472754-472787	7	0.794
NC_021362_3	3.4\|903482\|29\|NC_021362\|CRT	903482-903510	29	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1423777-1423805	7	0.759
NC_021362_3	3.11\|903941\|38\|NC_021362\|CRT	903941-903978	38	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	235991-236028	7	0.816
NC_021362_3	3.12\|904004\|29\|NC_021362\|CRT	904004-904032	29	NZ_CP033971	Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence	251658-251686	7	0.759
NC_021362_3	3.13\|904058\|29\|NC_021362\|CRT	904058-904086	29	NZ_CP033971	Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence	251658-251686	7	0.759
NC_021362_3	3.14\|904112\|29\|NC_021362\|CRT	904112-904140	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71380-71408	7	0.759
NC_021362_3	3.14\|904112\|29\|NC_021362\|CRT	904112-904140	29	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72483-72511	7	0.759
NC_021362_2	2.39\|900594\|34\|NC_021362\|CRT	900594-900627	34	NZ_CP040453	Halomonas sp. PA16-9 plasmid p_unnamed2, complete sequence	129584-129617	8	0.765
NC_021362_2	2.47\|901008\|34\|NC_021362\|CRT	901008-901041	34	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	485064-485097	8	0.765
NC_021362_2	2.49\|901125\|34\|NC_021362\|CRT	901125-901158	34	NC_014025	Bacillus megaterium QM B1551 plasmid pBM500, complete sequence	52502-52535	8	0.765
NC_021362_2	2.49\|901125\|34\|NC_021362\|CRT	901125-901158	34	NC_014025	Bacillus megaterium QM B1551 plasmid pBM500, complete sequence	52736-52769	8	0.765
NC_021362_2	2.51\|901242\|34\|NC_021362\|CRT	901242-901275	34	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71524-71557	8	0.765
NC_021362_2	2.54\|901404\|34\|NC_021362\|CRT	901404-901437	34	NZ_CP053689	Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence	173229-173262	8	0.765
NC_021362_2	2.55\|901458\|34\|NC_021362\|CRT	901458-901491	34	NZ_CP053689	Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence	173229-173262	8	0.765
NC_021362_3	3.5\|903536\|38\|NC_021362\|CRT	903536-903573	38	MN694114	Marine virus AFVG_250M252, complete genome	19685-19722	8	0.789
NC_021362_3	3.19\|904499\|47\|NC_021362\|CRT	904499-904545	47	MN694114	Marine virus AFVG_250M252, complete genome	19685-19731	8	0.83
NC_021362_2	2.27\|899865\|43\|NC_021362\|CRT	899865-899907	43	MN694114	Marine virus AFVG_250M252, complete genome	19682-19724	9	0.791
NC_021362_2	2.34\|900333\|34\|NC_021362\|CRT	900333-900366	34	NZ_CP019235	Bacillus thuringiensis strain YGd22-03 plasmid pYGD98, complete sequence	19530-19563	9	0.735
NC_021362_2	2.34\|900333\|34\|NC_021362\|CRT	900333-900366	34	NZ_CP019235	Bacillus thuringiensis strain YGd22-03 plasmid pYGD98, complete sequence	19602-19635	9	0.735
NC_021362_2	2.34\|900333\|34\|NC_021362\|CRT	900333-900366	34	NZ_CP019235	Bacillus thuringiensis strain YGd22-03 plasmid pYGD98, complete sequence	19638-19671	9	0.735
NC_021362_2	2.34\|900333\|34\|NC_021362\|CRT	900333-900366	34	NZ_CP019235	Bacillus thuringiensis strain YGd22-03 plasmid pYGD98, complete sequence	19674-19707	9	0.735
NC_021362_2	2.34\|900333\|34\|NC_021362\|CRT	900333-900366	34	NZ_CP019235	Bacillus thuringiensis strain YGd22-03 plasmid pYGD98, complete sequence	19710-19743	9	0.735
NC_021362_2	2.34\|900333\|34\|NC_021362\|CRT	900333-900366	34	NZ_CP019235	Bacillus thuringiensis strain YGd22-03 plasmid pYGD98, complete sequence	19746-19779	9	0.735
NC_021362_2	2.34\|900333\|34\|NC_021362\|CRT	900333-900366	34	NZ_CP019235	Bacillus thuringiensis strain YGd22-03 plasmid pYGD98, complete sequence	19782-19815	9	0.735
NC_021362_2	2.47\|901008\|34\|NC_021362\|CRT	901008-901041	34	MK524530	Mycobacterium phage Pharaoh, complete genome	5141-5174	9	0.735
NC_021362_2	2.49\|901125\|34\|NC_021362\|CRT	901125-901158	34	NC_014025	Bacillus megaterium QM B1551 plasmid pBM500, complete sequence	52412-52445	9	0.735
NC_021362_3	3.20\|904571\|38\|NC_021362\|CRT	904571-904608	38	KY421186	Flavobacterium phage FL-1, complete genome	26874-26911	9	0.763
NC_021362_2	2.34\|900333\|34\|NC_021362\|CRT	900333-900366	34	NZ_CP019235	Bacillus thuringiensis strain YGd22-03 plasmid pYGD98, complete sequence	19566-19599	10	0.706
NC_021362_2	2.39\|900594\|34\|NC_021362\|CRT	900594-900627	34	AB981169	Ralstonia phage RSY1 DNA, complete genome	1009-1042	10	0.706
NC_021362_3	3.5\|903536\|38\|NC_021362\|CRT	903536-903573	38	NZ_CP011054	Halomonas sp. KO116 plasmid unnamed2, complete sequence	48386-48423	10	0.737
NC_021362_2	2.47\|901008\|34\|NC_021362\|CRT	901008-901041	34	MH271316	Microbacterium phage Tandem, complete genome	19422-19455	11	0.676
NC_021362_2	2.47\|901008\|34\|NC_021362\|CRT	901008-901041	34	MH271310	Microbacterium phage Pioneer3, complete genome	19483-19516	11	0.676
NC_021362_2	2.47\|901008\|34\|NC_021362\|CRT	901008-901041	34	MK376963	Microbacterium phage Alleb, complete genome	19486-19519	11	0.676
NC_021362_2	2.47\|901008\|34\|NC_021362\|CRT	901008-901041	34	MH271307	Microbacterium phage OlinDD, complete genome	19499-19532	11	0.676
NC_021362_2	2.47\|901008\|34\|NC_021362\|CRT	901008-901041	34	MH271300	Microbacterium phage Hortus1, complete genome	19500-19533	11	0.676
NC_021362_3	3.20\|904571\|38\|NC_021362\|CRT	904571-904608	38	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	252018-252055	11	0.711
NC_021362_2	2.52\|901296\|34\|NC_021362\|CRT	901296-901329	34	MK649828	Klebsiella pneumoniae strain 1675479 plasmid p1675479_1, complete sequence	57324-57357	12	0.647
NC_021362_2	2.52\|901296\|34\|NC_021362\|CRT	901296-901329	34	NZ_CP041094	Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH01 plasmid unnamed2, complete sequence	84319-84352	12	0.647
NC_021362_2	2.53\|901350\|34\|NC_021362\|CRT	901350-901383	34	MK649828	Klebsiella pneumoniae strain 1675479 plasmid p1675479_1, complete sequence	57324-57357	12	0.647
NC_021362_2	2.53\|901350\|34\|NC_021362\|CRT	901350-901383	34	NZ_CP041094	Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH01 plasmid unnamed2, complete sequence	84319-84352	12	0.647
NC_021362_3	3.3\|903410\|47\|NC_021362\|CRT	903410-903456	47	MN694114	Marine virus AFVG_250M252, complete genome	19685-19731	12	0.745

1. spacer 2.49|901125|34|NC_021362|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 1, identity: 0.971

aggtgcaacgggagcaaccggagcgaccggagca	CRISPR spacer
tggtgcaacgggagcaaccggagcgaccggagca	Protospacer
 *********************************

2. spacer 2.37|900504|25|NC_021362|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 2, identity: 0.92

cggggcaacaggtgcaactggatca	CRISPR spacer
tggagcaacaggtgcaactggatca	Protospacer
.**.*********************

3. spacer 2.40|900648|25|NC_021362|CRT matches to NC_010180 (Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence) position: , mismatch: 2, identity: 0.92

aggcccaacaggtccaacgggagcc	CRISPR spacer
aggcccaaccggtccaacgggagca	Protospacer
********* **************

4. spacer 2.40|900648|25|NC_021362|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

aggcccaacaggtccaacgggagcc	CRISPR spacer
aggctcaacaggtccaacgggagca	Protospacer
****.*******************

5. spacer 2.43|900801|25|NC_021362|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 2, identity: 0.92

cggggcaacaggtgcaactggatca	CRISPR spacer
tggagcaacaggtgcaactggatca	Protospacer
.**.*********************

6. spacer 2.45|900900|25|NC_021362|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

aggctcaacaggcccaacaggagca	CRISPR spacer
aggatcaacaggcccaacaggacca	Protospacer
*** ****************** **

7. spacer 2.45|900900|25|NC_021362|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

aggctcaacaggcccaacaggagca	CRISPR spacer
aggctcaacaggtccaacgggagca	Protospacer
************.*****.******

8. spacer 2.45|900900|25|NC_021362|CRT matches to MG945435 (UNVERIFIED: Microviridae sp. isolate 5111-1801, complete genome) position: , mismatch: 2, identity: 0.92

aggctcaacaggcccaacaggagca	CRISPR spacer
aggctcaacaggctcagcaggagca	Protospacer
*************.**.********

9. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 2, identity: 0.92

cggagcaacgggtccaaccggagcg	CRISPR spacer
cggagcaacaggtcctaccggagcg	Protospacer
*********.***** *********

10. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 2, identity: 0.92

cggagcaacgggtccaaccggagcg	CRISPR spacer
cggagcaacaggtcctaccggagcg	Protospacer
*********.***** *********

11. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.92

cggagcaacgggtccaaccggagcg	CRISPR spacer
cggagcaacaggtcctaccggagcg	Protospacer
*********.***** *********

12. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.92

cggagcaacgggtccaaccggagcg	CRISPR spacer
cggagcaacaggtcctaccggagcg	Protospacer
*********.***** *********

13. spacer 2.58|901656|25|NC_021362|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 2, identity: 0.92

cggagcaacgggtccaaccggagcg	CRISPR spacer
cggagcaacaggtcctaccggagcg	Protospacer
*********.***** *********

14. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.92

cggagcaacgggtccaaccggagcg	CRISPR spacer
cggagcaacgggtgcaacaggagcg	Protospacer
************* **** ******

15. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 2, identity: 0.92

cggagcaacgggtccaaccggagcg	CRISPR spacer
cggagcaacaggtcctaccggagcg	Protospacer
*********.***** *********

16. spacer 3.4|903482|29|NC_021362|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.931

tccaaccggtccgacgggagcaaccggtc	CRISPR spacer
tccaaccggtccgactggagcaacgggtc	Protospacer
*************** ******** ****

17. spacer 3.13|904058|29|NC_021362|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 2, identity: 0.931

agcgacaggcgcaaccggagcgacaggcg	CRISPR spacer
agcgaccggcgcaaccggagcgactggcg	Protospacer
****** ***************** ****

18. spacer 3.13|904058|29|NC_021362|CRT matches to NC_021304 (Streptomyces phage Sujidade, complete genome) position: , mismatch: 2, identity: 0.931

agcgacaggcgcaaccggagcgacaggcg	CRISPR spacer
agcgaccggcgcaaccggagcgaccggcg	Protospacer
****** ***************** ****

19. spacer 2.30|900090|25|NC_021362|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cggcgcaacgggagcgacgggtcca	CRISPR spacer
gggagcaacgggagcgaccggtcca	Protospacer
 ** ************** ******

20. spacer 2.36|900459|25|NC_021362|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.88

cggagcgacgggtccaacaggagca	CRISPR spacer
aggagtgacggggccaacaggagca	Protospacer
 ****.****** ************

21. spacer 2.36|900459|25|NC_021362|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.88

cggagcgacgggtccaacaggagca	CRISPR spacer
aggagtgacggggccaacaggagca	Protospacer
 ****.****** ************

22. spacer 2.36|900459|25|NC_021362|CRT matches to NZ_CP011146 (Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence) position: , mismatch: 3, identity: 0.88

cggagcgacgggtccaacaggagca	CRISPR spacer
aggagcaacgggcccaacaggagca	Protospacer
 *****.*****.************

23. spacer 2.36|900459|25|NC_021362|CRT matches to NZ_CP011146 (Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence) position: , mismatch: 3, identity: 0.88

cggagcgacgggtccaacaggagca	CRISPR spacer
aggagcaacgggtccaacaggaaca	Protospacer
 *****.***************.**

24. spacer 2.36|900459|25|NC_021362|CRT matches to NZ_CP011146 (Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence) position: , mismatch: 3, identity: 0.88

cggagcgacgggtccaacaggagca	CRISPR spacer
aggagcaacgggcccaacaggagca	Protospacer
 *****.*****.************

25. spacer 2.36|900459|25|NC_021362|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.88

cggagcgacgggtccaacaggagca	CRISPR spacer
aggagtgacggggccaacaggagca	Protospacer
 ****.****** ************

26. spacer 2.36|900459|25|NC_021362|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.88

cggagcgacgggtccaacaggagca	CRISPR spacer
aggagtgacggggccaacaggagca	Protospacer
 ****.****** ************

27. spacer 2.36|900459|25|NC_021362|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cggagcgacgggtccaacaggagca	CRISPR spacer
gggagcgacgggtgaaacaggagca	Protospacer
 ************  **********

28. spacer 2.36|900459|25|NC_021362|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cggagcgacgggtccaacaggagca	CRISPR spacer
cggagcaacgggtgcaacaggagcg	Protospacer
******.****** **********.

29. spacer 2.40|900648|25|NC_021362|CRT matches to NC_010180 (Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence) position: , mismatch: 3, identity: 0.88

aggcccaacaggtccaacgggagcc	CRISPR spacer
aggcccaaccggtccaacgggagaa	Protospacer
********* *************

30. spacer 2.40|900648|25|NC_021362|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

aggcccaacaggtccaacgggagcc	CRISPR spacer
aggcccaacaggtcctgcgggaggc	Protospacer
*************** .****** *

31. spacer 2.42|900756|25|NC_021362|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.88

cggagcgacgggtccaacaggagca	CRISPR spacer
aggagtgacggggccaacaggagca	Protospacer
 ****.****** ************

32. spacer 2.42|900756|25|NC_021362|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.88

cggagcgacgggtccaacaggagca	CRISPR spacer
aggagtgacggggccaacaggagca	Protospacer
 ****.****** ************

33. spacer 2.42|900756|25|NC_021362|CRT matches to NZ_CP011146 (Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence) position: , mismatch: 3, identity: 0.88

cggagcgacgggtccaacaggagca	CRISPR spacer
aggagcaacgggcccaacaggagca	Protospacer
 *****.*****.************

34. spacer 2.42|900756|25|NC_021362|CRT matches to NZ_CP011146 (Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence) position: , mismatch: 3, identity: 0.88

cggagcgacgggtccaacaggagca	CRISPR spacer
aggagcaacgggtccaacaggaaca	Protospacer
 *****.***************.**

35. spacer 2.42|900756|25|NC_021362|CRT matches to NZ_CP011146 (Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence) position: , mismatch: 3, identity: 0.88

cggagcgacgggtccaacaggagca	CRISPR spacer
aggagcaacgggcccaacaggagca	Protospacer
 *****.*****.************

36. spacer 2.42|900756|25|NC_021362|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.88

cggagcgacgggtccaacaggagca	CRISPR spacer
aggagtgacggggccaacaggagca	Protospacer
 ****.****** ************

37. spacer 2.42|900756|25|NC_021362|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.88

cggagcgacgggtccaacaggagca	CRISPR spacer
aggagtgacggggccaacaggagca	Protospacer
 ****.****** ************

38. spacer 2.42|900756|25|NC_021362|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cggagcgacgggtccaacaggagca	CRISPR spacer
gggagcgacgggtgaaacaggagca	Protospacer
 ************  **********

39. spacer 2.42|900756|25|NC_021362|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cggagcgacgggtccaacaggagca	CRISPR spacer
cggagcaacgggtgcaacaggagcg	Protospacer
******.****** **********.

40. spacer 2.45|900900|25|NC_021362|CRT matches to NC_006552 (Pseudomonas phage F116, complete genome) position: , mismatch: 3, identity: 0.88

aggctcaacaggcccaacaggagca	CRISPR spacer
aggctcagcaggcccagcaggagcg	Protospacer
*******.********.*******.

41. spacer 2.45|900900|25|NC_021362|CRT matches to KC900378 (Pseudomonas phage LKA5, complete genome) position: , mismatch: 3, identity: 0.88

aggctcaacaggcccaacaggagca	CRISPR spacer
aggctcagcaggcccagcaggagcg	Protospacer
*******.********.*******.

42. spacer 2.45|900900|25|NC_021362|CRT matches to MT118301 (Pseudomonas phage Epa33, complete genome) position: , mismatch: 3, identity: 0.88

aggctcaacaggcccaacaggagca	CRISPR spacer
aggctcagcaggcccagcaggagcg	Protospacer
*******.********.*******.

43. spacer 2.45|900900|25|NC_021362|CRT matches to AY625898 (Pseudomonas aeruginosa phage F116, complete genome) position: , mismatch: 3, identity: 0.88

aggctcaacaggcccaacaggagca	CRISPR spacer
aggctcagcaggcccagcaggagcg	Protospacer
*******.********.*******.

44. spacer 2.45|900900|25|NC_021362|CRT matches to LT603684 (Pseudomonas phage phiC725A genome assembly) position: , mismatch: 3, identity: 0.88

aggctcaacaggcccaacaggagca	CRISPR spacer
aggctcagcaggcccagcaggagcg	Protospacer
*******.********.*******.

45. spacer 2.45|900900|25|NC_021362|CRT matches to MF490237 (Pseudomonas phage vB_PaeP_E220, complete genome) position: , mismatch: 3, identity: 0.88

aggctcaacaggcccaacaggagca	CRISPR spacer
aggctcagcaggcccagcaggagcg	Protospacer
*******.********.*******.

46. spacer 2.45|900900|25|NC_021362|CRT matches to KM389216 (UNVERIFIED: Pseudomonas phage F_ET605sp/Pa1651 clone contig00001 genomic sequence) position: , mismatch: 3, identity: 0.88

aggctcaacaggcccaacaggagca	CRISPR spacer
aggctcagcaggcccagcaggagcg	Protospacer
*******.********.*******.

47. spacer 2.45|900900|25|NC_021362|CRT matches to KM389247 (UNVERIFIED: Pseudomonas phage JBD90 clone contig00001 genomic sequence) position: , mismatch: 3, identity: 0.88

aggctcaacaggcccaacaggagca	CRISPR spacer
aggctcagcaggcccagcaggagcg	Protospacer
*******.********.*******.

48. spacer 2.45|900900|25|NC_021362|CRT matches to MN693183 (Marine virus AFVG_25M360, complete genome) position: , mismatch: 3, identity: 0.88

aggctcaacaggcccaacaggagca	CRISPR spacer
aggcccaacaggcccaacagggcca	Protospacer
****.****************. **

49. spacer 2.54|901404|34|NC_021362|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.912

aggcccaacgggagcaaccggcccgacaggagca	CRISPR spacer
cggcccaacgggagcaaccggcccaacgggagca	Protospacer
 ***********************.**.******

50. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

cggagcaacgggtccaaccggagcg	CRISPR spacer
cggagcaacaggtcctaccggagca	Protospacer
*********.***** ********.

51. spacer 2.58|901656|25|NC_021362|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 3, identity: 0.88

cggagcaacgggtccaaccggagcg	CRISPR spacer
cggagcaacaggtcctaccggagca	Protospacer
*********.***** ********.

52. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cggagcaacgggtccaaccggagcg	CRISPR spacer
cggagcaacgggtgcaacgggagca	Protospacer
************* **** *****.

53. spacer 2.58|901656|25|NC_021362|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 3, identity: 0.88

cggagcaacgggtccaaccggagcg	CRISPR spacer
cggagcaacgggagcaaccggagca	Protospacer
************  **********.

54. spacer 3.12|904004|29|NC_021362|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 3, identity: 0.897

agcgacaggcgcaaccggagcgacaggag	CRISPR spacer
agcgaccggcgcaaccggagcgactggcg	Protospacer
****** ***************** ** *

55. spacer 3.12|904004|29|NC_021362|CRT matches to NC_021304 (Streptomyces phage Sujidade, complete genome) position: , mismatch: 3, identity: 0.897

agcgacaggcgcaaccggagcgacaggag	CRISPR spacer
agcgaccggcgcaaccggagcgaccggcg	Protospacer
****** ***************** ** *

56. spacer 2.30|900090|25|NC_021362|CRT matches to MH727593 (Acidovorax phage ACPWH, complete genome) position: , mismatch: 4, identity: 0.84

cggcgcaacgggagcgacgggtcca	CRISPR spacer
gggcgaaacgggagcgacgggttct	Protospacer
 **** ****************.*

57. spacer 2.36|900459|25|NC_021362|CRT matches to MT219824 (Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcgacgggtccaacaggagca	CRISPR spacer
aggagcgactggtcctacaggagcg	Protospacer
 ******** ***** ********.

58. spacer 2.36|900459|25|NC_021362|CRT matches to MT219824 (Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcgacgggtccaacaggagca	CRISPR spacer
aggagcgactggtcctacaggagcg	Protospacer
 ******** ***** ********.

59. spacer 2.36|900459|25|NC_021362|CRT matches to MT219824 (Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcgacgggtccaacaggagca	CRISPR spacer
aggagcgacaggtcctacaggagcg	Protospacer
 ********.***** ********.

60. spacer 2.37|900504|25|NC_021362|CRT matches to NZ_CP015065 (Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence) position: , mismatch: 4, identity: 0.84

cggggcaacaggtgcaactggatca	CRISPR spacer
tggggcaacaggttcgactggatcg	Protospacer
.************ *.********.

61. spacer 2.37|900504|25|NC_021362|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

cggggcaacaggtgcaactggatca	CRISPR spacer
cggcggaacaggtgcaactggatgt	Protospacer
*** * *****************

62. spacer 2.37|900504|25|NC_021362|CRT matches to MN693845 (Marine virus AFVG_250M833, complete genome) position: , mismatch: 4, identity: 0.84

cggggcaacaggtgcaactggatca	CRISPR spacer
gggggcatcaggtggaactggatct	Protospacer
 ****** ****** *********

63. spacer 2.37|900504|25|NC_021362|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.84

cggggcaacaggtgcaactggatca	CRISPR spacer
aggggcaactggtgcaactggaccg	Protospacer
 ******** ************.*.

64. spacer 2.37|900504|25|NC_021362|CRT matches to NZ_CP032520 (Cupriavidus oxalaticus strain T2 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

cggggcaacaggtgcaactggatca	CRISPR spacer
cggcggaacaggtgcaactggatgt	Protospacer
*** * *****************

65. spacer 2.38|900549|25|NC_021362|CRT matches to MN693279 (Marine virus AFVG_25M346, complete genome) position: , mismatch: 4, identity: 0.84

aggtccaataggagccacgggagcg	CRISPR spacer
tggtccaacaggagcaacgggagct	Protospacer
 *******.****** ********

66. spacer 2.40|900648|25|NC_021362|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

aggcccaacaggtccaacgggagcc	CRISPR spacer
tggtccaccaggtccaacgggagca	Protospacer
 **.*** ****************

67. spacer 2.40|900648|25|NC_021362|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

aggcccaacaggtccaacgggagcc	CRISPR spacer
tggtccaccaggtccaacgggagca	Protospacer
 **.*** ****************

68. spacer 2.40|900648|25|NC_021362|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

aggcccaacaggtccaacgggagcc	CRISPR spacer
tggtccaccaggtccaacgggagcg	Protospacer
 **.*** ****************

69. spacer 2.40|900648|25|NC_021362|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

aggcccaacaggtccaacgggagcc	CRISPR spacer
tggtccaccaggtccaacgggagca	Protospacer
 **.*** ****************

70. spacer 2.40|900648|25|NC_021362|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

aggcccaacaggtccaacgggagcc	CRISPR spacer
tggtccaccaggtccaacgggagca	Protospacer
 **.*** ****************

71. spacer 2.40|900648|25|NC_021362|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

aggcccaacaggtccaacgggagcc	CRISPR spacer
tggtccaccaggtccaacgggagca	Protospacer
 **.*** ****************

72. spacer 2.40|900648|25|NC_021362|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

aggcccaacaggtccaacgggagcc	CRISPR spacer
tggtccaccaggtccaacgggagca	Protospacer
 **.*** ****************

73. spacer 2.40|900648|25|NC_021362|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

aggcccaacaggtccaacgggagcc	CRISPR spacer
tggtccaccaggtccaacgggagca	Protospacer
 **.*** ****************

74. spacer 2.40|900648|25|NC_021362|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.84

aggcccaacaggtccaacgggagcc	CRISPR spacer
aggaccaacaggtccatcgggagta	Protospacer
*** ************ ******.

75. spacer 2.40|900648|25|NC_021362|CRT matches to NZ_CP044353 (Xylella fastidiosa strain ATCC 35879 plasmid pXF879-41, complete sequence) position: , mismatch: 4, identity: 0.84

aggcccaacaggtccaacgggagcc	CRISPR spacer
tgaaccaacagttccaacgggagcc	Protospacer
 *. ******* *************

76. spacer 2.42|900756|25|NC_021362|CRT matches to MT219824 (Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcgacgggtccaacaggagca	CRISPR spacer
aggagcgactggtcctacaggagcg	Protospacer
 ******** ***** ********.

77. spacer 2.42|900756|25|NC_021362|CRT matches to MT219824 (Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcgacgggtccaacaggagca	CRISPR spacer
aggagcgactggtcctacaggagcg	Protospacer
 ******** ***** ********.

78. spacer 2.42|900756|25|NC_021362|CRT matches to MT219824 (Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcgacgggtccaacaggagca	CRISPR spacer
aggagcgacaggtcctacaggagcg	Protospacer
 ********.***** ********.

79. spacer 2.43|900801|25|NC_021362|CRT matches to NZ_CP015065 (Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence) position: , mismatch: 4, identity: 0.84

cggggcaacaggtgcaactggatca	CRISPR spacer
tggggcaacaggttcgactggatcg	Protospacer
.************ *.********.

80. spacer 2.43|900801|25|NC_021362|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

cggggcaacaggtgcaactggatca	CRISPR spacer
cggcggaacaggtgcaactggatgt	Protospacer
*** * *****************

81. spacer 2.43|900801|25|NC_021362|CRT matches to MN693845 (Marine virus AFVG_250M833, complete genome) position: , mismatch: 4, identity: 0.84

cggggcaacaggtgcaactggatca	CRISPR spacer
gggggcatcaggtggaactggatct	Protospacer
 ****** ****** *********

82. spacer 2.43|900801|25|NC_021362|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.84

cggggcaacaggtgcaactggatca	CRISPR spacer
aggggcaactggtgcaactggaccg	Protospacer
 ******** ************.*.

83. spacer 2.43|900801|25|NC_021362|CRT matches to NZ_CP032520 (Cupriavidus oxalaticus strain T2 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

cggggcaacaggtgcaactggatca	CRISPR spacer
cggcggaacaggtgcaactggatgt	Protospacer
*** * *****************

84. spacer 2.45|900900|25|NC_021362|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 4, identity: 0.84

aggctcaacaggcccaacaggagca	CRISPR spacer
tggcccaacaggcccaacaggaccc	Protospacer
 ***.***************** *

85. spacer 2.45|900900|25|NC_021362|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 4, identity: 0.84

aggctcaacaggcccaacaggagca	CRISPR spacer
tggcccaacaggcccaacaggacct	Protospacer
 ***.***************** *

86. spacer 2.45|900900|25|NC_021362|CRT matches to MN693383 (Marine virus AFVG_25M295, complete genome) position: , mismatch: 4, identity: 0.84

aggctcaacaggcccaacaggagca	CRISPR spacer
aggcgcaacaggcccaacaggtcct	Protospacer
**** ****************  *

87. spacer 2.45|900900|25|NC_021362|CRT matches to MN693263 (Marine virus AFVG_25M296, complete genome) position: , mismatch: 4, identity: 0.84

aggctcaacaggcccaacaggagca	CRISPR spacer
aggcgcaacaggcccaacaggtcct	Protospacer
**** ****************  *

88. spacer 2.49|901125|34|NC_021362|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.882

aggtgcaacgggagcaaccggagcgaccggagca	CRISPR spacer
aggagcaacgggagcaacgggagcgaccggtcca	Protospacer
*** ************** ***********  **

89. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

90. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

91. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

92. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

93. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

94. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

95. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

96. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

97. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

98. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

99. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

100. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

101. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

102. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

103. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

104. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

105. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

106. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

107. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

108. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

109. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

110. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

111. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

112. spacer 2.58|901656|25|NC_021362|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

113. spacer 2.58|901656|25|NC_021362|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

114. spacer 2.58|901656|25|NC_021362|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

115. spacer 2.58|901656|25|NC_021362|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

116. spacer 2.58|901656|25|NC_021362|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

117. spacer 2.58|901656|25|NC_021362|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

118. spacer 2.58|901656|25|NC_021362|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

119. spacer 2.58|901656|25|NC_021362|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

120. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

121. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

122. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

123. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

124. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
tggagcaacaggtcctaccggagca	Protospacer
.********.***** ********.

125. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
cggagcaacgggaccaaccggaaat	Protospacer
************ *********.

126. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
cggagcaacgggaccaaccggaaat	Protospacer
************ *********.

127. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP011358 (Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
cggagtaacgggaccaaccggagta	Protospacer
*****.****** **********..

128. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP011358 (Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
cggagtaacgggaccaaccggagta	Protospacer
*****.****** **********..

129. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP013057 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
cggagtaacgggaccaaccggagta	Protospacer
*****.****** **********..

130. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP013057 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
cggagtaacgggaccaaccggagta	Protospacer
*****.****** **********..

131. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP013058 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
cggagtaacgggaccaaccggagta	Protospacer
*****.****** **********..

132. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP013058 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
cggagtaacgggaccaaccggagta	Protospacer
*****.****** **********..

133. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP011146 (Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
aggagcaacgggcccaacaggagca	Protospacer
 ***********.***** *****.

134. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP011146 (Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
aggagcaacgggtccaacaggaaca	Protospacer
 ***************** ***.*.

135. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP011146 (Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
aggagcaacgggcccaacaggagca	Protospacer
 ***********.***** *****.

136. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP004875 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
cggagtaacgggaccaaccggagta	Protospacer
*****.****** **********..

137. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP004875 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
cggagtaacgggaccaaccggagta	Protospacer
*****.****** **********..

138. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP011357 (Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
cggagtaacgggaccaaccggagta	Protospacer
*****.****** **********..

139. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP011357 (Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
cggagtaacgggaccaaccggagta	Protospacer
*****.****** **********..

140. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
ggccgcatcgggtccaaccggagcg	Protospacer
 *  *** *****************

141. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP015155 (Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
cggagtaacgggaccaaccggagta	Protospacer
*****.****** **********..

142. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP015155 (Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
cggagtaacgggaccaaccggagta	Protospacer
*****.****** **********..

143. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP015156 (Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
cggagtaacgggaccaaccggagta	Protospacer
*****.****** **********..

144. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP015156 (Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence) position: , mismatch: 4, identity: 0.84

cggagcaacgggtccaaccggagcg	CRISPR spacer
cggagtaacgggaccaaccggagta	Protospacer
*****.****** **********..

145. spacer 3.4|903482|29|NC_021362|CRT matches to NC_010180 (Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence) position: , mismatch: 4, identity: 0.862

tccaaccggtccgacgggagcaaccggtc	CRISPR spacer
cccaaccggtccaacgggagcaacaggta	Protospacer
.***********.*********** ***

146. spacer 3.12|904004|29|NC_021362|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 4, identity: 0.862

agcgacaggcgcaaccggagcgacaggag	CRISPR spacer
agcgaccggcgcaaccggagcgaccggta	Protospacer
****** ***************** ** .

147. spacer 3.13|904058|29|NC_021362|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 4, identity: 0.862

agcgacaggcgcaaccggagcgacaggcg	CRISPR spacer
agcgaccggcgcaaccggagcgaccggta	Protospacer
****** ***************** **..

148. spacer 3.13|904058|29|NC_021362|CRT matches to NC_048029 (Sphingomonas phage Scott isolate SPS, complete genome) position: , mismatch: 4, identity: 0.862

agcgacaggcgcaaccggagcgacaggcg	CRISPR spacer
ctcgacaggctcgaccggagcgacaggcg	Protospacer
  ******** *.****************

149. spacer 3.13|904058|29|NC_021362|CRT matches to NC_048029 (Sphingomonas phage Scott isolate SPS, complete genome) position: , mismatch: 4, identity: 0.862

agcgacaggcgcaaccggagcgacaggcg	CRISPR spacer
agcgacaggcgcagccggagcggcaaccg	Protospacer
*************.********.**. **

150. spacer 3.14|904112|29|NC_021362|CRT matches to NZ_CP033971 (Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.862

agcgacaggcgcaacgggagcgacaggcg	CRISPR spacer
cgcgacaggcgcaacgggcgcgaccggtg	Protospacer
 ***************** ***** **.*

151. spacer 3.20|904571|38|NC_021362|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.895

agcaaccggggcaaccggagcaacgggagcaaccggcc	CRISPR spacer
agcaaccggggcaaccggagcaaccggagcaactggag	Protospacer
************************ ********.**

152. spacer 2.37|900504|25|NC_021362|CRT matches to NZ_CP016367 (Phaeobacter porticola strain P97 plasmid pP97_c, complete sequence) position: , mismatch: 5, identity: 0.8

cggggcaacaggtgcaactggatca	CRISPR spacer
tcgggcaacaggcgcaactggatat	Protospacer
. **********.**********

153. spacer 2.38|900549|25|NC_021362|CRT matches to NZ_CP018232 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed4, complete sequence) position: , mismatch: 5, identity: 0.8

aggtccaataggagccacgggagcg	CRISPR spacer
tcgcggaataggagccacgggagcg	Protospacer
  *.  *******************

154. spacer 2.38|900549|25|NC_021362|CRT matches to NZ_CP016291 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed6, complete sequence) position: , mismatch: 5, identity: 0.8

aggtccaataggagccacgggagcg	CRISPR spacer
tcgcggaataggagccacgggagcg	Protospacer
  *.  *******************

155. spacer 2.43|900801|25|NC_021362|CRT matches to NZ_CP016367 (Phaeobacter porticola strain P97 plasmid pP97_c, complete sequence) position: , mismatch: 5, identity: 0.8

cggggcaacaggtgcaactggatca	CRISPR spacer
tcgggcaacaggcgcaactggatat	Protospacer
. **********.**********

156. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP053936 (Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed4, complete sequence) position: , mismatch: 5, identity: 0.8

cggagcaacgggtccaaccggagcg	CRISPR spacer
gggagcaacaggtccaaccggaatc	Protospacer
 ********.************..

157. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP053933 (Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.8

cggagcaacgggtccaaccggagcg	CRISPR spacer
gggagcaacaggtccaaccggaatc	Protospacer
 ********.************..

158. spacer 2.58|901656|25|NC_021362|CRT matches to NZ_CP009718 (Bacillus thuringiensis strain HD682 plasmid pBGN_2, complete sequence) position: , mismatch: 5, identity: 0.8

cggagcaacgggtccaaccggagcg	CRISPR spacer
gggagcaacaggtccaaccggaatc	Protospacer
 ********.************..

159. spacer 3.4|903482|29|NC_021362|CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 5, identity: 0.828

tccaaccggtccgacgggagcaaccggtc	CRISPR spacer
ggccaccggtccgacgggcgcgaccggtc	Protospacer
  * ************** **.*******

160. spacer 3.12|904004|29|NC_021362|CRT matches to NC_048029 (Sphingomonas phage Scott isolate SPS, complete genome) position: , mismatch: 5, identity: 0.828

agcgacaggcgcaaccggagcgacaggag	CRISPR spacer
ctcgacaggctcgaccggagcgacaggcg	Protospacer
  ******** *.************** *

161. spacer 3.12|904004|29|NC_021362|CRT matches to NC_048029 (Sphingomonas phage Scott isolate SPS, complete genome) position: , mismatch: 5, identity: 0.828

agcgacaggcgcaaccggagcgacaggag	CRISPR spacer
agcgacaggcgcagccggagcggcaaccg	Protospacer
*************.********.**.  *

162. spacer 3.14|904112|29|NC_021362|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.828

agcgacaggcgcaacgggagcgacaggcg	CRISPR spacer
tgagacaggagcaacgggaacgacaggag	Protospacer
 * ****** *********.******* *

163. spacer 2.34|900333|34|NC_021362|CRT matches to MT219824 (Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence) position: , mismatch: 6, identity: 0.824

cggagccacgggagcgacaggtccaacaggagcg	CRISPR spacer
aggtcctacaggagcgacaggtcctacaggagcg	Protospacer
 **  *.**.************** *********

164. spacer 2.34|900333|34|NC_021362|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

cggagccacgggagcgacaggtccaacaggagcg	CRISPR spacer
aggtccaacgggagcgacaggtccatcaggcgcg	Protospacer
 **  * ****************** **** ***

165. spacer 2.39|900594|34|NC_021362|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 6, identity: 0.824

gggagcgacaggcccaacaggagcgacaggcgca	CRISPR spacer
aggccctacaggccctacaggagctacaggcgca	Protospacer
.**  * ******** ******** *********

166. spacer 2.39|900594|34|NC_021362|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.824

gggagcgacaggcccaacaggagcgacaggcgca	CRISPR spacer
aggccctacaggccctacaggagctacaggcgca	Protospacer
.**  * ******** ******** *********

167. spacer 2.39|900594|34|NC_021362|CRT matches to AP013564 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 6, identity: 0.824

gggagcgacaggcccaacaggagcgacaggcgca	CRISPR spacer
aggccctacaggccctacaggagctacaggcgca	Protospacer
.**  * ******** ******** *********

168. spacer 2.39|900594|34|NC_021362|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.824

gggagcgacaggcccaacaggagcgacaggcgca	CRISPR spacer
aggccctacaggccctacaggagctacaggcgca	Protospacer
.**  * ******** ******** *********

169. spacer 2.39|900594|34|NC_021362|CRT matches to AP013943 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.824

gggagcgacaggcccaacaggagcgacaggcgca	CRISPR spacer
aggccctacaggccctacaggagctacaggcgca	Protospacer
.**  * ******** ******** *********

170. spacer 2.39|900594|34|NC_021362|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.824

gggagcgacaggcccaacaggagcgacaggcgca	CRISPR spacer
aggccctacaggccctacaggagctacaggcgca	Protospacer
.**  * ******** ******** *********

171. spacer 2.51|901242|34|NC_021362|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.824

aggtccgaccggagtaaccggggcaaccggagca	CRISPR spacer
cggggcaacaggagcaaccggggcaaccggagca	Protospacer
 **  *.** ****.*******************

172. spacer 3.4|903482|29|NC_021362|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.793

tccaaccggtccgacgggagcaaccggtc	CRISPR spacer
ggtaaccggcccaacgggagcaaccggcc	Protospacer
  .******.**.**************.*

173. spacer 3.4|903482|29|NC_021362|CRT matches to NZ_CP053933 (Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.793

tccaaccggtccgacgggagcaaccggtc	CRISPR spacer
tgtaaccggaccgacgggagcaacaggaa	Protospacer
* .****** ************** **

174. spacer 3.4|903482|29|NC_021362|CRT matches to NZ_CP053936 (Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.793

tccaaccggtccgacgggagcaaccggtc	CRISPR spacer
tgtaaccggaccgacgggagcaacaggaa	Protospacer
* .****** ************** **

175. spacer 3.4|903482|29|NC_021362|CRT matches to NZ_CP009718 (Bacillus thuringiensis strain HD682 plasmid pBGN_2, complete sequence) position: , mismatch: 6, identity: 0.793

tccaaccggtccgacgggagcaaccggtc	CRISPR spacer
tgtaaccggaccgacgggagcaacaggaa	Protospacer
* .****** ************** **

176. spacer 3.4|903482|29|NC_021362|CRT matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 6, identity: 0.793

tccaaccggtccgacgggagcaaccggtc	CRISPR spacer
tgcgaccggttcgactggagcaaccggct	Protospacer
* *.******.**** ***********..

177. spacer 3.4|903482|29|NC_021362|CRT matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 6, identity: 0.793

tccaaccggtccgacgggagcaaccggtc	CRISPR spacer
tgcgaccggttcgactggagcaaccggct	Protospacer
* *.******.**** ***********..

178. spacer 3.4|903482|29|NC_021362|CRT matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 6, identity: 0.793

tccaaccggtccgacgggagcaaccggtc	CRISPR spacer
tgcgaccggttcgactggagcaaccggct	Protospacer
* *.******.**** ***********..

179. spacer 3.12|904004|29|NC_021362|CRT matches to NZ_CP011054 (Halomonas sp. KO116 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.793

agcgacaggcgcaaccggagcgacaggag	CRISPR spacer
tggcacaggcgcaaccgaagcaacaggtg	Protospacer
 *  *************.***.***** *

180. spacer 3.13|904058|29|NC_021362|CRT matches to NZ_CP011054 (Halomonas sp. KO116 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.793

agcgacaggcgcaaccggagcgacaggcg	CRISPR spacer
tggcacaggcgcaaccgaagcaacaggtg	Protospacer
 *  *************.***.*****.*

181. spacer 3.14|904112|29|NC_021362|CRT matches to NZ_CP016082 (Streptomyces sp. SAT1 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.793

agcgacaggcgcaacgggagcgacaggcg	CRISPR spacer
agcgacaggagcgacgggagcgacgcgat	Protospacer
********* **.***********. *

182. spacer 3.14|904112|29|NC_021362|CRT matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.793

agcgacaggcgcaacgggagcgacaggcg	CRISPR spacer
tccggggggcgcaacgggagagacaggcg	Protospacer
  **. .************* ********

183. spacer 3.14|904112|29|NC_021362|CRT matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 6, identity: 0.793

agcgacaggcgcaacgggagcgacaggcg	CRISPR spacer
tccggggggcgcaacgggagagacaggcg	Protospacer
  **. .************* ********

184. spacer 2.49|901125|34|NC_021362|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.794

aggtgcaacgggagcaaccggagcgaccggagca	CRISPR spacer
aggagcaacgggagcaatcggagcaattggccca	Protospacer
*** *************.******.*..**  **

185. spacer 2.52|901296|34|NC_021362|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

gggagccacaggagcaaccggcccgacaggagca	CRISPR spacer
aggcctgacaggagcaacaggcccgacaggagga	Protospacer
.**  . *********** ************* *

186. spacer 2.53|901350|34|NC_021362|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

gggagccacaggagcaaccggcccgacaggagca	CRISPR spacer
aggcctgacaggagcaacaggcccgacaggagga	Protospacer
.**  . *********** ************* *

187. spacer 3.4|903482|29|NC_021362|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

tccaaccggtccgacgggagcaaccggtc	CRISPR spacer
gccaaccggtccgactggaccaacgcccc	Protospacer
 ************** *** ****   .*

188. spacer 3.11|903941|38|NC_021362|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 7, identity: 0.816

cccaacaggtccaacaggcgcaaccggagcgacaggcg	CRISPR spacer
cccaacaggaccaacaggggcaaccggactaacgggtg	Protospacer
********* ******** ********* ..**.**.*

189. spacer 3.12|904004|29|NC_021362|CRT matches to NZ_CP033971 (Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.759

agcgacaggcgcaaccggagcgacaggag	CRISPR spacer
ctccacaggcgcaaccggcgccacaggtc	Protospacer
  * ************** ** *****

190. spacer 3.13|904058|29|NC_021362|CRT matches to NZ_CP033971 (Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.759

agcgacaggcgcaaccggagcgacaggcg	CRISPR spacer
ctccacaggcgcaaccggcgccacaggtc	Protospacer
  * ************** ** *****.

191. spacer 3.14|904112|29|NC_021362|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

agcgacaggcgcaacgggagcgacaggcg	CRISPR spacer
tgaaacaggagcaacgggagcgacgggaa	Protospacer
 * .***** **************.** .

192. spacer 3.14|904112|29|NC_021362|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

agcgacaggcgcaacgggagcgacaggcg	CRISPR spacer
tgaaacaggagcaacgggaacgacaggaa	Protospacer
 * .***** *********.******* .

193. spacer 2.39|900594|34|NC_021362|CRT matches to NZ_CP040453 (Halomonas sp. PA16-9 plasmid p_unnamed2, complete sequence) position: , mismatch: 8, identity: 0.765

gggagcgacaggcccaacaggagcgacaggcgca	CRISPR spacer
gagagcgacaggcccatcaagagcgaaggcagta	Protospacer
*.************** **.****** .*  *.*

194. spacer 2.47|901008|34|NC_021362|CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.765

gggagcgaccggagccaccggcccgaccggagcg	CRISPR spacer
cggtcggaccggggcgaccggcccgaccggtccg	Protospacer
 **   ******.** **************  **

195. spacer 2.49|901125|34|NC_021362|CRT matches to NC_014025 (Bacillus megaterium QM B1551 plasmid pBM500, complete sequence) position: , mismatch: 8, identity: 0.765

aggtgcaacgggagcaaccggagcgaccggagca	CRISPR spacer
cggagtcacgggagctaccggagctaccggagtt	Protospacer
 ** *. ******** ******** *******.

196. spacer 2.49|901125|34|NC_021362|CRT matches to NC_014025 (Bacillus megaterium QM B1551 plasmid pBM500, complete sequence) position: , mismatch: 8, identity: 0.765

aggtgcaacgggagcaaccggagcgaccggagca	CRISPR spacer
cggagtcacgggagctaccggagctaccggagtt	Protospacer
 ** *. ******** ******** *******.

197. spacer 2.51|901242|34|NC_021362|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.765

aggtccgaccggagtaaccggggcaaccggagca	CRISPR spacer
tggtgaaacaggagtaaccggagcaaccggagtg	Protospacer
 ***  .** ***********.**********..

198. spacer 2.54|901404|34|NC_021362|CRT matches to NZ_CP053689 (Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.765

aggcccaacgggagcaaccggcccgacaggagca	CRISPR spacer
gggatcgacaggagcaaccggcccaacaggaata	Protospacer
.** .*.**.**************.******..*

199. spacer 2.55|901458|34|NC_021362|CRT matches to NZ_CP053689 (Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.765

aggtccaacaggagtaaccgacccaacaggagca	CRISPR spacer
gggatcgacaggagcaaccggcccaacaggaata	Protospacer
.** .*.*******.*****.**********..*

200. spacer 3.5|903536|38|NC_021362|CRT matches to MN694114 (Marine virus AFVG_250M252, complete genome) position: , mismatch: 8, identity: 0.789

tccaacaggcgcaaccggagcaacaggcgcaacgggag	CRISPR spacer
cacgcagggcgcaacgggagcaaccggcgcaacgggag	Protospacer
. *.  .******** ******** *************

201. spacer 3.19|904499|47|NC_021362|CRT matches to MN694114 (Marine virus AFVG_250M252, complete genome) position: , mismatch: 8, identity: 0.83

cccaaccggagcaacgggagcaaccggcccaacgggagcaaccggcc	CRISPR spacer
cacgcagggcgcaacgggagcaaccggcgcaacgggagcaaccggcg	Protospacer
* *.   ** ****************** *****************

202. spacer 2.27|899865|43|NC_021362|CRT matches to MN694114 (Marine virus AFVG_250M252, complete genome) position: , mismatch: 9, identity: 0.791

gggagccac---aggcgcaacgggagcaaccggagcgacgggagcg	CRISPR spacer
---aatcacgcagggcgcaacgggagcaaccggcgcaacgggagca	Protospacer
   *..***   .******************** **.********.

203. spacer 2.34|900333|34|NC_021362|CRT matches to NZ_CP019235 (Bacillus thuringiensis strain YGd22-03 plasmid pYGD98, complete sequence) position: , mismatch: 9, identity: 0.735

cggagccacgggagcgacaggtccaacaggagcg	CRISPR spacer
gggccctacaggagcgacaggtcctacaggatta	Protospacer
 **  *.**.************** ****** ..

204. spacer 2.34|900333|34|NC_021362|CRT matches to NZ_CP019235 (Bacillus thuringiensis strain YGd22-03 plasmid pYGD98, complete sequence) position: , mismatch: 9, identity: 0.735

cggagccacgggagcgacaggtccaacaggagcg	CRISPR spacer
gggccctacaggagcgacaggtcctacaggatta	Protospacer
 **  *.**.************** ****** ..

205. spacer 2.34|900333|34|NC_021362|CRT matches to NZ_CP019235 (Bacillus thuringiensis strain YGd22-03 plasmid pYGD98, complete sequence) position: , mismatch: 9, identity: 0.735

cggagccacgggagcgacaggtccaacaggagcg	CRISPR spacer
gggccctacaggagcgacaggtcctacaggatta	Protospacer
 **  *.**.************** ****** ..

206. spacer 2.34|900333|34|NC_021362|CRT matches to NZ_CP019235 (Bacillus thuringiensis strain YGd22-03 plasmid pYGD98, complete sequence) position: , mismatch: 9, identity: 0.735

cggagccacgggagcgacaggtccaacaggagcg	CRISPR spacer
gggccctacaggagcgacaggtcctacaggatta	Protospacer
 **  *.**.************** ****** ..

207. spacer 2.34|900333|34|NC_021362|CRT matches to NZ_CP019235 (Bacillus thuringiensis strain YGd22-03 plasmid pYGD98, complete sequence) position: , mismatch: 9, identity: 0.735

cggagccacgggagcgacaggtccaacaggagcg	CRISPR spacer
gggccctacaggagcgacaggtcctacaggatta	Protospacer
 **  *.**.************** ****** ..

208. spacer 2.34|900333|34|NC_021362|CRT matches to NZ_CP019235 (Bacillus thuringiensis strain YGd22-03 plasmid pYGD98, complete sequence) position: , mismatch: 9, identity: 0.735

cggagccacgggagcgacaggtccaacaggagcg	CRISPR spacer
gggccctacaggagcgacaggtcctacaggatta	Protospacer
 **  *.**.************** ****** ..

209. spacer 2.34|900333|34|NC_021362|CRT matches to NZ_CP019235 (Bacillus thuringiensis strain YGd22-03 plasmid pYGD98, complete sequence) position: , mismatch: 9, identity: 0.735

cggagccacgggagcgacaggtccaacaggagcg	CRISPR spacer
gggccctacaggagcgacaggtcctacaggatta	Protospacer
 **  *.**.************** ****** ..

210. spacer 2.47|901008|34|NC_021362|CRT matches to MK524530 (Mycobacterium phage Pharaoh, complete genome) position: , mismatch: 9, identity: 0.735

gggagcgaccggagccaccggcccgaccggagcg	CRISPR spacer
cggagctaccggagccaccgggccgcaaggcgtc	Protospacer
 ***** ************** ***   ** *.

211. spacer 2.49|901125|34|NC_021362|CRT matches to NC_014025 (Bacillus megaterium QM B1551 plasmid pBM500, complete sequence) position: , mismatch: 9, identity: 0.735

aggtgcaacgggagcaaccggagcgaccggagca	CRISPR spacer
cggagtcacgggagctaccggagctaccggaatc	Protospacer
 ** *. ******** ******** ******..

212. spacer 3.20|904571|38|NC_021362|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 9, identity: 0.763

agcaaccggggcaaccggagcaacgggagcaaccggcc	CRISPR spacer
ttaaaccggagcaacgggagcaacgggagcaacggaag	Protospacer
   ******.***** ***************** *.

213. spacer 2.34|900333|34|NC_021362|CRT matches to NZ_CP019235 (Bacillus thuringiensis strain YGd22-03 plasmid pYGD98, complete sequence) position: , mismatch: 10, identity: 0.706

cggagccacgggagcgacaggtccaacaggagcg	CRISPR spacer
gagccctacaggagcgacaggtcctacaggatta	Protospacer
 .*  *.**.************** ****** ..

214. spacer 2.39|900594|34|NC_021362|CRT matches to AB981169 (Ralstonia phage RSY1 DNA, complete genome) position: , mismatch: 10, identity: 0.706

gggagcgacaggcccaacaggagcgacaggcgca	CRISPR spacer
gggaacgacaggcccaacaggcgcttgcgctgtt	Protospacer
****.**************** **    * .*.

215. spacer 3.5|903536|38|NC_021362|CRT matches to NZ_CP011054 (Halomonas sp. KO116 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.737

tccaacaggcgcaaccggagcaacaggcgcaacgggag	CRISPR spacer
tggcacaggcgcaaccgaagcaacaggtgcaaattgca	Protospacer
*   *************.*********.****   * .

216. spacer 2.47|901008|34|NC_021362|CRT matches to MH271316 (Microbacterium phage Tandem, complete genome) position: , mismatch: 11, identity: 0.676

gggagcgaccggagccaccggcccgaccggagcg	CRISPR spacer
caacccgaccggagccaccggcttgaccgttcgg	Protospacer
 ..  *****************..*****    *

217. spacer 2.47|901008|34|NC_021362|CRT matches to MH271310 (Microbacterium phage Pioneer3, complete genome) position: , mismatch: 11, identity: 0.676

gggagcgaccggagccaccggcccgaccggagcg	CRISPR spacer
caacccgaccggagccaccggcttgaccgttcgg	Protospacer
 ..  *****************..*****    *

218. spacer 2.47|901008|34|NC_021362|CRT matches to MK376963 (Microbacterium phage Alleb, complete genome) position: , mismatch: 11, identity: 0.676

gggagcgaccggagccaccggcccgaccggagcg	CRISPR spacer
caacccgaccggagccaccggcttgaccgttcgg	Protospacer
 ..  *****************..*****    *

219. spacer 2.47|901008|34|NC_021362|CRT matches to MH271307 (Microbacterium phage OlinDD, complete genome) position: , mismatch: 11, identity: 0.676

gggagcgaccggagccaccggcccgaccggagcg	CRISPR spacer
caacccgaccggagccaccggcttgaccgttcgg	Protospacer
 ..  *****************..*****    *

220. spacer 2.47|901008|34|NC_021362|CRT matches to MH271300 (Microbacterium phage Hortus1, complete genome) position: , mismatch: 11, identity: 0.676

gggagcgaccggagccaccggcccgaccggagcg	CRISPR spacer
caacccgaccggagccaccggcttgaccgttcgg	Protospacer
 ..  *****************..*****    *

221. spacer 3.20|904571|38|NC_021362|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 11, identity: 0.711

agcaaccggggcaaccggagcaacgggagcaaccggcc	CRISPR spacer
ggcaacaggggcaaccggagcaaccggaggtattttag	Protospacer
.***** ***************** ****  *..

222. spacer 2.52|901296|34|NC_021362|CRT matches to MK649828 (Klebsiella pneumoniae strain 1675479 plasmid p1675479_1, complete sequence) position: , mismatch: 12, identity: 0.647

gggagccacaggagcaaccggcccgacaggagca	CRISPR spacer
ctctagttcaggagcaaccgtcctgacaggagag	Protospacer
    . . ************ **.******** .

223. spacer 2.52|901296|34|NC_021362|CRT matches to NZ_CP041094 (Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH01 plasmid unnamed2, complete sequence) position: , mismatch: 12, identity: 0.647

gggagccacaggagcaaccggcccgacaggagca	CRISPR spacer
ctctagttcaggagcaaccgtcctgacaggagag	Protospacer
    . . ************ **.******** .

224. spacer 2.53|901350|34|NC_021362|CRT matches to MK649828 (Klebsiella pneumoniae strain 1675479 plasmid p1675479_1, complete sequence) position: , mismatch: 12, identity: 0.647

gggagccacaggagcaaccggcccgacaggagca	CRISPR spacer
ctctagttcaggagcaaccgtcctgacaggagag	Protospacer
    . . ************ **.******** .

225. spacer 2.53|901350|34|NC_021362|CRT matches to NZ_CP041094 (Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH01 plasmid unnamed2, complete sequence) position: , mismatch: 12, identity: 0.647

gggagccacaggagcaaccggcccgacaggagca	CRISPR spacer
ctctagttcaggagcaaccgtcctgacaggagag	Protospacer
    . . ************ **.******** .

226. spacer 3.3|903410|47|NC_021362|CRT matches to MN694114 (Marine virus AFVG_250M252, complete genome) position: , mismatch: 12, identity: 0.745

agcaaccggtccgacgggagcaaccggcccaacaggagcaaccggcc	CRISPR spacer
cacgcagggcgcaacgggagcaaccggcgcaacgggagcaaccggcg	Protospacer
 .*.   **. *.*************** ****.************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

648170 : 738383

100

Bacillus_phage(39.53%)

capsid,tail,protease,integrase,terminase,plate,tRNA,head,portal,holin

attL 658476:658497|attR 696431:696452

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020450323.1\|648170_648647_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_020450324.1\|648627_649317_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_020450325.1\|649329_649788_+	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_020450326.1\|649777_650803_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	2.7e-67	42.5
WP_020450327.1\|651042_652968_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	4.9e-62	32.5
WP_020450328.1\|653114_653621_+	cyclic pyranopterin monophosphate synthase MoaC	NA	NA	NA	NA
WP_020450329.1\|653624_654269_+	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_020450330.1\|654307_654481_+	twin-arginine translocase TatA/TatE family subunit	NA	NA	NA	NA
WP_020450331.1\|654487_655264_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	1.4e-15	25.6
WP_020450332.1\|655308_655503_-	YdiK family protein	NA	NA	NA	NA
WP_020450333.1\|655499_656234_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003179248.1\|656459_656744_+	co-chaperone GroES	A0A221S3C8	uncultured_virus	2.9e-19	52.7
WP_020450334.1\|656788_658423_+	chaperonin GroEL	A0A219YK78	uncultured_virus	4.8e-159	57.7
658476:658497	attL	NA	NA	NA	NA
WP_020450335.1\|658504_659722_-\|integrase	site-specific integrase	A0A0C5AN64	Paenibacillus_phage	2.6e-141	64.1
WP_009330103.1\|659735_660368_-	helix-turn-helix domain-containing protein	A0A1B2APZ3	Phage_Wrath	2.1e-70	61.0
WP_009330102.1\|660532_660781_+	helix-turn-helix transcriptional regulator	A0A1B2APZ4	Phage_Wrath	5.0e-20	67.1
WP_034292464.1\|660803_661004_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_009330101.1\|661018_661765_+	phage antirepressor Ant	A0A0C5AFE7	Paenibacillus_phage	1.8e-100	74.6
WP_009330100.1\|661778_662009_+	hypothetical protein	NA	NA	NA	NA
WP_017475041.1\|662125_662329_+	hypothetical protein	NA	NA	NA	NA
WP_041817158.1\|662325_662538_-	hypothetical protein	NA	NA	NA	NA
WP_009330095.1\|662590_662857_+	hypothetical protein	Q9ZXC9	Bacillus_phage	2.7e-19	54.7
WP_009330094.1\|663052_663610_+	host-nuclease inhibitor Gam family protein	Q9ZXC8	Bacillus_phage	3.7e-71	71.4
WP_009330093.1\|663613_664546_+	AAA family ATPase	Q9ZXC7	Bacillus_phage	2.0e-154	90.1
WP_041817159.1\|664545_664986_+	DUF669 domain-containing protein	Q9ZXC5	Bacillus_phage	7.0e-73	90.4
WP_020450338.1\|665046_667479_+	phage DNA primase	D6R422	Bacillus_phage	0.0e+00	81.0
WP_020450339.1\|667737_668100_+	hypothetical protein	NA	NA	NA	NA
WP_020450340.1\|668077_668515_+	hypothetical protein	Q9ZXC3	Bacillus_phage	2.9e-63	76.6
WP_020450341.1\|668511_669051_+	ERCC4 domain-containing protein	Q9ZXC2	Bacillus_phage	2.5e-88	89.4
WP_017695850.1\|669047_669218_+	Fur-regulated basic protein FbpA	A0A0S2SXY0	Bacillus_phage	5.1e-08	56.6
WP_020450342.1\|669221_669746_+	hypothetical protein	D6R425	Bacillus_phage	8.3e-81	82.2
WP_041817160.1\|669768_670704_+	DNA (cytosine-5-)-methyltransferase	A8YQM6	Lactobacillus_phage	4.2e-67	47.2
WP_020450344.1\|670685_671495_+	DNA adenine methylase	U5P0W8	Brevibacillus_phage	2.3e-85	57.2
WP_009330080.1\|671642_672023_+	ArpU family transcriptional regulator	Q9ZXB9	Bacillus_phage	5.1e-48	83.7
WP_020450346.1\|672550_673030_+	hypothetical protein	NA	NA	NA	NA
WP_020450347.1\|673036_673495_+	hypothetical protein	NA	NA	NA	NA
WP_041817161.1\|673764_673986_+	hypothetical protein	NA	NA	NA	NA
WP_009330078.1\|673988_674234_+	hypothetical protein	NA	NA	NA	NA
WP_017474594.1\|675661_676156_+\|terminase	phage terminase small subunit P27 family	A0A1Q1PVW3	Staphylococcus_phage	9.1e-21	36.8
WP_020450351.1\|676148_677855_+\|terminase	terminase large subunit	A0A2H4JC16	uncultured_Caudovirales_phage	8.1e-125	44.7
WP_039072986.1\|677875_678079_+	hypothetical protein	NA	NA	NA	NA
WP_020450352.1\|678083_679325_+\|portal	phage portal protein	A0A2H4J331	uncultured_Caudovirales_phage	1.7e-68	36.3
WP_020450353.1\|679317_679914_+\|head,protease	HK97 family phage prohead protease	A0A1J0MFL1	Staphylococcus_phage	1.1e-47	51.6
WP_020450354.1\|679962_681165_+\|capsid	phage major capsid protein	D2KRA9	Lactobacillus_phage	5.8e-77	43.9
WP_020450355.1\|681188_681623_+	collagen-like protein	D6R3Z0	Bacillus_phage	1.9e-14	60.2
WP_017474688.1\|681680_681974_+\|head,tail	phage gp6-like head-tail connector protein	A0A2H4J5J4	uncultured_Caudovirales_phage	2.6e-07	31.1
WP_017474687.1\|681963_682290_+\|head	phage head closure protein	NA	NA	NA	NA
WP_020450356.1\|682289_682673_+	HK97 gp10 family phage protein	A0A0M5M1E5	Enterococcus_phage	1.2e-09	39.0
WP_020450357.1\|682669_683062_+	hypothetical protein	NA	NA	NA	NA
WP_017474406.1\|683081_683666_+	UDP-N-acetylmuramoylalanine--D-glutamate ligase	J7KKC8	Streptococcus_phage	3.5e-27	37.3
WP_020450358.1\|683721_684078_+	hypothetical protein	NA	NA	NA	NA
WP_025807906.1\|684089_684272_+	hypothetical protein	NA	NA	NA	NA
WP_020450359.1\|684333_688056_+\|tail	phage tail tape measure protein	A0A0S2SXL7	Bacillus_phage	4.2e-102	63.0
WP_017474643.1\|688052_688883_+\|tail	phage tail family protein	NA	NA	NA	NA
WP_020450360.1\|688900_690799_+\|tail	phage tail protein	M5AC19	Bacillus_phage	6.6e-43	40.9
WP_020450361.1\|690805_692761_+	right-handed parallel beta-helix repeat-containing protein	U5PWM6	Bacillus_phage	2.6e-42	31.3
WP_020450362.1\|692781_694146_+\|plate	phage baseplate upper protein	M4ZRP1	Bacillus_phage	9.5e-52	50.0
WP_020450363.1\|694157_694472_+	hypothetical protein	M4ZR44	Bacillus_phage	5.8e-13	43.0
WP_017474865.1\|694468_694651_+	XkdX family protein	A0EWM9	Staphylococcus_virus	1.8e-06	50.0
WP_009329192.1\|694713_694983_+	hemolysin XhlA family protein	A0A2H4JD40	uncultured_Caudovirales_phage	1.4e-20	58.4
WP_020450364.1\|694998_695262_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	4.4e-30	73.6
WP_041817162.1\|695313_696156_+	N-acetylmuramoyl-L-alanine amidase	S6BFI4	Thermus_phage	1.1e-45	55.5
WP_020450369.1\|697376_698294_+	VanW family protein	NA	NA	NA	NA
696431:696452	attR	NA	NA	NA	NA
WP_020450370.1\|698410_698860_+	YfmQ family protein	NA	NA	NA	NA
WP_041817163.1\|698885_699152_-	hypothetical protein	NA	NA	NA	NA
WP_020450371.1\|699249_699711_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_020450372.1\|699779_700460_-	SOS response-associated peptidase	A0A1P8CX02	Bacillus_phage	1.0e-54	70.9
WP_020450373.1\|700499_700730_-	hypothetical protein	NA	NA	NA	NA
WP_020450374.1\|700890_701505_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_020450375.1\|701520_704145_+	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	5.2e-38	34.2
WP_020450376.1\|704171_704456_-	hypothetical protein	NA	NA	NA	NA
WP_020450377.1\|704521_704884_-	DUF488 family protein	NA	NA	NA	NA
WP_020450378.1\|704967_705732_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_020450379.1\|705885_707361_+	carboxylesterase/lipase family protein	S4VZJ7	Pandoravirus	3.0e-35	41.3
WP_020450380.1\|707381_708659_-	MFS transporter	NA	NA	NA	NA
WP_020450381.1\|709028_709709_+	PspA/IM30 family protein	NA	NA	NA	NA
WP_020450382.1\|709744_710770_+	TFIIB-type zinc ribbon-containing protein	NA	NA	NA	NA
WP_025811966.1\|710769_711537_+	TPM domain-containing protein	NA	NA	NA	NA
WP_020450384.1\|711557_712532_+	SPFH domain-containing protein	NA	NA	NA	NA
WP_020450385.1\|712768_713824_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_020450386.1\|713859_714687_-	TrmB family transcriptional regulator	NA	NA	NA	NA
WP_020450387.1\|714834_715467_+	LysE family transporter	NA	NA	NA	NA
WP_020450388.1\|715660_716305_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_020450389.1\|716320_717478_+	rod shape-determining protein RodA	NA	NA	NA	NA
WP_020450390.1\|717474_718617_+	putative lipid II flippase FtsW	NA	NA	NA	NA
WP_020450393.1\|719283_719709_-	VOC family protein	NA	NA	NA	NA
WP_020450394.1\|719803_720751_+	YafY family transcriptional regulator	NA	NA	NA	NA
WP_020450395.1\|721042_721720_+	DUF3298 and DUF4163 domain-containing protein	NA	NA	NA	NA
WP_020450396.1\|721791_723171_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_020450397.1\|723301_724840_+	alpha-amylase	NA	NA	NA	NA
WP_020450398.1\|725007_725958_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_020450399.1\|726073_727837_+	alpha-glycosidase	NA	NA	NA	NA
WP_020450400.1\|727931_729185_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_020450401.1\|729226_730534_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_020450402.1\|730534_731386_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_020450403.1\|731390_732275_+	DUF1189 family protein	NA	NA	NA	NA
WP_020450404.1\|732252_734589_+	glycoside hydrolase family 65 protein	NA	NA	NA	NA
WP_020450405.1\|734530_736237_+	alpha-glucosidase	NA	NA	NA	NA
WP_020450406.1\|736233_736914_+	beta-phosphoglucomutase	M1I5S4	Acanthocystis_turfacea_Chlorella_virus	6.5e-09	28.6
WP_020450407.1\|737129_738383_-\|tRNA	tyrosine--tRNA ligase	NA	NA	NA	NA

DBSCAN-SWA_2

765058 : 774983

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020450435.1\|765058_766354_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	5.9e-19	27.1
WP_020450436.1\|766428_767145_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3G7P8	Synechococcus_phage	7.4e-48	43.2
WP_003179532.1\|767146_767401_+	phosphoribosylformylglycinamidine synthase subunit PurS	M4QPE7	Synechococcus_phage	8.0e-05	33.3
WP_020450437.1\|767397_768081_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_020450438.1\|768064_770293_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.8e-159	41.9
WP_020450439.1\|770268_771699_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	5.8e-52	32.7
WP_035337048.1\|771823_772864_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.7e-62	46.3
WP_020450441.1\|772860_773448_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	3.1e-28	39.5
WP_020450442.1\|773444_774983_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	5.6e-77	52.0

DBSCAN-SWA_3

1369671 : 1411600

Bacillus_phage(30.0%)

holin,coat,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003180650.1\|1369671_1370574_-\|protease	protease adaptor protein SpxH	NA	NA	NA	NA
WP_003180652.1\|1370570_1370969_-	thiol management oxidoreductase	NA	NA	NA	NA
WP_020450947.1\|1371447_1372101_-	lytic transglycosylase domain-containing protein	A0A1P8CWQ1	Bacillus_phage	3.1e-40	71.6
WP_020450948.1\|1372113_1372686_-	CYTH domain-containing protein	NA	NA	NA	NA
WP_003180659.1\|1372816_1373182_+	hypothetical protein	NA	NA	NA	NA
WP_003180661.1\|1373213_1373849_+	GTP pyrophosphokinase family protein	NA	NA	NA	NA
WP_023856668.1\|1373867_1374668_+	NAD kinase	NA	NA	NA	NA
WP_080131322.1\|1374679_1375570_+	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_020450951.1\|1375586_1376327_-	bis(5'-nucleosyl)-tetraphosphatase PrpE	A0A7D9	Microcystis_virus	1.2e-16	29.3
WP_020450952.1\|1376591_1378436_+	monovalent cation:proton antiporter family protein	NA	NA	NA	NA
WP_020450953.1\|1378687_1379389_+	thiaminase II	NA	NA	NA	NA
WP_020450954.1\|1379363_1379975_+	thiazole tautomerase TenI	NA	NA	NA	NA
WP_020450955.1\|1379958_1381068_+	glycine oxidase ThiO	NA	NA	NA	NA
WP_020450956.1\|1381064_1381268_+	sulfur carrier protein ThiS	NA	NA	NA	NA
WP_020450957.1\|1381274_1382042_+	thiazole synthase	NA	NA	NA	NA
WP_020450958.1\|1382038_1383049_+	thiazole biosynthesis adenylyltransferase ThiF	NA	NA	NA	NA
WP_020450959.1\|1383072_1383891_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_003180687.1\|1384045_1384822_+	enoyl-ACP reductase FabI	NA	NA	NA	NA
WP_003180690.1\|1384924_1385404_+	hypothetical protein	NA	NA	NA	NA
WP_020450960.1\|1385440_1385890_-\|coat	spore coat protein CotZ	NA	NA	NA	NA
WP_020450961.1\|1386040_1386523_-\|coat	spore coat protein CotY	NA	NA	NA	NA
WP_003180696.1\|1386655_1387162_-\|coat	spore coat protein	NA	NA	NA	NA
WP_003180698.1\|1387229_1387583_-	hypothetical protein	NA	NA	NA	NA
WP_020450962.1\|1387631_1388018_-\|coat	spore coat protein	NA	NA	NA	NA
WP_003180704.1\|1388165_1388522_+	DUF1360 domain-containing protein	NA	NA	NA	NA
WP_020450964.1\|1388808_1389018_+	hypothetical protein	NA	NA	NA	NA
WP_020450965.1\|1389097_1389229_+	YjcZ family sporulation protein	NA	NA	NA	NA
WP_020450966.1\|1389355_1389613_+	stage VI sporulation protein F	NA	NA	NA	NA
WP_020450967.1\|1389651_1391931_-	ATP-dependent helicase	A0A068EQC7	Bacillus_phage	6.6e-90	35.5
WP_003180714.1\|1392052_1392310_+	hypothetical protein	NA	NA	NA	NA
WP_020450968.1\|1392349_1392937_-	DedA family protein	NA	NA	NA	NA
WP_020450969.1\|1393032_1394019_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	6.2e-53	38.4
WP_161517787.1\|1394015_1394912_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	3.0e-86	57.4
WP_020450971.1\|1394928_1395324_-	GtrA family protein	NA	NA	NA	NA
WP_003180726.1\|1395489_1395909_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003180728.1\|1395918_1396428_-	2'-5' RNA ligase family protein	NA	NA	NA	NA
WP_003180731.1\|1396492_1397215_-	esterase family protein	NA	NA	NA	NA
WP_003180732.1\|1397326_1397782_-	hypothetical protein	NA	NA	NA	NA
WP_020450972.1\|1397793_1398282_-	DinB family protein	NA	NA	NA	NA
WP_020450973.1\|1398362_1399310_-	YafY family transcriptional regulator	NA	NA	NA	NA
WP_003180736.1\|1399619_1400744_+	methionine biosynthesis PLP-dependent protein	A0A0B5JD48	Pandoravirus	9.0e-16	25.6
WP_020450974.1\|1400733_1401909_+	cystathionine beta-lyase	A0A0B5JD48	Pandoravirus	7.5e-21	28.7
WP_020450975.1\|1401953_1403144_-	DUF819 domain-containing protein	NA	NA	NA	NA
WP_020450976.1\|1403315_1403885_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_003180743.1\|1403874_1404159_+	hypothetical protein	NA	NA	NA	NA
WP_020450977.1\|1404336_1405710_+	serine hydrolase	A0A1D8EXR7	Mycobacterium_phage	1.0e-08	24.6
WP_026579886.1\|1405772_1406207_+	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_105980882.1\|1406294_1407272_-	glycoside hydrolase family 43 protein	NA	NA	NA	NA
WP_020450980.1\|1408275_1408608_-	hypothetical protein	NA	NA	NA	NA
WP_020450981.1\|1408619_1410062_-	hypothetical protein	NA	NA	NA	NA
WP_020450982.1\|1410115_1410454_+	DUF1433 domain-containing protein	NA	NA	NA	NA
WP_044805482.1\|1410531_1410708_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_020450984.1\|1411051_1411321_+	hemolysin XhlA family protein	A0A2H4JD40	uncultured_Caudovirales_phage	3.7e-24	62.9
WP_020450985.1\|1411336_1411600_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	1.5e-30	77.0

DBSCAN-SWA_4

1428129 : 1454234

Bacillus_phage(23.08%)

capsid,tail,terminase,plate,portal,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020451003.1\|1428129_1428777_+	poly-gamma-glutamate hydrolase family protein	A0A0Y0AJU6	Bacillus_phage	2.6e-44	46.5
WP_020451004.1\|1428789_1429446_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	6.8e-40	49.7
WP_020451005.1\|1429634_1429988_-	helix-turn-helix transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	3.6e-19	49.6
WP_020451006.1\|1430160_1430421_+	helix-turn-helix transcriptional regulator	S5MA07	Brevibacillus_phage	1.6e-05	44.4
WP_020451007.1\|1430410_1430707_+	hypothetical protein	NA	NA	NA	NA
WP_020451008.1\|1430707_1431532_+	hypothetical protein	S6BFM4	Thermus_phage	1.6e-25	29.6
WP_020451009.1\|1431431_1432232_+	ATP-binding protein	A6XMI1	Bacillus_virus	3.6e-59	47.7
WP_165583463.1\|1432231_1432402_+	hypothetical protein	NA	NA	NA	NA
WP_041817436.1\|1432501_1432843_+	hypothetical protein	NA	NA	NA	NA
WP_020451011.1\|1432839_1433043_+	XtrA/YqaO family protein	A0A2H4J4M6	uncultured_Caudovirales_phage	6.4e-13	56.2
WP_020451012.1\|1433160_1433664_+	sigma-70 family RNA polymerase sigma factor	A0A0K2CNQ1	Brevibacillus_phage	6.4e-22	39.3
WP_020451013.1\|1433808_1434609_+\|terminase	terminase small subunit	A0A0S2MVB6	Bacillus_phage	2.6e-65	51.4
WP_020451014.1\|1434605_1435904_+\|terminase	PBSX family phage terminase large subunit	M4ZRM5	Bacillus_phage	2.5e-150	60.3
WP_020451015.1\|1435907_1437422_+\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	6.4e-142	55.3
WP_020451016.1\|1437429_1438278_+	hypothetical protein	A0A1B1P7E4	Bacillus_phage	8.8e-56	60.6
WP_020451017.1\|1438295_1439231_+\|capsid	phage major capsid protein	A0A1B1P7E3	Bacillus_phage	3.6e-103	64.1
WP_023856716.1\|1439346_1439721_+	DUF3199 family protein	NA	NA	NA	NA
WP_020451019.1\|1439717_1440074_+	YqbH/XkdH family protein	NA	NA	NA	NA
WP_020451020.1\|1440070_1440559_+	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	1.4e-34	43.3
WP_020451021.1\|1440571_1441012_+	hypothetical protein	NA	NA	NA	NA
WP_020451022.1\|1441012_1441237_+	hypothetical protein	NA	NA	NA	NA
WP_020451023.1\|1441236_1442583_+\|tail	phage tail sheath family protein	S5MNC1	Brevibacillus_phage	3.1e-79	40.5
WP_020451024.1\|1442584_1443028_+\|tail	phage tail tube protein	A0A0K2CNG3	Brevibacillus_phage	1.6e-24	44.7
WP_020451025.1\|1443152_1443602_+	hypothetical protein	A0A0A7RTY8	Clostridium_phage	4.1e-12	38.7
WP_095290311.1\|1443643_1443781_+	hypothetical protein	NA	NA	NA	NA
WP_020451027.1\|1443784_1447549_+	transglycosylase SLT domain-containing protein	A0A1L2JY60	Aeribacillus_phage	3.4e-43	48.1
WP_020451028.1\|1447541_1448198_+	LysM peptidoglycan-binding domain-containing protein	A0A090DBR9	Clostridium_phage	2.4e-24	32.6
WP_020451029.1\|1448254_1449235_+	hypothetical protein	H7BV96	unidentified_phage	3.0e-39	31.4
WP_020451030.1\|1449231_1449540_+	DUF2577 domain-containing protein	S6C459	Thermus_phage	7.9e-07	37.3
WP_020451031.1\|1449558_1449984_+	DUF2634 domain-containing protein	A0A2H4J6K5	uncultured_Caudovirales_phage	1.6e-13	37.3
WP_020451032.1\|1449976_1451020_+\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	7.0e-71	43.5
WP_020451033.1\|1451006_1451927_+	YmfQ family protein	A0A0A7RTT8	Clostridium_phage	1.4e-14	31.7
WP_020451034.1\|1451940_1452327_+\|tail	phage tail protein	NA	NA	NA	NA
WP_020451036.1\|1453683_1453953_+	hemolysin XhlA family protein	A0A2H4JD40	uncultured_Caudovirales_phage	3.3e-25	64.0
WP_041817189.1\|1453967_1454234_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	1.2e-27	63.2

DBSCAN-SWA_5

2519481 : 2527869

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020452012.1\|2519481_2520678_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.6e-116	54.2
WP_020452013.1\|2520699_2521347_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	5.2e-40	43.4
WP_020452014.1\|2521358_2522447_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	1.6e-62	37.5
WP_020452015.1\|2522808_2523153_-	hypothetical protein	NA	NA	NA	NA
WP_020452016.1\|2523417_2525607_-	metallophosphoesterase	A0A220BYT7	Staphylococcus_phage	1.1e-153	41.7
WP_020452017.1\|2525812_2526082_-	hypothetical protein	NA	NA	NA	NA
WP_020452018.1\|2526071_2527202_-	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	1.2e-71	40.9
WP_020452019.1\|2527431_2527869_-	peptidylprolyl isomerase	A0A2H4UTF4	Bodo_saltans_virus	9.2e-17	44.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_021362

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection