CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NC_020385	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-328, complete sequence	0 crisprs	Cas14u_CAS-V,csa3,cas14j,RT	0	0	1
NC_020393	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-107, complete sequence	0 crisprs	RT,cas14j,csa3	0	0	1
NC_020382	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-68, complete sequence	0 crisprs	csa3	0	0	0
NC_020377	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-8, complete sequence	0 crisprs	NA	0	0	0
NC_020379	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-15, complete sequence	0 crisprs	NA	0	0	0
NC_020394	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-233, complete sequence	0 crisprs	cas14j,RT	0	0	1
NC_020380	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-16, complete sequence	0 crisprs	NA	0	0	0
NC_020390	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-6, complete sequence	0 crisprs	NA	0	0	0
NC_020391	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-11, complete sequence	0 crisprs	NA	0	0	0
NC_020376	Bacillus thuringiensis serovar thuringiensis str. IS5056, complete sequence	5 crisprs	cas3,csa3,RT,WYL,c2c9_V-U4,DinG,cas14k,DEDDh	3	11	12
NC_020392	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-63, complete sequence	0 crisprs	NA	0	0	7
NC_020381	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-39, complete sequence	0 crisprs	NA	0	0	2
NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	2 crisprs	cas14j,csa3,RT,cas3,cas5,cas8c,cas7	3	36	2
NC_020383	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence	1 crisprs	csa3,RT	0	2	0
NC_020378	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-9, complete sequence	0 crisprs	NA	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

141977 : 193464

Lactococcus_phage(30.77%)

integrase,transposase

attL 174580:174639|attR 194201:194301

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000538377.1\|141977_144941_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	7.0e-201	39.2
WP_000382147.1\|144959_145814_-	TnP I resolvase	S5M9V8	Brevibacillus_phage	4.4e-23	26.4
WP_015406671.1\|145883_146204_-	hypothetical protein	NA	NA	NA	NA
WP_000282533.1\|147074_147263_-	RNA chaperone Hfq	NA	NA	NA	NA
WP_000710775.1\|147962_148622_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_000793628.1\|148623_149601_+	multidrug resistance efflux transporter family protein	NA	NA	NA	NA
WP_001087712.1\|149897_150173_+	hypothetical protein	NA	NA	NA	NA
WP_000122389.1\|150240_150474_-	YuzF family protein	NA	NA	NA	NA
WP_000340038.1\|150713_150947_-	hypothetical protein	NA	NA	NA	NA
WP_000738546.1\|151242_151389_-	BC1881 family protein	NA	NA	NA	NA
WP_000486310.1\|151936_152398_-	hypothetical protein	NA	NA	NA	NA
WP_000957105.1\|152613_153522_-	acyl-ACP desaturase	NA	NA	NA	NA
WP_001192000.1\|154053_154353_+	hypothetical protein	NA	NA	NA	NA
WP_000410775.1\|154891_155095_+	cold-shock protein	Q9AZD3	Lactococcus_phage	1.5e-17	63.6
WP_001038995.1\|155225_158108_-	collagenase ColA	NA	NA	NA	NA
WP_000520478.1\|158856_159462_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_000954712.1\|159639_160446_-	arylamine N-acetyltransferase	NA	NA	NA	NA
WP_000540759.1\|160774_161335_-	hypothetical protein	NA	NA	NA	NA
WP_001058402.1\|161730_162105_-	hypothetical protein	NA	NA	NA	NA
WP_000422018.1\|162191_163919_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.1e-07	83.3
WP_000196664.1\|164296_164596_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_001014211.1\|165175_166495_-	septum formation initiator	NA	NA	NA	NA
WP_140157233.1\|166576_166624_-	hypothetical protein	NA	NA	NA	NA
WP_000281790.1\|166791_167679_-	L-serine ammonia-lyase, iron-sulfur-dependent, subunit alpha	NA	NA	NA	NA
WP_001024892.1\|167700_168399_-	serine dehydratase	NA	NA	NA	NA
WP_000064502.1\|170172_171363_-	MFS transporter	NA	NA	NA	NA
WP_003275109.1\|171721_172309_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_001222641.1\|173138_174224_+	tyrosinase family protein	NA	NA	NA	NA
174580:174639	attL	NA	NA	NA	NA
WP_000798699.1\|174680_175433_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	7.0e-57	47.3
WP_000275580.1\|175422_176718_-\|transposase	IS21-like element IS232 family transposase	A0A059NT83	Lactococcus_phage	1.0e-42	31.0
WP_000505353.1\|177408_178251_-	SMP-30/gluconolactonase/LRE family protein	NA	NA	NA	NA
WP_000233374.1\|178524_178878_-	DUF4360 domain-containing protein	NA	NA	NA	NA
WP_000089897.1\|179359_180727_-	S8 family serine peptidase	Q2A0D0	Sodalis_phage	4.8e-19	26.0
WP_000573035.1\|180916_181150_-	hypothetical protein	NA	NA	NA	NA
WP_001099187.1\|181283_181454_-	hypothetical protein	NA	NA	NA	NA
WP_000531388.1\|181758_182724_-	S8 family peptidase	A0A127AWU5	Bacillus_phage	3.1e-89	57.8
WP_015406677.1\|183147_184227_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0A8WI33	Clostridium_phage	4.2e-18	31.3
WP_015406678.1\|184232_184634_-\|transposase	IS200/IS605 family transposase	Q332K6	Clostridium_botulinum_C_phage	5.8e-50	71.2
WP_000358798.1\|185024_185168_-	hypothetical protein	NA	NA	NA	NA
WP_003275498.1\|185846_187589_-	S8 family serine peptidase	A0A1V0S9L2	Catovirus	1.2e-11	28.4
WP_015406680.1\|189237_190410_-\|integrase	tyrosine-type recombinase/integrase	A0A142F1N9	Bacillus_phage	6.8e-06	24.4
WP_000189815.1\|190813_191830_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_000275580.1\|192168_193464_+\|transposase	IS21-like element IS232 family transposase	A0A059NT83	Lactococcus_phage	1.0e-42	31.0
194201:194301	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_020393

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

4122 : 35114

Bacillus_phage(45.45%)

integrase,transposase

attL 22631:22646|attR 39872:39887

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000116413.1\|4122_5544_+\|transposase	IS4-like element ISBth4 family transposase	NA	NA	NA	NA
WP_000203376.1\|5899_9586_-	pesticidal crystal protein cry1Ba	NA	NA	NA	NA
WP_014481837.1\|10155_10602_-	hypothetical protein	A0A1B1P878	Bacillus_phage	1.6e-16	42.2
WP_000681129.1\|10588_10969_-	hypothetical protein	NA	NA	NA	NA
WP_003272683.1\|10965_12879_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_000861877.1\|12971_14090_-\|integrase	tyrosine-type recombinase/integrase	A0A0S2MV79	Bacillus_phage	3.2e-05	25.0
WP_001043946.1\|14572_14845_-	HU family DNA-binding protein	A7KV42	Bacillus_phage	1.8e-23	67.8
WP_015413263.1\|15295_15694_+\|transposase	IS200/IS605 family transposase	A0A286QN76	Streptococcus_phage	3.1e-51	69.7
WP_000595411.1\|15705_16812_+	helix-turn-helix domain-containing protein	A0A288TXV8	Enterococcus_phage	1.3e-78	47.5
WP_001058764.1\|17278_17488_+	hypothetical protein	NA	NA	NA	NA
WP_167374445.1\|17778_18132_+	ArsR family transcriptional regulator	NA	NA	NA	NA
WP_000021282.1\|18156_18387_+	hypothetical protein	A0A217ERD4	Bacillus_phage	2.2e-06	51.8
WP_000700965.1\|18713_19484_-	coenzyme F420-0:L-glutamate ligase	NA	NA	NA	NA
WP_000644939.1\|19480_20341_-	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
WP_000660942.1\|20337_21204_-	shikimate dehydrogenase	NA	NA	NA	NA
WP_000554005.1\|21411_22434_+	hypothetical protein	NA	NA	NA	NA
WP_000028781.1\|22417_23659_+	S-adenosylmethionine synthetase	NA	NA	NA	NA
22631:22646	attL	NA	NA	NA	NA
WP_000412005.1\|23639_24650_+	hypothetical protein	NA	NA	NA	NA
WP_000560325.1\|24646_25774_+	glycosyltransferase	NA	NA	NA	NA
WP_003275306.1\|26101_27349_+	MFS transporter	A0A1B0RXG2	Streptococcus_phage	9.4e-06	25.1
WP_014481840.1\|27345_30363_+	non-ribosomal peptide synthetase	A0A2K9L3I8	Tupanvirus	4.1e-39	28.0
WP_000704745.1\|30645_31812_+	nucleotide sugar dehydrogenase	A0A1J0FA55	Only_Syngen_Nebraska_virus	1.4e-107	52.1
WP_001021537.1\|32194_33238_-\|integrase	tyrosine-type recombinase/integrase	A0A0E3T6D9	Bacillus_phage	5.8e-09	23.4
WP_015413265.1\|33469_33739_+	zinc-finger domain-containing protein	NA	NA	NA	NA
WP_000275580.1\|33818_35114_+\|transposase	IS21-like element IS232 family transposase	A0A059NT83	Lactococcus_phage	1.0e-42	31.0
39872:39887	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NC_020392

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 3333

Brevibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000382147.1\|2478_3333_-	TnP I resolvase	S5M9V8	Brevibacillus_phage	4.4e-23	26.4

DBSCAN-SWA_2

9182 : 10139

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000215667.1\|9182_10139_-	N-acetylmuramoyl-L-alanine amidase	A0A0S2MV84	Bacillus_phage	6.9e-49	39.5

DBSCAN-SWA_3

13574 : 19567

Lactococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000275580.1\|13574_14870_+\|transposase	IS21-like element IS232 family transposase	A0A059NT83	Lactococcus_phage	1.0e-42	31.0
WP_000798699.1\|14859_15612_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	7.0e-57	47.3
WP_000714368.1\|15928_16105_-	hypothetical protein	NA	NA	NA	NA
WP_000809635.1\|16133_16715_-	hypothetical protein	NA	NA	NA	NA
WP_001236352.1\|17079_18309_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	1.1e-83	48.8
WP_000362624.1\|18457_19567_-	M23 family metallopeptidase	A0A2D0ZM66	Rhodococcus_phage	4.3e-18	45.2

DBSCAN-SWA_4

29278 : 32452

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015413262.1\|29278_32452_-	ATP-binding protein	A7KUX5	Bacillus_phage	2.2e-06	23.2

DBSCAN-SWA_5

36722 : 37916

Bacillus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000499523.1\|36722_37916_+\|transposase	IS110-like element ISBth13 family transposase	A0A0U3ULR1	Bacillus_phage	1.1e-24	26.1

DBSCAN-SWA_6

55286 : 57324

Lactococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000798699.1\|55286_56039_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	7.0e-57	47.3
WP_000275580.1\|56028_57324_-\|transposase	IS21-like element IS232 family transposase	A0A059NT83	Lactococcus_phage	1.0e-42	31.0

DBSCAN-SWA_7

60559 : 61495

Bacillus_phage(100.0%)

integrase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000873092.1\|60559_61495_+\|integrase	site-specific integrase	A0A1B1P793	Bacillus_phage	3.8e-76	46.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NC_020376

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_020376_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_020376_1

1112424-1112539

Orphan

Consensus_repeat	Method
GGTTTAAATACGTTAAATAGCAAAACAGGTGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_020376_1

>merge|NC_020376|1|1112424-1112539|CRISPRCasFinder
GGTTTAAATACGTTAAATAGCAAAACAGGTGAGATGCAGACGGGTATAGGGAAATTGCAAGATGGCTCCGGAAAAGTAACAGGCGGTTTAAATACGTTAAATAGCAAAACGGGTGA

>NC_020376|1|1|1112424-1112539|CRISPRCasFinder
GGTTTAAATACGTTAAATAGCAAAACAGGTGA	GATGCAGACGGGTATAGGGAAATTGCAAGATGGCTCCGGAAAAGTAACAGGC
GGTTTAAATACGTTAAATAGCAAAACGGGTGA

Protein	Signature genes	Signature genes Name	Protein_function
NC_020376.1\|WP_000963378.1\|1110904_1111477_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NC_020376.1\|WP_000279269.1\|1104324_1106691_+\|chitobiase/beta-hexosaminidase-C-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|225249
NC_020376.1\|WP_000103715.1\|1116179_1117193_+\|LacI-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224525
NC_020376.1\|WP_000897280.1\|1118308_1119298_+\|lipoate--protein-ligase	unknown	unknown	gnl\|CDD\|161920
NC_020376.1\|WP_000453694.1\|1102730_1104083_-\|DUF4026-domain-containing-protein	unknown	unknown	gnl\|CDD\|338635
NC_020376.1\|WP_000252605.1\|1099241_1100288_+\|uroporphyrinogen-decarboxylase	unknown	unknown	gnl\|CDD\|234644
NC_020376.1\|WP_001228113.1\|1101257_1102679_+\|protoporphyrinogen-oxidase	unknown	unknown	gnl\|CDD\|237009
NC_020376.1\|WP_001055187.1\|1120027_1121560_+\|fatty-acid--CoA-ligase-family-protein	unknown	unknown	gnl\|CDD\|236072
NC_020376.1\|WP_000620470.1\|1115475_1115985_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NC_020376.1\|WP_001176841.1\|1106822_1107122_+\|hypothetical-protein	unknown	unknown	unknown
NC_020376.1\|WP_001068221.1\|1114988_1115342_-\|PH-domain-containing-protein	unknown	unknown	gnl\|CDD\|379617
NC_020376.1\|WP_000567010.1\|1117232_1117361_-\|YhfH-family-protein	unknown	unknown	gnl\|CDD\|379490
NC_020376.1\|WP_000184503.1\|1108291_1108693_+\|BlaI/MecI/CopY-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|367747
NC_020376.1\|WP_000832166.1\|1119437_1119866_+\|hypothetical-protein	unknown	unknown	unknown
NC_020376.1\|WP_000726787.1\|1100302_1101238_+\|ferrochelatase	unknown	unknown	gnl\|CDD\|183526
NC_020376.1\|WP_000984143.1\|1107207_1108062_-\|hypothetical-protein	unknown	unknown	unknown
NC_020376.1\|WP_000140289.1\|1114656_1114962_+\|DUF2087-domain-containing-protein	unknown	unknown	gnl\|CDD\|226378
NC_020376.1\|WP_014481972.1\|1114440_1114653_+\|hypothetical-protein	unknown	unknown	unknown
NC_020376.1\|WP_000784690.1\|1117564_1118299_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293802
NC_020376.1\|WP_015055096.1\|1108695_1110633_+\|M56-family-metallopeptidase	unknown	unknown	gnl\|CDD\|310280

Protein	Function_ID	Function_description	E-value
NC_020376.1\|WP_000963378.1\|1110904_1111477_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	9.25802e-15
NC_020376.1\|WP_000279269.1\|1104324_1106691_+\|chitobiase/beta-hexosaminidase-C-terminal-domain-containing-protein	gnl\|CDD\|225249	COG2374, COG2374, Predicted extracellular nuclease [General function prediction only].	2.04865e-73
NC_020376.1\|WP_000103715.1\|1116179_1117193_+\|LacI-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|224525	COG1609, PurR, Transcriptional regulators [Transcription].	2.56346e-114
NC_020376.1\|WP_000453694.1\|1102730_1104083_-\|DUF4026-domain-containing-protein	gnl\|CDD\|338635	pfam13218, DUF4026, Protein of unknown function (DUF4026). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 450 amino acids in length. The family is found in association with pfam10077.	1.60196e-174
NC_020376.1\|WP_000252605.1\|1099241_1100288_+\|uroporphyrinogen-decarboxylase	gnl\|CDD\|234644	PRK00115, hemE, uroporphyrinogen decarboxylase; Validated.	0
NC_020376.1\|WP_001228113.1\|1101257_1102679_+\|protoporphyrinogen-oxidase	gnl\|CDD\|237009	PRK11883, PRK11883, protoporphyrinogen oxidase; Reviewed.	0
NC_020376.1\|WP_001055187.1\|1120027_1121560_+\|fatty-acid--CoA-ligase-family-protein	gnl\|CDD\|236072	PRK07656, PRK07656, long-chain-fatty-acid--CoA ligase; Validated.	0
NC_020376.1\|WP_000620470.1\|1115475_1115985_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	2.11979e-15
NC_020376.1\|WP_000784690.1\|1117564_1118299_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293802	cd07716, RNaseZ_short-form-like_MBL-fold, uncharacterized bacterial subgroup of Ribonuclease Z, short form; MBL-fold metallo-hydrolase domain. The tRNA maturase RNase Z (also known as tRNase Z or 3' tRNase) catalyzes the endonucleolytic removal of the 3' extension of the majority of tRNA precursors. Two forms of RNase Z exist in eukaryotes, one long (ELAC2) and one short form (ELAC1), the former may have resulted from a duplication of the shorter enzyme. Only the short form exists in bacteria. Members of this bacterial subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	3.54816e-86
NC_020376.1\|WP_001068221.1\|1114988_1115342_-\|PH-domain-containing-protein	gnl\|CDD\|379617	pfam14470, bPH_3, Bacterial PH domain. Proteins in this family are distantly related to PH domains.	1.32494e-19
NC_020376.1\|WP_000567010.1\|1117232_1117361_-\|YhfH-family-protein	gnl\|CDD\|379490	pfam14149, YhfH, YhfH-like protein. The YhfH-like protein family includes the B. subtilis YhfH protein, which is functionally uncharacterized. Its expression is repressed by the Spx paralogue MgsR, which regulates genes involved in stress response. This family of proteins is found in bacteria. Proteins in this family are typically between 42 and 53 amino acids in length.	3.52581e-13
NC_020376.1\|WP_000184503.1\|1108291_1108693_+\|BlaI/MecI/CopY-family-transcriptional-regulator	gnl\|CDD\|367747	pfam03965, Penicillinase_R, Penicillinase repressor. The penicillinase repressor negatively regulates expression of the penicillinase gene. The N-terminal region of this protein is involved in operator recognition, while the C-terminal is responsible for dimerization of the protein.	6.07643e-46
NC_020376.1\|WP_000726787.1\|1100302_1101238_+\|ferrochelatase	gnl\|CDD\|183526	PRK12435, PRK12435, ferrochelatase; Provisional.	0
NC_020376.1\|WP_000897280.1\|1118308_1119298_+\|lipoate--protein-ligase	gnl\|CDD\|161920	TIGR00545, Probable_lipoate-protein_ligase_A, lipoyltransferase and lipoate-protein ligase. One member of this group of proteins is bovine lipoyltransferase, which transfers the lipoyl group from lipoyl-AMP to the specific Lys of lipoate-dependent enzymes. However, it does not first activate lipoic acid with ATP to create lipoyl-AMP and pyrophosphate. Another member of this group, lipoate-protein ligase A from E. coli, catalyzes both the activation and the transfer of lipoate. Homology between the two is full-length, except for the bovine mitochondrial targeting signal, but is strongest toward the N-terminus. [Protein fate, Protein modification and repair].	3.20885e-138
NC_020376.1\|WP_000140289.1\|1114656_1114962_+\|DUF2087-domain-containing-protein	gnl\|CDD\|226378	COG3860, COG3860, Uncharacterized protein conserved in bacteria [Function unknown].	4.32398e-24
NC_020376.1\|WP_015055096.1\|1108695_1110633_+\|M56-family-metallopeptidase	gnl\|CDD\|310280	pfam05569, Peptidase_M56, BlaR1 peptidase M56. Production of beta-Lactamase and penicillin-binding protein 2a (which mediate staphylococcal resistance to beta-lactam antibiotics) is regulated by a signal-transducing integral membrane protein and a transcriptional repressor. The signal transducer is a fusion protein with penicillin-binding and zinc metalloprotease domains. The signal for protein expression is transmitted by site-specific proteolytic cleavage of both the transducer, which auto-activates, and the repressor, which is inactivated, unblocking gene transcription. homologs to this peptidase domain, which corresponds to Merops family M56, are also found in a number of other bacterial genome sequences.	5.09104e-49

>NC_020376.1|WP_000963378.1|1110904_1111477_+|TetR/AcrR-family-transcriptional-regulator
MAIDRKRSIIEAATKSFSAFGYKATTMDQVAKLANVGKGTIYTFFKNKEELFGEIISNLITEMKQVAENAIRSDVSFFENVHRALYSILEFRKEHQLMIKLIQEERDMGTKEVQEVMQQVDVEIVSVIQSYLKIAIEKGEISKCDPEITAFIMLRLYVSLIFDWEKNHEPLEKEKIAELFELYLLKGLSN
>NC_020376.1|WP_015055096.1|1108695_1110633_+|M56-family-metallopeptidase
MIDTLINVYLPHFFDWLIETSLMASILVGFILCIKVLFRNKLTPRWQYMLWIVLMIRLLLPWSPDSSYSIYSLLSYSSSVSEVIPKNMPATENIVNIESDRKVELESNPKMVTKTSEPEVEVSSEKQTTFSLYKLALYVWLAGVIILAAITFLTNRRLYSYIKKQPDITDEQVITVFDRCKQSMKVKKAVSLRLAGKIASPTVFSFFRPKVLLSKKHMKVLNEQQLQYVFYHELAHIKRKDVAVNWIMYSLILLNWFNPILWYAYFCMREDQELACDAYALTFIDKEEQIAYGHTIITLLEHYSYQVPSLANLSRNKRTLKRRIVMIKKFQKKSYRLSLLGIIAIAAIAGGFLLNAKITEGDERQEEKVVEKKQSKAAFEKAIETVLGTPENASREWGMSIKSYKRDTDFLYLAEKNFTKEEFEQYVQLFKEAKEIHKKAMVNKKVPENYDRDTKEFKRERLNKADQERLASIEKKLVPLSERVEKSLTYTIEEAKEHVPYQIKQPTYIPEGYELKREWADSYFGRDVELVVKSEYTNGKYGFTIYQSRIYAGGNKDPLHYMMPGEENLESYNLDGKGMVYNKSSHGEDKLKGLKMFVPEQGKNSEYQVVIVNDIFTRDTKIYEEIIDDELTKKEMEKILISMSK
>NC_020376.1|WP_000184503.1|1108291_1108693_+|BlaI/MecI/CopY-family-transcriptional-regulator
MTNQLPKISEAELEIMKVLWSNSPQTANEIIEELEDAMDWKPKTIRTLINRLVQKEAVSYHQDKGRMYAYYPLVSQDNYLQVETKSLLKRFCGAAFKPLLVNFLKEEKLSSEDINELKRILDEKTEENKRKDR
>NC_020376.1|WP_000984143.1|1107207_1108062_-|hypothetical-protein
MMRALRLNIKQAFCNRVSLIIMFSGFVLICIYHYYYVIRYLGDAANGPISTDIKWIGFRDNEMDVYLLLMPVIASFPFSTSYNSDKSDGFKPFVSKGISLFPYSVTKYIVTFFCGGFLYTFPFILSLLFCKLTIPDGEPTAGSGIINDNGMFANLYYESPLTYIAVYIGINFLFAGLMALLGLAASAWSQKDYMAILFPFAVASIPYVLLNTIFPTIGGAPFHLYDPKQPLHGMSPYILTMQCTFFLLVSLIMYIQGVKRDRKKYRRRLQKRERCRKAFQTISD
>NC_020376.1|WP_001176841.1|1106822_1107122_+|hypothetical-protein
MQLQINGKLMNQLAIFFSTIVMLQFVADITGLTSNLDITYNLINTAASYITFSLAVIFTLIGARRELSKYAIILLCSVVGIKAIYFAVFVILWGLAGTP
>NC_020376.1|WP_000279269.1|1104324_1106691_+|chitobiase/beta-hexosaminidase-C-terminal-domain-containing-protein
MAVKKLLSVFLSFLLLLSFTGTLAQAEETASMSVEKAIQVFKQQGKTKGIVEGYIVGYTQSSSKYTKDPAKFDDTNVAIADSPNETNPDKIMPIQLPKGDVRTAVNVKDHPENIGKKVSLTGTLELYFSNPGLKSVTAYKFQGEGQNRVSDVVASPNGGEVAKGTAVTLTTNTEGATIYYTLDGSNPTNKSVRYNGQIVMNENSVVKAIAEKEELTSSAISTFSFIIVNNEPVRIHDIQGKSHISPYNGKKVNNVEGVVTALDKNGFYIEDNQPDNDPATSEGIYVYKKDANVAVGDLIQVDGVVEEYVGPGYAERFETDLTTTEIKASRVAVIAKNQTLPAPIVLGENGVKIPDQIIDNDAFGLFDPNEDAIDFYESIEGMRVTMPTPKIITPQKNGNLYVTVKNGGDKIVTQYGTPLLDENQLNPERLSVKVPRDYVAKVGDTFTGDITGVVGYDYGSFRISPITELPAVVDGGFKQVGANIQPRLDKLTVATYNIENFSANKKETTDEKVKALAYSIKYNLKMPDIIGVEEMQDNNGSINDGTTDASLSAKRIIDAVLEIRGPKYEYVEIAPNNNQDGGAPGANIRVGFFYNPSRVKLATVPKLLDKNVVRIGDENPLFESTRKPLAAEFTFQGQNIVVVANHLNSKLGDATPFGKVQPLVLKSEDKRIQLAQEVNHFVQGIQEKNTNAPVVVLGDMNDFEFSKPLKALEGTILKDMLNTVPKENRYTYIHEGNAQVLDHILVTNNIAPHTIVDPVHLNSNIMKEHGRVSDHDPVLAQIDLKKAS
>NC_020376.1|WP_000453694.1|1102730_1104083_-|DUF4026-domain-containing-protein
MEVQTETYRAAMNGTLERHFSDMIAVIPTRITIEQLKHRLEIIATKVDELKIVYSDETSLIVELHMGETVIPYELHIDEANDPEEYKMYNRQDSTIVDRNFEDVAFGTEIFTRTLFVGDVLDCFFQQLQFLWNLAPDLLFVIDSSAAMKVISRSYIEYHVENELLPDIPDLYVIHSVYEDDKDDEPTQYWFHTHGLLRAGVTEIELIIPNRISSYYGIGDLFQTFANNAVENGQVPMNEPIVIAHSQQGSIHTVAVPWEKGLSYIGHKTSMDQLSSIEDEEVKLQPIDAQNTFLGGMDARDEYHQSPSVLLFKFNTSEEYIENFFKEHEEATGLMFYKTNSETARMAYNAKNTFGYFSNIFHIEQSNEDFRFLAKFGVSYEEGKSEHMWFEMQNITEDFIQGILINEPYFIKDMSEGNSYHLDFDNLTEWVIYAGDAVIKPNNLYMFIGE
>NC_020376.1|WP_001228113.1|1101257_1102679_+|protoporphyrinogen-oxidase
MRKKVVIVGGGITGLTAMYNLQKNIHEKNLPIDTLLIEASGKLGGKIQTVRKDGFTIERGPDSFLARKESVARLVKELGLGDELVNNQAGQSFILVNNRLHKMPNGSMMGIPTQITPFLFSGLFSPIGKLRAGFDLLMPRSKPVSDQSLGQFFRHRLGNEVVENLIEPLLSGIYAGDIDEMSLMSTFPQMYQIEQKHRSISLGMRTLAPKEEKAEPKKGMFQTVKTGLESIVKSLEAKMHEGTIIKGTRIEKIAKQGDGYTITLSNGKEIEADAIVVATSHKVLPSMFAQYKQFRFFRNIPSTSVANVALAFPKSAIQRDINGTGFVVSRNSDYTITACTWTHKKWPHTTPEGKTLLRCYVGRAGDEAVVEQTEEELVQLVLEDLRKTMDITEDPEFTIVSRWKEAMPQYTVGHNERMKKLTTFMEKELPGIYLAGSSYAGAGLPDCINQGEEAAKRVLSHLEKVIDAELIAQ
>NC_020376.1|WP_000726787.1|1100302_1101238_+|ferrochelatase
MKKKIGLLVMAYGTPYKEEDIERYYTHIRRGRKPSPEMLEDLTERYRAIGGISPLATITLEQAKKLEKRLNEVQDEVEYHMYLGLKHIEPFIEDAVKDMHNDGIQDAIALVLAPHYSTFSVKSYVGRAQEEAEKLGNLTIHGIDSWYKEPKFIQYWVDAVKVIYNGMSDAEREKAVLIVSAHSLPEKIIGMGDPYPDQLNETADYIARGAEVANYAVGWQSAGNTPDPWIGPDVQDLTRELNEKHGYTSFVYAPVGFVAEHLEVLYDNDFECKVVTDEIGAKYYRPEMPNASDAFIDCLTDVVLKKKESVL
>NC_020376.1|WP_000252605.1|1099241_1100288_+|uroporphyrinogen-decarboxylase
MVRTINETFLKACRGERTDYVPAWYMRQAGRSQPEYRKIKEKYSLFEITHNPELCAYVTKLPVDQYNVDAAILYKDIMSPLPAIGVDVEIKSGIGPVIDNPIRSLQDVEKLGEINPEDDVPYILDTIRLLTTEMLDVPLIGFSGAPFTLASYMIEGGPSRNYHNTKAFMYAEPKAWFALMDKLADMVITYLKAQINAGAKAVQIFDSWVGTVNVADYRVFIKPAMERIFAEVRKMGVPMIMHGVGAAHLVNEWHDLPLDVVGLDWRLPIEEARARGVHKAVQGNMDPSFLLAPWSVIEEHVKGILDQGMKQPGYIFNLGHGVFPEVNPDTLKRLTTFIHEYSKGQLAK
>NC_020376.1|WP_014481972.1|1114440_1114653_+|hypothetical-protein
MMRGNLTYYFIVNPLIIFLVYALSPILFDKEVYTSMKDAFGILTFYYVLMGGYYFIDILSEKIKKKSDGG
>NC_020376.1|WP_000140289.1|1114656_1114962_+|DUF2087-domain-containing-protein
MTESEMKFRDTTIRNFFDKEDRLKSIPGQKKKKLVLLEHLISKLNAENQYTEKEINTFIKQYHDDFCTIRREFIVQGFMDREDNMYRINGREVWTKWEELK
>NC_020376.1|WP_001068221.1|1114988_1115342_-|PH-domain-containing-protein
MNPILTAAKQLLHKEEKILSTLKCSLTGYMITHKVPYPGMLLATNRRLLFFSQYKNTFIAEFDYEKILSIETKRRIFDKKIIFYYEDEYITLGYITSSNVEAFIDLLQRNSKTSTGL
>NC_020376.1|WP_000620470.1|1115475_1115985_+|GNAT-family-N-acetyltransferase
MIRLVKETDAEAIMNIRKEIILSETTTKFFIVSPKKLPNDSNAEREKIRKSNEKGNLYIVYEVDGKVVGFLLFNRYELERLQHAGTMGMGIKEAYCNQGIGTKLIEFLISWAKGQKGLEKICLGVVSVNDRAIKVYKRMGFVEEGRQRKQIKYEDGSYGDDVLMGFYIE
>NC_020376.1|WP_000103715.1|1116179_1117193_+|LacI-family-DNA-binding-transcriptional-regulator
MSTIEDVAKLAGLSRTTVSRVINNHPYVSDEKKKRVQLAMKHLGFVPNSAARRLRKQKTETIAVLVPRITNPFFSRFIEAIEIAASEHKYKLIICQTRYLPEKEMEYLQLLSTKQVDGIILCSLENPWEDVEPYLQHGPIVLCNEYIEEANIPTVKFDHAQGAYIAAKHVLDQGYRNLIFCRGNETKVVSQQRKMGFLRAITEKSRQVEAIDFLENAFSWEDGKRIFHEVLKDKKNPTAILAGGDEVAAGIISEAKRHNWSIPDDLAVIGFDNQILSQITEPGITTIEQPIDEMARKVVDLMMDKIHTKNYRKKELYEFELELLVKGSTMKDKMLLA
>NC_020376.1|WP_000567010.1|1117232_1117361_-|YhfH-family-protein
MIDQPMEFFRNLPTKTCAHCGKEIDEQHEAYHNKCDDCVHEE
>NC_020376.1|WP_000784690.1|1117564_1118299_+|MBL-fold-metallo-hydrolase
MKMTVVGFWGGFPEAGEATSGYLFEHDGFRLLVDCGSGVLAQLQKYITPSHIDAVVLSHYHHDHVADIGVLQYARLITSATTRQLPELPIYGHTFDENGFHSLTHEPHTKGIAYNPEETLQVGPFSISFLKTVHPVTCFAMRITAGDDAVVYSADSSYIPEFIPFTKDADLFICECNMYAHQEAAKAGHMNSTEVASIAKDANVKELLLTHLPHTGNPSDLVTEAKQIFSGHITLAHSGYVWNS
>NC_020376.1|WP_000897280.1|1118308_1119298_+|lipoate--protein-ligase
MLFIDNKGITDPRINLAIEEYCVKNLDINETYLLFYINEPSIIIGKNQNTVEEINADYVKEKGIHVVRRLSGGGAVYHDLGNLNFSFITKDDGDSFSNFKKFTEPVTKALSKLGVNAELSGRNDILAEGRKISGNAQFSTKGRMFSHGTLLFDSEIDHVVSALKVKMDKIQSKGIKSIRSRVANITEFLNEEMTTEEFRQLLLETIFEGETEIPTYELTEEDWKEIHKLSEERYQNWDWNYGKSPKFNLQHSHRFPVGQVDVRLEVKKGTVTECKIYGDFFGSLDVHDIEERLTGVQFDKDAFTAALEGVDIARYFGNITTEDFLHLFF
>NC_020376.1|WP_000832166.1|1119437_1119866_+|hypothetical-protein
MKRVIHIVILLGFVIGIAACNSETSSSRTLLSIGKPARDNVIYFTHTDNKRKIQDIQDRFQNKEWKRNETFSTVNKTPDVVLSIDENNKGLPTLYVTVYFHENGADVLNLYGEYTNLNKEELNKLREKMNAYYPKMISGLVS
>NC_020376.1|WP_001055187.1|1120027_1121560_+|fatty-acid--CoA-ligase-family-protein
MNLVQSLAETAKKKGDKPAYIFMDQSVSYDQLNKMVTRFSSNLAEMGIGKGDNVALVVGNSPHFLVGLYGTMKAGATVIPVNPIYTADEMHYILQNGDVKTIIVLDVLLPVIQSLTTRLPSLENIIICETSSEFNHTETEKMKTFTSFVGAGDLQYEGPELDEEDVAVILYTSGTTGKPKGAMLTHKNLYSNANDVASYLQFTADDRVVAALPMFHVFCLTVAVNAPIVNGATILMLPKFSPKEVFRICRTYEPTIFAGVPTMYNYLYLFEEASAEDVKTLRLCISGGASMPVALLQNFEKRFNVIVSEGYGLSEASPVTCFNPLDRPRKPGSIGTNIWHVENKIVNELGEEVSVGAVGELIVRGPNVMKGYYNAPEDTAATLKDGWLYTGDLAKMDEEGYFYIVDRKKDIVLVGGYNVYPREVEEVLYTHESVAEVVVIGVPDENLGEAVRAYVVLKQANVTEEELMHYCALHLAKYKVPKSIEFLIELPKNTTGKLLRRALREKAMQV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_020376_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_020376_2

3426252-3426362

Orphan

Consensus_repeat	Method
TACCGGAATTGGAATAACTGGTCCTAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_020376_2

>merge|NC_020376|2|3426252-3426362|CRISPRCasFinder
TACCGGAATTGGAATAACTGGTCCTACCGGGGTTACAGGTCCTACCGGAATCGGAATAACTGGTCCTACTGGGGTTACAGGTTCTACCGGAATCGGAATAACTGGTCCTAC

>NC_020376|2|2|3426252-3426362|CRISPRCasFinder
TACCGGAATTGGAATAACTGGTCCTAC	CGGGGTTACAGGTCCTACCGGAATCGGAATAACTGGTCCTACTGGGGTTACAGGTTC
TACCGGAATCGGAATAACTGGTCCTAC

Protein	Signature genes	Signature genes Name	Protein_function
NC_020376.1\|WP_000129189.1\|3428686_3429478_+\|arylamine-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366312
NC_020376.1\|WP_000435522.1\|3433528_3434506_-\|agmatine-deiminase-family-protein	unknown	unknown	gnl\|CDD\|377332
NC_020376.1\|WP_001042044.1\|3422203_3422914_-\|histidine-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|366010
NC_020376.1\|WP_001081125.1\|3417598_3418054_-\|DinB-family-protein	unknown	unknown	gnl\|CDD\|378981
NC_020376.1\|WP_000256462.1\|3423074_3423599_-\|N-acetyltransferase	unknown	unknown	gnl\|CDD\|225695
NC_020376.1\|WP_000403896.1\|3420155_3421049_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NC_020376.1\|WP_000473732.1\|3419342_3419855_-\|YjfA-family-protein	unknown	unknown	gnl\|CDD\|371292
NC_020376.1\|WP_000915203.1\|3437922_3439050_-\|serine-hydrolase	unknown	unknown	gnl\|CDD\|365903
NC_020376.1\|WP_000137534.1\|3429595_3431383_+\|oligoendopeptidase-F	unknown	unknown	gnl\|CDD\|341071
NC_020376.1\|WP_000902416.1\|3418246_3418735_+\|DinB-family-protein	unknown	unknown	gnl\|CDD\|368313
NC_020376.1\|WP_001095202.1\|3423605_3425507_-\|mannonate-oxidoreductase	unknown	unknown	gnl\|CDD\|234750
NC_020376.1\|WP_000771162.1\|3418848_3419325_-\|DUF2690-domain-containing-protein	unknown	unknown	gnl\|CDD\|371292
NC_020376.1\|WP_003271092.1\|3416368_3417406_-\|DUF4003-domain-containing-protein	unknown	unknown	gnl\|CDD\|379047
NC_020376.1\|WP_000287981.1\|3432664_3433486_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133382
NC_020376.1\|WP_000582243.1\|3434737_3435670_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226304
NC_020376.1\|WP_000645266.1\|3421172_3422138_+\|quinone-oxidoreductase	unknown	unknown	gnl\|CDD\|176189
NC_020376.1\|WP_000476397.1\|3426941_3428483_-\|alpha-amylase	unknown	unknown	gnl\|CDD\|236518
NC_020376.1\|WP_001244187.1\|3431430_3432477_-\|agmatine-deiminase-family-protein	unknown	unknown	gnl\|CDD\|377332
NC_020376.1\|WP_000709187.1\|3436435_3437593_-\|agmatine-deiminase-family-protein	unknown	unknown	gnl\|CDD\|377332
NC_020376.1\|WP_000916570.1\|3435850_3436267_-\|phosphate-starvation-inducible-protein-PsiE	unknown	unknown	gnl\|CDD\|235075

Protein	Function_ID	Function_description	E-value
NC_020376.1\|WP_000129189.1\|3428686_3429478_+\|arylamine-N-acetyltransferase	gnl\|CDD\|366312	pfam00797, Acetyltransf_2, N-acetyltransferase. Arylamine N-acetyltransferase (NAT) is a cytosolic enzyme of approximately 30kDa. It facilitates the transfer of an acetyl group from Acetyl Coenzyme A on to a wide range of arylamine, N-hydroxyarylamines and hydrazines. Acetylation of these compounds generally results in inactivation. NAT is found in many species from Mycobacteria (M. tuberculosis, M. smegmatis etc) to man. It was the first enzyme to be observed to have polymorphic activity amongst human individuals. NAT is responsible for the inactivation of Isoniazid (a drug used to treat Tuberculosis) in humans. The NAT protein has also been shown to be involved in the breakdown of folic acid.	5.88396e-48
NC_020376.1\|WP_000435522.1\|3433528_3434506_-\|agmatine-deiminase-family-protein	gnl\|CDD\|377332	pfam04371, PAD_porph, Porphyromonas-type peptidyl-arginine deiminase. Peptidyl-arginine deiminase (PAD) enzymes catalyze the deimination of the guanidino group from carboxy-terminal arginine residues of various peptides to produce ammonia. PAD from Porphyromonas gingivalis (PPAD) appears to be evolutionarily unrelated to mammalian PAD (pfam03068), which is a metalloenzyme. PPAD is thought to belong to the same superfamily as aminotransferase and arginine deiminase, and to form an alpha/beta propeller structure. This family has previously been named PPADH (Porphyromonas peptidyl-arginine deiminase homologs). The predicted catalytic residues in PPAD are Asp130, Asp187, His236, Asp238 and Cys351. These are absolutely conserved with the exception of Asp187 which is absent in two family members. PPAD is also able to catalyze the deimination of free L-arginine, but has primarily peptidyl-arginine specificity. It may have a FMN cofactor.	4.68951e-17
NC_020376.1\|WP_001042044.1\|3422203_3422914_-\|histidine-phosphatase-family-protein	gnl\|CDD\|366010	pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1). The histidine phosphatase superfamily is so named because catalysis centers on a conserved His residue that is transiently phosphorylated during the catalytic cycle. Other conserved residues contribute to a 'phosphate pocket' and interact with the phospho group of substrate before, during and after its transfer to the His residue. Structure and sequence analyses show that different families contribute different additional residues to the 'phosphate pocket' and, more surprisingly, differ in the position, in sequence and in three dimensions, of a catalytically essential acidic residue. The superfamily may be divided into two main branches. The larger branch 1 contains a wide variety of catalytic functions, the best known being fructose 2,6-bisphosphatase (found in a bifunctional protein with 2-phosphofructokinase) and cofactor-dependent phosphoglycerate mutase. The latter is an unusual example of a mutase activity in the superfamily: the vast majority of members appear to be phosphatases. The bacterial regulatory protein phosphatase SixA is also in branch 1 and has a minimal, and possible ancestral-like structure, lacking the large domain insertions that contribute to binding of small molecules in branch 1 members.	3.42128e-40
NC_020376.1\|WP_001081125.1\|3417598_3418054_-\|DinB-family-protein	gnl\|CDD\|378981	pfam12867, DinB_2, DinB superfamily. The DinB family are an uncharacterized family of potential enzymes. The structure of these proteins is composed of a four helix bundle.	6.92304e-19
NC_020376.1\|WP_000256462.1\|3423074_3423599_-\|N-acetyltransferase	gnl\|CDD\|225695	COG3153, COG3153, Predicted acetyltransferase [General function prediction only].	3.44143e-55
NC_020376.1\|WP_000403896.1\|3420155_3421049_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	4.16213e-60
NC_020376.1\|WP_000473732.1\|3419342_3419855_-\|YjfA-family-protein	gnl\|CDD\|371292	pfam10901, DUF2690, Protein of unknown function (DUF2690). This bacterial family of proteins has no known function.	2.4949e-18
NC_020376.1\|WP_000915203.1\|3437922_3439050_-\|serine-hydrolase	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	1.56233e-58
NC_020376.1\|WP_000137534.1\|3429595_3431383_+\|oligoendopeptidase-F	gnl\|CDD\|341071	cd09608, M3B_PepF, Peptidase family M3B, oligopeptidase F (PepF). Peptidase family M3B oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the Bacillus amyloliquefaciens PepF oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over-expressed from a multicopy plasmid. This PepF family includes Streptococcus agalactiae PepB, a group B streptococcal oligopeptidase which has been shown to degrade a variety of bioactive peptides as well as the synthetic collagen-like substrate N-(3-[2-furyl]acryloyl)-Leu-Gly- Pro-Ala in vitro.	0
NC_020376.1\|WP_000902416.1\|3418246_3418735_+\|DinB-family-protein	gnl\|CDD\|368313	pfam05163, DinB, DinB family. DNA damage-inducible (din) genes in Bacillus subtilis are coordinately regulated and together compose a global regulatory network that has been termed the SOS-like or SOB regulon. This family includes DinB from B. subtilis.	2.7103e-16
NC_020376.1\|WP_001095202.1\|3423605_3425507_-\|mannonate-oxidoreductase	gnl\|CDD\|234750	PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed.	5.89169e-160
NC_020376.1\|WP_000771162.1\|3418848_3419325_-\|DUF2690-domain-containing-protein	gnl\|CDD\|371292	pfam10901, DUF2690, Protein of unknown function (DUF2690). This bacterial family of proteins has no known function.	1.59251e-18
NC_020376.1\|WP_003271092.1\|3416368_3417406_-\|DUF4003-domain-containing-protein	gnl\|CDD\|379047	pfam13170, DUF4003, Protein of unknown function (DUF4003). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 327 and 345 amino acids in length.	2.6875e-109
NC_020376.1\|WP_000287981.1\|3432664_3433486_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133382	cd01107, HTH_BmrR, Helix-Turn-Helix DNA binding domain of the BmrR transcription regulator. Helix-turn-helix (HTH) multidrug-efflux transporter transcription regulator, BmrR and YdfL of Bacillus subtilis, and related proteins; N-terminal domain. Bmr is a membrane protein which causes the efflux of a variety of toxic substances and antibiotics. BmrR is comprised of two distinct domains that harbor a regulatory (effector-binding) site and an active (DNA-binding) site. The conserved N-terminal domain contains a winged HTH motif that mediates DNA binding, while the C-terminal domain binds coactivating, toxic compounds. BmrR shares the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements.	2.71827e-30
NC_020376.1\|WP_000582243.1\|3434737_3435670_-\|hypothetical-protein	gnl\|CDD\|226304	COG3781, COG3781, Predicted membrane protein [Function unknown].	1.45258e-79
NC_020376.1\|WP_000645266.1\|3421172_3422138_+\|quinone-oxidoreductase	gnl\|CDD\|176189	cd05286, QOR2, Quinone oxidoreductase (QOR). Quinone oxidoreductase (QOR) and 2-haloacrylate reductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. 2-haloacrylate reductase, a member of this subgroup, catalyzes the NADPH-dependent reduction of a carbon-carbon double bond in organohalogen compounds. Although similar to QOR, Burkholderia 2-haloacrylate reductase does not act on the quinones 1,4-benzoquinone and 1,4-naphthoquinone. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	5.16851e-156
NC_020376.1\|WP_000476397.1\|3426941_3428483_-\|alpha-amylase	gnl\|CDD\|236518	PRK09441, PRK09441, cytoplasmic alpha-amylase; Reviewed.	0
NC_020376.1\|WP_001244187.1\|3431430_3432477_-\|agmatine-deiminase-family-protein	gnl\|CDD\|377332	pfam04371, PAD_porph, Porphyromonas-type peptidyl-arginine deiminase. Peptidyl-arginine deiminase (PAD) enzymes catalyze the deimination of the guanidino group from carboxy-terminal arginine residues of various peptides to produce ammonia. PAD from Porphyromonas gingivalis (PPAD) appears to be evolutionarily unrelated to mammalian PAD (pfam03068), which is a metalloenzyme. PPAD is thought to belong to the same superfamily as aminotransferase and arginine deiminase, and to form an alpha/beta propeller structure. This family has previously been named PPADH (Porphyromonas peptidyl-arginine deiminase homologs). The predicted catalytic residues in PPAD are Asp130, Asp187, His236, Asp238 and Cys351. These are absolutely conserved with the exception of Asp187 which is absent in two family members. PPAD is also able to catalyze the deimination of free L-arginine, but has primarily peptidyl-arginine specificity. It may have a FMN cofactor.	6.12076e-126
NC_020376.1\|WP_000709187.1\|3436435_3437593_-\|agmatine-deiminase-family-protein	gnl\|CDD\|377332	pfam04371, PAD_porph, Porphyromonas-type peptidyl-arginine deiminase. Peptidyl-arginine deiminase (PAD) enzymes catalyze the deimination of the guanidino group from carboxy-terminal arginine residues of various peptides to produce ammonia. PAD from Porphyromonas gingivalis (PPAD) appears to be evolutionarily unrelated to mammalian PAD (pfam03068), which is a metalloenzyme. PPAD is thought to belong to the same superfamily as aminotransferase and arginine deiminase, and to form an alpha/beta propeller structure. This family has previously been named PPADH (Porphyromonas peptidyl-arginine deiminase homologs). The predicted catalytic residues in PPAD are Asp130, Asp187, His236, Asp238 and Cys351. These are absolutely conserved with the exception of Asp187 which is absent in two family members. PPAD is also able to catalyze the deimination of free L-arginine, but has primarily peptidyl-arginine specificity. It may have a FMN cofactor.	9.76849e-116
NC_020376.1\|WP_000916570.1\|3435850_3436267_-\|phosphate-starvation-inducible-protein-PsiE	gnl\|CDD\|235075	PRK02833, PRK02833, phosphate-starvation-inducible protein PsiE; Provisional.	3.39618e-45

>NC_020376.1|WP_001095202.1|3423605_3425507_-|mannonate-oxidoreductase
MNTMTFEKLQYNELKDIVKSYCVSGLGKELVNKLEPSTSIKVVRNRLNETTEARAILDAEGHVPFFGISNIASTIQKLEKGMILDPEELVSVSDFLRGCRKIKKFMLDKEFFAPVLASYANSMTEYKSIEEEINFSIKGNSIDVAASKELKRIRNNIDSVDGKIKERLTKFLNSSANKKFIQEFFISKKDDRYTIPIKSSYKNQVAGSIIEASAKGSTVFIEPHTVTKLNAELAGLKAEEAVEEYQILATLSGMVLENIYNIKINMELISQYDMVFAKAKFSKSIDGIEPKLNDHGYIHLVNCKHPLLTGQVVPLHFKIGQEYRSLIITGPNAGGKTIVLKTIGLLTLATMSGLHIAGDKGTEIAIFENVFVDIGDNQSIENALSTFSSHMKNLSEIMRMSNNNTLLLFDEIGSGTEPNEGAALAISILEEFYLAGCITVASTHYGEIKRFSEMHDDFMNAAMQFNSETLEPLYKLVIGKSGESNALWIANKMSVKEHVLKRAKEYMGNKEYALEKVNESKIRKPKFVQEKRESHYEYKIGDRVNLLDHDDFGIIYKEKDNFYNVVVYYNGEFVEVNVKRITLEVAAKELYPEGYDLNTLFVDYKERKMQHDIERGSKKALRKIQKEIRKNRG
>NC_020376.1|WP_000256462.1|3423074_3423599_-|N-acetyltransferase
MVTIRQEQKNDYRKTEEVIKEAFLKEEFSDKTEHELVKRIRECDAFVPELSIVAVDEDIVGHIMLSKITIEQDGTSVESLALAPVSVARGHQKKGIGGNLIVAALEKAKELGYGSVVVLGHPEYYPKFGFKKASEWNIKAPFEVPEEVFMIMELTENSLRGVEGIVQYSSAFAE
>NC_020376.1|WP_001042044.1|3422203_3422914_-|histidine-phosphatase-family-protein
MNKRETDSNENAVTLYVTRHGKTILNTNHRAQGWADSPLVEKGVEVATNLGTGLKDIHFMNAYSSDSGRAIETANLVLKYSEQSKLKLEQRKDLRELNFGIFEGEKLENMWDVVGKAAGVASPEELMKFSIQEVINLIRVADPTKQAEDWELFSTRIKAEIDKISEEAAGNGGGNVLVVVHGLLITTLIEMLDSSKTKLGVENASVTKIVYQDGTYTVESVGDMSYVAKGKESVEI
>NC_020376.1|WP_000645266.1|3421172_3422138_+|quinone-oxidoreductase
MKALCFETFGDANVLHYKEIHDPIISPNEILVRTKAIGLNFADIYRRRGDYHLAGNPPYVLGYEGAGIVEKVGADVTTINLGDRIAFADVPFANAELVAVPSEKVIPLPDSISFETAASVLLQGLTAHYLTHDSYQLKQGDIALVHAAAGGVGQLLIQMIKLQGGTVIGLTSSKEKAKIATLAGADHVFLYNEEWHTKVLEMTNGTGVNLVYESVGSTLEESFNATKIGGTVVFYGMAGGNPAPVDPRMLMDTSKTLTGGDLWNVLTTYEERKKRSTQLFDWIATGKLNISNPTTFSLQDGALAHELLESRKSTGKILLIP
>NC_020376.1|WP_000403896.1|3420155_3421049_-|LysR-family-transcriptional-regulator
MEIKQLITFKVAAHTLNFTQTAKKLNFAQSSVTAQIKTLEAELGTPLFERLGKRLFLTEAGRKFQLYADKMIALSNEAKMAVKDDEEIAGTLIIGAQESQCTYRLPSILKRFKIKFPKIKLIFKPAHSNKDAKEQLMEGKVDLAFILDECKTEDVLHVEPLMKEELKVVAAPTHRLLEQPSVSIKDLESETLLLTELGCSYRTLFEELFRWEDVYPANKIEFVSVEAIKQCVIADLGIAVLPAIVVEKDIREGTIKELHLENTISPIYTQIAWHKDKWMTVPLRQFIDVTREFFVTD
>NC_020376.1|WP_000473732.1|3419342_3419855_-|YjfA-family-protein
MFKKLMKVCVLSAASIGVLFSFQGSTFAATDLSSYYDGKNPATTKVYGGSTTCDADGFNAKSTAVYEGSKKVGTVYLRYSNKCHAAWAKFVLDQPAPAVSGGVYAYAVVNKYKNGVFQKSVTSNQGNGTIKTGQTSTYTGMVFDLTADFGYTADAEAVTFNNGYGKTARY
>NC_020376.1|WP_000771162.1|3418848_3419325_-|DUF2690-domain-containing-protein
MKLLKKTSACLLLSLLVVTSMFSTTNSDKAYAEDHSYDGKSPYYNSCDQSAVTKEKKWIDSNSYVELKFSTTCKTAWAKVTVTRLAVYNNEADARIVRKTDGKAYTCGSAGGNGVVNKGQTSCYTPMVYDLDPRKAQAQGKHAIPNSDAYNYAETIWY
>NC_020376.1|WP_000902416.1|3418246_3418735_+|DinB-family-protein
MLHILKQQYNLISSTRETLFTFLEEIPLEKLHSTVPNFGSGSIIKTHIHVADCYRYWLGSFAFKQKRADFSFASDYEIEHADVAKVRARFKLVDETVQSFLNEYNDRWLENIANEVKWQREPWSTTPLWLLTHTETHEFHHKGQIVSMARHLGYNPPDTDLS
>NC_020376.1|WP_001081125.1|3417598_3418054_-|DinB-family-protein
MNRLVGLKQFEITRGALLKFMETLDDKTVDTQPEGFNNTIRWHIGHVLTAAEVFMFGKEFKQLPTEYPGMFGYGSRPSKWKTEGPSLEVLTAQLKEQAKRINEIPVEAFENKLPEPFLGLETVGELYGMMLYHEADHIGQMKAMERIIKAL
>NC_020376.1|WP_003271092.1|3416368_3417406_-|DUF4003-domain-containing-protein
MEYTYNNREELEIGVNTMITLEQKLEQYKHTYVQLKGELKWKTSDSRTGMMIAAMYAGSDKLFDLGRFLEISSYIKNQVGMFSYLKSYHRFVVAATLDIHFTDYNEAFRTFLDLYEQLVTGGFSRSIFTYLAAAVLLTEENEQHGTHIQRSMQVYKRMKKDHLFLTSTNDYPLAVLLAGQSEHVETLMDRVERLYQKLATAGLRKGNDLQFLSHILSLKKDVREELLVAKCTNIWNLLKQEKVKVKQMHYPAIGLLALLEDGEKEIHSIRAFIEKLQGDKLFRWHTDTNILIAIQLFVSQKGEESKATNTGLQTMIEVLIQAQQAAMMATIAASSAATSSASSSS
>NC_020376.1|WP_000476397.1|3426941_3428483_-|alpha-amylase
MFKRITIVGLSVVLFLPSIYGESKAYADTVNNGTLMQYFEWYAPNDGDHWNRLRTDAENLAQKGITSVWIPPAYKGTTQNDVGYGAYDLYDLGEFNQKGTVRTKYGTKAQLKSAIDALHKKNIDVYGDVVMNHKGGADYTETVTAVEVDPSNRNVEVSGDYEISAWTGFNFPGRGDSYSNFKWKWYHFDGTDWDEGKKLNRIYKFRGIGKAWDWEVSSENGNYDYLMYADLDFDHPDVANEMKKWGTWYAKELNLDGFRLDAVKHIDHEYLRDWVNHVRQQTGKEMFTVAEYWQNDIQTLNNYLAKVNYNQSVFDAPLHYNFHYASTGNGNYDMRNILKGTVVANHPTLAVTLVENHDSQPGQSLESVVSPWFKPLAYAFILTRAEGYPSVFYGDYYGTKGNSNYEIPALKDKIDPILTARKNFAYGTQRDYFDHPDVIGWTREGDSVHANSGLATLISDGPGGSKWMDVGKNNAGEVWYDITGNQTNTVTINKDGWGQFQVSGGSVSIYVQQ
>NC_020376.1|WP_000129189.1|3428686_3429478_+|arylamine-N-acetyltransferase
MTDFQKQFFARLHIEEKDTVSFEDLSNIMYAMAQTVPFENLNILEKNFKEISKENLKEKILVNNRGGLCYELNPTMYYFLKDSGFDVHLFSGTVYNAANSIWAVDSGHMATVLTHHNELYLIEVGFGSYLPLAPVPFSGEVIHSVTGDYRIRKEMTEKGNYILEMRKNNEFLDQSSADDWTLGYAFYIEEVDEEKANTAQKIIVEHEGSPFNKLPLIVKLTEDGHASLTKDSLTVAKNGKKTKETVTDMQFTNLLHSKFGIIL
>NC_020376.1|WP_000137534.1|3429595_3431383_+|oligoendopeptidase-F
MTELKDRLQVADIEKWDLTDIYHTIEDWESDFHKIEVLTKELHEFNGNIHDGNSLLAYLTKSEEISSIISLMFAYARLQSDLDTRDTDAQSLVDKVSQLHVKVSAAKSFFSPFLLSIDESTLHSYIEETEGLQYYKEDLFELYRYKKHVLNKDQEAILSQMGEALSSPQHTFGMLNNADILFGEVTTDDGEKVNLTRGMYAKLIEDTNREKRKEAYKAYYKPYVQLKNSIASTLSAAIKNNVTVSKLRNYPSALEKSLFGDMVPKEVYENLIDTTKKNIQTLHTYNEIRKEKLNVDELRQYDLGVDLVEGAKQDIPYSEAFDIMIASLAPLGEEYIETLKSFKDKRYIDVRETPGKRSGAYNFGVYGVHPFILLNHHDDLNSLFTLTHECGHGMHTHYSHGYQPRISAHYSIFVAEVASTVNEVLLIHYLLKEAKETNVRNHLVNHFIEKFKGTFFTQIMFAEFEKITHEMAEQGKPLNAQVFSEIYEKLFKEYNGDSLVFDEEVKYGWARIPHFYRPFYVYKYATGFASAIQIADKLLSGDPNAQKNYIEFLKGGSSDYPLNLLKKAGVDLTTPEPIESALKQFTQLVEEFSAL
>NC_020376.1|WP_001244187.1|3431430_3432477_-|agmatine-deiminase-family-protein
MRNIENSLFYMPAEWEKHEGTWLQWPHDKAHRGEGYRAKLDDIWISMAKELHYGENVHIVVCDEEEKIHVQSKLMEANVNMDKIDFLIQETDDIWIRDNGPIFVTDKEGNRCLTHWIFNGWGNKYPYEKDANIPNKISEMYRIPKVESSVCLEGGGIEINGNGTLMAAKTSIINENRNPTLSQKEIEMELTKYLGVTNFIWITGIRGEDNYDEDTDYHIDGAARFVNENTILYEYDPFGEGEPYLLEAYEKHYQELRQAKNIDGKPFQLIPVPVTRKVVKEADCKGSYLNFYIGNEVVLVPVYGDEHDKLGLQIIEGQFPGRRIVGIYVNELYAYGGMIHCVTQQHIE
>NC_020376.1|WP_000287981.1|3432664_3433486_-|MerR-family-transcriptional-regulator
MYTIAEFSRICKMSTRMLRHYDKEEILKPAYVNPVNGYRYYEQEQLEVALKIKKLREYKFPLPKIKIVLQSSDQDSFVQHIQSQIIELSHEVKQNLQVISEMNEMVMVNSSLNIARHRSYDILMGMRNEVTLITQRVKIDIDDIDDYFYDLYEEVQKNNFQIVGSPSAVFYDEEYIPSNSDIELRIPVMQGNDEDVAPKYEMKQLSPHHIVTTMHYGSYDYIGYAYIALEEWVEKNGCVIVNSPYEVYIKGPECDCLAEEYVTQICFLVTKIE
>NC_020376.1|WP_000435522.1|3433528_3434506_-|agmatine-deiminase-family-protein
MEQKHNGIIFTAIPDESNEYYQPFYEDLIYFNECLNEKKSIADQLISLSVEEQDFHTSCFEYDDIWLRDVAPVVTNHLVKFKYRPNYLPDDQGRYLDQQFNKWLKKNDFEYVKSPLILDGGNLIWNKKDTVILTERIFDDNDDWTEEEIIEQLEWDLEVSRVIIIPAEEGDVLAHADGMVKFIDEHTMFISDFLGDHEFRYSVQEIIQEQMPEAEFIVVPSSYTEKGQYDQEIASAKGLYINMLESCDALYVPKFGLAKDEEVLRYIQQYTEKQVIQIHVGEISTMGGAMNCLTWYCPSHLLPSKMRRLKNQNEDFSMKKIFDWF
>NC_020376.1|WP_000582243.1|3434737_3435670_-|hypothetical-protein
MIHYNNQNSLHQIFTLKGTIIRDIFPQIVLYTCISTIVAVINYYYTEININQTPWVIVGGALGLLLVFRTNTAYDRYWEGRKLFGTIGACTRNLAISFLCHWDSKGKSMEQEKIKFLHLLIAFPKLAKGHLREEKNLSEVKSLLAVCSEKEKALLVESNHLPISIVFMLKTILSKGLKTGQIHPNAIISMEMDLNTLLTSVGGCDRIKTTPIPFAYFAHIKILLIIFCATLPIGLVDSLGWFTVLATTFISFAFIGIEAIGVEIEDPFGQDPNDLPLEGICIGVEAHLVNLYNQNDLLEVMGLNLDTKII
>NC_020376.1|WP_000916570.1|3435850_3436267_-|phosphate-starvation-inducible-protein-PsiE
MLKNFKIVFSYFPIVLQYILNVALICLGVVLSVFLMKEVIQFIQELKLDGNESSYHLIDSIVVFFLYFEFIVMIIKYFQMNFHFPLRYFIYIGITAIVRLIIIDHDSPLDLLLYACAIFVLISALFIANSKMMRRDLE
>NC_020376.1|WP_000709187.1|3436435_3437593_-|agmatine-deiminase-family-protein
MKKAIKFCLIATLSTTIISGCSFEGNNENVKGKEGEKVEVQKNAGKYTMPDEKDKHEGTWLQWPHEYTYGEEYKQEVEPIWVKMASALTEGEKVHIVAYDQEEKERINNLLTDEGLNMEKIDFFIAPTDDVWARDSGPIFVYDSNKNLKILDPAFNGWGKKTPYKNDAQIRKNVSKQSGIERIDWGKFVLEGGAIELDSNGTALLTRSAVTNKNRNPDLSEKEIEKYISDLGVSNFIWLDGVPNLDITDFHIDGFAKFHNKSTIVTMKEDDLAEWGLSNKDMDTLLDAKNASGQKYKYEYLPLSKEKVALENGKTLDYKGSYINYYIGNTVVLVPNYNDPNDKIANDTIQKLYPDRKVVGIDVRELYKNGGMIHCVTQQQPIALK
>NC_020376.1|WP_000915203.1|3437922_3439050_-|serine-hydrolase
MLKKWLIVFFIFAVFCGSVVTLIHANKGKKYDTKAFSNVNSKQKDVKQEVDANEKKRYEIAAGKLDQYLKDKGFNGSVLVASKDHVILRKGYGYANVKDQVLTTPRTKYRIGSITKTVVAISIMQLKEKGKLNIEDNVNKYIPSFPADKNITLRNLLTHTSGLPEQGQGSVDAASRLKLVTWIGAQTLQFPAGTGWKYTDYNYMVLAYIVEKISNKPLAEYVKENILTPVEMNESGMGATLPEDIFLAEGYTKKDNKLIATPRLKMNWLYGCGEMYTTVEDMKKLDEAIMDGKLLSKQSVSDMFSASPARKYGFSFYIYPDYYHNHGVLAGWNTFNNFNWDKRTFVILFSNVQNGMNDAFNQEFRKMANDLIEGK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_020376_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_020376_3

3674262-3674765

Orphan

Consensus_repeat	Method
CGCTACNGGNGCTACNGG	CRT

12 spacers

The CRISPR arrays of NC_020376_3

>merge|NC_020376|3|3674262-3674765|CRT
CGCTACTGGTGCTACCGGACCTCGAGGTAACACGGGCGCTACTGGCGCTACCGGTGCCACTGGACCTCGAGGTAACACGGGCGCTACCGGTGCTACCGGACCTCGAGGTAACACGGGCGCTACTGGCGCTACCGGACCTCAAGGTAACACGGGCACTACCGGTGCCACTGGACCTCAAGGTAACACGGGTGCTACTGGCGTTACCGGTGCCACTGGACCTCGAGGTAACACGGGCGCTACTGGCGCTACCGGACCTCAAGGTAACACGGGCGCTACTGGCGCTACCGGTGCCACTGGACCTCGAGGTAACACGGGCGCTACTGGCGCTACCGGACCTCAAGGTAACACGGGCGCTACTGGCGCTACCGGTGCCACTGGACCTCGAGGTAACACGGGCGCTACCGGCGCTACTGGACCTCAAGGTAACACGGGCGCTACTGGCGCTACCGGTGCCACTGGACCTCAAGGTGTTCAAGGTAACACAGGTGCTACCGGTGCCACTGG

>NC_020376|3|1|3674262-3674765|CRT
CGCTACTGGTGCTACCGG	ACCTCGAGGTAACACGGG
CGCTACTGGCGCTACCGG	TGCCACTGGACCTCGAGG
TAACACGGGCGCTACCGG	TGCTACCGGACCTCGAGGTAACACGGG
CGCTACTGGCGCTACCGG	ACCTCAAGGTAACACGGG
CACTACCGGTGCCACTGG	ACCTCAAGGTAACACGGGTGCTACTGG
CGTTACCGGTGCCACTGG	ACCTCGAGGTAACACGGG
CGCTACTGGCGCTACCGG	ACCTCAAGGTAACACGGG
CGCTACTGGCGCTACCGG	TGCCACTGGACCTCGAGGTAACACGGG
CGCTACTGGCGCTACCGG	ACCTCAAGGTAACACGGG
CGCTACTGGCGCTACCGG	TGCCACTGGACCTCGAGGTAACACGGG
CGCTACCGGCGCTACTGG	ACCTCAAGGTAACACGGG
CGCTACTGGCGCTACCGG	TGCCACTGGACCTCAAGGTGTTCAAGGTAACACAGG
TGCTACCGGTGCCACTGG

Protein	Signature genes	Signature genes Name	Protein_function
NC_020376.1\|WP_000228315.1\|3685366_3685909_-\|DUF420-domain-containing-protein	unknown	unknown	gnl\|CDD\|225204
NC_020376.1\|WP_087944820.1\|3675977_3677332_-\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NC_020376.1\|WP_000656783.1\|3667374_3667764_-\|transcriptional-repressor-GlnR	unknown	unknown	gnl\|CDD\|133380
NC_020376.1\|WP_000504953.1\|3677670_3678624_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
NC_020376.1\|WP_000814431.1\|3678805_3679051_+\|hypothetical-protein	unknown	unknown	unknown
NC_020376.1\|WP_000181505.1\|3671292_3671430_+\|hypothetical-protein	unknown	unknown	unknown
NC_020376.1\|WP_000312267.1\|3670569_3671193_+\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NC_020376.1\|WP_001102628.1\|3665049_3665373_-\|PadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224609
NC_020376.1\|WP_000031386.1\|3664514_3665057_-\|DUF1700-domain-containing-protein	unknown	unknown	gnl\|CDD\|285278
NC_020376.1\|WP_000391413.1\|3669202_3670477_-\|GTPase-HflX	unknown	unknown	gnl\|CDD\|274455
NC_020376.1\|WP_000813896.1\|3677424_3677649_-\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|179001
NC_020376.1\|WP_000735452.1\|3679113_3680046_-\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|226112
NC_020376.1\|WP_000957288.1\|3683173_3683926_-\|DeoR/GlpR-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268
NC_020376.1\|WP_000704592.1\|3680395_3682252_-\|PTS-fructose-transporter-subunit-IIABC	unknown	unknown	gnl\|CDD\|236740
NC_020376.1\|WP_000450330.1\|3672682_3673648_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271175
NC_020376.1\|WP_000438179.1\|3671461_3672418_-\|stage-V-sporulation-protein-K	unknown	unknown	gnl\|CDD\|163057
NC_020376.1\|WP_001179067.1\|3684085_3685249_-\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341466
NC_020376.1\|WP_000640854.1\|3682265_3683177_-\|1-phosphofructokinase	unknown	unknown	gnl\|CDD\|238570
NC_020376.1\|WP_000092763.1\|3665991_3667326_-\|type-I-glutamate--ammonia-ligase	unknown	unknown	gnl\|CDD\|273198
NC_020376.1\|WP_000460310.1\|3667938_3669210_-\|methionine-gamma-lyase-family-protein	unknown	unknown	gnl\|CDD\|311036

Protein	Function_ID	Function_description	E-value
NC_020376.1\|WP_000228315.1\|3685366_3685909_-\|DUF420-domain-containing-protein	gnl\|CDD\|225204	COG2322, COG2322, Predicted membrane protein [Function unknown].	9.14687e-57
NC_020376.1\|WP_087944820.1\|3675977_3677332_-\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	1.40732e-57
NC_020376.1\|WP_000656783.1\|3667374_3667764_-\|transcriptional-repressor-GlnR	gnl\|CDD\|133380	cd01105, HTH_GlnR-like, Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators. Helix-turn-helix (HTH) transcription regulator GlnR and related proteins, N-terminal domain. The GlnR and TnrA (also known as ScgR) proteins have been shown to regulate expression of glutamine synthetase as well as several genes involved in nitrogen metabolism. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	1.14369e-23
NC_020376.1\|WP_000504953.1\|3677670_3678624_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	1.35751e-163
NC_020376.1\|WP_000312267.1\|3670569_3671193_+\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	1.8015e-60
NC_020376.1\|WP_001102628.1\|3665049_3665373_-\|PadR-family-transcriptional-regulator	gnl\|CDD\|224609	COG1695, COG1695, Predicted transcriptional regulators [Transcription].	1.79312e-24
NC_020376.1\|WP_000031386.1\|3664514_3665057_-\|DUF1700-domain-containing-protein	gnl\|CDD\|285278	pfam08006, DUF1700, Protein of unknown function (DUF1700). This family contains many hypothetical bacterial proteins and putative membrane proteins.	3.85083e-81
NC_020376.1\|WP_000391413.1\|3669202_3670477_-\|GTPase-HflX	gnl\|CDD\|274455	TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). [Unknown function, General].	0
NC_020376.1\|WP_000813896.1\|3677424_3677649_-\|RNA-chaperone-Hfq	gnl\|CDD\|179001	PRK00395, hfq, RNA-binding protein Hfq; Provisional.	3.4363e-41
NC_020376.1\|WP_000735452.1\|3679113_3680046_-\|SH3-domain-containing-protein	gnl\|CDD\|226112	COG3584, COG3584, Uncharacterized protein conserved in bacteria [Function unknown].	4.41594e-37
NC_020376.1\|WP_000957288.1\|3683173_3683926_-\|DeoR/GlpR-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	2.43302e-81
NC_020376.1\|WP_000704592.1\|3680395_3682252_-\|PTS-fructose-transporter-subunit-IIABC	gnl\|CDD\|236740	PRK10712, PRK10712, PTS system fructose-specific transporter subunits IIBC; Provisional.	9.46809e-144
NC_020376.1\|WP_000450330.1\|3672682_3673648_+\|site-specific-integrase	gnl\|CDD\|271175	cd00397, DNA_BRE_C, DNA breaking-rejoining enzymes, C-terminal catalytic domain. The DNA breaking-rejoining enzyme superfamily includes type IB topoisomerases and tyrosine based site-specific recombinases (integrases) that share the same fold in their catalytic domain containing conserved active site residues. The best-studied members of this diverse superfamily include Human topoisomerase I, the bacteriophage lambda integrase, the bacteriophage P1 Cre recombinase, the yeast Flp recombinase, and the bacterial XerD/C recombinases. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. The enzymes differ in that topoisomerases cleave and then rejoin the same 5' and 3' termini, whereas a site-specific recombinase transfers a 5' hydroxyl generated by recombinase cleavage to a new 3' phosphate partner located in a different duplex region. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	1.54948e-12
NC_020376.1\|WP_000438179.1\|3671461_3672418_-\|stage-V-sporulation-protein-K	gnl\|CDD\|163057	TIGR02881, Stage_V_sporulation_protein_K, stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group. [Cellular processes, Sporulation and germination].	1.10483e-156
NC_020376.1\|WP_001179067.1\|3684085_3685249_-\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341466	cd08187, BDH, Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. The butanol dehydrogenase (BDH) is involved in the final step of the butanol formation pathway in anaerobic micro-organism. Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. Activity in the reverse direction is 50-fold lower than that in the forward direction. The NADH-BDH has higher activity with longer chained aldehydes and is inhibited by metabolites containing an adenine moiety. This protein family belongs to the so-called iron-containing alcohol dehydrogenase superfamily. Since members of this superfamily use different divalent ions, preferentially iron or zinc, it has been suggested to be renamed to family III metal-dependent polyol dehydrogenases. This family also includes E. coli YqhD enzyme, an NADP-dependent dehydrogenase whose activity measurements with several alcohols demonstrate preference for alcohols longer than C3. The active site of YqhD contains a Zn metal, and a modified NADPH cofactor bearing OH groups on the saturated C5 and C6 atoms, possibly due to oxygen stress on the enzyme, which would functionally work under anaerobic conditions.	0
NC_020376.1\|WP_000640854.1\|3682265_3683177_-\|1-phosphofructokinase	gnl\|CDD\|238570	cd01164, FruK_PfkB_like, 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases. FruK plays an important role in the predominant pathway for fructose utilisation.This group also contains tagatose-6-phophate kinase, an enzyme of the tagatose 6-phosphate pathway, which responsible for breakdown of the galactose moiety during lactose metabolism by bacteria such as L. lactis.	8.00474e-143
NC_020376.1\|WP_000092763.1\|3665991_3667326_-\|type-I-glutamate--ammonia-ligase	gnl\|CDD\|273198	TIGR00653, Glutamine_synthetase, glutamine synthetase, type I. Alternate name: glutamate--ammonia ligase. This model represents the dodecameric form, which can be subdivided into 1-alpha and 1-beta forms. The phylogeny of the 1-alpha and 1-beta forms appears polyphyletic. E. coli, Synechocystis PCC6803, Aquifex aeolicus, and the crenarcheon Sulfolobus acidocaldarius have form 1-beta, while Bacillus subtilis, Thermotoga maritima, and various euryarchaea has form 1-alpha. The 1-beta dodecamer from the crenarcheon Sulfolobus acidocaldarius differs from that in E. coli in that it is not regulated by adenylylation. [Amino acid biosynthesis, Glutamate family].	0
NC_020376.1\|WP_000460310.1\|3667938_3669210_-\|methionine-gamma-lyase-family-protein	gnl\|CDD\|311036	pfam06838, Met_gamma_lyase, Methionine gamma-lyase. This is a putative pyridoxal 5'-phosphate-dependent methionine gamma-lyase enzyme involved in methionine catabolism.	0

>NC_020376.1|WP_000450330.1|3672682_3673648_+|site-specific-integrase
METTEFHDTIQAFSIFLLNKGRKPSTIKRYVYDVEDFGHWLEKNKKLPSSNIWATLCTKDYEDYFSDLKTNRHYSEKTMHRVFTVLNRMHHFLNIPNPLKNMEISIQPDRTLRNEDFISPDEEKRLKYIVTSLEGLSEKQLPVRPLLMDRNIAILNLLIDYGLSLQELTALTMHHVHFETNTLSIPATAGVERTITLAKEDKKQLYNYYKSIPEPVRPKYHSDDSLFVAFDFNRGTYRWVYENDAPKALTEIAIQKMIRLEVARANLRKGISGQHFRNTYILNLIKKETPESEIIKLAGFKSKISLKRYYQYAENRKNALL
>NC_020376.1|WP_000438179.1|3671461_3672418_-|stage-V-sporulation-protein-K
MEQSMRKKNNNQINIVLNHRKKISLPAAENKTVISNETTIKHEMLQRIEEEMGKLVGMDDIKKIIKEIYAWIYVNKKRQEKGLKSEKQVLHMLFKGNPGTGKTTVARMIGKLLFEMNILSKGHLVEAERADLVGEYIGHTAQKTRDLIKKAMGGILFIDEAYSLARGGEKDFGKEAIDTLVKHMEDKQHGFVLILAGYSREMNHFLSLNPGLQSRFPFIIEFTDYSVNQLLEIGKRMYEDREYQLSKEAEWKFRDHLHAVKYSSQITSFSNGRYVRNIVEKSIRTQAMRLLQEDTYDKNDLIGISSMDLMLEEETHST
>NC_020376.1|WP_000181505.1|3671292_3671430_+|hypothetical-protein
MTNHVNKGAQKSSVNQFGHDPNSAHEKSAKMERFHKAHQEKAKKE
>NC_020376.1|WP_000312267.1|3670569_3671193_+|trimeric-intracellular-cation-channel-family-protein
MAWEIFSIIGTIAFALSGAIVAMEEDYDIFGVYILGMATAFGGGALRNLLIGYPIVAFWQQDMLFQIALLSMTIIFLFPNKLIRHWKKWENITDAIGLSAFAVQGALYAQKLNLPISATIVAAVLTGIGGGIIRDLLARRKPLVLRAEVYAFWTILAGFLIGAQIIVSDWALYILFILIVCFRMVSIHYKWHLPHRRIETKERSMHK
>NC_020376.1|WP_000391413.1|3669202_3670477_-|GTPase-HflX
MEEKEKVILVGCQLPQDDDEKFMHSMKELASLAKTARAEVLVSTTQKRPKFHPATYIGKGKLEELTMLTEELEPDVIIFNNELTPSQIRNLSSVLDARVIDRTQLILDIFAQRAKSREGKLQVELAQLQYTMPRLMGQGLSLSRLGGGIGTRGPGETKLETDRRHIRSRIDEIKKQLAVVVEHRKRYRERRKDNKVFQISLIGYTNAGKSTLFNRLTEANTFEENLLFATLDPTTRKMPLPSGYTVLLTDTVGFIQDLPTSLIAAFRSTLEEAGEADVILHVVDSADPNYIGHEKTVKRLLSELEINHIPIITLYNKKDELHQNFIPFPKSDFLMTSAFEESDVLRIKEAIEMKMKKEMDRYRVEIPPSEGKLLTLLKTETILAKMEFLEDKFVYDCAGYIFTHSSLNVQLKRFLVEEGENKNV
>NC_020376.1|WP_000460310.1|3667938_3669210_-|methionine-gamma-lyase-family-protein
MFDRLKNGEKIAPIVKEVESQITEVHKRADEVIESNQFRVLESFRKHKISDSHFIPTTGYGYDDIGRDTLEKVYADVFGAEAGLVRSQIISGTHAISTALFGILRPGDELLYITGKPYDTLEEIVGVRGKGVGSFKEYNIGYNAVPLTEGGLVDFEAVAAAIHSNTKMIGIQRSKGYATRPSFTISQIKEMIAFVKEIKPDVVVFVDNCYGEFIEEQEPCHVGADLMAGSLIKNPGGGIVKTGGYIVGKEQYVEACAYRLTSPGIGAEAGASLYSLQEMYQGFFLAPHVAGQALKGAIFTAAFLEKLGMNTSPAWNAPRTDLIQSVQFDDKDRMVAFCQAIQYASPINSHFTPYANYMPGYEDDVIMAAGTFIQGASIELSADGPIRPPYVAYVQGGLTYSHVKIAICSAIDELIEKNLLTIS
>NC_020376.1|WP_000656783.1|3667374_3667764_-|transcriptional-repressor-GlnR
MKEDRRSAPLFPIGIVMDLTQLSARQIRYYEEHNLVSPTRTKGNRRLFSFNDVDKLLEIKDLLDQGLNMAGIKQVLLMKENQTEAVKVKEETKEISKTELRKILRDELQHTGRFNRTSLRQGDISRFFH
>NC_020376.1|WP_000092763.1|3665991_3667326_-|type-I-glutamate--ammonia-ligase
MSRYTKEDIFRLAKEENVKYIRLQFTDLLGVIKNVEIPVRQLTKALDNKMMFDGSSIEGFVRIEESDMYLYPDLDTWVIFPWTAEKGKVARLICDIYNADGTPFDGDPRNNLKRVLKEMEALGFSDFNLGPEPEFFLFKVDEKGNPTLELNDNGGYFDLAPMDLGENCRRDIVLELEEMGFEIEASHHEVAPGQHEIDFKYANAIRSCDDIQTFKLVVKTIARKHGLHATFMPKPLYGVNGSGMHCNLSLFKNGENVFFDANGDLQLSDDARHFIAGILKHAPAFTAIANPTVNSYKRLVPGYEAPCYVAWSAQNRSPLVRIPASRGISTRVEVRSVDPAANPYLVMATLLAAGLDGIKNKLTPPAAVDRNIYVMTKEEREEAGIVDLPATLAQALVTLQSNEVVCGALGEHLLEHFIEAKEIEWDIFRTQVHQWERDQYMSLY
>NC_020376.1|WP_001102628.1|3665049_3665373_-|PadR-family-transcriptional-regulator
MNVQFKKGVLELCVLALVKRKDSYGYELVQQISNKFLISEGSVYPLLRRLTKEGYFQTYLKESTEGPPRKYYQLTEQGETQFHLLVTEWRDFAKGVQEIIEGVEWDE
>NC_020376.1|WP_000031386.1|3664514_3665057_-|DUF1700-domain-containing-protein
MSKEGFLKELSSYLRKLPEEERQDILLDYEEHFQFGLEEGKTESEIIQGLGSPKVIAKELLAMYRFDEMKKNPSTSNVTRAVMAAIGLSLFNFIIVLGPLVAIVAFIFSFWIGGIASVVTPFFVIGKVFMGTFIWLDLFVSITFVGVGLLLCIIAFYSTKWFKRLCVRYVIWNFKMIKGE
>NC_020376.1|WP_087944820.1|3675977_3677332_-|IS3-family-transposase
MAKFTADEKIQIVLRYLNGNESYREIGRSLGINDTIILNWVNQYKQNGLEAFLKRCTNYTQQFKLDVLNFMIENGMSLFETAAIFNIPAPSTISVWKKQLETQGIDALQSKKKGRPSMKKDSNKQLKQPLAEGSVEALEARIKQLEMENEYFKKVKCLSSKQGKITKQDKAQVVYELRHKYSVKALVELATIPRSTYYDLVKKMNRPDLDADLKAEIKAIYEENEGRYGYRRIRDELTNRGQKVNHKKVQRIMKELGLKCVVRMKKYKSYKGKVGRIAPNILERNFYTDAPNQKWVTDITEFKLFGEKLYVSPVLDLYNGEIITYTIGSRPTYSLVSDMLEKALERLPETHQLLMHSDQGWHYQMRQYVGTLESRAIVQSMSRKGNCYDNAVIENFFGIMKSEFLYIKEFENVEHFKIELEKYIDYYNTKRIKAKLKMSPVQYRTHFYQAA
>NC_020376.1|WP_000813896.1|3677424_3677649_-|RNA-chaperone-Hfq
MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEGKQQLIYKHAISTFVPQKNVSIELE
>NC_020376.1|WP_000504953.1|3677670_3678624_-|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MGEVQREKVAVIIGPTAVGKTKLSIDLAKALNGEIISGDSMQIYRTMDIGTAKVTQAEMDGIPHYMVDIKNPEDSFSVAEFQERVRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDVIYREQMEKLALERGVEYVHKKLQEVDPESAERIHANNVRRVIRALEIFHTTGEKMSDQIEKQEKELLYDVSLIGLTMDREMLYDRINLRVDLMMEQGLLEEVEGLYNRGIRDCQSIQAIGYKEIYDYFENRAPLEDAVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEKTSEILRYIEGKLQVKSNNSK
>NC_020376.1|WP_000814431.1|3678805_3679051_+|hypothetical-protein
MKQSTINFSSLTKDLILATSTKEQNCSQEELYFALNCLLRAFHSTLHETTSHPENKNTEYIQTQFCSAYKIITGKTIYPFQ
>NC_020376.1|WP_000735452.1|3679113_3680046_-|SH3-domain-containing-protein
MKKLLSIATAAVFGLGIFAGSAKAETIVTTDVLNVRENPNVESKLVGKVLSGNTLDVINTENGWTKIKLNGKEAFVSADFTKSTYYVTAGVLNVRAGANTDSEILGKLNKNDVIETTNQVQNEWLQFDYNGKVGYVHVPFLTGTAPVIEKKEVVAQEEAPVKNNTAVKNKESVKSNDSIKNVESSKPVVKEKPAAKPVAKSTETSAPTGGREITVEATAYTADPSENGSYGGRVLTAMGHDLTANPNMKVIAVDPKVIPLGSKVWVEGYGEAIAGDTGGAIKGNRIDVLVGSDGSANNWGRKSVKVKVIQ
>NC_020376.1|WP_000704592.1|3680395_3682252_-|PTS-fructose-transporter-subunit-IIABC
MKITELLKRDTVIMDLTASNKEAVIDELVEKLHGANRLNSKTEFKEAILKRESQSTTGIGEGIAIPHAKTKAVKQPSICFGRSVSGINYESLDGQPAHLFFMIAASEGANNTHLETLSRLSTLLMDEGFRKQLLEAKDESELLQLFDEKENEKEEEIEFAKPEGNEPYVLAVTACPTGIAHTYMAADSLKAKATELGIAIKVETNGSTGIKNGLTKEDIERATAIIVAADKQVEMNRFAGKHVIQVPVADGIRKTENLLKRAVKQDAPIFKGVKEDGKTESIEREKGLGIYKHLMSGVSNMLPFVVGGGILIALAFSFGGIKAEGPLAELFMSIGGGKTGAFLFLVPILAGFIASSIADRPGFMPGVVGGFLAANANAGFLGGLIAGFLAGYVVLGLKRLFSGLPVQLEGIKPVLLYPVFGLLITGVVMQKVVIPPVVALNEMLTGWLNGLNGTNAILLGLILGGMMAIDMGGPINKAAFTFGIAAIEAQNFGVHSAVMAGGMVPPLAIAFATTFFKSKFTEAERKSGLTNYIMGASFITEGAIPFAAADPVRVIVSCVVGSSIAGALSMLFQITLPAPHGGLFVIALVNKPLLYIFSILIGTIVSAIMLGVWKKKVQ
>NC_020376.1|WP_000640854.1|3682265_3683177_-|1-phosphofructokinase
MIYTVTLNPSIDYVVQVPSFDLGTINRAEKDMKFPGGKGINVSRVLQRLGVKNIALGFTGGFTGQFIKEVLHDEGVTTNFVQVDEDTRINVKIKGKEETELNGQGPIVTKEQFEQLMKKIESMQPGDCVVLAGSVPISIPSTFYESIAAFGAEKGIRVVVDASGSALQHVIKNKPFLIKPNHHELGELFGVELSTVEDVLPYGRKLIEQGVKHVIVSMAGEGALLFTAEGIYEATVPKGVVINSVGAGDSLVAGFVGKYEQTKDIEKAFQYGVATGSATAFSADLCKKEKVEELLSQVIVAKR
>NC_020376.1|WP_000957288.1|3683173_3683926_-|DeoR/GlpR-transcriptional-regulator
MLTPERHQMILQLVKEQKVVKLQQLVERTESSESTIRRDLAQLEKQRLLKRVHGGAAVLTGKGQEPTMVEKSSKNIQIKQQIANYAASVVEQGDCIYLDAGSTTFEMIPFLINKDVTVVTNGLMHIEALVENNIRAYLLGGMMKSRTKALIGAMAQESMQKYRFDKCFLGANGVHEQLGFTTPDPEEALLKQMALTLANEGYFLIDESKFSEVAFAKIANVEDANIITNHLEIDLEKYKKQTNVIEADKQ
>NC_020376.1|WP_001179067.1|3684085_3685249_-|iron-containing-alcohol-dehydrogenase
MQNFVFRNPTKLIFGKDQLEQLKTEIPQFGKKVLLVYGGGSIKRNGIYDNVISILKDINAEVFELTGVEPNPRVSTVKKGIQICKDNGVEFILAVGGGSVIDCTKAIAAGSKYDGDVWDIVTKKAFASEALPFGTVLTLAATGSEMNAGSVITNWETNEKYGWGSPVTFPQFSILDPVHTASVPRDQTIYGMVDIMSHVLEQYFHHGTNTELQDRYCESVLKTVIETAPKLLSDLENYEHRETILYCGTMALNGILAMGVKGDWATHNIEHAVSAVHDIPHGGGLAILFPNWMKHVVEENVSRFKQFAIRVFEIETDGKTDKEVALEGIEALRQFWTSIEAPATLADYGIGENEIDIMANKAMAYGEFGNFKKLNKDDVLSIYKASL
>NC_020376.1|WP_000228315.1|3685366_3685909_-|DUF420-domain-containing-protein
MVDQSTNQKSYAPIVITLSVIVNAIILFLFFGPVGYEGEVHFDVTILPMLNAIFNSFTFVFLLAALFSIIKKNVKMHRGFILAAFTTTLLFCVSYLSYHYLAPATHFGGEGFIKYVYFIILITHIILAAIIVPLALFALVFGFTNQLTRHRKIVRWTMPIWLYVSLSGVIVYLMISPYYQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_020376_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_020376_4

3674847-3675395

Orphan

Consensus_repeat	Method
NGCTACTGGACCTCAAGG	CRT

12 spacers

The CRISPR arrays of NC_020376_4

>merge|NC_020376|4|3674847-3675395|CRT
ACCTACTGGACCTCAGGGACCTCAAGGTAACACAGGTGCTACTGGACCTCAAGGCGCTCAAGGACCTGCTGGTGCTACCGGCGCTACTGGACCTCAAGGCGTTCAAGGTAACACAGGTGCTACTGGTGCTACCGGCGCTACTGGACCTCAAGGCGTTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCAAGGCGTTCAAGGTAACACAGGTGCTACCGGCGCTACTGGACCTCAAGGTGTTCAAGGTAACACAGGTGCTACCGGTGCTACTGGACCTCAGGGCGTTCAAGGTAACACGGGCGCTACTGGCGCTACTGGACCTCAAGGTGTTCAAGGTAACACGGGTGCTACTGGACCTCAGGGTGCTCAAGGTAACACAGGTGCTACCGGTGCCACTGGACCTCAAGGCGTTCAAGGTAACACGGGTGCTACTGGACCTCAAGGTGCTCAAGGTAACACAGGTGCTACTGGTGCTACCGGCGCTACTGGACCTCAAGGCGTTCAAGGTAACACAGGTGCTACCGGCGCTACCGGACCTCAAGG

>NC_020376|4|2|3674847-3675395|CRT
ACCTACTGGACCTCAGGG	ACCTCAAGGTAACACAGG
TGCTACTGGACCTCAAGG	CGCTCAAGGACCTGCTGGTGCTACCGG
CGCTACTGGACCTCAAGG	CGTTCAAGGTAACACAGGTGCTACTGGTGCTACCGG
CGCTACTGGACCTCAAGG	CGTTCAAGGTAACACAGGTGCTACTGG
TGCCACTGGACCTCAAGG	CGTTCAAGGTAACACAGGTGCTACCGG
CGCTACTGGACCTCAAGG	TGTTCAAGGTAACACAGGTGCTACCGG
TGCTACTGGACCTCAGGG	CGTTCAAGGTAACACGGGCGCTACTGG
CGCTACTGGACCTCAAGG	TGTTCAAGGTAACACGGG
TGCTACTGGACCTCAGGG	TGCTCAAGGTAACACAGGTGCTACCGG
TGCCACTGGACCTCAAGG	CGTTCAAGGTAACACGGG
TGCTACTGGACCTCAAGG	TGCTCAAGGTAACACAGGTGCTACTGGTGCTACCGG
CGCTACTGGACCTCAAGG	CGTTCAAGGTAACACAGGTGCTACCGG
CGCTACCGGACCTCAAGG

Protein	Signature genes	Signature genes Name	Protein_function
NC_020376.1\|WP_000228315.1\|3685366_3685909_-\|DUF420-domain-containing-protein	unknown	unknown	gnl\|CDD\|225204
NC_020376.1\|WP_087944820.1\|3675977_3677332_-\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NC_020376.1\|WP_000656783.1\|3667374_3667764_-\|transcriptional-repressor-GlnR	unknown	unknown	gnl\|CDD\|133380
NC_020376.1\|WP_000504953.1\|3677670_3678624_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
NC_020376.1\|WP_000814431.1\|3678805_3679051_+\|hypothetical-protein	unknown	unknown	unknown
NC_020376.1\|WP_000181505.1\|3671292_3671430_+\|hypothetical-protein	unknown	unknown	unknown
NC_020376.1\|WP_000312267.1\|3670569_3671193_+\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NC_020376.1\|WP_001102628.1\|3665049_3665373_-\|PadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224609
NC_020376.1\|WP_000031386.1\|3664514_3665057_-\|DUF1700-domain-containing-protein	unknown	unknown	gnl\|CDD\|285278
NC_020376.1\|WP_000391413.1\|3669202_3670477_-\|GTPase-HflX	unknown	unknown	gnl\|CDD\|274455
NC_020376.1\|WP_000813896.1\|3677424_3677649_-\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|179001
NC_020376.1\|WP_000735452.1\|3679113_3680046_-\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|226112
NC_020376.1\|WP_000957288.1\|3683173_3683926_-\|DeoR/GlpR-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268
NC_020376.1\|WP_000704592.1\|3680395_3682252_-\|PTS-fructose-transporter-subunit-IIABC	unknown	unknown	gnl\|CDD\|236740
NC_020376.1\|WP_000450330.1\|3672682_3673648_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271175
NC_020376.1\|WP_000438179.1\|3671461_3672418_-\|stage-V-sporulation-protein-K	unknown	unknown	gnl\|CDD\|163057
NC_020376.1\|WP_001179067.1\|3684085_3685249_-\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341466
NC_020376.1\|WP_000640854.1\|3682265_3683177_-\|1-phosphofructokinase	unknown	unknown	gnl\|CDD\|238570
NC_020376.1\|WP_000092763.1\|3665991_3667326_-\|type-I-glutamate--ammonia-ligase	unknown	unknown	gnl\|CDD\|273198
NC_020376.1\|WP_000460310.1\|3667938_3669210_-\|methionine-gamma-lyase-family-protein	unknown	unknown	gnl\|CDD\|311036

Protein	Function_ID	Function_description	E-value
NC_020376.1\|WP_000228315.1\|3685366_3685909_-\|DUF420-domain-containing-protein	gnl\|CDD\|225204	COG2322, COG2322, Predicted membrane protein [Function unknown].	9.14687e-57
NC_020376.1\|WP_087944820.1\|3675977_3677332_-\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	1.40732e-57
NC_020376.1\|WP_000656783.1\|3667374_3667764_-\|transcriptional-repressor-GlnR	gnl\|CDD\|133380	cd01105, HTH_GlnR-like, Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators. Helix-turn-helix (HTH) transcription regulator GlnR and related proteins, N-terminal domain. The GlnR and TnrA (also known as ScgR) proteins have been shown to regulate expression of glutamine synthetase as well as several genes involved in nitrogen metabolism. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	1.14369e-23
NC_020376.1\|WP_000504953.1\|3677670_3678624_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	1.35751e-163
NC_020376.1\|WP_000312267.1\|3670569_3671193_+\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	1.8015e-60
NC_020376.1\|WP_001102628.1\|3665049_3665373_-\|PadR-family-transcriptional-regulator	gnl\|CDD\|224609	COG1695, COG1695, Predicted transcriptional regulators [Transcription].	1.79312e-24
NC_020376.1\|WP_000031386.1\|3664514_3665057_-\|DUF1700-domain-containing-protein	gnl\|CDD\|285278	pfam08006, DUF1700, Protein of unknown function (DUF1700). This family contains many hypothetical bacterial proteins and putative membrane proteins.	3.85083e-81
NC_020376.1\|WP_000391413.1\|3669202_3670477_-\|GTPase-HflX	gnl\|CDD\|274455	TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). [Unknown function, General].	0
NC_020376.1\|WP_000813896.1\|3677424_3677649_-\|RNA-chaperone-Hfq	gnl\|CDD\|179001	PRK00395, hfq, RNA-binding protein Hfq; Provisional.	3.4363e-41
NC_020376.1\|WP_000735452.1\|3679113_3680046_-\|SH3-domain-containing-protein	gnl\|CDD\|226112	COG3584, COG3584, Uncharacterized protein conserved in bacteria [Function unknown].	4.41594e-37
NC_020376.1\|WP_000957288.1\|3683173_3683926_-\|DeoR/GlpR-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	2.43302e-81
NC_020376.1\|WP_000704592.1\|3680395_3682252_-\|PTS-fructose-transporter-subunit-IIABC	gnl\|CDD\|236740	PRK10712, PRK10712, PTS system fructose-specific transporter subunits IIBC; Provisional.	9.46809e-144
NC_020376.1\|WP_000450330.1\|3672682_3673648_+\|site-specific-integrase	gnl\|CDD\|271175	cd00397, DNA_BRE_C, DNA breaking-rejoining enzymes, C-terminal catalytic domain. The DNA breaking-rejoining enzyme superfamily includes type IB topoisomerases and tyrosine based site-specific recombinases (integrases) that share the same fold in their catalytic domain containing conserved active site residues. The best-studied members of this diverse superfamily include Human topoisomerase I, the bacteriophage lambda integrase, the bacteriophage P1 Cre recombinase, the yeast Flp recombinase, and the bacterial XerD/C recombinases. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. The enzymes differ in that topoisomerases cleave and then rejoin the same 5' and 3' termini, whereas a site-specific recombinase transfers a 5' hydroxyl generated by recombinase cleavage to a new 3' phosphate partner located in a different duplex region. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	1.54948e-12
NC_020376.1\|WP_000438179.1\|3671461_3672418_-\|stage-V-sporulation-protein-K	gnl\|CDD\|163057	TIGR02881, Stage_V_sporulation_protein_K, stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group. [Cellular processes, Sporulation and germination].	1.10483e-156
NC_020376.1\|WP_001179067.1\|3684085_3685249_-\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341466	cd08187, BDH, Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. The butanol dehydrogenase (BDH) is involved in the final step of the butanol formation pathway in anaerobic micro-organism. Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. Activity in the reverse direction is 50-fold lower than that in the forward direction. The NADH-BDH has higher activity with longer chained aldehydes and is inhibited by metabolites containing an adenine moiety. This protein family belongs to the so-called iron-containing alcohol dehydrogenase superfamily. Since members of this superfamily use different divalent ions, preferentially iron or zinc, it has been suggested to be renamed to family III metal-dependent polyol dehydrogenases. This family also includes E. coli YqhD enzyme, an NADP-dependent dehydrogenase whose activity measurements with several alcohols demonstrate preference for alcohols longer than C3. The active site of YqhD contains a Zn metal, and a modified NADPH cofactor bearing OH groups on the saturated C5 and C6 atoms, possibly due to oxygen stress on the enzyme, which would functionally work under anaerobic conditions.	0
NC_020376.1\|WP_000640854.1\|3682265_3683177_-\|1-phosphofructokinase	gnl\|CDD\|238570	cd01164, FruK_PfkB_like, 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases. FruK plays an important role in the predominant pathway for fructose utilisation.This group also contains tagatose-6-phophate kinase, an enzyme of the tagatose 6-phosphate pathway, which responsible for breakdown of the galactose moiety during lactose metabolism by bacteria such as L. lactis.	8.00474e-143
NC_020376.1\|WP_000092763.1\|3665991_3667326_-\|type-I-glutamate--ammonia-ligase	gnl\|CDD\|273198	TIGR00653, Glutamine_synthetase, glutamine synthetase, type I. Alternate name: glutamate--ammonia ligase. This model represents the dodecameric form, which can be subdivided into 1-alpha and 1-beta forms. The phylogeny of the 1-alpha and 1-beta forms appears polyphyletic. E. coli, Synechocystis PCC6803, Aquifex aeolicus, and the crenarcheon Sulfolobus acidocaldarius have form 1-beta, while Bacillus subtilis, Thermotoga maritima, and various euryarchaea has form 1-alpha. The 1-beta dodecamer from the crenarcheon Sulfolobus acidocaldarius differs from that in E. coli in that it is not regulated by adenylylation. [Amino acid biosynthesis, Glutamate family].	0
NC_020376.1\|WP_000460310.1\|3667938_3669210_-\|methionine-gamma-lyase-family-protein	gnl\|CDD\|311036	pfam06838, Met_gamma_lyase, Methionine gamma-lyase. This is a putative pyridoxal 5'-phosphate-dependent methionine gamma-lyase enzyme involved in methionine catabolism.	0

>NC_020376.1|WP_000450330.1|3672682_3673648_+|site-specific-integrase
METTEFHDTIQAFSIFLLNKGRKPSTIKRYVYDVEDFGHWLEKNKKLPSSNIWATLCTKDYEDYFSDLKTNRHYSEKTMHRVFTVLNRMHHFLNIPNPLKNMEISIQPDRTLRNEDFISPDEEKRLKYIVTSLEGLSEKQLPVRPLLMDRNIAILNLLIDYGLSLQELTALTMHHVHFETNTLSIPATAGVERTITLAKEDKKQLYNYYKSIPEPVRPKYHSDDSLFVAFDFNRGTYRWVYENDAPKALTEIAIQKMIRLEVARANLRKGISGQHFRNTYILNLIKKETPESEIIKLAGFKSKISLKRYYQYAENRKNALL
>NC_020376.1|WP_000438179.1|3671461_3672418_-|stage-V-sporulation-protein-K
MEQSMRKKNNNQINIVLNHRKKISLPAAENKTVISNETTIKHEMLQRIEEEMGKLVGMDDIKKIIKEIYAWIYVNKKRQEKGLKSEKQVLHMLFKGNPGTGKTTVARMIGKLLFEMNILSKGHLVEAERADLVGEYIGHTAQKTRDLIKKAMGGILFIDEAYSLARGGEKDFGKEAIDTLVKHMEDKQHGFVLILAGYSREMNHFLSLNPGLQSRFPFIIEFTDYSVNQLLEIGKRMYEDREYQLSKEAEWKFRDHLHAVKYSSQITSFSNGRYVRNIVEKSIRTQAMRLLQEDTYDKNDLIGISSMDLMLEEETHST
>NC_020376.1|WP_000181505.1|3671292_3671430_+|hypothetical-protein
MTNHVNKGAQKSSVNQFGHDPNSAHEKSAKMERFHKAHQEKAKKE
>NC_020376.1|WP_000312267.1|3670569_3671193_+|trimeric-intracellular-cation-channel-family-protein
MAWEIFSIIGTIAFALSGAIVAMEEDYDIFGVYILGMATAFGGGALRNLLIGYPIVAFWQQDMLFQIALLSMTIIFLFPNKLIRHWKKWENITDAIGLSAFAVQGALYAQKLNLPISATIVAAVLTGIGGGIIRDLLARRKPLVLRAEVYAFWTILAGFLIGAQIIVSDWALYILFILIVCFRMVSIHYKWHLPHRRIETKERSMHK
>NC_020376.1|WP_000391413.1|3669202_3670477_-|GTPase-HflX
MEEKEKVILVGCQLPQDDDEKFMHSMKELASLAKTARAEVLVSTTQKRPKFHPATYIGKGKLEELTMLTEELEPDVIIFNNELTPSQIRNLSSVLDARVIDRTQLILDIFAQRAKSREGKLQVELAQLQYTMPRLMGQGLSLSRLGGGIGTRGPGETKLETDRRHIRSRIDEIKKQLAVVVEHRKRYRERRKDNKVFQISLIGYTNAGKSTLFNRLTEANTFEENLLFATLDPTTRKMPLPSGYTVLLTDTVGFIQDLPTSLIAAFRSTLEEAGEADVILHVVDSADPNYIGHEKTVKRLLSELEINHIPIITLYNKKDELHQNFIPFPKSDFLMTSAFEESDVLRIKEAIEMKMKKEMDRYRVEIPPSEGKLLTLLKTETILAKMEFLEDKFVYDCAGYIFTHSSLNVQLKRFLVEEGENKNV
>NC_020376.1|WP_000460310.1|3667938_3669210_-|methionine-gamma-lyase-family-protein
MFDRLKNGEKIAPIVKEVESQITEVHKRADEVIESNQFRVLESFRKHKISDSHFIPTTGYGYDDIGRDTLEKVYADVFGAEAGLVRSQIISGTHAISTALFGILRPGDELLYITGKPYDTLEEIVGVRGKGVGSFKEYNIGYNAVPLTEGGLVDFEAVAAAIHSNTKMIGIQRSKGYATRPSFTISQIKEMIAFVKEIKPDVVVFVDNCYGEFIEEQEPCHVGADLMAGSLIKNPGGGIVKTGGYIVGKEQYVEACAYRLTSPGIGAEAGASLYSLQEMYQGFFLAPHVAGQALKGAIFTAAFLEKLGMNTSPAWNAPRTDLIQSVQFDDKDRMVAFCQAIQYASPINSHFTPYANYMPGYEDDVIMAAGTFIQGASIELSADGPIRPPYVAYVQGGLTYSHVKIAICSAIDELIEKNLLTIS
>NC_020376.1|WP_000656783.1|3667374_3667764_-|transcriptional-repressor-GlnR
MKEDRRSAPLFPIGIVMDLTQLSARQIRYYEEHNLVSPTRTKGNRRLFSFNDVDKLLEIKDLLDQGLNMAGIKQVLLMKENQTEAVKVKEETKEISKTELRKILRDELQHTGRFNRTSLRQGDISRFFH
>NC_020376.1|WP_000092763.1|3665991_3667326_-|type-I-glutamate--ammonia-ligase
MSRYTKEDIFRLAKEENVKYIRLQFTDLLGVIKNVEIPVRQLTKALDNKMMFDGSSIEGFVRIEESDMYLYPDLDTWVIFPWTAEKGKVARLICDIYNADGTPFDGDPRNNLKRVLKEMEALGFSDFNLGPEPEFFLFKVDEKGNPTLELNDNGGYFDLAPMDLGENCRRDIVLELEEMGFEIEASHHEVAPGQHEIDFKYANAIRSCDDIQTFKLVVKTIARKHGLHATFMPKPLYGVNGSGMHCNLSLFKNGENVFFDANGDLQLSDDARHFIAGILKHAPAFTAIANPTVNSYKRLVPGYEAPCYVAWSAQNRSPLVRIPASRGISTRVEVRSVDPAANPYLVMATLLAAGLDGIKNKLTPPAAVDRNIYVMTKEEREEAGIVDLPATLAQALVTLQSNEVVCGALGEHLLEHFIEAKEIEWDIFRTQVHQWERDQYMSLY
>NC_020376.1|WP_001102628.1|3665049_3665373_-|PadR-family-transcriptional-regulator
MNVQFKKGVLELCVLALVKRKDSYGYELVQQISNKFLISEGSVYPLLRRLTKEGYFQTYLKESTEGPPRKYYQLTEQGETQFHLLVTEWRDFAKGVQEIIEGVEWDE
>NC_020376.1|WP_000031386.1|3664514_3665057_-|DUF1700-domain-containing-protein
MSKEGFLKELSSYLRKLPEEERQDILLDYEEHFQFGLEEGKTESEIIQGLGSPKVIAKELLAMYRFDEMKKNPSTSNVTRAVMAAIGLSLFNFIIVLGPLVAIVAFIFSFWIGGIASVVTPFFVIGKVFMGTFIWLDLFVSITFVGVGLLLCIIAFYSTKWFKRLCVRYVIWNFKMIKGE
>NC_020376.1|WP_087944820.1|3675977_3677332_-|IS3-family-transposase
MAKFTADEKIQIVLRYLNGNESYREIGRSLGINDTIILNWVNQYKQNGLEAFLKRCTNYTQQFKLDVLNFMIENGMSLFETAAIFNIPAPSTISVWKKQLETQGIDALQSKKKGRPSMKKDSNKQLKQPLAEGSVEALEARIKQLEMENEYFKKVKCLSSKQGKITKQDKAQVVYELRHKYSVKALVELATIPRSTYYDLVKKMNRPDLDADLKAEIKAIYEENEGRYGYRRIRDELTNRGQKVNHKKVQRIMKELGLKCVVRMKKYKSYKGKVGRIAPNILERNFYTDAPNQKWVTDITEFKLFGEKLYVSPVLDLYNGEIITYTIGSRPTYSLVSDMLEKALERLPETHQLLMHSDQGWHYQMRQYVGTLESRAIVQSMSRKGNCYDNAVIENFFGIMKSEFLYIKEFENVEHFKIELEKYIDYYNTKRIKAKLKMSPVQYRTHFYQAA
>NC_020376.1|WP_000813896.1|3677424_3677649_-|RNA-chaperone-Hfq
MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEGKQQLIYKHAISTFVPQKNVSIELE
>NC_020376.1|WP_000504953.1|3677670_3678624_-|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MGEVQREKVAVIIGPTAVGKTKLSIDLAKALNGEIISGDSMQIYRTMDIGTAKVTQAEMDGIPHYMVDIKNPEDSFSVAEFQERVRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDVIYREQMEKLALERGVEYVHKKLQEVDPESAERIHANNVRRVIRALEIFHTTGEKMSDQIEKQEKELLYDVSLIGLTMDREMLYDRINLRVDLMMEQGLLEEVEGLYNRGIRDCQSIQAIGYKEIYDYFENRAPLEDAVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEKTSEILRYIEGKLQVKSNNSK
>NC_020376.1|WP_000814431.1|3678805_3679051_+|hypothetical-protein
MKQSTINFSSLTKDLILATSTKEQNCSQEELYFALNCLLRAFHSTLHETTSHPENKNTEYIQTQFCSAYKIITGKTIYPFQ
>NC_020376.1|WP_000735452.1|3679113_3680046_-|SH3-domain-containing-protein
MKKLLSIATAAVFGLGIFAGSAKAETIVTTDVLNVRENPNVESKLVGKVLSGNTLDVINTENGWTKIKLNGKEAFVSADFTKSTYYVTAGVLNVRAGANTDSEILGKLNKNDVIETTNQVQNEWLQFDYNGKVGYVHVPFLTGTAPVIEKKEVVAQEEAPVKNNTAVKNKESVKSNDSIKNVESSKPVVKEKPAAKPVAKSTETSAPTGGREITVEATAYTADPSENGSYGGRVLTAMGHDLTANPNMKVIAVDPKVIPLGSKVWVEGYGEAIAGDTGGAIKGNRIDVLVGSDGSANNWGRKSVKVKVIQ
>NC_020376.1|WP_000704592.1|3680395_3682252_-|PTS-fructose-transporter-subunit-IIABC
MKITELLKRDTVIMDLTASNKEAVIDELVEKLHGANRLNSKTEFKEAILKRESQSTTGIGEGIAIPHAKTKAVKQPSICFGRSVSGINYESLDGQPAHLFFMIAASEGANNTHLETLSRLSTLLMDEGFRKQLLEAKDESELLQLFDEKENEKEEEIEFAKPEGNEPYVLAVTACPTGIAHTYMAADSLKAKATELGIAIKVETNGSTGIKNGLTKEDIERATAIIVAADKQVEMNRFAGKHVIQVPVADGIRKTENLLKRAVKQDAPIFKGVKEDGKTESIEREKGLGIYKHLMSGVSNMLPFVVGGGILIALAFSFGGIKAEGPLAELFMSIGGGKTGAFLFLVPILAGFIASSIADRPGFMPGVVGGFLAANANAGFLGGLIAGFLAGYVVLGLKRLFSGLPVQLEGIKPVLLYPVFGLLITGVVMQKVVIPPVVALNEMLTGWLNGLNGTNAILLGLILGGMMAIDMGGPINKAAFTFGIAAIEAQNFGVHSAVMAGGMVPPLAIAFATTFFKSKFTEAERKSGLTNYIMGASFITEGAIPFAAADPVRVIVSCVVGSSIAGALSMLFQITLPAPHGGLFVIALVNKPLLYIFSILIGTIVSAIMLGVWKKKVQ
>NC_020376.1|WP_000640854.1|3682265_3683177_-|1-phosphofructokinase
MIYTVTLNPSIDYVVQVPSFDLGTINRAEKDMKFPGGKGINVSRVLQRLGVKNIALGFTGGFTGQFIKEVLHDEGVTTNFVQVDEDTRINVKIKGKEETELNGQGPIVTKEQFEQLMKKIESMQPGDCVVLAGSVPISIPSTFYESIAAFGAEKGIRVVVDASGSALQHVIKNKPFLIKPNHHELGELFGVELSTVEDVLPYGRKLIEQGVKHVIVSMAGEGALLFTAEGIYEATVPKGVVINSVGAGDSLVAGFVGKYEQTKDIEKAFQYGVATGSATAFSADLCKKEKVEELLSQVIVAKR
>NC_020376.1|WP_000957288.1|3683173_3683926_-|DeoR/GlpR-transcriptional-regulator
MLTPERHQMILQLVKEQKVVKLQQLVERTESSESTIRRDLAQLEKQRLLKRVHGGAAVLTGKGQEPTMVEKSSKNIQIKQQIANYAASVVEQGDCIYLDAGSTTFEMIPFLINKDVTVVTNGLMHIEALVENNIRAYLLGGMMKSRTKALIGAMAQESMQKYRFDKCFLGANGVHEQLGFTTPDPEEALLKQMALTLANEGYFLIDESKFSEVAFAKIANVEDANIITNHLEIDLEKYKKQTNVIEADKQ
>NC_020376.1|WP_001179067.1|3684085_3685249_-|iron-containing-alcohol-dehydrogenase
MQNFVFRNPTKLIFGKDQLEQLKTEIPQFGKKVLLVYGGGSIKRNGIYDNVISILKDINAEVFELTGVEPNPRVSTVKKGIQICKDNGVEFILAVGGGSVIDCTKAIAAGSKYDGDVWDIVTKKAFASEALPFGTVLTLAATGSEMNAGSVITNWETNEKYGWGSPVTFPQFSILDPVHTASVPRDQTIYGMVDIMSHVLEQYFHHGTNTELQDRYCESVLKTVIETAPKLLSDLENYEHRETILYCGTMALNGILAMGVKGDWATHNIEHAVSAVHDIPHGGGLAILFPNWMKHVVEENVSRFKQFAIRVFEIETDGKTDKEVALEGIEALRQFWTSIEAPATLADYGIGENEIDIMANKAMAYGEFGNFKKLNKDDVLSIYKASL
>NC_020376.1|WP_000228315.1|3685366_3685909_-|DUF420-domain-containing-protein
MVDQSTNQKSYAPIVITLSVIVNAIILFLFFGPVGYEGEVHFDVTILPMLNAIFNSFTFVFLLAALFSIIKKNVKMHRGFILAAFTTTLLFCVSYLSYHYLAPATHFGGEGFIKYVYFIILITHIILAAIIVPLALFALVFGFTNQLTRHRKIVRWTMPIWLYVSLSGVIVYLMISPYYQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_020376_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_020376_5

5271948-5272081

Orphan

Consensus_repeat	Method
GTTGATTTCTCTTCTTTTTGAGA	CRISPRCasFinder

2 spacers

The CRISPR arrays of NC_020376_5

>merge|NC_020376|5|5271948-5272081|CRISPRCasFinder
GTTGATTTTTCTTCTTTCTTCGGTTCTTCTTTTTTGTCACTAGTTGAACCGCTTGTTGATTTCTCTTCTTTTTGAGACTTGTCTTCTGTTTTATTTTCTGGTTTCGTGCTCGTTGACTTCTCTTCTTTTTGAGA

>NC_020376|5|3|5271948-5272081|CRISPRCasFinder
GTTGATTTTTCTTCTTTCTTCGG	TTCTTCTTTTTTGTCACTAGTTGAACCGCTT
GTTGATTTCTCTTCTTTTTGAGA	CTTGTCTTCTGTTTTATTTTCTGGTTTCGTGCTC
GTTGACTTCTCTTCTTTTTGAGA

Protein	Signature genes	Signature genes Name	Protein_function
NC_020376.1\|WP_000392722.1\|5263458_5264139_-\|sugar-transferase	unknown	unknown	gnl\|CDD\|376775
NC_020376.1\|WP_003272396.1\|5278374_5279085_-\|YwmB-family-TATA-box-binding-protein	unknown	unknown	gnl\|CDD\|370056
NC_020376.1\|WP_001185911.1\|5274696_5275704_-\|LytTR-family-transcriptional-regulator-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|224054
NC_020376.1\|WP_000998943.1\|5281090_5282593_-\|NADH-quinone-oxidoreductase-subunit-M	unknown	unknown	gnl\|CDD\|235622
NC_020376.1\|WP_000144445.1\|5272968_5273673_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|372253
NC_020376.1\|WP_000467944.1\|5267850_5268528_-\|CpsD/CapB-family-tyrosine-protein-kinase	unknown	unknown	gnl\|CDD\|349772
NC_020376.1\|WP_000457978.1\|5269736_5270738_-\|rod-shape-determining-protein	unknown	unknown	gnl\|CDD\|237563
NC_020376.1\|WP_000008903.1\|5271479_5271614_-\|hypothetical-protein	unknown	unknown	unknown
NC_020376.1\|WP_000566188.1\|5265280_5266048_-\|tyrosine-protein-phosphatase	unknown	unknown	gnl\|CDD\|226870
NC_020376.1\|WP_000393129.1\|5266846_5267590_-\|capsular-polysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|226453
NC_020376.1\|WP_000672649.1\|5275803_5276823_-\|stage-II-sporulation-protein-D	unknown	unknown	gnl\|CDD\|274332
NC_020376.1\|WP_001207174.1\|5266155_5266857_-\|CpsD/CapB-family-tyrosine-protein-kinase	unknown	unknown	gnl\|CDD\|349772
NC_020376.1\|WP_000757789.1\|5264157_5265039_-\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	unknown	unknown	gnl\|CDD\|224131
NC_020376.1\|WP_000367476.1\|5279568_5281089_-\|NADH-quinone-oxidoreductase-subunit-NuoN	unknown	unknown	gnl\|CDD\|235603
NC_020376.1\|WP_000057889.1\|5279129_5279366_-\|DUF1146-domain-containing-protein	unknown	unknown	gnl\|CDD\|227173
NC_020376.1\|WP_000170868.1\|5273672_5274515_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224054
NC_020376.1\|WP_000411275.1\|5277030_5278335_-\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	unknown	unknown	gnl\|CDD\|236486
NC_020376.1\|WP_000544012.1\|5270898_5271171_-\|sporulation-transcriptional-regulator-SpoIIID	unknown	unknown	gnl\|CDD\|378813
NC_020376.1\|WP_000568236.1\|5282589_5284452_-\|NADH-quinone-oxidoreductase-subunit-L	unknown	unknown	gnl\|CDD\|235836
NC_020376.1\|WP_000931959.1\|5268872_5269307_-\|3-hydroxyacyl-ACP-dehydratase-FabZ	unknown	unknown	gnl\|CDD\|234568

Protein	Function_ID	Function_description	E-value
NC_020376.1\|WP_000392722.1\|5263458_5264139_-\|sugar-transferase	gnl\|CDD\|376775	pfam02397, Bac_transf, Bacterial sugar transferase. This Pfam family represents a conserved region from a number of different bacterial sugar transferases, involved in diverse biosynthesis pathways.	6.75846e-92
NC_020376.1\|WP_003272396.1\|5278374_5279085_-\|YwmB-family-TATA-box-binding-protein	gnl\|CDD\|370056	pfam08680, DUF1779, TATA-box binding. TATA-box_bdg is a family of bacterial proteins. YwmB from Bacillus subtilis contains a circularly permuted TATA-box binding protein-like fold. Jian-Xiang Liu, Qi Xie, Jun Lin. Protein Structural Data Mining and Evolutionary Bioinformatic Analysis on Domains of TATA-box Binding Protein-like Fold. Life Science Journal 2014; 11(2): 298-302 (not yet in PubMed 27-02-2014).	1.11897e-33
NC_020376.1\|WP_001185911.1\|5274696_5275704_-\|LytTR-family-transcriptional-regulator-DNA-binding-domain-containing-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	7.20511e-32
NC_020376.1\|WP_000998943.1\|5281090_5282593_-\|NADH-quinone-oxidoreductase-subunit-M	gnl\|CDD\|235622	PRK05846, PRK05846, NADH:ubiquinone oxidoreductase subunit M; Reviewed.	1.8214e-178
NC_020376.1\|WP_000144445.1\|5272968_5273673_-\|ABC-transporter-permease	gnl\|CDD\|372253	pfam12679, ABC2_membrane_2, ABC-2 family transporter protein. This family is related to the ABC-2 membrane transporter family.	0.00051695
NC_020376.1\|WP_000467944.1\|5267850_5268528_-\|CpsD/CapB-family-tyrosine-protein-kinase	gnl\|CDD\|349772	cd05387, BY-kinase, bacterial tyrosine-kinase. Bacterial tyrosine (BY)-kinases catalyze the autophosphorylation on a C-terminal tyrosine cluster and also phosphorylate endogenous protein substrates by using ATP as phosphoryl donor. Besides their capacity to function as tyrosine kinase, most of these proteins are also involved in the production and transport of exopolysaccharides. BY-kinases are involved in a number of physiological processes ranging from stress resistance to pathogenicity.	1.84961e-82
NC_020376.1\|WP_000457978.1\|5269736_5270738_-\|rod-shape-determining-protein	gnl\|CDD\|237563	PRK13928, PRK13928, rod shape-determining protein Mbl; Provisional.	0
NC_020376.1\|WP_000566188.1\|5265280_5266048_-\|tyrosine-protein-phosphatase	gnl\|CDD\|226870	COG4464, CapC, Capsular polysaccharide biosynthesis protein [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane].	5.65562e-105
NC_020376.1\|WP_000544012.1\|5270898_5271171_-\|sporulation-transcriptional-regulator-SpoIIID	gnl\|CDD\|378813	pfam12116, SpoIIID, Stage III sporulation protein D. This stage III sporulation protein is a small DNA-binding family that is essential for gene expression of the mother-cell compartment during sporulation. The domain is found in bacteria and viruses, and is about 40 amino acids in length. It has a conserved RGG sequence motif.	1.17272e-38
NC_020376.1\|WP_000672649.1\|5275803_5276823_-\|stage-II-sporulation-protein-D	gnl\|CDD\|274332	TIGR02870, Stage_II_sporulation_protein_D, stage II sporulation protein D. Stage II sporulation protein D (SpoIID) is a protein of the endospore formation program in a number of lineages in the Firmicutes (low-GC Gram-positive bacteria). It is expressed in the mother cell compartment, under control of Sigma-E. SpoIID, along with SpoIIM and SpoIIP, is one of three major proteins involved in engulfment of the forespore by the mother cell. [Cellular processes, Sporulation and germination].	6.74744e-135
NC_020376.1\|WP_001207174.1\|5266155_5266857_-\|CpsD/CapB-family-tyrosine-protein-kinase	gnl\|CDD\|349772	cd05387, BY-kinase, bacterial tyrosine-kinase. Bacterial tyrosine (BY)-kinases catalyze the autophosphorylation on a C-terminal tyrosine cluster and also phosphorylate endogenous protein substrates by using ATP as phosphoryl donor. Besides their capacity to function as tyrosine kinase, most of these proteins are also involved in the production and transport of exopolysaccharides. BY-kinases are involved in a number of physiological processes ranging from stress resistance to pathogenicity.	1.10744e-83
NC_020376.1\|WP_000757789.1\|5264157_5265039_-\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	gnl\|CDD\|224131	COG1210, GalU, UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane].	0
NC_020376.1\|WP_000367476.1\|5279568_5281089_-\|NADH-quinone-oxidoreductase-subunit-NuoN	gnl\|CDD\|235603	PRK05777, PRK05777, NADH-quinone oxidoreductase subunit NuoN.	1.4127e-150
NC_020376.1\|WP_000057889.1\|5279129_5279366_-\|DUF1146-domain-containing-protein	gnl\|CDD\|227173	COG4836, COG4836, Predicted membrane protein [Function unknown].	1.23409e-23
NC_020376.1\|WP_000170868.1\|5273672_5274515_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	5.40548e-90
NC_020376.1\|WP_000411275.1\|5277030_5278335_-\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	gnl\|CDD\|236486	PRK09369, PRK09369, UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Validated.	0
NC_020376.1\|WP_000393129.1\|5266846_5267590_-\|capsular-polysaccharide-biosynthesis-protein	gnl\|CDD\|226453	COG3944, COG3944, Capsular polysaccharide biosynthesis protein [Cell envelope biogenesis, outer membrane].	2.45465e-86
NC_020376.1\|WP_000568236.1\|5282589_5284452_-\|NADH-quinone-oxidoreductase-subunit-L	gnl\|CDD\|235836	PRK06590, PRK06590, NADH:ubiquinone oxidoreductase subunit L; Reviewed.	0
NC_020376.1\|WP_000931959.1\|5268872_5269307_-\|3-hydroxyacyl-ACP-dehydratase-FabZ	gnl\|CDD\|234568	PRK00006, fabZ, 3-hydroxyacyl-ACP dehydratase FabZ.	5.26499e-95

>NC_020376.1|WP_000008903.1|5271479_5271614_-|hypothetical-protein
MSFLFVLSTAIILLFVLFTLYYYIAGKKEVPHHQLLEEELEREE
>NC_020376.1|WP_000544012.1|5270898_5271171_-|sporulation-transcriptional-regulator-SpoIIID
MHDYIKERTIKIGKYIVETRKTVRVIAKEFGVSKSTVHKDLTERLPEINPELANEVKEILDYHKSIRHLRGGEATKQKYRKEDVEKPVRQ
>NC_020376.1|WP_000457978.1|5269736_5270738_-|rod-shape-determining-protein
MFARDIGIDLGTANVLIHVKGKGIVLNEPSVVAIDRNSGKVLAVGEEARSMVGRTPGNIVAIRPLKDGVIADFEITEAMLKYFINKLDVKSFFSKPRILICCPTNITSVEQKAIREAAERSGGKTVFLEEEPKVAAVGAGMEIFQPSGNMVVDIGGGTTDIAVLSMGDIVTSSSIKMAGDKFDMEILNYIKRKYKLLIGERTSEDIKIKVGTVFPGARSEELEIRGRDMVTGLPRTITVCSEEITEALKENAAVIVQAAKGVLERTPPELSADIIDRGVILTGGGALLHGIDMLLAEELKVPVLIAENPMHCVAVGTGIMLENIDRLPKRALR
>NC_020376.1|WP_000931959.1|5268872_5269307_-|3-hydroxyacyl-ACP-dehydratase-FabZ
MLNIEQIKEIIPHRYPFLLVDKILEVDEGKRAVGIKNVSANEEFFNGHFPDYAVMPGVLIVEALAQVGAVAVLKKEENRGRLAFFAGIDNCRFKKQVRPGDQLRLEVEMTRVRGPIGKGKAIATVDGEVACEAEITFAIGDKKE
>NC_020376.1|WP_000467944.1|5267850_5268528_-|CpsD/CapB-family-tyrosine-protein-kinase
MFGRKKRKPLRQLITHKEPKSRITEQYRNIRTNIEFTSVDNHVRSIIVTSADPGDGKTTTIANLAVVFGQQGKKVLLIGADLRKPTIQNLFAIHSSNGLTNLLSGQAKLMQCIQKTDIENVYLMAAGPIPPNPAELLGSRAMDEALLEAYNMFDIILIDTPPVLAVTDAQILANKCDGIVLVVRSEKTEKDKIVKAKQILDKASGKILGVVLNDKREEKEQYGYY
>NC_020376.1|WP_000393129.1|5266846_5267590_-|capsular-polysaccharide-biosynthesis-protein
MEETISLKELFHILKKRLAMILVIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGAAIQYNEVQTNIQLTNTYKVIIKSPVILDQVKEKLGLNITAQELNKKIEVANEKDSQVVAVTAQDKDPKLARDIANTTAEVFKGEVAKIMSVDNVTVLSKAELSEELSPIKPRPMLNVAIAFVVGLMASIGLAFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETLNVKSHAPSSRKVRGQTIGS
>NC_020376.1|WP_001207174.1|5266155_5266857_-|CpsD/CapB-family-tyrosine-protein-kinase
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKVLLIDADMRKPAMHQMFQVDNIFGLTNVLTNSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>NC_020376.1|WP_000566188.1|5265280_5266048_-|tyrosine-protein-phosphatase
MIDLHCHILHGIDDGAQTVTDSLAMAQQAVSEGIHTIVATPHHQNGKYINERTSIIHHVKQLNDELQQYNIPLTILPGQEIRLYGDLLEDYEAGKIVTLNETNKYIFIEFPSNHVPRYAEQLLYELRVKGMIPIIVHPERNAELIERPDKLYNLVNKGALTQVTAGSLLGKFGKKIKKFSLQLVEHNLTHMVASDAHNTTSRGFHLAESYELIEKEFGMNVMSDLKENPYLLISGKAIYKEDPEQIRRKKLFGIF
>NC_020376.1|WP_000757789.1|5264157_5265039_-|UTP--glucose-1-phosphate-uridylyltransferase-GalU
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAIESGIEDIIIVTGKGKRAIEDHFDHSFELEQSLLEKGKYEMLEKVQASSKINIHYIRQKEPKGLGHAVWCARKFIGNEPFAVLLGDDIVQAETPCLRQLMDQYEGTQSSVIGVQTVPENETHRYGIIDPVEQNDRRYQVRQFVEKPAQGTAPSNLAIMGRYVLTPEIFMFLENQQTGAGGEIQLTDAIQRLNEIQRVFAYDFEGTRYDVGEKFGFIKTTIEMALQHEELKEDLMKYMNTIVGKENVFI
>NC_020376.1|WP_000392722.1|5263458_5264139_-|sugar-transferase
MEERNLINKSATETIDTVRKQNVLYLLMKRAIDIVGAIIGLIIFSPFFIIIPILYMRGEGKGPVFFRQSRIGQNGETFGIYKFRSMVIDAEKKLKQNEVLYKKYIDNNYKLEPEEDPRITSVGRFLRKTSLDELPQFINVLKGDMSLVGPRPVVQEELLEYGERKSDFLSVKPGITGYWQVSGRSDVGYPERVDLELHYVYNASLFFDIKILFLTVVNVVLRRGAY
>NC_020376.1|WP_000144445.1|5272968_5273673_-|ABC-transporter-permease
MTFSMRRVSAIFRKEVQDFKTNSQVLLMAFLPIILSFLFSRFGVGKEMLGITTITAFLFVAGFVQSMVIAEEKEKHTLRVLMLSPASSVEVLLGKSILTACLTLGICIVNLFILDQFSGNLLLLGFIFLCGTILFIVIGTMIGLLAASVPQTSIIGMPILMTMYLAVQFEPMVENKVIKTMIGYLPTSHIVKALNSLVGGAGFSSISGHVLNVAIWLIIALIACLIVYKKKQMD
>NC_020376.1|WP_000170868.1|5273672_5274515_-|ABC-transporter-ATP-binding-protein
MTLAIEMKDVMKSFSGKTALRNVNIEVKQGEIFGFLGPSGSGKTTTVKILTSQLLHSVGTVRVLGKDITGPSSIDYKRIGILTDNSGLYERLSIYDNLLLFCDLYDCKKKRIDEVLTQVNLLDDKKTPVKKLSKGMKQRVTLARAILHKPDILFLDEPTSALDPVNVQNIHKILKDLNEEGTTIFLTTHNMDEAETLCNRIAFLCGGEIVALDTPENLRLQYAKDQIEVVLKDKQKAVVQKDELGAKRISEWMNKGELLSIHSHEPTLGDIFIEVTGRGL
>NC_020376.1|WP_001185911.1|5274696_5275704_-|LytTR-family-transcriptional-regulator-DNA-binding-domain-containing-protein
MALLELKQLGKANQLPAIELEVEKGKCIVLQCNNHTAKVLHRIIIGEEEASTGNVLFEGEAIGKKNYSRIGFCFLKDEAYDRLKVKEYFKFLLGLYESKISIEEVVQSVGLLDKLNVKIEKLSFSEKRRLHIGRVMIHNPDLVILEEPEQNVDIESTVIIRKAIMKMKEQGKAIFITSSFLSDALSLTEDVYILNNDGVKKVEIEQEEAEKVDEEKVVQIIPQMKLERIPAKVNDKIILLDPMEIHFIETQNGVTHIHVREGDFVCALTLSELEARLTGFGFFRCHRSYLVNLQRVREVITWTRNSFSLILDDERKSSIPLSKGRMDELKGVIGL
>NC_020376.1|WP_000672649.1|5275803_5276823_-|stage-II-sporulation-protein-D
MKFSKPLFITVALLIALVIIVPAALVIPFAKAKVGEETASKTPPAIESIPAPGKVDTAVQVAVYREKQKKVELLPMEEYVTGVVASEMNASFEIEALKAQALAARTFVVQRMLSGGKKNNADVTDTVKDQVYKSKDELKKQWGNNYENNLKKIEEAVSKTAGQVLTYDGKPISASFFSTSNGRTENAADYWGNDYPYLKSVDSPWDQASPKFTSEQTFTVADFQKRLGVKVLADGKVGNIKDLTEGKRVKDVAFQGKTLTGKEVREKLDLRSSDFTWKQQGDKIIVTTKGFGHGVGMSQYGANGMAAEGKKYTDIVAHYYKGVEIKTMNDYEGKLMVKK
>NC_020376.1|WP_000411275.1|5277030_5278335_-|UDP-N-acetylglucosamine-1-carboxyvinyltransferase
MEKIIVRGGKRLNGTVRVEGAKNAVLPIIAAALLASDGKNVLSEVPVLSDVYTINEVLRHLNAEVVFENNQVTIDSSKELNIEAPFEYVRKMRASVQVMGPLLARNGRARIALPGGCAIGSRPIDQHLKGFEAMGAKVQVGNGFVEAYVEGELKGAKIYLDFPSVGATENIMSAATLAKGTTILENAAKEPEIVDLANFLNAMGAKVRGAGTGTIRIEGVDKLYGANHSIIPDRIEAGTFMVAAAITGGDILIENAVPEHLRSITAKMEEMGVKIIEENEGVRVIGPDKLKAVDIKTMPHPGFPTDMQSQMMALLLQADGTSMITETVFENRFMHVEEFRRMNADIKIEGRSVIMNGPNSLQGAEVGATDLRAAAALILAGLVSEGYTRVTELKHLDRGYVDFHKKLAALGATIERVNEKVEEVKEQEVSDLHA
>NC_020376.1|WP_003272396.1|5278374_5279085_-|YwmB-family-TATA-box-binding-protein
MKLKLKAILIVALSVVLFLVGYREMKPISDEQKMESMIKALEKNDAKVEKWSWLARETKTISNIHTFQKLLNDVKDKANIQKWEVEQSPDGYKATSYKKFASHEERVVVTWSKENTKENTFIIFEVSGAKWDPKYVQKVNKIFSEKPIIYTCVQGVLNDKIEGVLQNKTNQVLKDLSARAIEQVEERAFVSVSAYNKKWDDALSTNREKINVQIAIRSTDNKDTIVVGTPIITSEY
>NC_020376.1|WP_000057889.1|5279129_5279366_-|DUF1146-domain-containing-protein
MAQLLGQQALIAIVSHLLFITITWWALQGIHIERLMKSGKVLQTRVLLILITIAIGTSVSNFFLDYLGYSKSLTYLVK
>NC_020376.1|WP_000367476.1|5279568_5281089_-|NADH-quinone-oxidoreductase-subunit-NuoN
MDMNTLLSLSWHLMVPEFIILGAAILLSICDLFFKLNHRYVALGAIAAIVLAIVSLITLYSEPAGDILNGSFVLDGFSKGFKTLLLGASALILCIAMSDDKKNPIEDKGEYYYLFLMALLGAMFMASSVDFITLFVGLELLSLSSYILVGIRKKNRASNEAAMKYVISGGIGTAITLFGMSYLYGITGSTNIVDMQKVLTGELASGIQLLLALAFLLLLVGLSFKIATVPFHMWAPDVYEGATTPVTAFLGTISKIAGFLLIIRLFLMVFASVLIQGDMKSLYGHMSIYIAVLASITMIVGNVVALKQYNVKRLFAYSGIAHAGYLLVPLVALSPFTLDSMWFYMLAYMLMNIGAFAIIHGLILQNDKENITIFTGLYKKSPFAAIMMTIFILSLAGIPGTAGFIGKINIFLGALHVEPAHYVLASIMMGTTVVSFVYYFRILQQMFFRTGETEERIRLPLNIKVVMSLCAISIVILGIMPMIGYNFFYEYFPLMKDFFFLGNVVQ
>NC_020376.1|WP_000998943.1|5281090_5282593_-|NADH-quinone-oxidoreductase-subunit-M
MNDLLLTFFIFSPLLGILLLVLTPKKELRTVRALGLFGTALPFGIAIVLACTYASGKSLSLFDEKVKWIKFGDFTAVDKRWFSIYYELGIDGLSLVMMVLTALLAMLAAIAAFSIKRNLKAFYMLLLMLEIGMLGVFAAQNLMLFFIFFEITLPPMFLLIGKWGKLSSEKAAYSYLIYNGIGSAVLLIVFSILFAKTGTTNIVELKEILRSVSAEGELIIPSSLQLGVFISIMIAFAIKLPVFPLHRWMVNVHIEAHPAVVMLHAGVLLKIGAYGIIRFGKGLFPEYFHDVATLIAILGVINLLYGAFLALIQTDFRKVLAYSSISHMGIVLMGLASLNAPGTQGALFQVVSHGLIAALLFFLLGVIEQRFGTSEITALGGLAKSVPVLSGFFLAGGMASLGLPGMSGFVSEFLAFLGLFQGEPVIAAVGVIGIILTAVYVLRATLQVTFGKKEWEAKSDIHGWEYVPVLLLIFCIIVIGVMPEILGDPLQNTLKTLGVK
>NC_020376.1|WP_000568236.1|5282589_5284452_-|NADH-quinone-oxidoreductase-subunit-L
MIDYAWLIPLFPLVSFLLLIIFGKKIREGSSVLSIFFVFLSFILAVLVLIERFSEASVKHKWVWLRAGDVDISFGFEVTALGALMLFIVTLVSLLVHVYSKGYMKGDERLPTFYAYLGLFTFAMLGLVISTNLLQLYIFWELVGLGSFLLIGFYFFKEEAKAAAKKAFIMTRIGDVGLFIGMILIFWYAGSFEYDAIFRAIYTGDLPPYMITITAILIFIGAMGKSGQFPLHTWLPDAMEGPTPVSALIHAATMVAAGVYLVATMFPLFSASTVAMQTVAIVGAFTAIFAASIGLVQTDIKRVLAYSTVSQLGYMMLALGSAGYVAGVFHLTTHAFFKALLFLAAGSVIHAVHTQNINKMGGLQKKMKVTGTLFLIGTLAISGVPLLSGFFSKDEILAATWMNGNYVLFTLAVIAAFLTAFYMFRLYFLVFTGETKTKEDVHESPRVMTYPMIVLGVLAVVAGYINTPWFGTFLGDWLTKDVGFKVEEAHGPVWIMIVATLVSFAGIALAYFIYGKKSISRDWAGGTETSLYNLLKEKYYVDELYNMTVIPITKGIAHVLRLFEVYVVEGIAVLIGSVVKGTSNLGSKLQNGNVQVYGTVTAVSLAVLVIILLYTGGDLR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_020376_3	3.2\|3674316\|18\|NC_020376\|CRT	3674316-3674333	18	NC_020376.1	3674757-3674774	1	0.944
NC_020376_3	3.12\|3674712\|36\|NC_020376\|CRT	3674712-3674747	36	NC_020376.1	3674757-3674792	2	0.944
NC_020376_4	4.8\|3675180\|18\|NC_020376\|CRT	3675180-3675197	18	NC_020376.1	3674775-3674792	1	0.944

1. spacer 3.2|3674316|18|NC_020376|CRT matches to position: 3674757-3674774, mismatch: 1, identity: 0.944

tgccactggacctcgagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
**************.***

2. spacer 3.12|3674712|36|NC_020376|CRT matches to position: 3674757-3674792, mismatch: 2, identity: 0.944

tgccactggacctcaaggtgttcaaggtaacacagg	CRISPR spacer
tgccactggacctcaaggtgctcaaggtaacacggg	Protospacer
********************.************.**

3. spacer 4.8|3675180|18|NC_020376|CRT matches to position: 3674775-3674792, mismatch: 1, identity: 0.944

tgttcaaggtaacacggg	CRISPR spacer
tgctcaaggtaacacggg	Protospacer
**.***************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_020376_4	4.9\|3675216\|27\|NC_020376\|CRT	3675216-3675242	27	JQ691611	Cronobacter phage CR9, complete genome	9702-9728	2	0.926
NC_020376_3	3.5\|3674433\|27\|NC_020376\|CRT	3674433-3674459	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81955-81981	3	0.889
NC_020376_3	3.5\|3674433\|27\|NC_020376\|CRT	3674433-3674459	27	MN101228	Klebsiella phage KPN4, complete genome	27720-27746	3	0.889
NC_020376_4	4.6\|3675090\|27\|NC_020376\|CRT	3675090-3675116	27	JQ691611	Cronobacter phage CR9, complete genome	9702-9728	3	0.889
NC_020376_4	4.2\|3674901\|27\|NC_020376\|CRT	3674901-3674927	27	MH593831	Podoviridae sp. isolate ctdb7, complete genome	1630-1656	4	0.852
NC_020376_4	4.2\|3674901\|27\|NC_020376\|CRT	3674901-3674927	27	NZ_CP049906	Diaphorobacter sp. HDW4B plasmid unnamed1, complete sequence	380839-380865	4	0.852
NC_020376_4	4.2\|3674901\|27\|NC_020376\|CRT	3674901-3674927	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	963441-963467	4	0.852
NC_020376_4	4.4\|3675000\|27\|NC_020376\|CRT	3675000-3675026	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81955-81981	4	0.852
NC_020376_4	4.5\|3675045\|27\|NC_020376\|CRT	3675045-3675071	27	JQ691611	Cronobacter phage CR9, complete genome	9702-9728	4	0.852
NC_020376_4	4.9\|3675216\|27\|NC_020376\|CRT	3675216-3675242	27	MN163280	Klebsiella phage KpGranit, complete genome	83373-83399	4	0.852
NC_020376_4	4.9\|3675216\|27\|NC_020376\|CRT	3675216-3675242	27	MN163280	Klebsiella phage KpGranit, complete genome	84576-84602	4	0.852
NC_020376_4	4.12\|3675351\|27\|NC_020376\|CRT	3675351-3675377	27	JQ691611	Cronobacter phage CR9, complete genome	9702-9728	4	0.852
NC_020376_4	4.2\|3674901\|27\|NC_020376\|CRT	3674901-3674927	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	18186-18212	5	0.815
NC_020376_4	4.2\|3674901\|27\|NC_020376\|CRT	3674901-3674927	27	AP013564	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, * SEQUENCING IN PROGRESS *, 4 ordered pieces	8316-8342	5	0.815
NC_020376_4	4.2\|3674901\|27\|NC_020376\|CRT	3674901-3674927	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	8146-8172	5	0.815
NC_020376_4	4.2\|3674901\|27\|NC_020376\|CRT	3674901-3674927	27	AP013943	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, * SEQUENCING IN PROGRESS *	8990-9016	5	0.815
NC_020376_4	4.2\|3674901\|27\|NC_020376\|CRT	3674901-3674927	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	15786-15812	5	0.815
NC_020376_4	4.2\|3674901\|27\|NC_020376\|CRT	3674901-3674927	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	3615-3641	5	0.815
NC_020376_4	4.2\|3674901\|27\|NC_020376\|CRT	3674901-3674927	27	NZ_LR594690	Variovorax sp. WDL1 plasmid 2	541609-541635	5	0.815
NC_020376_4	4.2\|3674901\|27\|NC_020376\|CRT	3674901-3674927	27	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	650048-650074	5	0.815
NC_020376_4	4.2\|3674901\|27\|NC_020376\|CRT	3674901-3674927	27	NZ_CP023738	Methylosinus trichosporium OB3b plasmid pOB3b1, complete sequence	122815-122841	5	0.815
NC_020376_4	4.2\|3674901\|27\|NC_020376\|CRT	3674901-3674927	27	NZ_CP023740	Methylosinus trichosporium OB3b plasmid pOB3b3, complete sequence	57293-57319	5	0.815
NC_020376_4	4.2\|3674901\|27\|NC_020376\|CRT	3674901-3674927	27	NC_019718	Enterobacteria phage vB_EcoS_Rogue1, complete genome	9971-9997	5	0.815
NC_020376_4	4.4\|3675000\|27\|NC_020376\|CRT	3675000-3675026	27	MN163280	Klebsiella phage KpGranit, complete genome	83373-83399	5	0.815
NC_020376_4	4.4\|3675000\|27\|NC_020376\|CRT	3675000-3675026	27	MN163280	Klebsiella phage KpGranit, complete genome	84576-84602	5	0.815
NC_020376_4	4.4\|3675000\|27\|NC_020376\|CRT	3675000-3675026	27	JQ691611	Cronobacter phage CR9, complete genome	9702-9728	5	0.815
NC_020376_4	4.4\|3675000\|27\|NC_020376\|CRT	3675000-3675026	27	MN101228	Klebsiella phage KPN4, complete genome	27720-27746	5	0.815
NC_020376_4	4.6\|3675090\|27\|NC_020376\|CRT	3675090-3675116	27	MN163280	Klebsiella phage KpGranit, complete genome	83373-83399	5	0.815
NC_020376_4	4.6\|3675090\|27\|NC_020376\|CRT	3675090-3675116	27	MN163280	Klebsiella phage KpGranit, complete genome	84576-84602	5	0.815
NC_020376_4	4.4\|3675000\|27\|NC_020376\|CRT	3675000-3675026	27	MN163280	Klebsiella phage KpGranit, complete genome	81270-81296	6	0.778
NC_020376_4	4.4\|3675000\|27\|NC_020376\|CRT	3675000-3675026	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	85222-85248	6	0.778
NC_020376_4	4.4\|3675000\|27\|NC_020376\|CRT	3675000-3675026	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3951-3977	6	0.778
NC_020376_4	4.4\|3675000\|27\|NC_020376\|CRT	3675000-3675026	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29528-29554	6	0.778
NC_020376_4	4.4\|3675000\|27\|NC_020376\|CRT	3675000-3675026	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	76467-76493	6	0.778
NC_020376_4	4.4\|3675000\|27\|NC_020376\|CRT	3675000-3675026	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78603-78629	6	0.778
NC_020376_4	4.4\|3675000\|27\|NC_020376\|CRT	3675000-3675026	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79815-79841	6	0.778
NC_020376_4	4.4\|3675000\|27\|NC_020376\|CRT	3675000-3675026	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	80972-80998	6	0.778
NC_020376_4	4.4\|3675000\|27\|NC_020376\|CRT	3675000-3675026	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83108-83134	6	0.778
NC_020376_4	4.4\|3675000\|27\|NC_020376\|CRT	3675000-3675026	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84320-84346	6	0.778
NC_020376_4	4.5\|3675045\|27\|NC_020376\|CRT	3675045-3675071	27	MN163280	Klebsiella phage KpGranit, complete genome	83373-83399	6	0.778
NC_020376_4	4.5\|3675045\|27\|NC_020376\|CRT	3675045-3675071	27	MN163280	Klebsiella phage KpGranit, complete genome	84576-84602	6	0.778
NC_020376_4	4.12\|3675351\|27\|NC_020376\|CRT	3675351-3675377	27	MN163280	Klebsiella phage KpGranit, complete genome	83373-83399	6	0.778
NC_020376_4	4.12\|3675351\|27\|NC_020376\|CRT	3675351-3675377	27	MN163280	Klebsiella phage KpGranit, complete genome	84576-84602	6	0.778
NC_020376_4	4.11\|3675297\|36\|NC_020376\|CRT	3675297-3675332	36	MN163280	Klebsiella phage KpGranit, complete genome	83364-83399	7	0.806
NC_020376_4	4.11\|3675297\|36\|NC_020376\|CRT	3675297-3675332	36	MN163280	Klebsiella phage KpGranit, complete genome	84567-84602	7	0.806
NC_020376_4	4.11\|3675297\|36\|NC_020376\|CRT	3675297-3675332	36	MN101228	Klebsiella phage KPN4, complete genome	27720-27755	8	0.778
NC_020376_5	5.1\|5271971\|31\|NC_020376\|CRISPRCasFinder	5271971-5272001	31	JX238501	Bacillus phage phiAGATE, complete genome	124559-124589	8	0.742
NC_020376_5	5.2\|5272025\|34\|NC_020376\|CRISPRCasFinder	5272025-5272058	34	NZ_CP014851	Bacillus thuringiensis strain HD12 plasmid pHD120112, complete sequence	100650-100683	8	0.765
NC_020376_5	5.2\|5272025\|34\|NC_020376\|CRISPRCasFinder	5272025-5272058	34	MN812210	Flavobacterium phage vB_FspS_hemulen9-1, complete genome	22854-22887	8	0.765
NC_020376_5	5.2\|5272025\|34\|NC_020376\|CRISPRCasFinder	5272025-5272058	34	MN812215	Flavobacterium phage vB_FspS_lillamy9-4, complete genome	22191-22224	8	0.765
NC_020376_5	5.2\|5272025\|34\|NC_020376\|CRISPRCasFinder	5272025-5272058	34	MN812216	Flavobacterium phage vB_FspS_lillamy9-5, complete genome	22191-22224	8	0.765
NC_020376_5	5.2\|5272025\|34\|NC_020376\|CRISPRCasFinder	5272025-5272058	34	NC_048835	Flavobacterium phage vB_FspS_lillamy9-1, complete genome	22191-22224	8	0.765
NC_020376_5	5.2\|5272025\|34\|NC_020376\|CRISPRCasFinder	5272025-5272058	34	MN812213	Flavobacterium phage vB_FspS_lillamy9-2, complete genome	22191-22224	8	0.765
NC_020376_5	5.2\|5272025\|34\|NC_020376\|CRISPRCasFinder	5272025-5272058	34	MN812230	Flavobacterium phage vB_FspS_sniff9-2, complete genome	21831-21864	8	0.765
NC_020376_5	5.2\|5272025\|34\|NC_020376\|CRISPRCasFinder	5272025-5272058	34	MN812209	Flavobacterium phage vB_FspS_hemulen6-2, complete genome	22983-23016	8	0.765
NC_020376_5	5.2\|5272025\|34\|NC_020376\|CRISPRCasFinder	5272025-5272058	34	MN812218	Flavobacterium phage vB_FspS_lillamy9-7, complete genome	21454-21487	8	0.765
NC_020376_5	5.2\|5272025\|34\|NC_020376\|CRISPRCasFinder	5272025-5272058	34	MN812233	Flavobacterium phage vB_FspS_snork9-1, complete genome	22007-22040	8	0.765
NC_020376_5	5.2\|5272025\|34\|NC_020376\|CRISPRCasFinder	5272025-5272058	34	MN812219	Flavobacterium phage vB_FspS_morran9-1, complete genome	22308-22341	8	0.765
NC_020376_5	5.2\|5272025\|34\|NC_020376\|CRISPRCasFinder	5272025-5272058	34	MN812217	Flavobacterium phage vB_FspS_lillamy9-6, complete genome	21930-21963	8	0.765
NC_020376_5	5.2\|5272025\|34\|NC_020376\|CRISPRCasFinder	5272025-5272058	34	NC_048840	Flavobacterium phage vB_FspS_snork6-1, complete genome	22137-22170	8	0.765
NC_020376_5	5.2\|5272025\|34\|NC_020376\|CRISPRCasFinder	5272025-5272058	34	NC_048839	Flavobacterium phage vB_FspS_sniff9-1, complete genome	22057-22090	8	0.765
NC_020376_5	5.2\|5272025\|34\|NC_020376\|CRISPRCasFinder	5272025-5272058	34	NC_048842	Flavobacterium phage vB_FspS_stinky9-1, complete genome	21673-21706	8	0.765
NC_020376_5	5.2\|5272025\|34\|NC_020376\|CRISPRCasFinder	5272025-5272058	34	MN812232	Flavobacterium phage vB_FspS_snork6-2, complete genome	21655-21688	8	0.765
NC_020376_5	5.2\|5272025\|34\|NC_020376\|CRISPRCasFinder	5272025-5272058	34	MN812208	Flavobacterium phage vB_FspS_hemulen6-1, complete genome	22983-23016	8	0.765
NC_020376_4	4.3\|3674946\|36\|NC_020376\|CRT	3674946-3674981	36	MN163280	Klebsiella phage KpGranit, complete genome	83364-83399	9	0.75
NC_020376_4	4.3\|3674946\|36\|NC_020376\|CRT	3674946-3674981	36	MN163280	Klebsiella phage KpGranit, complete genome	84567-84602	9	0.75
NC_020376_4	4.11\|3675297\|36\|NC_020376\|CRT	3675297-3675332	36	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81946-81981	9	0.75
NC_020376_5	5.2\|5272025\|34\|NC_020376\|CRISPRCasFinder	5272025-5272058	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	47181-47214	11	0.676
NC_020376_5	5.2\|5272025\|34\|NC_020376\|CRISPRCasFinder	5272025-5272058	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	47565-47598	11	0.676
NC_020376_5	5.2\|5272025\|34\|NC_020376\|CRISPRCasFinder	5272025-5272058	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	47949-47982	11	0.676
NC_020376_5	5.2\|5272025\|34\|NC_020376\|CRISPRCasFinder	5272025-5272058	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	48333-48366	11	0.676
NC_020376_5	5.2\|5272025\|34\|NC_020376\|CRISPRCasFinder	5272025-5272058	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	48717-48750	11	0.676
NC_020376_5	5.2\|5272025\|34\|NC_020376\|CRISPRCasFinder	5272025-5272058	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	49101-49134	11	0.676
NC_020376_5	5.2\|5272025\|34\|NC_020376\|CRISPRCasFinder	5272025-5272058	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	49485-49518	11	0.676

1. spacer 4.9|3675216|27|NC_020376|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctaccgg	CRISPR spacer
tcctcaaggtaacacaggtcctaccgg	Protospacer
* ***************** *******

2. spacer 3.5|3674433|27|NC_020376|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 3, identity: 0.889

acctcaaggtaacacgggtgctactgg	CRISPR spacer
ccctcagggtaacactggtgctactgg	Protospacer
 *****.******** ***********

3. spacer 3.5|3674433|27|NC_020376|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 3, identity: 0.889

acctcaaggtaacacgggtgctactgg	CRISPR spacer
tcctcagggtaacactggtgctactgg	Protospacer
 *****.******** ***********

4. spacer 4.6|3675090|27|NC_020376|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 3, identity: 0.889

tgttcaaggtaacacaggtgctaccgg	CRISPR spacer
tcctcaaggtaacacaggtcctaccgg	Protospacer
* .**************** *******

5. spacer 4.2|3674901|27|NC_020376|CRT matches to MH593831 (Podoviridae sp. isolate ctdb7, complete genome) position: , mismatch: 4, identity: 0.852

cgctcaaggacctgctggtgctaccgg	CRISPR spacer
cgctcaaggagctgctggtgctgacgt	Protospacer
********** ***********. **

6. spacer 4.2|3674901|27|NC_020376|CRT matches to NZ_CP049906 (Diaphorobacter sp. HDW4B plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.852

cgctcaaggacctgctggtgctaccgg	CRISPR spacer
cgctcaaggacctgcaggtgcgccagg	Protospacer
*************** *****  * **

7. spacer 4.2|3674901|27|NC_020376|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 4, identity: 0.852

cgctcaaggacctgctggtgctaccgg	CRISPR spacer
cgctcaaggacctgccggtgcagctgg	Protospacer
***************.***** .*.**

8. spacer 4.4|3675000|27|NC_020376|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
ccctcagggtaacactggtgctactgg	Protospacer
* .***.******** ***********

9. spacer 4.5|3675045|27|NC_020376|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 4, identity: 0.852

cgttcaaggtaacacaggtgctaccgg	CRISPR spacer
tcctcaaggtaacacaggtcctaccgg	Protospacer
. .**************** *******

10. spacer 4.9|3675216|27|NC_020376|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctaccgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
* * **.*****************.**

11. spacer 4.9|3675216|27|NC_020376|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctaccgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
* * **.*****************.**

12. spacer 4.12|3675351|27|NC_020376|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 4, identity: 0.852

cgttcaaggtaacacaggtgctaccgg	CRISPR spacer
tcctcaaggtaacacaggtcctaccgg	Protospacer
. .**************** *******

13. spacer 4.2|3674901|27|NC_020376|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 5, identity: 0.815

cgctcaaggacctgctggtgctaccgg	CRISPR spacer
tcctcaaggacctgctggtgctgatgg	Protospacer
. ********************. .**

14. spacer 4.2|3674901|27|NC_020376|CRT matches to AP013564 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 5, identity: 0.815

cgctcaaggacctgctggtgctaccgg	CRISPR spacer
tcctcaaggacctgctggtgctgatgg	Protospacer
. ********************. .**

15. spacer 4.2|3674901|27|NC_020376|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

cgctcaaggacctgctggtgctaccgg	CRISPR spacer
tcctcaaggacctgctggtgctgatgg	Protospacer
. ********************. .**

16. spacer 4.2|3674901|27|NC_020376|CRT matches to AP013943 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

cgctcaaggacctgctggtgctaccgg	CRISPR spacer
tcctcaaggacctgctggtgctgatgg	Protospacer
. ********************. .**

17. spacer 4.2|3674901|27|NC_020376|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

cgctcaaggacctgctggtgctaccgg	CRISPR spacer
tcctcaaggacctgctggtgctgatgg	Protospacer
. ********************. .**

18. spacer 4.2|3674901|27|NC_020376|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

cgctcaaggacctgctggtgctaccgg	CRISPR spacer
tcctcaaggacctgctggtgctgatgg	Protospacer
. ********************. .**

19. spacer 4.2|3674901|27|NC_020376|CRT matches to NZ_LR594690 (Variovorax sp. WDL1 plasmid 2) position: , mismatch: 5, identity: 0.815

cgctcaaggacctgctggtgctaccgg	CRISPR spacer
cactcaaggacctgctggtgcaggccg	Protospacer
*.******************* . * *

20. spacer 4.2|3674901|27|NC_020376|CRT matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.815

cgctcaaggacctgctggtgctaccgg	CRISPR spacer
agctcaaggaccagctggtgctgctga	Protospacer
 *********** *********.*.*.

21. spacer 4.2|3674901|27|NC_020376|CRT matches to NZ_CP023738 (Methylosinus trichosporium OB3b plasmid pOB3b1, complete sequence) position: , mismatch: 5, identity: 0.815

cgctcaaggacctgctggtgctaccgg	CRISPR spacer
cgctcaaggacctgctggtcattctcg	Protospacer
*******************  * *. *

22. spacer 4.2|3674901|27|NC_020376|CRT matches to NZ_CP023740 (Methylosinus trichosporium OB3b plasmid pOB3b3, complete sequence) position: , mismatch: 5, identity: 0.815

cgctcaaggacctgctggtgctaccgg	CRISPR spacer
cgctcaaggacctgctggtcattctcg	Protospacer
*******************  * *. *

23. spacer 4.2|3674901|27|NC_020376|CRT matches to NC_019718 (Enterobacteria phage vB_EcoS_Rogue1, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggacctgctggtgctaccgg	CRISPR spacer
tccacaaggcccagctggtgctaccgg	Protospacer
. * ***** ** **************

24. spacer 4.4|3675000|27|NC_020376|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 5, identity: 0.815

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
. . **.********************

25. spacer 4.4|3675000|27|NC_020376|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 5, identity: 0.815

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
. . **.********************

26. spacer 4.4|3675000|27|NC_020376|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 5, identity: 0.815

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcaaggtaacacaggtcctaccgg	Protospacer
. .**************** ****.**

27. spacer 4.4|3675000|27|NC_020376|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 5, identity: 0.815

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcagggtaacactggtgctactgg	Protospacer
. .***.******** ***********

28. spacer 4.6|3675090|27|NC_020376|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 5, identity: 0.815

tgttcaaggtaacacaggtgctaccgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
* . **.*****************.**

29. spacer 4.6|3675090|27|NC_020376|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 5, identity: 0.815

tgttcaaggtaacacaggtgctaccgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
* . **.*****************.**

30. spacer 4.4|3675000|27|NC_020376|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacaccggtgctactgg	Protospacer
. . **.******** ***********

31. spacer 4.4|3675000|27|NC_020376|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacaaggtaacaaaggtgatactgg	Protospacer
. . ********** ***** ******

32. spacer 4.4|3675000|27|NC_020376|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
  . ********.***** ********

33. spacer 4.4|3675000|27|NC_020376|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
  . ********.***** ********

34. spacer 4.4|3675000|27|NC_020376|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
. . **.******** ***********

35. spacer 4.4|3675000|27|NC_020376|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
. . **.******** ***********

36. spacer 4.4|3675000|27|NC_020376|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
. . **.******** ***********

37. spacer 4.4|3675000|27|NC_020376|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
. . **.******** ***********

38. spacer 4.4|3675000|27|NC_020376|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
. . **.******** ***********

39. spacer 4.4|3675000|27|NC_020376|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
. . **.******** ***********

40. spacer 4.5|3675045|27|NC_020376|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctaccgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
. . **.*****************.**

41. spacer 4.5|3675045|27|NC_020376|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctaccgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
. . **.*****************.**

42. spacer 4.12|3675351|27|NC_020376|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctaccgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
. . **.*****************.**

43. spacer 4.12|3675351|27|NC_020376|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctaccgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
. . **.*****************.**

44. spacer 4.11|3675297|36|NC_020376|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 7, identity: 0.806

tgctcaaggtaacacaggtgctactggtgctaccgg	CRISPR spacer
tccacagggtaacacaggtgctactggtcctcaggg	Protospacer
* * **.********************* **   **

45. spacer 4.11|3675297|36|NC_020376|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 7, identity: 0.806

tgctcaaggtaacacaggtgctactggtgctaccgg	CRISPR spacer
tccacagggtaacacaggtgctactggtcctcaggg	Protospacer
* * **.********************* **   **

46. spacer 4.11|3675297|36|NC_020376|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 8, identity: 0.778

tgctcaaggtaacacaggtgctactggtgctaccgg	CRISPR spacer
tcctcagggtaacactggtgctactggttcccaagg	Protospacer
* ****.******** ************ *.   **

47. spacer 5.1|5271971|31|NC_020376|CRISPRCasFinder matches to JX238501 (Bacillus phage phiAGATE, complete genome) position: , mismatch: 8, identity: 0.742

ttcttcttttttgtcactagttgaaccgctt	CRISPR spacer
ctaaccttttttgccactagttaaaccgccc	Protospacer
.*  .********.********.******..

48. spacer 5.2|5272025|34|NC_020376|CRISPRCasFinder matches to NZ_CP014851 (Bacillus thuringiensis strain HD12 plasmid pHD120112, complete sequence) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
tttatcttcttttttattttctggtttattttcc	Protospacer
.**.****** ****************  * ..*

49. spacer 5.2|5272025|34|NC_020376|CRISPRCasFinder matches to MN812210 (Flavobacterium phage vB_FspS_hemulen9-1, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

50. spacer 5.2|5272025|34|NC_020376|CRISPRCasFinder matches to MN812215 (Flavobacterium phage vB_FspS_lillamy9-4, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

51. spacer 5.2|5272025|34|NC_020376|CRISPRCasFinder matches to MN812216 (Flavobacterium phage vB_FspS_lillamy9-5, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

52. spacer 5.2|5272025|34|NC_020376|CRISPRCasFinder matches to NC_048835 (Flavobacterium phage vB_FspS_lillamy9-1, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

53. spacer 5.2|5272025|34|NC_020376|CRISPRCasFinder matches to MN812213 (Flavobacterium phage vB_FspS_lillamy9-2, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

54. spacer 5.2|5272025|34|NC_020376|CRISPRCasFinder matches to MN812230 (Flavobacterium phage vB_FspS_sniff9-2, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

55. spacer 5.2|5272025|34|NC_020376|CRISPRCasFinder matches to MN812209 (Flavobacterium phage vB_FspS_hemulen6-2, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

56. spacer 5.2|5272025|34|NC_020376|CRISPRCasFinder matches to MN812218 (Flavobacterium phage vB_FspS_lillamy9-7, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

57. spacer 5.2|5272025|34|NC_020376|CRISPRCasFinder matches to MN812233 (Flavobacterium phage vB_FspS_snork9-1, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

58. spacer 5.2|5272025|34|NC_020376|CRISPRCasFinder matches to MN812219 (Flavobacterium phage vB_FspS_morran9-1, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

59. spacer 5.2|5272025|34|NC_020376|CRISPRCasFinder matches to MN812217 (Flavobacterium phage vB_FspS_lillamy9-6, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

60. spacer 5.2|5272025|34|NC_020376|CRISPRCasFinder matches to NC_048840 (Flavobacterium phage vB_FspS_snork6-1, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

61. spacer 5.2|5272025|34|NC_020376|CRISPRCasFinder matches to NC_048839 (Flavobacterium phage vB_FspS_sniff9-1, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

62. spacer 5.2|5272025|34|NC_020376|CRISPRCasFinder matches to NC_048842 (Flavobacterium phage vB_FspS_stinky9-1, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

63. spacer 5.2|5272025|34|NC_020376|CRISPRCasFinder matches to MN812232 (Flavobacterium phage vB_FspS_snork6-2, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

64. spacer 5.2|5272025|34|NC_020376|CRISPRCasFinder matches to MN812208 (Flavobacterium phage vB_FspS_hemulen6-1, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

65. spacer 4.3|3674946|36|NC_020376|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 9, identity: 0.75

cgttcaaggtaacacaggtgctactggtgctaccgg	CRISPR spacer
tccacagggtaacacaggtgctactggtcctcaggg	Protospacer
. . **.********************* **   **

66. spacer 4.3|3674946|36|NC_020376|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 9, identity: 0.75

cgttcaaggtaacacaggtgctactggtgctaccgg	CRISPR spacer
tccacagggtaacacaggtgctactggtcctcaggg	Protospacer
. . **.********************* **   **

67. spacer 4.11|3675297|36|NC_020376|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 9, identity: 0.75

tgctcaaggtaacacaggtgctactggtgctaccgg	CRISPR spacer
ccctcagggtaacactggtgctactggtccacaagg	Protospacer
. ****.******** ************ *    **

68. spacer 5.2|5272025|34|NC_020376|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

69. spacer 5.2|5272025|34|NC_020376|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

70. spacer 5.2|5272025|34|NC_020376|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

71. spacer 5.2|5272025|34|NC_020376|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

72. spacer 5.2|5272025|34|NC_020376|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

73. spacer 5.2|5272025|34|NC_020376|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

74. spacer 5.2|5272025|34|NC_020376|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

308046 : 316422

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000625682.1\|308046_309354_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.9e-21	25.3
WP_001170549.1\|309442_310162_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	8.0e-50	44.8
WP_000278823.1\|310154_310409_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_000666785.1\|310405_311089_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_000055559.1\|311072_313292_+	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	2.0e-163	41.2
WP_000879026.1\|313276_314692_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	3.3e-55	35.4
WP_001262441.1\|314797_315838_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.1e-67	45.9
WP_000088590.1\|315834_316422_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	9.1e-28	37.4

DBSCAN-SWA_2

656456 : 664616

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000030268.1\|656456_657410_-	YafY family transcriptional regulator	A0A1B0RXM1	Streptococcus_phage	4.1e-17	29.9
WP_003273797.1\|657597_658038_+	dihydrofolate reductase	NA	NA	NA	NA
WP_000822580.1\|658203_659595_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	3.1e-34	30.5
WP_000565468.1\|659606_660284_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.1e-32	36.1
WP_000738870.1\|660459_661707_+	hypothetical protein	NA	NA	NA	NA
WP_000277054.1\|661840_662371_+	DUF4352 domain-containing protein	A0A0S2MVG4	Bacillus_phage	2.5e-16	33.5
WP_000831286.1\|662383_662728_+	DUF4064 domain-containing protein	A0A0S2MVJ2	Bacillus_phage	8.5e-42	78.1
WP_000487919.1\|663164_664616_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	5.8e-140	54.4

DBSCAN-SWA_3

686482 : 716538

Bacillus_phage(64.29%)

terminase,integrase,capsid

attL 685728:685743|attR 709583:709598

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
685728:685743	attL	NA	NA	NA	NA
WP_000645827.1\|686482_687535_+	(R,R)-butanediol dehydrogenase	E3SJ82	Synechococcus_phage	3.9e-21	27.6
WP_000948241.1\|687653_687998_+	two pore domain potassium channel family protein	NA	NA	NA	NA
WP_000730997.1\|688251_689103_+	phospholipase C	NA	NA	NA	NA
WP_000676798.1\|689179_690226_+	sphingomyelin phosphodiesterase	A0A1P8L6H7	Staphylococcus_phage	8.2e-88	59.3
WP_000262043.1\|690164_691265_-\|integrase	site-specific integrase	A0A0S2GLI2	Bacillus_phage	1.4e-199	96.7
WP_000009558.1\|692091_693294_+	hypothetical protein	W8CYT9	Bacillus_phage	8.0e-87	43.3
WP_000511081.1\|693636_693981_-	helix-turn-helix transcriptional regulator	W8CZ48	Bacillus_phage	1.9e-57	100.0
WP_000813894.1\|694129_694366_+	helix-turn-helix transcriptional regulator	W8CYU0	Bacillus_phage	4.3e-37	100.0
WP_000277640.1\|694398_694587_+	helix-turn-helix transcriptional regulator	W8CYN7	Bacillus_phage	9.4e-27	98.4
WP_000187072.1\|694607_695255_+	sigma-70 family RNA polymerase sigma factor	W8CYN8	Bacillus_phage	1.9e-98	86.0
WP_000788396.1\|695314_695470_+	hypothetical protein	I7J4K2	Bacillus_phage	4.1e-20	88.2
WP_000167564.1\|695532_695826_+	hypothetical protein	A0A0S2GLB6	Bacillus_phage	1.5e-26	63.0
WP_000102854.1\|695847_696108_+	hypothetical protein	NA	NA	NA	NA
WP_001061882.1\|696179_696608_+	hypothetical protein	NA	NA	NA	NA
WP_000892407.1\|696715_696910_+	hypothetical protein	NA	NA	NA	NA
WP_001148168.1\|696988_697924_+	YqaJ viral recombinase family protein	S6C475	Thermus_phage	5.8e-101	59.5
WP_000224586.1\|697945_698752_+	recombination protein RecT	S6AVW6	Thermus_phage	3.1e-95	66.8
WP_000040570.1\|698923_699727_+	DnaD domain protein	A0A0U4JX08	Bacillus_phage	2.7e-38	42.8
WP_003269479.1\|699824_700568_+	ATP-binding protein	A0A1B0T6C3	Bacillus_phage	1.5e-59	49.8
WP_001045406.1\|700591_701101_+	YpiB family protein	NA	NA	NA	NA
WP_000049838.1\|701113_701539_+	DUF1064 domain-containing protein	A0A2P1JTY5	Anoxybacillus_phage	4.1e-30	51.9
WP_000323349.1\|701554_702223_+	hypothetical protein	NA	NA	NA	NA
WP_000762586.1\|702212_702935_+	zinc-finger domain-containing protein	NA	NA	NA	NA
WP_000778925.1\|702944_703367_+	hypothetical protein	NA	NA	NA	NA
WP_000973815.1\|703350_704085_+	sigma-70 family RNA polymerase sigma factor	C7DTL2	Bacillus_phage	2.1e-58	51.2
WP_000433162.1\|704317_704482_+	hypothetical protein	W8CYP0	Bacillus_phage	1.1e-12	66.7
WP_000520931.1\|704660_704843_+	hypothetical protein	A0A1B1P7L7	Bacillus_phage	2.9e-09	58.5
WP_000164425.1\|704877_705675_+	phage antirepressor KilAC domain-containing protein	A0A1Q1PVZ8	Staphylococcus_phage	3.3e-73	51.7
WP_001072816.1\|706344_706719_+	ArpU family transcriptional regulator	Q9ZXB9	Bacillus_phage	6.0e-17	40.7
WP_000876114.1\|707080_707296_+	hypothetical protein	NA	NA	NA	NA
WP_000248554.1\|707580_707736_+	BC1881 family protein	NA	NA	NA	NA
WP_003269487.1\|707821_708004_+	hypothetical protein	NA	NA	NA	NA
WP_000576172.1\|708156_708729_+	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	2.2e-42	48.1
WP_000515245.1\|708771_709308_+	hypothetical protein	A5GYP7	Lactococcus_phage	9.5e-40	56.3
WP_003311458.1\|709273_710737_+\|terminase	phage terminase large subunit	U5PVG8	Bacillus_phage	7.5e-196	68.9
709583:709598	attR	NA	NA	NA	NA
WP_000222862.1\|710733_710964_+	hypothetical protein	NA	NA	NA	NA
WP_000124815.1\|710977_711178_+	hypothetical protein	NA	NA	NA	NA
WP_000467413.1\|711235_713359_+	hypothetical protein	NA	NA	NA	NA
WP_000366284.1\|713359_713635_+	DUF2829 domain-containing protein	A0A0A7AQX0	Bacillus_phage	1.4e-23	59.0
WP_003269488.1\|713634_713886_+	DUF2829 domain-containing protein	A0A1B0VMG3	Pseudomonas_phage	3.3e-19	54.2
WP_000668389.1\|713885_714146_+	DUF2829 domain-containing protein	S5MAK7	Bacillus_phage	4.3e-30	70.6
WP_000791085.1\|714145_714400_+	hypothetical protein	A0A1B1P7N4	Bacillus_phage	1.4e-38	85.4
WP_000917220.1\|714483_715332_+	hypothetical protein	NA	NA	NA	NA
WP_000501401.1\|715347_716538_+\|capsid	phage major capsid protein	A0A1B1IV93	uncultured_Mediterranean_phage	1.0e-33	28.2

DBSCAN-SWA_4

720945 : 731203

Bacillus_phage(100.0%)

bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001137510.1\|720945_725214_+	hypothetical protein	A0A0A0RPU4	Bacillus_phage	3.2e-138	36.3
WP_000392441.1\|725265_725496_+\|bacteriocin	bacteriocin biosynthesis protein	A0A1B1P7Q9	Bacillus_phage	1.6e-28	87.8
WP_003269494.1\|725495_726200_+	N-acetylmuramoyl-L-alanine amidase	W8CZ46	Bacillus_phage	3.8e-113	84.0
WP_000494384.1\|726326_726725_-	DUF3221 domain-containing protein	NA	NA	NA	NA
WP_000264500.1\|727522_727747_-	hypothetical protein	A0A1B1P883	Bacillus_phage	1.3e-27	74.3
WP_127057661.1\|728070_728202_+	hypothetical protein	W8CYT8	Bacillus_phage	6.9e-21	100.0
WP_000495115.1\|728221_728542_+	hypothetical protein	A0A0S2GLK1	Bacillus_phage	2.1e-50	98.1
WP_000511372.1\|728552_729719_+	DNA translocase FtsK	W8CYG2	Bacillus_phage	1.4e-221	98.5
WP_000842170.1\|729708_730317_+	replication-relaxation family protein	W8CZ47	Bacillus_phage	2.4e-111	98.5
WP_015406454.1\|730321_731203_-	helix-turn-helix domain-containing protein	I7ILW0	Bacillus_phage	3.3e-154	96.9

DBSCAN-SWA_5

1843953 : 1901377

Bacillus_phage(69.44%)

transposase,portal,integrase,terminase,tail,holin

attL 1839479:1839497|attR 1906264:1906282

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1839479:1839497	attL	NA	NA	NA	NA
WP_000499525.1\|1843953_1845150_-\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	5.6e-24	25.9
WP_001190219.1\|1845446_1845608_+	hypothetical protein	NA	NA	NA	NA
WP_015055111.1\|1845591_1847148_+	AAA family ATPase	A7KV18	Bacillus_phage	2.4e-22	31.8
WP_000567354.1\|1847161_1847464_+	hypothetical protein	NA	NA	NA	NA
WP_000421152.1\|1847463_1847697_+	hypothetical protein	NA	NA	NA	NA
WP_000273133.1\|1847710_1848346_+	hypothetical protein	A7KV15	Bacillus_phage	3.2e-26	34.8
WP_000334956.1\|1848362_1848728_+	hypothetical protein	NA	NA	NA	NA
WP_000546453.1\|1848727_1849786_+	metallophosphoesterase	NA	NA	NA	NA
WP_000636793.1\|1849782_1850085_+	hypothetical protein	NA	NA	NA	NA
WP_000137796.1\|1850077_1850629_+	hypothetical protein	NA	NA	NA	NA
WP_000371314.1\|1850638_1851157_+	hypothetical protein	NA	NA	NA	NA
WP_003271401.1\|1851240_1852818_+	DEAD/DEAH box helicase family protein	A0A1B0Z0P8	Vibrio_phage	1.7e-15	24.2
WP_000523223.1\|1852907_1853150_+	hypothetical protein	NA	NA	NA	NA
WP_000191310.1\|1853149_1853893_+	hypothetical protein	NA	NA	NA	NA
WP_001074794.1\|1853912_1856999_+	hypothetical protein	A0A1L4BKL0	Thermus_phage	8.0e-14	28.6
WP_000147936.1\|1857022_1859449_+	bifunctional 3'-5' exonuclease/DNA polymerase	F8WQ35	Bacillus_phage	5.1e-32	23.9
WP_000532406.1\|1859452_1859725_+	hypothetical protein	NA	NA	NA	NA
WP_000993003.1\|1859687_1859945_+	hypothetical protein	NA	NA	NA	NA
WP_000509446.1\|1859970_1860336_+	hypothetical protein	NA	NA	NA	NA
WP_001249533.1\|1860478_1860802_+	hypothetical protein	NA	NA	NA	NA
WP_001021290.1\|1860798_1861338_+	dUTP diphosphatase	A0A288WGA4	Bacillus_phage	5.8e-21	34.2
WP_000521061.1\|1861352_1862129_+	hypothetical protein	NA	NA	NA	NA
WP_000693593.1\|1862298_1862670_+	hypothetical protein	NA	NA	NA	NA
WP_000391475.1\|1862717_1863026_+	hypothetical protein	NA	NA	NA	NA
WP_000422433.1\|1863063_1864044_+	site-specific DNA-methyltransferase	A0A2H4JD00	uncultured_Caudovirales_phage	5.5e-118	61.2
WP_000404006.1\|1864285_1864783_+	hypothetical protein	A0A288WFR1	Bacillus_phage	1.7e-27	67.4
WP_000539655.1\|1864834_1865002_+	hypothetical protein	A0A0M4RER6	Bacillus_phage	2.0e-20	87.3
WP_000053745.1\|1866129_1866540_+	hypothetical protein	S5MUC4	Brevibacillus_phage	2.2e-12	54.2
WP_001043868.1\|1866536_1867190_+	hypothetical protein	NA	NA	NA	NA
WP_000805617.1\|1867311_1867629_+	hypothetical protein	A0A0K2CZ01	Paenibacillus_phage	1.0e-04	34.7
WP_000154978.1\|1867645_1868563_+	hypothetical protein	NA	NA	NA	NA
WP_000790088.1\|1868565_1868712_+	BC1881 family protein	NA	NA	NA	NA
WP_001202995.1\|1868837_1869059_+	hypothetical protein	NA	NA	NA	NA
WP_000843025.1\|1869055_1869337_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	3.0e-13	59.0
WP_001294615.1\|1869338_1869536_+	hypothetical protein	A0A1L2JY50	Aeribacillus_phage	9.5e-06	44.8
WP_080546110.1\|1869562_1869730_+	hypothetical protein	NA	NA	NA	NA
WP_000410292.1\|1869732_1870257_+	hypothetical protein	NA	NA	NA	NA
WP_001106358.1\|1870253_1870436_+	hypothetical protein	A0A1B1P7M4	Bacillus_phage	3.3e-13	68.0
WP_000200015.1\|1870425_1870752_+	hypothetical protein	NA	NA	NA	NA
WP_000196741.1\|1871012_1871393_+	hypothetical protein	NA	NA	NA	NA
WP_000873650.1\|1871799_1872363_+	recombinase family protein	A0A0A8WIK3	Clostridium_phage	9.0e-41	51.3
WP_001086032.1\|1872560_1872989_+	hypothetical protein	A0A2H4J6Z8	uncultured_Caudovirales_phage	1.2e-32	51.1
WP_000323341.1\|1873005_1874721_+\|terminase	phage terminase large subunit	A0A142F1L6	Bacillus_phage	8.0e-149	52.1
WP_001265883.1\|1874737_1876255_+\|portal	phage portal protein	A0A142F1L7	Bacillus_phage	1.1e-67	30.5
WP_003271428.1\|1876313_1877093_+	phage scaffolding protein	Q4ZC70	Staphylococcus_virus	9.7e-09	40.0
WP_001145075.1\|1877153_1878278_+	DUF5309 family protein	NA	NA	NA	NA
WP_000027969.1\|1878327_1878552_+	hypothetical protein	NA	NA	NA	NA
WP_000868477.1\|1878581_1878923_+	hypothetical protein	NA	NA	NA	NA
WP_001285263.1\|1878927_1879734_+	hypothetical protein	NA	NA	NA	NA
WP_000954643.1\|1879737_1880112_+	hypothetical protein	NA	NA	NA	NA
WP_001222696.1\|1880111_1880471_+	hypothetical protein	NA	NA	NA	NA
WP_000930921.1\|1880473_1880881_+	hypothetical protein	NA	NA	NA	NA
WP_000852562.1\|1880894_1881401_+\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_000443956.1\|1881424_1881784_+	hypothetical protein	A0A0A7AQ61	Bacillus_phage	5.4e-39	82.9
WP_000762691.1\|1881770_1881986_+	hypothetical protein	H0USV9	Bacillus_phage	2.3e-29	97.1
WP_000818630.1\|1882053_1882431_+	hypothetical protein	NA	NA	NA	NA
WP_000931847.1\|1882520_1882775_+	hypothetical protein	NA	NA	NA	NA
WP_003271441.1\|1882811_1886708_+\|tail	phage tail tape measure protein	A6M961	Geobacillus_virus	4.2e-12	48.8
WP_000959919.1\|1886722_1888219_+\|tail	phage tail family protein	A0A0A7AQV1	Bacillus_phage	4.0e-221	80.4
WP_001260209.1\|1888215_1893195_+	hypothetical protein	A0A0S2MVB4	Bacillus_phage	0.0e+00	65.6
WP_000342975.1\|1893206_1893587_+	hypothetical protein	A0A0S2MVE0	Bacillus_phage	2.3e-48	79.2
WP_000822841.1\|1893686_1894646_+\|integrase	site-specific integrase	A0A0S2GLC8	Bacillus_phage	2.1e-175	95.3
WP_000373895.1\|1894661_1895087_+\|holin	phage holin family protein	A0A1B1P787	Bacillus_phage	7.0e-70	95.0
WP_001216050.1\|1895086_1895920_+	N-acetylmuramoyl-L-alanine amidase	A0A1B1P783	Bacillus_phage	1.9e-148	88.1
WP_000370580.1\|1895974_1896241_-	hypothetical protein	NA	NA	NA	NA
WP_000727572.1\|1896350_1896494_-	hypothetical protein	NA	NA	NA	NA
WP_001230989.1\|1896520_1897123_-	hypothetical protein	NA	NA	NA	NA
WP_000578036.1\|1897221_1897458_-	helix-turn-helix transcriptional regulator	Q2I8D9	Bacillus_phage	9.0e-19	57.9
WP_000854597.1\|1897614_1897737_+	DUF3961 domain-containing protein	Q3HKZ4	Bacillus_phage	4.8e-08	62.2
WP_000669093.1\|1898378_1898579_-	helix-turn-helix transcriptional regulator	Q2I8E4	Bacillus_phage	1.1e-12	54.5
WP_001247349.1\|1898764_1899031_+	hypothetical protein	NA	NA	NA	NA
WP_001267622.1\|1899030_1899333_+	hypothetical protein	A0A288WG08	Bacillus_phage	8.0e-28	58.2
WP_000176361.1\|1899329_1899512_+	hypothetical protein	Q2I8E2	Bacillus_phage	1.1e-19	81.7
WP_000891521.1\|1899627_1900812_+	cell division protein FtsK	A0A288WFS1	Bacillus_phage	2.1e-140	62.9
WP_001025807.1\|1900753_1901377_+	replication-relaxation family protein	H0USY2	Bacillus_phage	2.3e-93	80.1
1906264:1906282	attR	NA	NA	NA	NA

DBSCAN-SWA_6

1938257 : 1947556

Bacillus_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000755523.1\|1938257_1939550_+	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	5.0e-10	30.3
WP_000453879.1\|1940654_1942415_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.8e-273	98.0
WP_015055113.1\|1942455_1943133_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.5e-122	99.1
WP_001231619.1\|1943129_1944203_+	HAMP domain-containing sensor histidine kinase	W8CYF6	Bacillus_phage	8.8e-186	97.8
WP_003270270.1\|1944227_1944821_-	DUF3139 domain-containing protein	NA	NA	NA	NA
WP_000818985.1\|1945011_1945731_+	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
WP_000014165.1\|1945878_1946550_+	O-methyltransferase	W8CYT3	Bacillus_phage	1.8e-64	92.0
WP_001258527.1\|1946683_1947556_+	aminoglycoside 6-adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	4.0e-64	44.4

DBSCAN-SWA_7

2368090 : 2375171

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015055127.1\|2368090_2368420_+	HNH endonuclease	A0A1S7FZ53	Listeria_phage	2.6e-16	45.7
WP_003269337.1\|2368479_2368725_+	hypothetical protein	NA	NA	NA	NA
WP_000015466.1\|2369133_2369631_+	helix-turn-helix domain-containing protein	A0A1B1P762	Bacillus_phage	6.2e-09	34.0
WP_000461733.1\|2370336_2370576_+	hypothetical protein	A0A0A7AR38	Bacillus_phage	1.0e-30	92.4
WP_000753400.1\|2370572_2371622_+	N-acetylmuramoyl-L-alanine amidase	A0A0A7AQV3	Bacillus_phage	2.4e-188	91.0
WP_000384715.1\|2371680_2372022_-	hypothetical protein	NA	NA	NA	NA
WP_000249917.1\|2372047_2373538_-	WXG100 family type VII secretion target	A0A2H4J389	uncultured_Caudovirales_phage	5.0e-22	46.7
WP_001281134.1\|2373765_2374002_-	hypothetical protein	NA	NA	NA	NA
WP_000598277.1\|2374388_2375171_-	glycosyltransferase family 2 protein	A0A1V0SJD8	Klosneuvirus	2.2e-21	31.6

DBSCAN-SWA_8

2601964 : 2674013

Bacillus_phage(66.67%)

bacteriocin,transposase,portal,integrase,capsid,terminase,tail,protease

attL 2620310:2620345|attR 2679368:2679403

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001071355.1\|2601964_2602294_+\|bacteriocin	heterocycloanthracin/sonorensin family bacteriocin	NA	NA	NA	NA
WP_003270601.1\|2602777_2603263_+	hypothetical protein	NA	NA	NA	NA
WP_000736205.1\|2603574_2604276_+	DUF3962 domain-containing protein	NA	NA	NA	NA
WP_000675858.1\|2604314_2605424_-\|integrase	tyrosine-type recombinase/integrase	A0A0U3U8Y8	Bacillus_phage	1.1e-146	79.4
WP_000732892.1\|2605655_2606129_+	hypothetical protein	NA	NA	NA	NA
WP_000734558.1\|2606362_2606824_+	hypothetical protein	NA	NA	NA	NA
WP_001197708.1\|2607485_2608694_+	hypothetical protein	D2XQ10	Bacillus_virus	2.3e-81	45.2
WP_000791664.1\|2608720_2608876_+	hypothetical protein	NA	NA	NA	NA
WP_000425257.1\|2609136_2609487_-	helix-turn-helix transcriptional regulator	A0A288WFW4	Bacillus_phage	9.6e-17	39.7
WP_001180927.1\|2609670_2609967_+	helix-turn-helix transcriptional regulator	A0A288WG89	Bacillus_phage	8.2e-09	46.5
WP_000522023.1\|2610182_2610449_+	helix-turn-helix domain-containing protein	A0A0U3ULL9	Bacillus_phage	2.0e-35	90.6
WP_000390298.1\|2610448_2610613_+	hypothetical protein	A0A0U3B230	Bacillus_phage	1.5e-20	90.7
WP_001241129.1\|2610642_2610819_+	hypothetical protein	A0A0U3SQC4	Bacillus_phage	6.3e-25	93.1
WP_000190250.1\|2610823_2611558_+	DnaD domain protein	A0A1B1P7T6	Bacillus_phage	1.1e-89	83.9
WP_014482038.1\|2611526_2612330_+	ATP-binding protein	A0A1B1P7U2	Bacillus_phage	7.3e-145	98.5
WP_000332458.1\|2612344_2612539_+	hypothetical protein	A0A1B1P7U7	Bacillus_phage	2.2e-26	87.5
WP_000792379.1\|2612555_2612966_+	hypothetical protein	NA	NA	NA	NA
WP_000312979.1\|2612998_2613253_-	hypothetical protein	NA	NA	NA	NA
WP_014482039.1\|2613340_2613484_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	9.6e-08	68.3
WP_001053955.1\|2613595_2615032_-\|transposase	IS4-like element IS231A family transposase	NA	NA	NA	NA
WP_001125966.1\|2615278_2615638_+	hypothetical protein	A0A1B1P7A1	Bacillus_phage	1.6e-30	52.5
WP_000717823.1\|2615655_2615823_+	DUF3954 domain-containing protein	A0A1B0T6B8	Bacillus_phage	1.1e-13	62.3
WP_000109538.1\|2615848_2616100_+	hypothetical protein	A0A0K2CNP4	Brevibacillus_phage	6.5e-07	36.1
WP_140340092.1\|2616212_2617001_-	glycosyltransferase family 2 protein	A0A1V0SJD8	Klosneuvirus	9.4e-20	32.1
WP_000185202.1\|2617216_2618005_-	sulfotransferase family 2 domain-containing protein	A0A288WG17	Bacillus_phage	3.0e-106	72.3
WP_000527470.1\|2618913_2619273_-	septum formation initiator family protein	NA	NA	NA	NA
WP_000506751.1\|2619420_2619624_+	hypothetical protein	NA	NA	NA	NA
WP_000133487.1\|2619717_2619882_-	hypothetical protein	A0A288WGN0	Bacillus_phage	2.2e-08	51.9
WP_000183173.1\|2619984_2620107_+	DUF3983 domain-containing protein	NA	NA	NA	NA
WP_001013579.1\|2620127_2620316_+	hypothetical protein	NA	NA	NA	NA
2620310:2620345	attL	NA	NA	NA	NA
WP_000677277.1\|2620414_2620585_+	hypothetical protein	A0A1B1P735	Bacillus_phage	5.1e-08	87.5
WP_001041413.1\|2620605_2621076_+	ArpU family transcriptional regulator	A0A1B1P744	Bacillus_phage	7.2e-76	91.0
WP_001028517.1\|2621072_2621615_+\|integrase	tyrosine-type recombinase/integrase	A0A1B1P746	Bacillus_phage	1.0e-94	97.2
WP_000351128.1\|2621739_2622396_+	hypothetical protein	NA	NA	NA	NA
WP_000538961.1\|2622379_2623540_+	ImmA/IrrE family metallo-endopeptidase	A0A0A7RTT7	Clostridium_phage	1.1e-56	34.5
WP_000440224.1\|2623972_2624902_+	hypothetical protein	NA	NA	NA	NA
WP_000453364.1\|2625282_2625504_+	hypothetical protein	NA	NA	NA	NA
WP_000615852.1\|2625500_2625830_+	HNH endonuclease	A0A1B1P757	Bacillus_phage	6.1e-21	50.0
WP_000377853.1\|2625832_2626141_+	hypothetical protein	NA	NA	NA	NA
WP_000015467.1\|2626449_2626947_+	helix-turn-helix domain-containing protein	A0A1B1P762	Bacillus_phage	6.2e-09	34.0
WP_000988815.1\|2626921_2628598_+\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	7.8e-181	57.8
WP_000512879.1\|2628614_2629859_+\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	6.8e-73	37.5
WP_003272656.1\|2629875_2630508_+\|protease	Clp protease ClpP	D2XR17	Bacillus_phage	1.9e-34	45.5
WP_000588590.1\|2630521_2631646_+\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	7.2e-98	50.0
WP_001282872.1\|2631659_2631983_+	hypothetical protein	NA	NA	NA	NA
WP_000963758.1\|2631972_2632329_+	hypothetical protein	NA	NA	NA	NA
WP_000174092.1\|2632315_2632696_+	hypothetical protein	NA	NA	NA	NA
WP_001111193.1\|2632685_2633096_+	hypothetical protein	NA	NA	NA	NA
WP_001145608.1\|2633097_2633667_+	hypothetical protein	Q858W9	Listeria_phage	3.5e-40	45.4
WP_000159510.1\|2633728_2634079_+	hypothetical protein	A0A1S7FZ84	Listeria_phage	1.5e-09	36.5
WP_000235149.1\|2634261_2638092_+\|tail	phage tail tape measure protein	A0A1S5SFC1	Streptococcus_phage	5.8e-46	30.2
WP_000227695.1\|2638084_2638771_+	hypothetical protein	A0A2H4J851	uncultured_Caudovirales_phage	2.4e-80	63.7
WP_000631955.1\|2638767_2641497_+\|tail	phage tail protein	A0A1B1P770	Bacillus_phage	3.6e-236	50.2
WP_000387824.1\|2641535_2641769_+	hemolysin XhlA family protein	A0A2H4J382	uncultured_Caudovirales_phage	2.7e-15	95.9
WP_000499523.1\|2641863_2643057_-\|transposase	IS110-like element ISBth13 family transposase	A0A0U3ULR1	Bacillus_phage	1.1e-24	26.1
WP_000461714.1\|2643354_2643594_+	hypothetical protein	A0A0A7AR38	Bacillus_phage	1.5e-32	93.7
WP_000753418.1\|2643590_2644655_+	N-acetylmuramoyl-L-alanine amidase	A0A0A7AQV3	Bacillus_phage	4.2e-196	94.1
WP_000459800.1\|2644696_2645605_+	collagen-like protein	NA	NA	NA	NA
WP_000998176.1\|2645869_2646169_-	hypothetical protein	NA	NA	NA	NA
WP_000249915.1\|2646187_2647597_-	WXG100 family type VII secretion target	A0A2H4J389	uncultured_Caudovirales_phage	6.2e-22	45.8
WP_000626125.1\|2647902_2649585_+	DUF3893 domain-containing protein	NA	NA	NA	NA
WP_000732186.1\|2649791_2650556_+	DUF3959 family protein	NA	NA	NA	NA
WP_000905570.1\|2650700_2651117_+	DUF3995 domain-containing protein	NA	NA	NA	NA
WP_000878371.1\|2651237_2651441_+	hypothetical protein	NA	NA	NA	NA
WP_000362069.1\|2651770_2651983_-	hypothetical protein	NA	NA	NA	NA
WP_000565693.1\|2652192_2653200_+	DUF1835 domain-containing protein	NA	NA	NA	NA
WP_000282689.1\|2653342_2653747_+	hypothetical protein	NA	NA	NA	NA
WP_000062121.1\|2653906_2655142_+	cytochrome P450	NA	NA	NA	NA
WP_000426103.1\|2655553_2656696_+	MFS transporter	NA	NA	NA	NA
WP_001069254.1\|2656685_2657318_+	Vat family streptogramin A O-acetyltransferase	A0A2R8FE91	Brazilian_cedratvirus	1.6e-25	43.1
WP_000046095.1\|2657388_2657544_+	DUF1540 domain-containing protein	NA	NA	NA	NA
WP_000289124.1\|2657646_2658144_-	PadR family transcriptional regulator	NA	NA	NA	NA
WP_000168009.1\|2658284_2659499_+	cytochrome P450	NA	NA	NA	NA
WP_000954443.1\|2659608_2660187_+	cysteine dioxygenase family protein	NA	NA	NA	NA
WP_000766393.1\|2660362_2661214_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_001088549.1\|2661636_2663424_+	PAS domain-containing protein	NA	NA	NA	NA
WP_000743772.1\|2663658_2665785_+	penicillin-binding protein 2	NA	NA	NA	NA
WP_000932141.1\|2666649_2667828_+	UDP-glucosyltransferase	A0A2H4ZK81	Cryptophlebia_leucotreta_granulosis_virus	6.8e-06	28.3
WP_000864376.1\|2667927_2668608_-	aspartate/glutamate racemase family protein	NA	NA	NA	NA
WP_001038210.1\|2669018_2669567_+	ECF-type riboflavin transporter substrate-binding protein	NA	NA	NA	NA
WP_001182519.1\|2669577_2671278_+	energy-coupling factor ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	6.1e-16	30.0
WP_000556364.1\|2671270_2672071_+	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_000120182.1\|2672207_2672315_+	YjcZ family sporulation protein	NA	NA	NA	NA
WP_000348328.1\|2672416_2673676_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.2e-24	29.1
WP_003270646.1\|2673800_2674013_-\|transposase	transposase	A0A0U3U8Y8	Bacillus_phage	2.0e-17	71.4
2679368:2679403	attR	NA	NA	NA	NA

DBSCAN-SWA_9

3720431 : 3827922

108

Bacillus_phage(56.6%)

bacteriocin,transposase,portal,integrase,capsid,head,terminase,tail,protease,tRNA,coat,holin

attL 3796456:3796473|attR 3812509:3812526

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000878380.1\|3720431_3720788_-\|holin	CidA/LrgA family holin-like protein	NA	NA	NA	NA
WP_000454956.1\|3720821_3722255_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_000006458.1\|3722441_3722633_-	hypothetical protein	NA	NA	NA	NA
WP_001274919.1\|3722853_3723561_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_000671631.1\|3723591_3725001_-	glycoside hydrolase family 1 protein	A0A0B5JD41	Pandoravirus	7.8e-57	30.0
WP_000066296.1\|3725192_3726182_-	phosphatidylinositol diacylglycerol-lyase	NA	NA	NA	NA
WP_000689202.1\|3726361_3728203_-	peptidase	NA	NA	NA	NA
WP_000771003.1\|3728495_3729293_+	LysM peptidoglycan-binding domain-containing protein	A0A172JHR8	Bacillus_phage	2.8e-35	38.6
WP_000272398.1\|3729558_3730896_+	NAD(P)-binding protein	NA	NA	NA	NA
WP_000791042.1\|3731397_3733317_+	LTA synthase family protein	W6LM83	Streptococcus_phage	2.7e-97	37.3
WP_001235332.1\|3733366_3736150_-	dynamin family protein	NA	NA	NA	NA
WP_000461138.1\|3736654_3736840_+	hypothetical protein	NA	NA	NA	NA
WP_000516464.1\|3737118_3739062_-	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	4.5e-63	30.0
WP_000195993.1\|3739070_3741743_-	DNA mismatch repair protein MutS	A0A1V0SGG8	Hokovirus	2.3e-33	24.2
WP_001288799.1\|3741923_3742466_-\|coat	outer spore coat protein CotE	NA	NA	NA	NA
WP_000870460.1\|3742593_3743025_-	RicAFT regulatory complex protein RicA family protein	NA	NA	NA	NA
WP_001005391.1\|3743028_3744558_-\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
WP_000190159.1\|3744986_3745853_-	2-oxoacid:ferredoxin oxidoreductase subunit beta	NA	NA	NA	NA
WP_000625417.1\|3745839_3747597_-	2-oxoacid:acceptor oxidoreductase subunit alpha	NA	NA	NA	NA
WP_000688049.1\|3747824_3748748_-	dipeptidase	NA	NA	NA	NA
WP_000404341.1\|3748807_3749068_-	stage V sporulation protein SpoVS	J9PTX7	Bacillus_phage	8.4e-10	43.8
WP_001221095.1\|3749217_3750012_-	TIGR00282 family metallophosphoesterase	NA	NA	NA	NA
WP_000099769.1\|3750174_3751740_-	ribonuclease Y	NA	NA	NA	NA
WP_001283854.1\|3752222_3753254_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	1.9e-137	71.8
WP_000990687.1\|3753398_3754637_-	competence/damage-inducible protein CinA	NA	NA	NA	NA
WP_001052967.1\|3754657_3755236_-	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_000137473.1\|3755300_3756212_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_000574107.1\|3756233_3757019_-	DUF3388 domain-containing protein	NA	NA	NA	NA
WP_000114444.1\|3757157_3757406_-	DUF3243 domain-containing protein	NA	NA	NA	NA
WP_000759628.1\|3757481_3758195_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_000411974.1\|3758295_3759582_-	insulinase family protein	A0A2H4UVM3	Bodo_saltans_virus	1.0e-10	28.9
WP_000772415.1\|3759582_3760857_-	insulinase family protein	A0A1X9I714	Streptococcus_phage	3.5e-56	30.0
WP_000008857.1\|3761065_3762025_-	ABC transporter permease	NA	NA	NA	NA
WP_001085254.1\|3762025_3763084_-	ABC transporter permease	NA	NA	NA	NA
WP_000456926.1\|3763076_3764609_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	6.3e-12	26.3
WP_000725769.1\|3764727_3765813_-	BMP family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000114182.1\|3765905_3766631_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_001118792.1\|3767169_3769551_-	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	2.0e-89	51.4
WP_000605020.1\|3769763_3769967_-	YlzJ-like family protein	NA	NA	NA	NA
WP_000139807.1\|3769963_3770713_-	translocation-enhancing protein TepA	NA	NA	NA	NA
WP_000823071.1\|3770816_3772487_-	ribonuclease J	NA	NA	NA	NA
WP_000564763.1\|3773412_3774291_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_000692450.1\|3774302_3775535_-	aspartate kinase	NA	NA	NA	NA
WP_000414846.1\|3775558_3776605_-	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_001238645.1\|3776755_3776932_-	dipicolinate synthase	NA	NA	NA	NA
WP_015406503.1\|3777046_3777901_-	flagellar hook-length control protein FliK	NA	NA	NA	NA
WP_000249941.1\|3778386_3779304_+	WXG100 family type VII secretion target	A0A2H4J389	uncultured_Caudovirales_phage	7.1e-19	36.2
WP_000069067.1\|3779326_3779827_+	hypothetical protein	NA	NA	NA	NA
WP_014482108.1\|3779805_3779958_+	hypothetical protein	NA	NA	NA	NA
WP_001022083.1\|3780092_3780482_+	hypothetical protein	NA	NA	NA	NA
WP_000540624.1\|3780609_3781419_-	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	9.1e-135	82.9
WP_001261076.1\|3781418_3781655_-\|bacteriocin	bacteriocin biosynthesis protein	A0A2H4JGN9	uncultured_Caudovirales_phage	1.7e-25	100.0
WP_000499523.1\|3781942_3783136_+\|transposase	IS110-like element ISBth13 family transposase	A0A0U3ULR1	Bacillus_phage	1.1e-24	26.1
WP_000342979.1\|3783268_3783637_-	hypothetical protein	A0A0S2MVE0	Bacillus_phage	1.7e-32	61.5
WP_001260192.1\|3783648_3788034_-\|tail	phage tail protein	A0A0S2MVB4	Bacillus_phage	0.0e+00	53.6
WP_000094125.1\|3788030_3789488_-\|tail	phage tail family protein	A0A0A7AQV1	Bacillus_phage	2.3e-173	59.9
WP_000897025.1\|3789529_3793156_-	hypothetical protein	A0A2H4JAI2	uncultured_Caudovirales_phage	1.9e-184	86.5
WP_000415912.1\|3793388_3793751_-	hypothetical protein	A0A2H4JAG8	uncultured_Caudovirales_phage	2.4e-42	70.8
WP_001004907.1\|3793755_3794343_-\|tail	phage tail protein	A0A2H4JDV4	uncultured_Caudovirales_phage	5.1e-87	82.1
WP_000176452.1\|3794343_3794679_-	hypothetical protein	D2XR22	Bacillus_phage	7.5e-51	89.9
WP_001279008.1\|3794675_3795020_-	HK97 gp10 family phage protein	A0A2H4JAH8	uncultured_Caudovirales_phage	7.0e-44	78.8
WP_001247272.1\|3795021_3795372_-\|head	phage head closure protein	D2XR20	Bacillus_phage	1.3e-53	87.9
WP_001243203.1\|3795373_3795670_-	hypothetical protein	D2XR19	Bacillus_phage	9.5e-42	87.5
WP_000234856.1\|3795682_3796846_-\|capsid	phage major capsid protein	A0A2H4JH29	uncultured_Caudovirales_phage	5.5e-210	95.9
3796456:3796473	attL	NA	NA	NA	NA
WP_000216400.1\|3796865_3797642_-\|protease	Clp protease ClpP	A0A0A7RWX3	Clostridium_phage	1.5e-57	57.7
WP_015406504.1\|3797625_3798732_-\|portal	phage portal protein	A0A2H4JAJ1	uncultured_Caudovirales_phage	9.0e-186	90.1
WP_000615661.1\|3798797_3800456_-\|terminase	terminase large subunit	A0A2H4JHE9	uncultured_Caudovirales_phage	1.1e-256	79.0
WP_000124844.1\|3800452_3800788_-	hypothetical protein	A0A1B1P762	Bacillus_phage	1.7e-07	31.2
WP_001258474.1\|3800940_3801282_-	HNH endonuclease	D2XR61	Bacillus_phage	1.1e-54	93.6
WP_000049336.1\|3801262_3801676_-	hypothetical protein	Q2I8B8	Bacillus_phage	1.1e-30	52.5
WP_000196709.1\|3801689_3801911_-	hypothetical protein	NA	NA	NA	NA
WP_000333210.1\|3801903_3802071_-	hypothetical protein	A0A1B1P8J7	Bacillus_phage	8.1e-14	67.3
WP_015055180.1\|3802165_3802360_-	hypothetical protein	NA	NA	NA	NA
WP_003271368.1\|3802527_3802719_-	hypothetical protein	A0A1B1P857	Bacillus_phage	2.9e-23	77.8
WP_000930972.1\|3803173_3803392_-	hypothetical protein	H0USV5	Bacillus_phage	5.2e-21	66.2
WP_001170299.1\|3803814_3804765_-	nucleoside hydrolase	NA	NA	NA	NA
WP_001012136.1\|3804978_3805521_-\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	2.1e-87	90.6
WP_000166167.1\|3805520_3806003_-	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	2.1e-70	80.6
WP_000866139.1\|3806030_3806201_-	hypothetical protein	A0A1B0T6D0	Bacillus_phage	6.1e-09	73.2
WP_001061238.1\|3806305_3806437_-	DUF3983 domain-containing protein	A0A1B1P7V8	Bacillus_phage	4.5e-12	83.7
WP_001141572.1\|3806673_3806889_+	spore germination protein	A0A2H4J3A3	uncultured_Caudovirales_phage	7.7e-25	80.3
WP_015406505.1\|3807150_3807948_+	hypothetical protein	A0A285PWR0	Cedratvirus	2.7e-38	62.6
WP_001151791.1\|3808704_3808926_-	hypothetical protein	NA	NA	NA	NA
WP_000512858.1\|3808961_3809153_-	DUF3954 domain-containing protein	D2XR48	Bacillus_phage	8.3e-15	65.1
WP_001126000.1\|3809226_3809589_-	hypothetical protein	D2XR47	Bacillus_phage	2.4e-55	90.0
WP_000926801.1\|3809563_3809752_-	hypothetical protein	D2XR45	Bacillus_phage	5.3e-14	80.0
WP_000063842.1\|3809754_3811077_-	replicative DNA helicase	D2XR44	Bacillus_phage	1.9e-235	94.8
WP_000312138.1\|3811073_3812021_-	DnaD domain protein	D2XR43	Bacillus_phage	1.2e-74	59.9
WP_000923256.1\|3812022_3812199_-	hypothetical protein	NA	NA	NA	NA
WP_000998232.1\|3812300_3812585_-	hypothetical protein	D2XR42	Bacillus_phage	2.5e-23	54.3
3812509:3812526	attR	NA	NA	NA	NA
WP_000215311.1\|3812765_3812987_-	hypothetical protein	NA	NA	NA	NA
WP_000537278.1\|3813000_3813588_-	hypothetical protein	D2XR41	Bacillus_phage	8.4e-74	69.2
WP_001141264.1\|3813678_3813927_-	hypothetical protein	NA	NA	NA	NA
WP_001036233.1\|3813959_3814151_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_000900759.1\|3814323_3814761_+	helix-turn-helix transcriptional regulator	D2XR39	Bacillus_phage	7.0e-33	59.9
WP_000403118.1\|3814773_3815202_+	ImmA/IrrE family metallo-endopeptidase	D2XR38	Bacillus_phage	7.1e-62	80.3
WP_000202384.1\|3815285_3816098_+	hypothetical protein	NA	NA	NA	NA
WP_000661246.1\|3816155_3817151_+	hypothetical protein	NA	NA	NA	NA
WP_000949469.1\|3817134_3817302_-	hypothetical protein	NA	NA	NA	NA
WP_000844785.1\|3817472_3819020_+	recombinase family protein	I3VYZ3	Thermoanaerobacterium_phage	1.0e-142	53.4
WP_000954735.1\|3819474_3820377_-	dipicolinic acid synthetase subunit A	NA	NA	NA	NA
WP_001239759.1\|3820546_3820798_-	YlmC/YmxH family sporulation protein	NA	NA	NA	NA
WP_000593001.1\|3820933_3822175_-	insulinase family protein	G3MBJ8	Bacillus_virus	4.4e-56	34.5
WP_000868222.1\|3822262_3823162_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_000076745.1\|3823314_3825453_-	polyribonucleotide nucleotidyltransferase	NA	NA	NA	NA
WP_001229392.1\|3825613_3825883_-	30S ribosomal protein S15	NA	NA	NA	NA
WP_000766703.1\|3825983_3826955_-	bifunctional riboflavin kinase/FAD synthetase	A0A1V0SD03	Indivirus	2.1e-05	31.8
WP_000399362.1\|3826998_3827922_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA

DBSCAN-SWA_10

4526310 : 4533993

Staphylococcus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000221100.1\|4526310_4527234_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	6.9e-46	44.0
WP_000247669.1\|4527360_4528296_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	4.9e-23	26.3
WP_000018060.1\|4528297_4528990_-	response regulator transcription factor	B5LWA6	Feldmannia_species_virus	1.0e-06	28.8
WP_001293585.1\|4529158_4529332_+	hypothetical protein	NA	NA	NA	NA
WP_001014310.1\|4529332_4529527_+	YwbE family protein	NA	NA	NA	NA
WP_001255968.1\|4529567_4530767_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	5.6e-72	41.2
WP_000587824.1\|4531061_4531385_+	heme oxygenase	NA	NA	NA	NA
WP_000095598.1\|4531453_4532218_-	class B sortase	NA	NA	NA	NA
WP_000403738.1\|4532249_4533020_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.3e-13	26.6
WP_001036824.1\|4533009_4533993_-	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	7.1e-17	26.9

DBSCAN-SWA_11

4727816 : 4734860

Staphylococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000165837.1\|4727816_4728578_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-34	39.3
WP_000527699.1\|4728843_4729866_-	DUF418 domain-containing protein	NA	NA	NA	NA
WP_000817275.1\|4730022_4731180_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q331V1	Clostridium_botulinum_C_phage	9.6e-122	59.0
WP_004412121.1\|4731176_4731527_-\|transposase	IS607 family transposase	Q331V0	Clostridium_botulinum_C_phage	9.2e-44	66.7
WP_001129340.1\|4731741_4731891_-	hypothetical protein	NA	NA	NA	NA
WP_000840869.1\|4731906_4732170_-	YtzC family protein	NA	NA	NA	NA
WP_000868033.1\|4732281_4733241_+	TIGR01212 family radical SAM protein	A0A2H4PQV5	Staphylococcus_phage	1.7e-55	72.0
WP_000764492.1\|4733237_4733810_+	class I SAM-dependent methyltransferase	A0A2H4PQV0	Staphylococcus_phage	4.1e-49	53.4
WP_000959717.1\|4734026_4734860_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.8e-16	31.1

DBSCAN-SWA_12

4881806 : 4970353

Bacillus_phage(67.86%)

transposase,plate,portal,integrase,capsid,head,terminase,tail,protease,tRNA,coat,holin

attL 4876366:4876389|attR 4972367:4972390

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4876366:4876389	attL	NA	NA	NA	NA
WP_000287154.1\|4881806_4883183_+\|tRNA	glycine--tRNA ligase	A0A1V0SIF1	Klosneuvirus	3.4e-49	28.1
WP_001140612.1\|4883222_4883606_-	hotdog fold thioesterase	NA	NA	NA	NA
WP_000810334.1\|4883701_4884445_+	DUF3298 and DUF4163 domain-containing protein	NA	NA	NA	NA
WP_015406515.1\|4884495_4885089_+	biotin transporter BioY	NA	NA	NA	NA
WP_000757822.1\|4885134_4886022_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.2e-79	54.1
WP_001104228.1\|4886129_4887854_-	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	3.5e-176	53.5
WP_000545250.1\|4887997_4888603_+	DNA integrity scanning protein DisA nucleotide-binding domain protein	NA	NA	NA	NA
WP_001028674.1\|4889016_4890270_-	hypothetical protein	NA	NA	NA	NA
WP_000537660.1\|4890285_4890708_-	divergent PAP2 family protein	NA	NA	NA	NA
WP_001183889.1\|4890719_4891064_-	EamA family transporter	NA	NA	NA	NA
WP_001206693.1\|4891166_4892054_-	decaprenyl-phosphate phosphoribosyltransferase	NA	NA	NA	NA
WP_000487953.1\|4892228_4893713_-	cytosol aminopeptidase	Q6GYZ8	Mycoplasma_phage	1.9e-58	36.6
WP_002094181.1\|4893858_4894485_-	3D domain-containing protein	A0A0H3UZG2	Geobacillus_virus	2.1e-14	43.0
WP_000027016.1\|4894570_4894888_-	YuiB family protein	NA	NA	NA	NA
WP_000517993.1\|4894884_4895391_-	NUDIX hydrolase	NA	NA	NA	NA
WP_000856603.1\|4895708_4896917_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_000829790.1\|4897379_4898369_+	NAD(P)/FAD-dependent oxidoreductase	Q9JRK7	Streptococcus_phage	3.0e-31	52.4
WP_000815781.1\|4898482_4908670_-	DUF11 domain-containing protein	NA	NA	NA	NA
WP_000606660.1\|4909134_4909614_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_000391931.1\|4909832_4911080_+	MFS transporter	NA	NA	NA	NA
WP_000535246.1\|4911097_4911979_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_000635489.1\|4912059_4912521_+	DUF523 domain-containing protein	NA	NA	NA	NA
WP_000710531.1\|4912843_4913671_+	hypothetical protein	A0A2H4J6G7	uncultured_Caudovirales_phage	1.8e-101	69.5
WP_000551103.1\|4913680_4914301_-	replication-relaxation family protein	H0USY2	Bacillus_phage	6.5e-109	93.2
WP_000891536.1\|4914242_4915424_-	cell division protein FtsK	H0USY1	Bacillus_phage	6.9e-216	94.7
WP_000170777.1\|4915539_4915722_-	hypothetical protein	Q2I8E2	Bacillus_phage	1.4e-22	90.0
WP_001257569.1\|4915718_4916036_-	hypothetical protein	H0USY0	Bacillus_phage	6.4e-52	98.1
WP_000649833.1\|4916218_4916416_+	helix-turn-helix transcriptional regulator	A0A288WG80	Bacillus_phage	3.4e-19	76.2
WP_001137905.1\|4916424_4916604_+	hypothetical protein	NA	NA	NA	NA
WP_000043397.1\|4916609_4917188_+	type IV secretory system conjugative DNA transfer family protein	H0USX9	Bacillus_phage	5.0e-95	88.0
WP_000119483.1\|4917241_4917580_+	hypothetical protein	A0A1B1P7R0	Bacillus_phage	2.1e-48	94.6
WP_000405778.1\|4918125_4918827_-	N-acetylmuramoyl-L-alanine amidase	W8CZ46	Bacillus_phage	1.7e-121	90.3
WP_000373913.1\|4918826_4919252_-\|holin	phage holin family protein	H0USX7	Bacillus_phage	1.2e-69	96.5
WP_000390482.1\|4919327_4919552_-	hemolysin XhlA family protein	A0A1B1P780	Bacillus_phage	8.3e-30	97.3
WP_001243323.1\|4919702_4920878_-\|plate	BppU family phage baseplate upper protein	A0A1B1P768	Bacillus_phage	4.6e-172	80.4
WP_000631942.1\|4920892_4923235_-\|tail	phage tail protein	A0A1C8E983	Bacillus_phage	0.0e+00	95.3
WP_000884123.1\|4923231_4923915_-\|tail	phage tail family protein	A0A1B0T6A0	Bacillus_phage	2.1e-124	96.0
WP_001119327.1\|4923915_4927308_-\|tail	phage tail tape measure protein	A0A1B0T698	Bacillus_phage	0.0e+00	92.1
WP_000113340.1\|4927551_4927938_-	hypothetical protein	A0A1C8E984	Bacillus_phage	3.6e-65	99.2
WP_000151366.1\|4927949_4928585_-	hypothetical protein	A0A1C8E980	Bacillus_phage	1.6e-115	99.1
WP_000157921.1\|4928596_4928974_-	HK97 gp10 family phage protein	A0A1C8E995	Bacillus_phage	2.5e-55	87.2
WP_001166633.1\|4928973_4929303_-	hypothetical protein	A0A1B0T6B7	Bacillus_phage	2.2e-55	96.3
WP_001126092.1\|4929292_4929625_-	hypothetical protein	A0A1B2APX8	Phage_Wrath	1.6e-53	96.4
WP_000342229.1\|4929602_4929863_-\|head,tail	phage gp6-like head-tail connector protein	A0A1B2APX3	Phage_Wrath	1.4e-41	96.5
WP_001049344.1\|4929864_4931169_-\|capsid	phage major capsid protein	A0A2H4JFZ3	uncultured_Caudovirales_phage	5.5e-198	91.1
WP_000687903.1\|4931170_4931752_-\|head,protease	HK97 family phage prohead protease	A0A1C8EA63	Bacillus_phage	1.4e-97	96.4
WP_000603760.1\|4931822_4932080_+	hypothetical protein	A0A1C8E966	Bacillus_phage	2.2e-26	70.6
WP_000524246.1\|4932248_4933421_-\|portal	phage portal protein	A0A1C8E972	Bacillus_phage	2.7e-220	99.2
WP_000587611.1\|4933436_4935161_-\|terminase	terminase large subunit	A0A1C8E985	Bacillus_phage	0.0e+00	94.3
WP_000113444.1\|4935157_4935583_-\|terminase	P27 family phage terminase small subunit	A0A1C8E969	Bacillus_phage	5.3e-70	94.3
WP_000872554.1\|4935665_4936058_-	HNH endonuclease	A0A1B1P7N1	Bacillus_phage	6.9e-72	96.2
WP_000627440.1\|4936054_4936369_-	Rho termination factor N-terminal domain-containing protein	A0A1B0T6C6	Bacillus_phage	1.4e-46	89.4
WP_000074276.1\|4936365_4936584_-	hypothetical protein	NA	NA	NA	NA
WP_000052395.1\|4936630_4936828_-	hypothetical protein	A0A1C8E9B9	Bacillus_phage	2.3e-23	83.1
WP_000930965.1\|4936885_4937110_-	hypothetical protein	H0USV5	Bacillus_phage	2.3e-32	91.9
WP_000895343.1\|4937394_4937784_-	hypothetical protein	A0A1C8E9D1	Bacillus_phage	9.9e-39	61.2
WP_102981940.1\|4937801_4937900_-	DUF3983 domain-containing protein	NA	NA	NA	NA
WP_000847100.1\|4938067_4938253_-	hypothetical protein	Q3HKX5	Bacillus_phage	5.1e-09	50.0
WP_001092478.1\|4938300_4938588_-	hypothetical protein	A0A0S2MVI8	Bacillus_phage	8.9e-45	92.6
WP_000726820.1\|4938813_4939212_-	hypothetical protein	A0A1B0T6B6	Bacillus_phage	1.0e-67	97.0
WP_000159772.1\|4939296_4940043_-	sigma-70 family RNA polymerase sigma factor	Q2I8C6	Bacillus_phage	8.2e-98	74.2
WP_000002743.1\|4940039_4940264_-	hypothetical protein	C7DTL1	Bacillus_phage	4.0e-24	72.6
WP_000532218.1\|4940263_4941145_-	ATP-binding protein	A0A1B1P7U2	Bacillus_phage	5.2e-27	32.6
WP_000040038.1\|4941156_4941930_-	conserved phage C-terminal domain-containing protein	A0A1W6JNI1	Staphylococcus_phage	4.9e-53	47.4
WP_000525424.1\|4942062_4942944_-	hypothetical protein	NA	NA	NA	NA
WP_000372558.1\|4942967_4943642_-	Rha family transcriptional regulator	A0A288WFT2	Bacillus_phage	4.6e-84	66.5
WP_000277642.1\|4943855_4944044_-	helix-turn-helix domain-containing protein	A0A1B2APY7	Phage_Wrath	3.4e-21	80.6
WP_000368215.1\|4944188_4944434_-	hypothetical protein	NA	NA	NA	NA
WP_001236353.1\|4944815_4946045_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	1.7e-84	48.5
WP_000004989.1\|4946414_4946744_+	helix-turn-helix transcriptional regulator	H0UST7	Bacillus_phage	9.6e-51	96.3
WP_001233256.1\|4947018_4947168_-	hypothetical protein	NA	NA	NA	NA
WP_000466634.1\|4947164_4948418_-	hypothetical protein	H0UST6	Bacillus_phage	1.7e-212	98.1
WP_000237488.1\|4949759_4950821_+\|integrase	site-specific integrase	A0A1B2AQ00	Phage_Wrath	4.6e-171	83.6
WP_000833148.1\|4950910_4951264_-	YxeA family protein	A0A0K2CYS5	Paenibacillus_phage	1.3e-13	40.2
WP_003272374.1\|4951370_4951556_-	methyltransferase	NA	NA	NA	NA
WP_000834607.1\|4951959_4952730_-	hypothetical protein	NA	NA	NA	NA
WP_001068189.1\|4953642_4954206_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000573830.1\|4954311_4954665_-	iron-sulfur cluster assembly accessory protein	A0A2H4N7M3	Lake_Baikal_phage	8.2e-16	42.3
WP_000077392.1\|4954706_4955573_-	diaminopimelate epimerase	NA	NA	NA	NA
WP_000595026.1\|4955819_4956059_-	YuzB family protein	NA	NA	NA	NA
WP_000682065.1\|4956411_4957482_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_001054089.1\|4957715_4957889_+	aspartyl-phosphate phosphatase Spo0E family protein	NA	NA	NA	NA
WP_000470295.1\|4957944_4958604_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.9e-22	35.7
WP_000679257.1\|4958587_4959385_+	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
WP_000212735.1\|4959626_4959968_-	alkylphosphonate utilization operon protein PhnA	NA	NA	NA	NA
WP_024927875.1\|4960127_4960409_-	hypothetical protein	NA	NA	NA	NA
WP_003272364.1\|4960478_4961276_-	DUF2628 domain-containing protein	NA	NA	NA	NA
WP_001019404.1\|4961602_4962280_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003272363.1\|4962378_4963173_-	nucleotidyltransferase domain-containing protein	NA	NA	NA	NA
WP_000248588.1\|4963225_4963534_-	YuzD family protein	NA	NA	NA	NA
WP_000431159.1\|4963729_4963966_+	NifU family protein	Q58MC7	Prochlorococcus_phage	2.0e-10	46.6
WP_001125507.1\|4964285_4964501_+	hypothetical protein	NA	NA	NA	NA
WP_000614216.1\|4964562_4965564_-\|coat	spore coat protein CotS	NA	NA	NA	NA
WP_000665103.1\|4965684_4966176_+	phosphatidylglycerophosphatase A	G3MBC5	Bacillus_virus	3.5e-41	53.8
WP_000351152.1\|4966199_4966679_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_001106075.1\|4966840_4967944_+	HpcH/HpaI aldolase/citrate lyase family protein	NA	NA	NA	NA
WP_000856291.1\|4967888_4969235_+	phosphoribosyltransferase family protein	NA	NA	NA	NA
WP_000241506.1\|4969240_4970353_+\|protease	cysteine protease StiP family protein	NA	NA	NA	NA
4972367:4972390	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. NC_020394

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

87750 : 98825

Bacillus_phage(91.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015413274.1\|87750_88869_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	4.4e-172	81.2
WP_001127274.1\|90018_90594_-	hypothetical protein	NA	NA	NA	NA
WP_000731447.1\|90914_91970_-	N-acetylmuramoyl-L-alanine amidase	A0A1B0T6C8	Bacillus_phage	2.0e-150	71.2
WP_000570185.1\|91966_92206_-	hypothetical protein	A0A0A7AR38	Bacillus_phage	2.7e-26	75.9
WP_000377827.1\|92205_92442_-	hemolysin XhlA family protein	A0A2H4J382	uncultured_Caudovirales_phage	3.0e-14	84.6
WP_000405795.1\|92632_93517_-	N-acetylmuramoyl-L-alanine amidase family protein	A0A0S2MVR5	Bacillus_phage	4.2e-77	52.4
WP_000159989.1\|93790_94612_-	M23 family metallopeptidase	A0A218KCJ1	Bacillus_phage	1.5e-28	43.8
WP_000025079.1\|94753_95722_-	lysozyme family protein	A0A223LKM8	Bacillus_phage	1.7e-31	41.7
WP_000460736.1\|95959_96346_-	DUF1492 domain-containing protein	A0A288WG73	Bacillus_phage	7.5e-47	70.6
WP_000510871.1\|96449_97346_-	DnaD domain protein	A0A1C8E9B4	Bacillus_phage	1.1e-77	63.5
WP_000527099.1\|97572_97809_-	helix-turn-helix transcriptional regulator	W8CYU0	Bacillus_phage	3.7e-12	60.0
WP_000579787.1\|97945_98374_+	helix-turn-helix transcriptional regulator	Q786F1	Bacillus_phage	2.1e-29	50.7
WP_000673773.1\|98396_98825_+	ImmA/IrrE family metallo-endopeptidase	Q9T201	Bacillus_phage	3.1e-33	54.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

6. NC_020384

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_020384_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_020384_1

179627-180314

TypeI

NA:I-C

Consensus_repeat	Method
TGTCGCACCTCATATAGGTGCGTGGATTGAAATACA	PILER-CR
GTCGCACCTCATATAGGTGCGTGGATTGAAAT	CRISPRCasFinder
GTCGCACCTNATATAGGTGCGTG	CRT

10 spacers

cas3,cas5,cas8c,cas7

The CRISPR arrays of NC_020384_1

>merge|NC_020384|1|179627-180314|PILER-CR,CRISPRCasFinder,CRT
TGTCGCACCTCATATAGGTGCGTGGATTGAAATACAAGATACGAGAATTTAATGACGTCACCCACATGTCGCACCTCATATAGGTGCGTGGATTGAAATTATTGTTACACCTTTAGAGTATCCGAGTAAAAAAGTCGCACCTCATATAGGTGCGTGGATTGAAATACAATGGGAAAGTGTTAGGTTATGCACGTTTTAAAGTCGCACCTCATATAGGTGCGTGAATTGAAATGAAGATAGTAGAAGAAATCAAAAAAAGTGTATGTCGCACCTTATATAGGTGTGTGAATTGAAATTTTGTTGCTCCAGTCGTTATGATCGTCTTTGCAGTCGCACTTTATATAGGTGCGTGGATTGAAATTAGGAGTTATTAATGGCTTTAGATGTTAGACCAGTCGCACCTTATATAGGTGTGAGGATTGAAATTACCTCGGGTTTATATTTATCTGGAATGCCCATAGTCGCACCCTATATAGGTGCGTGGATTGAAATTTTGCAACTAGCTCAATTGTTTTTCCGTTTTCAGTCGCACCTCATATAGGTGCATGGATTGAAATTACCTCGGGTTTATATTTATCTGGAACGCTCATAGTCGCACCTTAAATAGGTGTGTGGATTGAAATATAATATCACAATTTTGACAAAATTCAGTCATGATTGCACCTCATATAGGTGCTTGGATTGAAAT

>NC_020384|1|1|179627-179794|PILER-CR
TGTCGCACCTCATATAGGTGCGTGGATTGAAATACA	AGATACGAGAATTTAATGACGTCACCCACA
TGTCGCACCTCATATAGGTGCGTGGATTGAAATTAT	TGTTACACCTTTAGAGTATCCGAGTAAAAAAGT
CGCACCTCATATAGGTGCGTGGATTGAAATACA

>NC_020384|1|1|179628-180314|CRISPRCasFinder
GTCGCACCTCATATAGGTGCGTGGATTGAAAT	ACAAGATACGAGAATTTAATGACGTCACCCACAT
GTCGCACCTCATATAGGTGCGTGGATTGAAAT	TATTGTTACACCTTTAGAGTATCCGAGTAAAAAA
GTCGCACCTCATATAGGTGCGTGGATTGAAAT	ACAATGGGAAAGTGTTAGGTTATGCACGTTTTAAA
GTCGCACCTCATATAGGTGCGTGAATTGAAAT	GAAGATAGTAGAAGAAATCAAAAAAAGTGTAT
GTCGCACCTTATATAGGTGTGTGAATTGAAAT	TTTGTTGCTCCAGTCGTTATGATCGTCTTTGCA
GTCGCACTTTATATAGGTGCGTGGATTGAAAT	TAGGAGTTATTAATGGCTTTAGATGTTAGACCA
GTCGCACCTTATATAGGTGTGAGGATTGAAAT	TACCTCGGGTTTATATTTATCTGGAATGCCCATA
GTCGCACCCTATATAGGTGCGTGGATTGAAAT	TTTGCAACTAGCTCAATTGTTTTTCCGTTTTCA
GTCGCACCTCATATAGGTGCATGGATTGAAAT	TACCTCGGGTTTATATTTATCTGGAACGCTCATA
GTCGCACCTTAAATAGGTGTGTGGATTGAAAT	ATAATATCACAATTTTGACAAAATTCAGTCATG
ATTGCACCTCATATAGGTGCTTGGATTGAAAT

>NC_020384|1|1|179628-180305|CRT
GTCGCACCTCATATAGGTGCGTG	GATTGAAATACAAGATACGAGAATTTAATGACGTCACCCACAT
GTCGCACCTCATATAGGTGCGTG	GATTGAAATTATTGTTACACCTTTAGAGTATCCGAGTAAAAAA
GTCGCACCTCATATAGGTGCGTG	GATTGAAATACAATGGGAAAGTGTTAGGTTATGCACGTTTTAAA
GTCGCACCTCATATAGGTGCGTG	AATTGAAATGAAGATAGTAGAAGAAATCAAAAAAAGTGTAT
GTCGCACCTTATATAGGTGTGTG	AATTGAAATTTTGTTGCTCCAGTCGTTATGATCGTCTTTGCA
GTCGCACTTTATATAGGTGCGTG	GATTGAAATTAGGAGTTATTAATGGCTTTAGATGTTAGACCA
GTCGCACCTTATATAGGTGTGAG	GATTGAAATTACCTCGGGTTTATATTTATCTGGAATGCCCATA
GTCGCACCCTATATAGGTGCGTG	GATTGAAATTTTGCAACTAGCTCAATTGTTTTTCCGTTTTCA
GTCGCACCTCATATAGGTGCATG	GATTGAAATTACCTCGGGTTTATATTTATCTGGAACGCTCATA
GTCGCACCTTAAATAGGTGTGTG	GATTGAAATATAATATCACAATTTTGACAAAATTCAGTCATG
ATTGCACCTCATATAGGTGCTTG

Protein	Signature genes	Signature genes Name	Protein_function
NC_020384.1\|WP_000373088.1\|176174_177092_+\|hypothetical-protein	unknown	unknown	unknown
NC_020384.1\|WP_000114815.1\|191470_191698_+\|hypothetical-protein	unknown	unknown	unknown
NC_020384.1\|WP_000853368.1\|185614_186475_+\|type-I-C-CRISPR-associated-protein-Cas7/Csd2	cas7	COG3649_cas7_CAS-I-C	gnl\|CDD\|226175
NC_020384.1\|WP_000372481.1\|170179_171904_+\|hypothetical-protein	unknown	unknown	unknown
NC_020384.1\|WP_014481878.1\|180397_182767_+\|CRISPR-associated-helicase/endonuclease-Cas3	cas3	COG1203_cas3_CAS-I	gnl\|CDD\|224124
NC_020384.1\|WP_000459233.1\|172285_173095_-\|hypothetical-protein	unknown	unknown	unknown
NC_020384.1\|WP_000217299.1\|165192_165336_-\|hypothetical-protein	unknown	unknown	unknown
NC_020384.1\|WP_003319726.1\|182972_183692_+\|type-I-C-CRISPR-associated-protein-Cas5	cas5	cd09752_cas5_CAS-I-C	gnl\|CDD\|273847
NC_020384.1\|WP_000041871.1\|164104_165052_-\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271175
NC_020384.1\|WP_000610947.1\|175377_176160_+\|ImmA/IrrE-family-metallo-endopeptidase	unknown	unknown	gnl\|CDD\|368753
NC_020384.1\|WP_000520262.1\|166278_167988_-\|hypothetical-protein	unknown	unknown	unknown
NC_020384.1\|WP_001219637.1\|190363_191455_+\|methyltransferase	unknown	unknown	gnl\|CDD\|274377
NC_020384.1\|WP_000710813.1\|190121_190259_+\|hypothetical-protein	unknown	unknown	unknown
NC_020384.1\|WP_000118651.1\|183692_185612_+\|type-I-C-CRISPR-associated-protein-Cas8c/Csd1	cas8c	pfam09709_cas8c_CAS-I-C	gnl\|CDD\|187887
NC_020384.1\|WP_000372779.1\|168674_170144_+\|hypothetical-protein	unknown	unknown	unknown
NC_020384.1\|WP_000335059.1\|177501_179304_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|276809
NC_020384.1\|WP_071686409.1\|186981_187215_+\|type-I-CRISPR-associated-protein-Cas7	cas7	COG3649_cas7_CAS-I-C	gnl\|CDD\|226175
NC_020384.1\|WP_000724860.1\|174892_175285_+\|hypothetical-protein	unknown	unknown	unknown
NC_020384.1\|WP_000710696.1\|189674_190100_+\|hypothetical-protein	unknown	unknown	unknown
NC_020384.1\|WP_130055909.1\|186765_186930_+\|type-I-CRISPR-associated-protein-Cas7	cas7	COG3649_cas7_CAS-I-C	gnl\|CDD\|226175

Protein	Function_ID	Function_description	E-value
NC_020384.1\|WP_130055909.1\|186765_186930_+\|type-I-CRISPR-associated-protein-Cas7	gnl\|CDD\|226175	COG3649, COG3649, CRISPR system related protein [Defense mechanisms].	5.9384e-16
NC_020384.1\|WP_000118651.1\|183692_185612_+\|type-I-C-CRISPR-associated-protein-Cas8c/Csd1	gnl\|CDD\|187887	cd09757, Cas8c_I-C, CRISPR/Cas system-associated protein Cas8c. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Zn-finger domain containing protein, distant homologs of Cas8 proteins; signature gene for I-C subtype; also known as Csd1 family.	4.95792e-169
NC_020384.1\|WP_003319726.1\|182972_183692_+\|type-I-C-CRISPR-associated-protein-Cas5	gnl\|CDD\|273847	TIGR01876, cas_Cas5d, CRISPR-associated protein Cas5, subtype I-C/DVULG. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This small Cas family is represented by CT1134 of Chlorobium tepidum. This family belongs to a set of several Cas protein families, one each for a number of different CRISPR/Cas subtypes, that share a region of N-terminal sequence similarity modeled by TIGR02593. This family represents the Dvulg subtype of CRISPR/Cas locus.	1.61876e-96
NC_020384.1\|WP_014481878.1\|180397_182767_+\|CRISPR-associated-helicase/endonuclease-Cas3	gnl\|CDD\|224124	COG1203, COG1203, CRISPR-associated helicase Cas3 [Defense mechanisms].	2.06683e-76
NC_020384.1\|WP_001219637.1\|190363_191455_+\|methyltransferase	gnl\|CDD\|274377	TIGR02987, m6_adenine_and_m5_cytosine_DNA_methyltransferase, type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family. Members of this family are the m6-adenine DNA methyltransferase protein, or domain of a fusion protein that also carries m5 cytosine methyltransferase activity, of type II restriction systems of the Alw26I/Eco31I/Esp3I family. A methyltransferase of this family is alway accompanied by a type II restriction endonuclease from the Alw26I/Eco31I/Esp3I family (TIGR02986) and by an adenine-specific modification methyltransferase. Members of this family are unusual in that regions of similarity to homologs outside this family are circularly permuted. [DNA metabolism, Restriction/modification].	0.00066001
NC_020384.1\|WP_071686409.1\|186981_187215_+\|type-I-CRISPR-associated-protein-Cas7	gnl\|CDD\|226175	COG3649, COG3649, CRISPR system related protein [Defense mechanisms].	2.97546e-21
NC_020384.1\|WP_000335059.1\|177501_179304_+\|hypothetical-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	7.64325e-11
NC_020384.1\|WP_000853368.1\|185614_186475_+\|type-I-C-CRISPR-associated-protein-Cas7/Csd2	gnl\|CDD\|226175	COG3649, COG3649, CRISPR system related protein [Defense mechanisms].	1.09266e-135
NC_020384.1\|WP_000610947.1\|175377_176160_+\|ImmA/IrrE-family-metallo-endopeptidase	gnl\|CDD\|368753	pfam06114, Peptidase_M78, IrrE N-terminal-like domain. This entry includes the catalytic domain of the protein ImmA, which is a metallopeptidase containing an HEXXH zinc-binding motif from peptidase family M78. ImmA is encoded on a conjugative transposon. Conjugating bacteria are able to transfer conjugative transposons that can, for example, confer resistance to antibiotics. The transposon is integrated into the chromosome, but during conjugation excises itself and then moves to the recipient bacterium and re-integrate into its chromosome. Typically a conjugative tranposon encodes only the proteins required for this activity and the proteins that regulate it. During exponential growth, the ICEBs1 transposon of Bacillus subtilis is inactivated by the immunity repressor protein ImmR, which is encoded by the transposon and represses the genes for excision and transfer. Cleavage of ImmR relaxes repression and allows transfer of the transposon. ImmA has been shown to be essential for the cleavage of ImmR. This domain is also found in in metalloprotease IrrE, a central regulator of DNA damage repair in Deinococcaceae, HTH-type transcriptional regulators RamB and PrpC.	6.33521e-07
NC_020384.1\|WP_000041871.1\|164104_165052_-\|site-specific-integrase	gnl\|CDD\|271175	cd00397, DNA_BRE_C, DNA breaking-rejoining enzymes, C-terminal catalytic domain. The DNA breaking-rejoining enzyme superfamily includes type IB topoisomerases and tyrosine based site-specific recombinases (integrases) that share the same fold in their catalytic domain containing conserved active site residues. The best-studied members of this diverse superfamily include Human topoisomerase I, the bacteriophage lambda integrase, the bacteriophage P1 Cre recombinase, the yeast Flp recombinase, and the bacterial XerD/C recombinases. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. The enzymes differ in that topoisomerases cleave and then rejoin the same 5' and 3' termini, whereas a site-specific recombinase transfers a 5' hydroxyl generated by recombinase cleavage to a new 3' phosphate partner located in a different duplex region. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	1.04048e-15

>NC_020384.1|WP_000335059.1|177501_179304_+|hypothetical-protein
MCKCRVCETNNNDFHCNIAGDNICRNCCNDFQLRNFKDSWSGLVKLVKDEMEIYNISECCLKCKGLMRNQRVELTGDGSIINYGYNGKYVFNDMVDSYSYKFFNKKKIVLLESMNSLDITGVYDLAEGYYLLEEYEKAIDLLENLEGKDTDSKVLLLLGKVYFHANNLQAAIDCLLNSIKIHGDNSETYRILGEVYQADNNLINSAYYFNQAIKYFKIDAYDRPNDYFPQYSYLGLAVVYSKLNQHNEVIKSAEKFLESQYSWDTLVEMLYEQRSGEKNYIGFGGFFACATIYELMALSYLEKENLMLAEKYIDRAQELNPENTNIATTKGIIIGRKHNDGKISEYREQISSLRQNIELRASSINKLKTLRPEEQVKLFTGNEEESVWGFLVGKIFDNLKTIENLSPIVTPSQNKAAEEDRYTDLFKSHMDSNLVDTFGWITHTQSRGGYTRKEMGDRGGIGERDIVIRSHQNKDLLMGEALILKGKDTASIKTHTKKIFGYDIGNCNFHIIINWGFSEKPDSVWKDYRKLVISRQEGIYAVIENGETENLYPGINKQGIRTFYTKHSTDVENEVATAIHVYVDVLKQMKREGAELARKK
>NC_020384.1|WP_000373088.1|176174_177092_+|hypothetical-protein
MDQVTNTPETNQDSKCNGIEPYLQDGRKNDRVTHYYILDNNVLSDLAKLAREEQSSFKELMTCYKGTVFIVPEMVMEEAIRNLPGQQWVDEKYLNFYQVMSELHIPIYLESVEHNYQIFAEGYGSKEEAFLQYKEIALNSISNIAIQGELREAKSCKDIEKAYSQSLKDAGERFIFLYAHAMLQDKVNKISILSNEIKGVYNVWKANMRKGELLELVRVTSHEEYCEKLRPVSYNCILVNSLKKNPTLTSEQKKSLLQIMRDSKIIGRNVYYSQKSCNLVDTRADMNNEEFINFIEKHDDYKLAF
>NC_020384.1|WP_000610947.1|175377_176160_+|ImmA/IrrE-family-metallo-endopeptidase
MINSTNIREVIEQNQKILPSILVNVESTIEKGIHFKYKTIESIRNYLMQKTEVLLFPSKSLSYGGMVLYRNGSFYININTLQPKTYENFVWAHEYYHFEFEKDRIKNADDVTFVNNPVLNENERRANLFAAELLINDDVLKTLFQEIKLNYVNDSLEKNVIRLIPAFELPYKTMVIKLAQENLISMEDAERIIDHDYRHNLPQDFDLSILEPTKAIKIDGLNKLLESESVQENMLESDFESIQNLANQHFKQLEAIRMEI
>NC_020384.1|WP_000724860.1|174892_175285_+|hypothetical-protein
MKKIVGENIRIYLEATGRTHQWVMDKGGIPKATFYKLLKGEGDLTKGIEKINELFGIKDDFYFYNSEFKPPLKLEDKLKRSDIRNFAAANYVAVEGEETEFKNTLDTLDDFIRMIELLKPYNNLNRNDFI
>NC_020384.1|WP_000459233.1|172285_173095_-|hypothetical-protein
MFDFELELFNFYSKKLSKWNLVYKYVLKNIIFLVATFISIAALVIISLNIFVEHDIEFDSFYIYMIFFFVYMILFLVCMHYVVVKPAILISVNKYNISFKSKQWQVFICLIVQSYLFKKELLNNDPKFNEESLQFLIQVLKEKKEETEKLNVLKLLSSYGSLFFLFTIPVWSAFNSWVYNHEIKTSAEAIQYLLMLGFLIFMSVFLIWMPFKKNFLEELFSKESSKISDLIKALENINFSLKNFCHLKSEKSGVIKQSTIDSIIKENTN
>NC_020384.1|WP_000372481.1|170179_171904_+|hypothetical-protein
MDQLKQLFQSTLLVAYPLFQNIENNERIFNKWRGLCTLINSDVSYLEDPMYTSVSFKKFANWISYKESQGVGIMEIVAQIEGYRPEVFELLANDIEKEFEILLVKQKQEKKHTEEQQSFIEHSSAGFMYHLTDTIAKNNFTEDKELNAHIAELPDKSNSLVVVSSRFNDGDMKLRGAGELNRWNTLVDSTFVDRVMDDLTADCLDIVTEIWVKSASTESSPVHIGYEEILEMCSMKQVRNGKSYYRKEDRLKIMERLAALASIFIYVNEDNEIVILNDDENPNESLAYKKQRVRRLFVMDEIVFAKDIDTDEMLGIESMNVAPGTFLSKYLYGSEKLTGLLSKKALEYNSKQQRYHKRLTRYLSWRWRIQQAYQHLVHPYSIGGPKGLISVMGVSMNQNPARIRSVFEKTLDDLMRDEVIKEWQYQTPIDEGKCSGRNWLENYWLNLKVTVTPTDELVSLQQELLQKKKITPKNKLMETVVKDPVIEVQDMEIEEIQTSQLEQQQVNRDINWYQQKILQYKEENKCSLRDMAKEIEISPSNLSKLLIGKRKRLSEETHNKLDKWIERQEVVNLL
>NC_020384.1|WP_000372779.1|168674_170144_+|hypothetical-protein
MDQRIEEVNYKLIDNGIFFSVNKTQLARHFLNNVLEIDVCNLNKEEVTKIICEKYGYKLKQLPDEEEIYLFVAHNIMGIKEDKEPYECFNHEVFLVMKDLRKINFMIQEYESKQQVKDIDRYEKKKYQYLAEKLYKAKDVICEYMTGEINSCIYKEVKDWSKPNGFPSSGSFNQMLPSRYAFRGREEEYEMSVFDGLNYKFEFITLQERNELKLLHSNNKDEFNERVDRYIITHEIDNKILSLIEENHVLNKRGMLKQAIEIYKEDMMELFCQIIPLQIEGIIYDYCIELGVSSANIERTSLDRKIEEIVKKDRRFKCHEYFKYDFIELRNTAAHGRLHENVNFKDTANMLILDLMYLCDALNNSNALVVNRMRSLIKRFEENFNNDYVPIDGIVYSFIAKYRDKSLPSIYEKENVIQEIKKYAMSDNFLRYIHIHIMHPSLVSELSPEQKQEIKKIIVYLMRSKEIKERCVNLLKLLADNSKEELVHK
>NC_020384.1|WP_000520262.1|166278_167988_-|hypothetical-protein
MGKSFVIRNQRSLNGETTNAVLVTLKSWQKFVETFEEKYYSYKDTYLEDILQHMTYEERIADVEGFVEKAKPSFSRRAMSAIAEKTGRKHKLYGITNADLEVFLYLHKKCYTNGVIPNVTIHMMWEDYKQYKEELAYIQHSQFYIALKKLSLHNIISIENGLDGRYTIKLTHFINEETEKANPYVYISPVVFTKAFFKLSVAAKKLFLDIAMQQHTETTLKRSLDKQDERGNKTHFGGMYCFLHKKYPHQIRAVIEELTTALPCTGNPLFKICKMQKGVKHTKRYTTLYLSIHSDFLCSKEAGEEQHRDPFTPKATYARKAKFIEAVLQEMNIGELSADMNKFIHVLKHTCHRQIRSVIRGLRDMVDRKEGYPTKIVYTLKKLLHQTSQYQILDTAAKEGIYPLIAQHIPKERNSDREQAVFNFGLHYSMYSLHNIKKMFKNVHALLKQKFAVPVTEESYHRNYLKYQEETLFRKYAYDQGVNLHAYIALEIEMREKLKVRGHKERTIPSDVREWFIEAIDKLPQEKLRVIELPKQFNLLEFMRTFERLVRADVTITAPDQVLHAMETK
>NC_020384.1|WP_000217299.1|165192_165336_-|hypothetical-protein
MTVLKDTTYLDIDTYNEIRFFKGIFWGLVFVVPFWSIMITLFILLYR
>NC_020384.1|WP_000041871.1|164104_165052_-|site-specific-integrase
MSKNINLEETLAAFSAYLTEKGRKQSTIKRYAYDIKDFYKWLRENEKLLHIKSWRELSEADYQTYFSELEDKRKYSQKTRHRIWVVLKKVHMFLGIVSPLDGINFSLIPDQSLNDNDFITEMEEKLLKQTVLSTKGLTERQAKYRPLIMDRNVCIINLVVNYGLSLHELVSLNMSHIKFARNILMVPGENGATRSVFLTMEDTQQLYKYYKTIPEPVRPRQHTDNPLFVAFDFNRGTYRWVYEKDMPKALSEVAIQKMIRLEVKRAGLKRRISAQQMRNTFILRLIKQGVTEKDLVSRMGFKTKISLKRYYQYLQ
>NC_020384.1|WP_014481878.1|180397_182767_+|CRISPR-associated-helicase/endonuclease-Cas3
MTYIAHIRESDSQVQTVEEHLLRVKELAETYGEKIGIKHLAGLAGMLHDMGKYTNEFKEYILEAVNNPNSPPKKGSVDHSTAGGKLLYQLFHTENMIPYKGIISEIVGNAIISHHGYLQDFLNPDLESPYLNRVRDKQLRGFDVTQQFFFKHVMKEKDFHEYVDKATVELESFLLKESPENAEKQLMFLTKFIFSTLIDADRTNTRLFEEEKSVESVINVDELFEKYYERLMTKINSFKKQQNANTPINMLRADMSDQCDQFAERPSGIYTLSIPTGGGKTLASLRYALKHANTHNKKRIIYVVPFTTIIEQNAEEVRRILEDEENILEHHSNIVEEVNEHDENEDGVVSIQQKLKLAKDNWDSPIIFTTMVQFLNVFYAKGNRNTRRLHNLSEAIIIFDEVQKVPVSCVSLFNQALNFLKIYTRSSIVLCTATQPALDFVEQKLDINTDAEMINNLDHVIEAFKRVKIIDQATNEIFNKDKLKTFIHTKIEEVQSILIVLNTKSVVRDLYTQLQSQGLNIPIYHLSTTMCAAHRHKILEEVRECLKEGRKIICISTQLIEAGVDVSFECVVRSLSGLDYIAQAAGRCNRHGEKGIQNVYVIDYEEENLSHLKEIKIGKKITKKILMDLKHNDKIHGGHILSREAMKRYFKEYYREFESDLDYFIPKLKKNMTELLSVPRIENSYRRAYIHKHDKKDIPLFIINSYQTAAKHFNVIDDITTSVIVPYEEGKDIIAELNSNNSIEDLTRLLRKAQQYTVNVFNYEKEKLIINDGLVYYLDGKILALKESA
>NC_020384.1|WP_003319726.1|182972_183692_+|type-I-C-CRISPR-associated-protein-Cas5
MRNSIEFEVFGDYALFTDPLMKMGGEKLTYQVPTYQAIKGIVESIYWKPTLLMIVDKIRIMNAIKMESKGIRPIEYGGGNTLANYTYLKNVRYQVQAHFIFNHHRPDLAFDRNEYKHHNILKRSLKVGGRRDIFLGTRECQGYVEPCVFGEGEGFYDNYGGDIHLGTMVHGLNYPDETGRNELEVRLWNPVMRDGIIQFIRPEECTKIRKISKMDPKIFDSSNVESVDELIKQLEEGGE
>NC_020384.1|WP_000118651.1|183692_185612_+|type-I-C-CRISPR-associated-protein-Cas8c/Csd1
MSWLLNLYETYQSNLDRVGKIEKKYNGQEYTLLPISHTTQSANIEVLITEEGEFHSATVIDKSDANTLIPCTEDSASRSGTGAYKVPHPLHDKLTYVAGDFGEYGGSKKEEESFGYYIEHLRNWVESPYSTDKLKSIYKYLRKKQLVKDLVETKILWLDENQKLIGKWDKKVEVFLGNKPEIFTVLPAGQEAAFVRFTVYSPNKMLSKVWQDKEIHNSFINFYDGLLDNEDYCYVTGEIKPSTDKHAKKIRNASDQAKLISSNDLRGFTFRGRFTTSNEVANISYDVSQKAHNALKWLINKQGKIIDQRVFLVWGNDAEDVPDIVEDSYSIFSMDIRGTKKREIKSYTHEQFANEVAKAIDGYKNNLSSSENVNILLLDSATTGRLAVLYYRNMDKNLYLNRLKNWHSTCVWEHGYRKNADNEFVKFYGTPSTRDIAFAAYGPKANEKVVKSLMERMLPCIIDERKIPFDIVRSAFQRASNPLSMEKWEWEKTLSITCALINKMEGYQLVLDKENNNRDYLFGRLLAVADVLERKALNNGDQRATNARRYMNSFSQHPERTWRTIQGALQPYQARLGEKVWYYNKLIDEIGSMIKIEDFNNKPLSGKYLLGFYSQRHELYQKKEKNVSLNDVVNIGEEN
>NC_020384.1|WP_000853368.1|185614_186475_+|type-I-C-CRISPR-associated-protein-Cas7/Csd2
MKTLDHKIDFAVVLSVTKANPNGDPLNGNRPRQNYDGHGEISDVAIKRKIRNRLQDMEESIFVQSNDRKVDQFNSLRERAETNVDLVKALKSKDNPHEQFAAIACKEWIDVRSFGQVFAFKGGAGKGVSVGVRGPVSIHTATSVDPIDITSMQITKSVNSEPGKDKGSDTMGMKHRVDFGVYVFYGSINTQLAEKTGFTNEDAEKIKNALVTLFENDASAARPEGSIEVHKVCWWDHNSKLGQYSSAKVHRLLEVKRNIDEPKTIDDYTVLVHELDDLKVEIINGM
>NC_020384.1|WP_130055909.1|186765_186930_+|type-I-CRISPR-associated-protein-Cas7
MHTTTSVNPIDITSMQITKSVMSEPGKDKGSDTMGMKHGVDLGAYIFYGSIHMQ
>NC_020384.1|WP_071686409.1|186981_187215_+|type-I-CRISPR-associated-protein-Cas7
MVTLFGNDGSAARPEGSIEVHKVCWWKHNSKLGQYSSAKVHRLLDIKRNIDEPKIIDDYNILVKELDILKVAIIDGL
>NC_020384.1|WP_000710696.1|189674_190100_+|hypothetical-protein
MKKDCRHLRLVPTVEEHKTRIEANETYQQKSYATSTMSSETRGRLNQMRGCFEAEIILPVGKFQYFKPHAMNEKEAIQEIALFIEGIQEMNIGYVILWRFVGQQSFYSGTKIVAEPKFRKIMRKLKDYLFDYEELIYETEK
>NC_020384.1|WP_000710813.1|190121_190259_+|hypothetical-protein
MKKDKIWTVLDDPKEQETKEQSQEPDDIFAGMEELSEITDDELPF
>NC_020384.1|WP_001219637.1|190363_191455_+|methyltransferase
MRIGNDLAAGYYPTPLLEGKHLIQLLQMEPERVYACFDPCCGEGTILRSFADEVRQVSIQIDTYGVEVDANRYGKAKEQLDEVVCSDFESMMISHDYFPLIFLNPPYNTELRTENTKSEKMEFNFLKRAHLYLQDGGIMVYVIPYDKFARDDISYFIAKHYEEIGLMRFGDENEEFEQFKQCVFIGRKRAATKNDTYFNDRFANFCENMSDLSFVKKHVNTLAEMVNRKDWAIPELRHQNKLIFTSRVDYKSAYEGVGKSEGISSFKKRLNRGNGYSLQGEKTAAERAKMPIASGQLGLLLITGVADGLLGEGDTLHAVRGSENVYYETSFEPLQKTTKEVVLQKRRAKFIIATPTGEVKELV
>NC_020384.1|WP_000114815.1|191470_191698_+|hypothetical-protein
MSVLLGIGALFIVWEFSNRMFRIAIVLTVICLCASQLGAGTYLEVLEQFSAFQGAGNMLHAAEQSLPEWKQFIDF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_020384_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_020384_2

187288-187714

TypeI

NA:I-C

Consensus_repeat	Method
GTCGCACCTNNTNTAGGTGCGTGGATTGAAAT	CRT
TAGTAGGTGCGTGGATTGAAATAT	CRISPRCasFinder
AGTCGCACCTTATATAGGTGCGTGGATTGAAATAT	PILER-CR

6 spacers

cas7,cas8c,cas5,cas3,RT

The CRISPR arrays of NC_020384_2

>merge|NC_020384|2|187288-187714|CRT,CRISPRCasFinder,PILER-CR
GTCGTACCTCTTGTAGGTACGTGGATTGAAATCATTGGCGGTAGTTCATAAGTAACAACAAATGGATGTCGCACCTCTAGTAGGTGCGTGGATTGAAATATGATATTCAAAGAGCCTGAACAAGTGGAATCGAGTCGCACCTTATATAGGTGCGTGGATTGAAATATAATTGAATATGAGCTGCCGCCGATGGAAGGGACGTCGCACCTTATATAGGTGTGTAGATTGAAATATGGAAATGGAACGTTCTTACGGATCAAAAGAAGTCGCACCTTATATGGGTGCGTGGATTGAAATATGTAGCTGGTATTAATGCTTTGTGAAAAACAAGTCGCACCTTATATAGGTGCATGGATTGAAATTAAATTACTTGCTGCCTTATCTAGATTACTTTCGTCGCATCTCTTGTAGGTGTATGGAGTAAGAC

>NC_020384|2|2|187288-187714|CRT
GTCGTACCTCTTGTAGGTACGTGGATTGAAAT	CATTGGCGGTAGTTCATAAGTAACAACAAATGGAT
GTCGCACCTCTAGTAGGTGCGTGGATTGAAAT	ATGATATTCAAAGAGCCTGAACAAGTGGAATCGA
GTCGCACCTTATATAGGTGCGTGGATTGAAAT	ATAATTGAATATGAGCTGCCGCCGATGGAAGGGAC
GTCGCACCTTATATAGGTGTGTAGATTGAAAT	ATGGAAATGGAACGTTCTTACGGATCAAAAGAA
GTCGCACCTTATATGGGTGCGTGGATTGAAAT	ATGTAGCTGGTATTAATGCTTTGTGAAAAACAA
GTCGCACCTTATATAGGTGCATGGATTGAAAT	TAAATTACTTGCTGCCTTATCTAGATTACTTTC
GTCGCATCTCTTGTAGGTGTATGGAGTAAGAC

>NC_020384|2|2|187298-187651|CRISPRCasFinder
TTGTAGGTACGTGGATTGAAATCA	TTGGCGGTAGTTCATAAGTAACAACAAATGGATGTCGCACCTC
TAGTAGGTGCGTGGATTGAAATAT	GATATTCAAAGAGCCTGAACAAGTGGAATCGAGTCGCACCTT
ATATAGGTGCGTGGATTGAAATAT	AATTGAATATGAGCTGCCGCCGATGGAAGGGACGTCGCACCTT
ATATAGGTGTGTAGATTGAAATAT	GGAAATGGAACGTTCTTACGGATCAAAAGAAGTCGCACCTT
ATATGGGTGCGTGGATTGAAATAT	GTAGCTGGTATTAATGCTTTGTGAAAAACAAGTCGCACCTT
ATATAGGTGCATGGATTGAAATTA

>NC_020384|2|2|187420-187651|PILER-CR
AGTCGCACCTTATATAGGTGCGTGGATTGAAATAT	AATTGAATATGAGCTGCCGCCGATGGAAGGGA
CGTCGCACCTTATATAGGTGTGTAGATTGAAATAT	GGAAATGGAACGTTCTTACGGATCAAAAGA
AGTCGCACCTTATATGGGTGCGTGGATTGAAATAT	GTAGCTGGTATTAATGCTTTGTGAAAAACA
AGTCGCACCTTATATAGGTGCATGGATTGAAATTA

Protein	Signature genes	Signature genes Name	Protein_function
NC_020384.1\|WP_000373088.1\|176174_177092_+\|hypothetical-protein	unknown	unknown	unknown
NC_020384.1\|WP_000114815.1\|191470_191698_+\|hypothetical-protein	unknown	unknown	unknown
NC_020384.1\|WP_003319726.1\|182972_183692_+\|type-I-C-CRISPR-associated-protein-Cas5	cas5	cd09752_cas5_CAS-I-C	gnl\|CDD\|273847
NC_020384.1\|WP_014481878.1\|180397_182767_+\|CRISPR-associated-helicase/endonuclease-Cas3	cas3	COG1203_cas3_CAS-I	gnl\|CDD\|224124
NC_020384.1\|WP_001219637.1\|190363_191455_+\|methyltransferase	unknown	unknown	gnl\|CDD\|274377
NC_020384.1\|WP_103653709.1\|195567_197970_+\|DEAD/DEAH-box-helicase	unknown	unknown	gnl\|CDD\|223627
NC_020384.1\|WP_000724860.1\|174892_175285_+\|hypothetical-protein	unknown	unknown	unknown
NC_020384.1\|WP_000853368.1\|185614_186475_+\|type-I-C-CRISPR-associated-protein-Cas7/Csd2	cas7	COG3649_cas7_CAS-I-C	gnl\|CDD\|226175
NC_020384.1\|WP_078405438.1\|200351_200930_-\|hypothetical-protein	unknown	unknown	unknown
NC_020384.1\|WP_000494364.1\|197986_198700_+\|hypothetical-protein	unknown	unknown	unknown
NC_020384.1\|WP_000817905.1\|199665_200301_+\|hypothetical-protein	unknown	unknown	unknown
NC_020384.1\|WP_000654328.1\|193424_195290_+\|group-II-intron-reverse-transcriptase/maturase	RT	pfam00078_RT_CAS-I:CAS-III	gnl\|CDD\|275209
NC_020384.1\|WP_000710813.1\|190121_190259_+\|hypothetical-protein	unknown	unknown	unknown
NC_020384.1\|WP_000118651.1\|183692_185612_+\|type-I-C-CRISPR-associated-protein-Cas8c/Csd1	cas8c	pfam09709_cas8c_CAS-I-C	gnl\|CDD\|187887
NC_020384.1\|WP_001024816.1\|199036_199666_+\|hypothetical-protein	unknown	unknown	unknown
NC_020384.1\|WP_000335059.1\|177501_179304_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|276809
NC_020384.1\|WP_071686409.1\|186981_187215_+\|type-I-CRISPR-associated-protein-Cas7	cas7	COG3649_cas7_CAS-I-C	gnl\|CDD\|226175
NC_020384.1\|WP_000610947.1\|175377_176160_+\|ImmA/IrrE-family-metallo-endopeptidase	unknown	unknown	gnl\|CDD\|368753
NC_020384.1\|WP_000710696.1\|189674_190100_+\|hypothetical-protein	unknown	unknown	unknown
NC_020384.1\|WP_130055909.1\|186765_186930_+\|type-I-CRISPR-associated-protein-Cas7	cas7	COG3649_cas7_CAS-I-C	gnl\|CDD\|226175

Protein	Function_ID	Function_description	E-value
NC_020384.1\|WP_000654328.1\|193424_195290_+\|group-II-intron-reverse-transcriptase/maturase	gnl\|CDD\|275209	TIGR04416, hypothetical_protein, group II intron reverse transcriptase/maturase. Members of this protein family are multifunctional proteins encoded in most examples of bacterial group II introns. These group II introns are mobile selfish genetic elements, often with multiple highly identical copies per genome. Member proteins have an N-terminal reverse transcriptase (RNA-directed DNA polymerase) domain (pfam00078) followed by an RNA-binding maturase domain (pfam08388). Some members of this family may have an additional C-terminal DNA endonuclease domain that this model does not cover. A region of the group II intron ribozyme structure should be detectable nearby on the genome by Rfam model RF00029. [Mobile and extrachromosomal element functions, Other].	4.217e-121
NC_020384.1\|WP_000853368.1\|185614_186475_+\|type-I-C-CRISPR-associated-protein-Cas7/Csd2	gnl\|CDD\|226175	COG3649, COG3649, CRISPR system related protein [Defense mechanisms].	1.09266e-135
NC_020384.1\|WP_000118651.1\|183692_185612_+\|type-I-C-CRISPR-associated-protein-Cas8c/Csd1	gnl\|CDD\|187887	cd09757, Cas8c_I-C, CRISPR/Cas system-associated protein Cas8c. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Zn-finger domain containing protein, distant homologs of Cas8 proteins; signature gene for I-C subtype; also known as Csd1 family.	4.95792e-169
NC_020384.1\|WP_001219637.1\|190363_191455_+\|methyltransferase	gnl\|CDD\|274377	TIGR02987, m6_adenine_and_m5_cytosine_DNA_methyltransferase, type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family. Members of this family are the m6-adenine DNA methyltransferase protein, or domain of a fusion protein that also carries m5 cytosine methyltransferase activity, of type II restriction systems of the Alw26I/Eco31I/Esp3I family. A methyltransferase of this family is alway accompanied by a type II restriction endonuclease from the Alw26I/Eco31I/Esp3I family (TIGR02986) and by an adenine-specific modification methyltransferase. Members of this family are unusual in that regions of similarity to homologs outside this family are circularly permuted. [DNA metabolism, Restriction/modification].	0.00066001
NC_020384.1\|WP_000335059.1\|177501_179304_+\|hypothetical-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	7.64325e-11
NC_020384.1\|WP_014481878.1\|180397_182767_+\|CRISPR-associated-helicase/endonuclease-Cas3	gnl\|CDD\|224124	COG1203, COG1203, CRISPR-associated helicase Cas3 [Defense mechanisms].	2.06683e-76
NC_020384.1\|WP_003319726.1\|182972_183692_+\|type-I-C-CRISPR-associated-protein-Cas5	gnl\|CDD\|273847	TIGR01876, cas_Cas5d, CRISPR-associated protein Cas5, subtype I-C/DVULG. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This small Cas family is represented by CT1134 of Chlorobium tepidum. This family belongs to a set of several Cas protein families, one each for a number of different CRISPR/Cas subtypes, that share a region of N-terminal sequence similarity modeled by TIGR02593. This family represents the Dvulg subtype of CRISPR/Cas locus.	1.61876e-96
NC_020384.1\|WP_071686409.1\|186981_187215_+\|type-I-CRISPR-associated-protein-Cas7	gnl\|CDD\|226175	COG3649, COG3649, CRISPR system related protein [Defense mechanisms].	2.97546e-21
NC_020384.1\|WP_000610947.1\|175377_176160_+\|ImmA/IrrE-family-metallo-endopeptidase	gnl\|CDD\|368753	pfam06114, Peptidase_M78, IrrE N-terminal-like domain. This entry includes the catalytic domain of the protein ImmA, which is a metallopeptidase containing an HEXXH zinc-binding motif from peptidase family M78. ImmA is encoded on a conjugative transposon. Conjugating bacteria are able to transfer conjugative transposons that can, for example, confer resistance to antibiotics. The transposon is integrated into the chromosome, but during conjugation excises itself and then moves to the recipient bacterium and re-integrate into its chromosome. Typically a conjugative tranposon encodes only the proteins required for this activity and the proteins that regulate it. During exponential growth, the ICEBs1 transposon of Bacillus subtilis is inactivated by the immunity repressor protein ImmR, which is encoded by the transposon and represses the genes for excision and transfer. Cleavage of ImmR relaxes repression and allows transfer of the transposon. ImmA has been shown to be essential for the cleavage of ImmR. This domain is also found in in metalloprotease IrrE, a central regulator of DNA damage repair in Deinococcaceae, HTH-type transcriptional regulators RamB and PrpC.	6.33521e-07
NC_020384.1\|WP_103653709.1\|195567_197970_+\|DEAD/DEAH-box-helicase	gnl\|CDD\|223627	COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair].	1.89065e-07
NC_020384.1\|WP_130055909.1\|186765_186930_+\|type-I-CRISPR-associated-protein-Cas7	gnl\|CDD\|226175	COG3649, COG3649, CRISPR system related protein [Defense mechanisms].	5.9384e-16

>NC_020384.1|WP_071686409.1|186981_187215_+|type-I-CRISPR-associated-protein-Cas7
MVTLFGNDGSAARPEGSIEVHKVCWWKHNSKLGQYSSAKVHRLLDIKRNIDEPKIIDDYNILVKELDILKVAIIDGL
>NC_020384.1|WP_130055909.1|186765_186930_+|type-I-CRISPR-associated-protein-Cas7
MHTTTSVNPIDITSMQITKSVMSEPGKDKGSDTMGMKHGVDLGAYIFYGSIHMQ
>NC_020384.1|WP_000853368.1|185614_186475_+|type-I-C-CRISPR-associated-protein-Cas7/Csd2
MKTLDHKIDFAVVLSVTKANPNGDPLNGNRPRQNYDGHGEISDVAIKRKIRNRLQDMEESIFVQSNDRKVDQFNSLRERAETNVDLVKALKSKDNPHEQFAAIACKEWIDVRSFGQVFAFKGGAGKGVSVGVRGPVSIHTATSVDPIDITSMQITKSVNSEPGKDKGSDTMGMKHRVDFGVYVFYGSINTQLAEKTGFTNEDAEKIKNALVTLFENDASAARPEGSIEVHKVCWWDHNSKLGQYSSAKVHRLLEVKRNIDEPKTIDDYTVLVHELDDLKVEIINGM
>NC_020384.1|WP_000118651.1|183692_185612_+|type-I-C-CRISPR-associated-protein-Cas8c/Csd1
MSWLLNLYETYQSNLDRVGKIEKKYNGQEYTLLPISHTTQSANIEVLITEEGEFHSATVIDKSDANTLIPCTEDSASRSGTGAYKVPHPLHDKLTYVAGDFGEYGGSKKEEESFGYYIEHLRNWVESPYSTDKLKSIYKYLRKKQLVKDLVETKILWLDENQKLIGKWDKKVEVFLGNKPEIFTVLPAGQEAAFVRFTVYSPNKMLSKVWQDKEIHNSFINFYDGLLDNEDYCYVTGEIKPSTDKHAKKIRNASDQAKLISSNDLRGFTFRGRFTTSNEVANISYDVSQKAHNALKWLINKQGKIIDQRVFLVWGNDAEDVPDIVEDSYSIFSMDIRGTKKREIKSYTHEQFANEVAKAIDGYKNNLSSSENVNILLLDSATTGRLAVLYYRNMDKNLYLNRLKNWHSTCVWEHGYRKNADNEFVKFYGTPSTRDIAFAAYGPKANEKVVKSLMERMLPCIIDERKIPFDIVRSAFQRASNPLSMEKWEWEKTLSITCALINKMEGYQLVLDKENNNRDYLFGRLLAVADVLERKALNNGDQRATNARRYMNSFSQHPERTWRTIQGALQPYQARLGEKVWYYNKLIDEIGSMIKIEDFNNKPLSGKYLLGFYSQRHELYQKKEKNVSLNDVVNIGEEN
>NC_020384.1|WP_003319726.1|182972_183692_+|type-I-C-CRISPR-associated-protein-Cas5
MRNSIEFEVFGDYALFTDPLMKMGGEKLTYQVPTYQAIKGIVESIYWKPTLLMIVDKIRIMNAIKMESKGIRPIEYGGGNTLANYTYLKNVRYQVQAHFIFNHHRPDLAFDRNEYKHHNILKRSLKVGGRRDIFLGTRECQGYVEPCVFGEGEGFYDNYGGDIHLGTMVHGLNYPDETGRNELEVRLWNPVMRDGIIQFIRPEECTKIRKISKMDPKIFDSSNVESVDELIKQLEEGGE
>NC_020384.1|WP_014481878.1|180397_182767_+|CRISPR-associated-helicase/endonuclease-Cas3
MTYIAHIRESDSQVQTVEEHLLRVKELAETYGEKIGIKHLAGLAGMLHDMGKYTNEFKEYILEAVNNPNSPPKKGSVDHSTAGGKLLYQLFHTENMIPYKGIISEIVGNAIISHHGYLQDFLNPDLESPYLNRVRDKQLRGFDVTQQFFFKHVMKEKDFHEYVDKATVELESFLLKESPENAEKQLMFLTKFIFSTLIDADRTNTRLFEEEKSVESVINVDELFEKYYERLMTKINSFKKQQNANTPINMLRADMSDQCDQFAERPSGIYTLSIPTGGGKTLASLRYALKHANTHNKKRIIYVVPFTTIIEQNAEEVRRILEDEENILEHHSNIVEEVNEHDENEDGVVSIQQKLKLAKDNWDSPIIFTTMVQFLNVFYAKGNRNTRRLHNLSEAIIIFDEVQKVPVSCVSLFNQALNFLKIYTRSSIVLCTATQPALDFVEQKLDINTDAEMINNLDHVIEAFKRVKIIDQATNEIFNKDKLKTFIHTKIEEVQSILIVLNTKSVVRDLYTQLQSQGLNIPIYHLSTTMCAAHRHKILEEVRECLKEGRKIICISTQLIEAGVDVSFECVVRSLSGLDYIAQAAGRCNRHGEKGIQNVYVIDYEEENLSHLKEIKIGKKITKKILMDLKHNDKIHGGHILSREAMKRYFKEYYREFESDLDYFIPKLKKNMTELLSVPRIENSYRRAYIHKHDKKDIPLFIINSYQTAAKHFNVIDDITTSVIVPYEEGKDIIAELNSNNSIEDLTRLLRKAQQYTVNVFNYEKEKLIINDGLVYYLDGKILALKESA
>NC_020384.1|WP_000335059.1|177501_179304_+|hypothetical-protein
MCKCRVCETNNNDFHCNIAGDNICRNCCNDFQLRNFKDSWSGLVKLVKDEMEIYNISECCLKCKGLMRNQRVELTGDGSIINYGYNGKYVFNDMVDSYSYKFFNKKKIVLLESMNSLDITGVYDLAEGYYLLEEYEKAIDLLENLEGKDTDSKVLLLLGKVYFHANNLQAAIDCLLNSIKIHGDNSETYRILGEVYQADNNLINSAYYFNQAIKYFKIDAYDRPNDYFPQYSYLGLAVVYSKLNQHNEVIKSAEKFLESQYSWDTLVEMLYEQRSGEKNYIGFGGFFACATIYELMALSYLEKENLMLAEKYIDRAQELNPENTNIATTKGIIIGRKHNDGKISEYREQISSLRQNIELRASSINKLKTLRPEEQVKLFTGNEEESVWGFLVGKIFDNLKTIENLSPIVTPSQNKAAEEDRYTDLFKSHMDSNLVDTFGWITHTQSRGGYTRKEMGDRGGIGERDIVIRSHQNKDLLMGEALILKGKDTASIKTHTKKIFGYDIGNCNFHIIINWGFSEKPDSVWKDYRKLVISRQEGIYAVIENGETENLYPGINKQGIRTFYTKHSTDVENEVATAIHVYVDVLKQMKREGAELARKK
>NC_020384.1|WP_000373088.1|176174_177092_+|hypothetical-protein
MDQVTNTPETNQDSKCNGIEPYLQDGRKNDRVTHYYILDNNVLSDLAKLAREEQSSFKELMTCYKGTVFIVPEMVMEEAIRNLPGQQWVDEKYLNFYQVMSELHIPIYLESVEHNYQIFAEGYGSKEEAFLQYKEIALNSISNIAIQGELREAKSCKDIEKAYSQSLKDAGERFIFLYAHAMLQDKVNKISILSNEIKGVYNVWKANMRKGELLELVRVTSHEEYCEKLRPVSYNCILVNSLKKNPTLTSEQKKSLLQIMRDSKIIGRNVYYSQKSCNLVDTRADMNNEEFINFIEKHDDYKLAF
>NC_020384.1|WP_000610947.1|175377_176160_+|ImmA/IrrE-family-metallo-endopeptidase
MINSTNIREVIEQNQKILPSILVNVESTIEKGIHFKYKTIESIRNYLMQKTEVLLFPSKSLSYGGMVLYRNGSFYININTLQPKTYENFVWAHEYYHFEFEKDRIKNADDVTFVNNPVLNENERRANLFAAELLINDDVLKTLFQEIKLNYVNDSLEKNVIRLIPAFELPYKTMVIKLAQENLISMEDAERIIDHDYRHNLPQDFDLSILEPTKAIKIDGLNKLLESESVQENMLESDFESIQNLANQHFKQLEAIRMEI
>NC_020384.1|WP_000724860.1|174892_175285_+|hypothetical-protein
MKKIVGENIRIYLEATGRTHQWVMDKGGIPKATFYKLLKGEGDLTKGIEKINELFGIKDDFYFYNSEFKPPLKLEDKLKRSDIRNFAAANYVAVEGEETEFKNTLDTLDDFIRMIELLKPYNNLNRNDFI
>NC_020384.1|WP_000710696.1|189674_190100_+|hypothetical-protein
MKKDCRHLRLVPTVEEHKTRIEANETYQQKSYATSTMSSETRGRLNQMRGCFEAEIILPVGKFQYFKPHAMNEKEAIQEIALFIEGIQEMNIGYVILWRFVGQQSFYSGTKIVAEPKFRKIMRKLKDYLFDYEELIYETEK
>NC_020384.1|WP_000710813.1|190121_190259_+|hypothetical-protein
MKKDKIWTVLDDPKEQETKEQSQEPDDIFAGMEELSEITDDELPF
>NC_020384.1|WP_001219637.1|190363_191455_+|methyltransferase
MRIGNDLAAGYYPTPLLEGKHLIQLLQMEPERVYACFDPCCGEGTILRSFADEVRQVSIQIDTYGVEVDANRYGKAKEQLDEVVCSDFESMMISHDYFPLIFLNPPYNTELRTENTKSEKMEFNFLKRAHLYLQDGGIMVYVIPYDKFARDDISYFIAKHYEEIGLMRFGDENEEFEQFKQCVFIGRKRAATKNDTYFNDRFANFCENMSDLSFVKKHVNTLAEMVNRKDWAIPELRHQNKLIFTSRVDYKSAYEGVGKSEGISSFKKRLNRGNGYSLQGEKTAAERAKMPIASGQLGLLLITGVADGLLGEGDTLHAVRGSENVYYETSFEPLQKTTKEVVLQKRRAKFIIATPTGEVKELV
>NC_020384.1|WP_000114815.1|191470_191698_+|hypothetical-protein
MSVLLGIGALFIVWEFSNRMFRIAIVLTVICLCASQLGAGTYLEVLEQFSAFQGAGNMLHAAEQSLPEWKQFIDF
>NC_020384.1|WP_000654328.1|193424_195290_+|group-II-intron-reverse-transcriptase/maturase
MKDNKQFPQNEKELKLALDSMYRIAKESSKPFYNLIELMKNEQTILTAIHNIKGNKGSKTAGTDGKTMDYYLQMGRDKLMSLIRRNINNYQPSPVRRKYIPKSNGKQRPLGIPNMIDRIIQEIAKIVIEPIAEAKFYHYSFGFRPMRSAEQAIAETLERIRRSKTYWVIEGDIKGYFDNINHNKLIEIMWKIGIRDKRVLMMIKKMLKAGIMEEGKVRDNVSGSPQGGIISPLLANIYLNYFDWEIARMFQEHPARYKVKDVSRNGLQRVRQRHEDTFLIRYADDWVILCKSEGNAKRILKKVEKYFNHQLKLELSKEKTLITDVRTNRVNFLGFWIFAEEHRLRKGNIQGKAIPNMDKAKLKIKEINKNIKTLYDHRGNKSKQVAIIESINSKIVGIANYYKIANVSTIFQGFDKRIHYAQWRTWLFMNNRRGRYYQLTTPADTLLNRRDRHKEQKSKVFFIEEHGAKVGITKFAFTPKRNAMKVNLLMSPYTDNGRSIYKRTTGKREALERPNFFQEEIPFYQLNNRYPIYNFEFYLNREYAFNRDRGKCNCCKVQLNEWNLNTHHKNPKLPLNKVNKVINLVSLCKTCHKLVHNENPVTNTKGGKKIEQLRKLLKEVK
>NC_020384.1|WP_103653709.1|195567_197970_+|DEAD/DEAH-box-helicase
MTAAVDGYFHLKGKKGYRTCVFVPPTLTEKWAKEEIRHLLPDAEIHLIKRTEDLIRIHQAWIQAGRPKPQKPTFFVISFTTMRGDSIKMMPLSYKQTPLSKKSEEEVQRYYKNGYYCSDCGAKLRKKTSSIMVQQANGEQKEVCQYKDFTASDLDTKTNKNSVCADCNSNIWSPKVKTKYASFKEWTKYEEQLVQAIKEGNKPLQKQLELENRVKPYDAKHSGRAYRKVAAVEYIRRKMKHFFDVLIADEIHELKSESAQGTALGSLAKVCKKVVAGTGTLFGGRASDVFYTLWRLFPQKMVKSGFEYSSFMEWNETYGNIERTYYHDGEVTSNIASRGAQGTLDKTKVVPGISPYVFTQFLMDTTINVRLKDVWPNPVELVNVPTILVDMSEEQKQAYEHMKESFEKAIEAAKGTPDAGKLWLSYIRTGNAYPDNMIHYPNYYLDDAGKELVWSNDKFKFDEDCIQPKERELQSILRTEISEGRPTIVYVCDTGSTVKERDVQPRLQKVVEQISGAKVAILRTNTVTPPKRSEWLKDQVNSGVNVIICSLELVKVGLDLLATPTLIFYQLPFSLFALNQAARRHCRIGQTKQCRTFYLGYRETFQQQMAQLIAQKNKAAEAMNGEVTSDGLNAMLGDTGDLQTLLIQNIKSGNQLKGSTEEWTKAASDESKRVLANIGNVITPVFESIEIQFTNWVGKLPGTMDVAFMKEVQFVQRAVECIKKEQVPGVRVKKNVLEIAGEIEDVIRALTTLNTDKRMLVQKQDITFWDSVIVEVDSSKKKGKRKNKVIDGQFEFDLFG
>NC_020384.1|WP_000494364.1|197986_198700_+|hypothetical-protein
MFTKIFIGLFCYVFLVVRNSKKKFLMEEAKKKEMENKPVERPVYWCPRENKPIGREQERVTVPTKEITLEKDVASIYDLVATSVHKNLGEEESDRLKHEDIEEVEYAEDFHHTPTPEAVYDIPFPSDEDIPVELLEYEDMYPQQEYVSIPPETEHVFSVQQGVADVEDMDFVRWTAKVIEQEQGLTRVINMSNKKRYWIHTEGEILPKNQLLYMKLEVNSPYSYTLVEWSNRQLGNI
>NC_020384.1|WP_001024816.1|199036_199666_+|hypothetical-protein
MNINSISNNVVEKLEQTVRYEKKQVQVLRVSKSSSNIHAYMIFPEFSEVKISNTELDEYIENLSTSVKYVIDRKLSQQEIEKQNHSFIMTCEVEEDGVIDDETIHFNTTYVKPPTIANKVFKLVCGLGNRLDSLKELHITVLNNNINRIEIEFYNENETYVAVEKEEIANAIMGAYTKANIYYAADLYYAAEGNEIKLKSIKPKLAGDV
>NC_020384.1|WP_000817905.1|199665_200301_+|hypothetical-protein
MKREKGMIGVLCTLVLMILLLVPLEAAQASVKVDFNELKGNDVSSSFKDGLNNRMKTTEKEDSFGSSIIQKIEGLYAPAFKVGVNIFSISFVLGVIVMVMALITKNGQWMKWATGSMIFSFISMMSMRLSVYFLFSSDVFSFMNIFTDFLDLFKATALIFTPFMLIAGIRLRRIHESTKQPEYYRWANRVITGSCLLCMLAVLAPWLFANM
>NC_020384.1|WP_078405438.1|200351_200930_-|hypothetical-protein
MLEHTILFSLVQLVPLIVSTGIIYILLELTDTEWKTWFSYEGIFVIIFLITRFQVFQNKKSIISLNQHEKWFSKLNIFLISIFLVLFASIPTLLKIAFILQMTVILFLLEYLCLYINRLPTHNLYRVKEIICDKKQLKIERIIPNNEEHGTHTIKTNDGQYFLYTAVYLSGILSPISEEVFEEYERKNLMGR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_020384_1	1.10\|180119\|33\|NC_020384\|CRISPRCasFinder	180119-180151	33	NC_020383.1	62525-62557	1	0.97
NC_020384_2	2.4\|187520\|33\|NC_020384\|CRT	187520-187552	33	NC_020383.1	57456-57488	1	0.97
NC_020384_2	2.13\|187522\|30\|NC_020384\|PILER-CR	187522-187551	30	NC_020383.1	57457-57486	1	0.967

1. spacer 1.10|180119|33|NC_020384|CRISPRCasFinder matches to position: 62525-62557, mismatch: 1, identity: 0.97

tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
tttgcaactagctcaattgttttcccgttttca	Protospacer
***********************.*********

2. spacer 2.4|187520|33|NC_020384|CRT matches to position: 57456-57488, mismatch: 1, identity: 0.97

atggaaatggaacgttcttacggatcaaaagaa	CRISPR spacer
atggaaatggaacgtttttacggatcaaaagaa	Protospacer
****************.****************

3. spacer 2.13|187522|30|NC_020384|PILER-CR matches to position: 57457-57486, mismatch: 1, identity: 0.967

ggaaatggaacgttcttacggatcaaaaga	CRISPR spacer
ggaaatggaacgtttttacggatcaaaaga	Protospacer
**************.***************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_020384_1	1.1\|179663\|30\|NC_020384\|PILER-CR	179663-179692	30	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143272-143301	0	1.0
NC_020384_1	1.1\|179663\|30\|NC_020384\|PILER-CR	179663-179692	30	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175438-175467	0	1.0
NC_020384_1	1.1\|179663\|30\|NC_020384\|PILER-CR	179663-179692	30	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	179663-179692	0	1.0
NC_020384_1	1.1\|179663\|30\|NC_020384\|PILER-CR	179663-179692	30	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	6738-6767	0	1.0
NC_020384_1	1.1\|179663\|30\|NC_020384\|PILER-CR	179663-179692	30	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140603-140632	0	1.0
NC_020384_1	1.1\|179663\|30\|NC_020384\|PILER-CR	179663-179692	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	705127-705156	0	1.0
NC_020384_1	1.1\|179663\|30\|NC_020384\|PILER-CR	179663-179692	30	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24665-24694	0	1.0
NC_020384_1	1.1\|179663\|30\|NC_020384\|PILER-CR	179663-179692	30	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6957-6986	0	1.0
NC_020384_1	1.1\|179663\|30\|NC_020384\|PILER-CR	179663-179692	30	NZ_CP010096	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMBLin15, complete sequence	12892-12921	0	1.0
NC_020384_1	1.2\|179729\|33\|NC_020384\|PILER-CR	179729-179761	33	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143335-143367	0	1.0
NC_020384_1	1.2\|179729\|33\|NC_020384\|PILER-CR	179729-179761	33	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175501-175533	0	1.0
NC_020384_1	1.2\|179729\|33\|NC_020384\|PILER-CR	179729-179761	33	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	179726-179758	0	1.0
NC_020384_1	1.2\|179729\|33\|NC_020384\|PILER-CR	179729-179761	33	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	705061-705093	0	1.0
NC_020384_1	1.2\|179729\|33\|NC_020384\|PILER-CR	179729-179761	33	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24599-24631	0	1.0
NC_020384_1	1.2\|179729\|33\|NC_020384\|PILER-CR	179729-179761	33	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140666-140698	0	1.0
NC_020384_1	1.2\|179729\|33\|NC_020384\|PILER-CR	179729-179761	33	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6891-6923	0	1.0
NC_020384_1	1.2\|179729\|33\|NC_020384\|PILER-CR	179729-179761	33	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135332-135364	0	1.0
NC_020384_1	1.3\|179660\|34\|NC_020384\|CRISPRCasFinder	179660-179693	34	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143269-143302	0	1.0
NC_020384_1	1.3\|179660\|34\|NC_020384\|CRISPRCasFinder	179660-179693	34	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175435-175468	0	1.0
NC_020384_1	1.3\|179660\|34\|NC_020384\|CRISPRCasFinder	179660-179693	34	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	179660-179693	0	1.0
NC_020384_1	1.3\|179660\|34\|NC_020384\|CRISPRCasFinder	179660-179693	34	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	705126-705159	0	1.0
NC_020384_1	1.3\|179660\|34\|NC_020384\|CRISPRCasFinder	179660-179693	34	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	6735-6768	0	1.0
NC_020384_1	1.3\|179660\|34\|NC_020384\|CRISPRCasFinder	179660-179693	34	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24664-24697	0	1.0
NC_020384_1	1.3\|179660\|34\|NC_020384\|CRISPRCasFinder	179660-179693	34	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140600-140633	0	1.0
NC_020384_1	1.3\|179660\|34\|NC_020384\|CRISPRCasFinder	179660-179693	34	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6956-6989	0	1.0
NC_020384_1	1.4\|179726\|34\|NC_020384\|CRISPRCasFinder	179726-179759	34	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143335-143368	0	1.0
NC_020384_1	1.4\|179726\|34\|NC_020384\|CRISPRCasFinder	179726-179759	34	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175501-175534	0	1.0
NC_020384_1	1.4\|179726\|34\|NC_020384\|CRISPRCasFinder	179726-179759	34	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	179726-179759	0	1.0
NC_020384_1	1.4\|179726\|34\|NC_020384\|CRISPRCasFinder	179726-179759	34	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140666-140699	0	1.0
NC_020384_1	1.4\|179726\|34\|NC_020384\|CRISPRCasFinder	179726-179759	34	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135332-135365	0	1.0
NC_020384_1	1.4\|179726\|34\|NC_020384\|CRISPRCasFinder	179726-179759	34	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	705060-705093	0	1.0
NC_020384_1	1.4\|179726\|34\|NC_020384\|CRISPRCasFinder	179726-179759	34	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24598-24631	0	1.0
NC_020384_1	1.4\|179726\|34\|NC_020384\|CRISPRCasFinder	179726-179759	34	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6890-6923	0	1.0
NC_020384_1	1.5\|179792\|35\|NC_020384\|CRISPRCasFinder	179792-179826	35	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704993-705027	0	1.0
NC_020384_1	1.5\|179792\|35\|NC_020384\|CRISPRCasFinder	179792-179826	35	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24531-24565	0	1.0
NC_020384_1	1.5\|179792\|35\|NC_020384\|CRISPRCasFinder	179792-179826	35	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6757-6791	0	1.0
NC_020384_1	1.5\|179792\|35\|NC_020384\|CRISPRCasFinder	179792-179826	35	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143401-143435	0	1.0
NC_020384_1	1.5\|179792\|35\|NC_020384\|CRISPRCasFinder	179792-179826	35	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175567-175601	0	1.0
NC_020384_1	1.5\|179792\|35\|NC_020384\|CRISPRCasFinder	179792-179826	35	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	179792-179826	0	1.0
NC_020384_1	1.5\|179792\|35\|NC_020384\|CRISPRCasFinder	179792-179826	35	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140732-140766	0	1.0
NC_020384_1	1.5\|179792\|35\|NC_020384\|CRISPRCasFinder	179792-179826	35	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135464-135498	0	1.0
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NZ_CP004871	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB46, complete sequence	26388-26419	0	1.0
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143468-143499	0	1.0
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175634-175665	0	1.0
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	179859-179890	0	1.0
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NC_023074	Bacillus thuringiensis serovar tenebrionis str. YBT-1765 plasmid pBMB165, complete sequence	37573-37604	0	1.0
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704929-704960	0	1.0
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NZ_CP011352	Bacillus thuringiensis strain YC-10 plasmid pYC4, complete sequence	37048-37079	0	1.0
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	6933-6964	0	1.0
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24467-24498	0	1.0
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NZ_CP013060	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-5, complete sequence	9632-9663	0	1.0
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140799-140830	0	1.0
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135531-135562	0	1.0
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NZ_CP010095	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB47, complete sequence	26388-26419	0	1.0
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	MK843319	Bacillus phage vB_BthS-TP21T, complete genome	34443-34474	0	1.0
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	KT970646	Bacillus phage phiS58, complete genome	34443-34474	0	1.0
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	KJ024807	Bacillus phage vB_BtS_BMBtp3, complete genome	34642-34673	0	1.0
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NC_025424	Bacillus phage Waukesha92, complete genome	11483-11514	0	1.0
NC_020384_1	1.7\|179923\|33\|NC_020384\|CRISPRCasFinder	179923-179955	33	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143532-143564	0	1.0
NC_020384_1	1.7\|179923\|33\|NC_020384\|CRISPRCasFinder	179923-179955	33	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175698-175730	0	1.0
NC_020384_1	1.7\|179923\|33\|NC_020384\|CRISPRCasFinder	179923-179955	33	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	179923-179955	0	1.0
NC_020384_1	1.7\|179923\|33\|NC_020384\|CRISPRCasFinder	179923-179955	33	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	6997-7029	0	1.0
NC_020384_1	1.7\|179923\|33\|NC_020384\|CRISPRCasFinder	179923-179955	33	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140863-140895	0	1.0
NC_020384_1	1.7\|179923\|33\|NC_020384\|CRISPRCasFinder	179923-179955	33	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135595-135627	0	1.0
NC_020384_1	1.7\|179923\|33\|NC_020384\|CRISPRCasFinder	179923-179955	33	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704864-704896	0	1.0
NC_020384_1	1.7\|179923\|33\|NC_020384\|CRISPRCasFinder	179923-179955	33	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24402-24434	0	1.0
NC_020384_1	1.8\|179988\|33\|NC_020384\|CRISPRCasFinder	179988-180020	33	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	151946-151978	0	1.0
NC_020384_1	1.8\|179988\|33\|NC_020384\|CRISPRCasFinder	179988-180020	33	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704799-704831	0	1.0
NC_020384_1	1.8\|179988\|33\|NC_020384\|CRISPRCasFinder	179988-180020	33	NZ_CP053974	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed5, complete sequence	2157-2189	0	1.0
NC_020384_1	1.8\|179988\|33\|NC_020384\|CRISPRCasFinder	179988-180020	33	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24337-24369	0	1.0
NC_020384_1	1.8\|179988\|33\|NC_020384\|CRISPRCasFinder	179988-180020	33	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	243847-243879	0	1.0
NC_020384_1	1.8\|179988\|33\|NC_020384\|CRISPRCasFinder	179988-180020	33	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6692-6724	0	1.0
NC_020384_1	1.8\|179988\|33\|NC_020384\|CRISPRCasFinder	179988-180020	33	NZ_CP009346	Bacillus thuringiensis HD1002 plasmid 5, complete sequence	3933-3965	0	1.0
NC_020384_1	1.8\|179988\|33\|NC_020384\|CRISPRCasFinder	179988-180020	33	NZ_CP045027	Bacillus thuringiensis strain JW-1 plasmid p5, complete sequence	3931-3963	0	1.0
NC_020384_1	1.8\|179988\|33\|NC_020384\|CRISPRCasFinder	179988-180020	33	CP013282	Bacillus phage pGIL02, complete sequence	3933-3965	0	1.0
NC_020384_1	1.8\|179988\|33\|NC_020384\|CRISPRCasFinder	179988-180020	33	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143597-143629	0	1.0
NC_020384_1	1.8\|179988\|33\|NC_020384\|CRISPRCasFinder	179988-180020	33	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175763-175795	0	1.0
NC_020384_1	1.8\|179988\|33\|NC_020384\|CRISPRCasFinder	179988-180020	33	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	179988-180020	0	1.0
NC_020384_1	1.8\|179988\|33\|NC_020384\|CRISPRCasFinder	179988-180020	33	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	7062-7094	0	1.0
NC_020384_1	1.8\|179988\|33\|NC_020384\|CRISPRCasFinder	179988-180020	33	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140928-140960	0	1.0
NC_020384_1	1.8\|179988\|33\|NC_020384\|CRISPRCasFinder	179988-180020	33	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135660-135692	0	1.0
NC_020384_1	1.8\|179988\|33\|NC_020384\|CRISPRCasFinder	179988-180020	33	NC_005258	Bacillus phage Bam35c, complete genome	10971-11003	0	1.0
NC_020384_1	1.8\|179988\|33\|NC_020384\|CRISPRCasFinder	179988-180020	33	AY257527	Bacillus thuringiensis bacteriophage Bam35c, complete genome	10971-11003	0	1.0
NC_020384_1	1.8\|179988\|33\|NC_020384\|CRISPRCasFinder	179988-180020	33	AJ536073	Bacillus phage pGIL01, complete genome	10969-11001	0	1.0
NC_020384_1	1.9\|180053\|34\|NC_020384\|CRISPRCasFinder	180053-180086	34	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704733-704766	0	1.0
NC_020384_1	1.9\|180053\|34\|NC_020384\|CRISPRCasFinder	180053-180086	34	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24271-24304	0	1.0
NC_020384_1	1.9\|180053\|34\|NC_020384\|CRISPRCasFinder	180053-180086	34	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6626-6659	0	1.0
NC_020384_1	1.9\|180053\|34\|NC_020384\|CRISPRCasFinder	180053-180086	34	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143662-143695	0	1.0
NC_020384_1	1.9\|180053\|34\|NC_020384\|CRISPRCasFinder	180053-180086	34	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175828-175861	0	1.0
NC_020384_1	1.9\|180053\|34\|NC_020384\|CRISPRCasFinder	180053-180086	34	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	180053-180086	0	1.0
NC_020384_1	1.9\|180053\|34\|NC_020384\|CRISPRCasFinder	180053-180086	34	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	7126-7159	0	1.0
NC_020384_1	1.9\|180053\|34\|NC_020384\|CRISPRCasFinder	180053-180086	34	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140993-141026	0	1.0
NC_020384_1	1.9\|180053\|34\|NC_020384\|CRISPRCasFinder	180053-180086	34	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135725-135758	0	1.0
NC_020384_1	1.10\|180119\|33\|NC_020384\|CRISPRCasFinder	180119-180151	33	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143728-143760	0	1.0
NC_020384_1	1.10\|180119\|33\|NC_020384\|CRISPRCasFinder	180119-180151	33	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175894-175926	0	1.0
NC_020384_1	1.10\|180119\|33\|NC_020384\|CRISPRCasFinder	180119-180151	33	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	180119-180151	0	1.0
NC_020384_1	1.10\|180119\|33\|NC_020384\|CRISPRCasFinder	180119-180151	33	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	141059-141091	0	1.0
NC_020384_1	1.10\|180119\|33\|NC_020384\|CRISPRCasFinder	180119-180151	33	CP041751	Bacillus paranthracis strain NCCP 14796 plasmid unnamed1, complete sequence	10913-10945	0	1.0
NC_020384_1	1.10\|180119\|33\|NC_020384\|CRISPRCasFinder	180119-180151	33	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135791-135823	0	1.0
NC_020384_1	1.10\|180119\|33\|NC_020384\|CRISPRCasFinder	180119-180151	33	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704668-704700	0	1.0
NC_020384_1	1.10\|180119\|33\|NC_020384\|CRISPRCasFinder	180119-180151	33	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24206-24238	0	1.0
NC_020384_1	1.10\|180119\|33\|NC_020384\|CRISPRCasFinder	180119-180151	33	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6561-6593	0	1.0
NC_020384_1	1.10\|180119\|33\|NC_020384\|CRISPRCasFinder	180119-180151	33	CP024689	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-5-125K, complete sequence	6571-6603	0	1.0
NC_020384_1	1.10\|180119\|33\|NC_020384\|CRISPRCasFinder	180119-180151	33	NC_018685	Bacillus thuringiensis MC28 plasmid pMC95, complete sequence	23122-23154	0	1.0
NC_020384_1	1.10\|180119\|33\|NC_020384\|CRISPRCasFinder	180119-180151	33	NZ_CP033793	Bacillus sp. FDAARGOS_527 plasmid unnamed6, complete sequence	2200-2232	0	1.0
NC_020384_1	1.11\|180184\|34\|NC_020384\|CRISPRCasFinder	180184-180217	34	NZ_KX258624	Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence	50231-50264	0	1.0
NC_020384_1	1.11\|180184\|34\|NC_020384\|CRISPRCasFinder	180184-180217	34	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704602-704635	0	1.0
NC_020384_1	1.11\|180184\|34\|NC_020384\|CRISPRCasFinder	180184-180217	34	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24140-24173	0	1.0
NC_020384_1	1.11\|180184\|34\|NC_020384\|CRISPRCasFinder	180184-180217	34	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6495-6528	0	1.0
NC_020384_1	1.11\|180184\|34\|NC_020384\|CRISPRCasFinder	180184-180217	34	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143793-143826	0	1.0
NC_020384_1	1.11\|180184\|34\|NC_020384\|CRISPRCasFinder	180184-180217	34	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175959-175992	0	1.0
NC_020384_1	1.11\|180184\|34\|NC_020384\|CRISPRCasFinder	180184-180217	34	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	180184-180217	0	1.0
NC_020384_1	1.11\|180184\|34\|NC_020384\|CRISPRCasFinder	180184-180217	34	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	7258-7291	0	1.0
NC_020384_1	1.11\|180184\|34\|NC_020384\|CRISPRCasFinder	180184-180217	34	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	141124-141157	0	1.0
NC_020384_1	1.11\|180184\|34\|NC_020384\|CRISPRCasFinder	180184-180217	34	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135856-135889	0	1.0
NC_020384_1	1.12\|180250\|33\|NC_020384\|CRISPRCasFinder	180250-180282	33	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143859-143891	0	1.0
NC_020384_1	1.12\|180250\|33\|NC_020384\|CRISPRCasFinder	180250-180282	33	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	176025-176057	0	1.0
NC_020384_1	1.12\|180250\|33\|NC_020384\|CRISPRCasFinder	180250-180282	33	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	180250-180282	0	1.0
NC_020384_1	1.12\|180250\|33\|NC_020384\|CRISPRCasFinder	180250-180282	33	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	7325-7357	0	1.0
NC_020384_1	1.12\|180250\|33\|NC_020384\|CRISPRCasFinder	180250-180282	33	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	141190-141222	0	1.0
NC_020384_1	1.12\|180250\|33\|NC_020384\|CRISPRCasFinder	180250-180282	33	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135922-135954	0	1.0
NC_020384_1	1.12\|180250\|33\|NC_020384\|CRISPRCasFinder	180250-180282	33	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704537-704569	0	1.0
NC_020384_1	1.12\|180250\|33\|NC_020384\|CRISPRCasFinder	180250-180282	33	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24075-24107	0	1.0
NC_020384_1	1.12\|180250\|33\|NC_020384\|CRISPRCasFinder	180250-180282	33	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6430-6462	0	1.0
NC_020384_1	1.13\|179651\|43\|NC_020384\|CRT	179651-179693	43	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143260-143302	0	1.0
NC_020384_1	1.13\|179651\|43\|NC_020384\|CRT	179651-179693	43	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175426-175468	0	1.0
NC_020384_1	1.13\|179651\|43\|NC_020384\|CRT	179651-179693	43	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	179651-179693	0	1.0
NC_020384_1	1.13\|179651\|43\|NC_020384\|CRT	179651-179693	43	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	705126-705168	0	1.0
NC_020384_1	1.13\|179651\|43\|NC_020384\|CRT	179651-179693	43	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	6726-6768	0	1.0
NC_020384_1	1.13\|179651\|43\|NC_020384\|CRT	179651-179693	43	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24664-24706	0	1.0
NC_020384_1	1.13\|179651\|43\|NC_020384\|CRT	179651-179693	43	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140591-140633	0	1.0
NC_020384_1	1.13\|179651\|43\|NC_020384\|CRT	179651-179693	43	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6956-6998	0	1.0
NC_020384_1	1.14\|179717\|43\|NC_020384\|CRT	179717-179759	43	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143326-143368	0	1.0
NC_020384_1	1.14\|179717\|43\|NC_020384\|CRT	179717-179759	43	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175492-175534	0	1.0
NC_020384_1	1.14\|179717\|43\|NC_020384\|CRT	179717-179759	43	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	179717-179759	0	1.0
NC_020384_1	1.14\|179717\|43\|NC_020384\|CRT	179717-179759	43	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140657-140699	0	1.0
NC_020384_1	1.14\|179717\|43\|NC_020384\|CRT	179717-179759	43	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135323-135365	0	1.0
NC_020384_1	1.14\|179717\|43\|NC_020384\|CRT	179717-179759	43	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	705060-705102	0	1.0
NC_020384_1	1.14\|179717\|43\|NC_020384\|CRT	179717-179759	43	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24598-24640	0	1.0
NC_020384_1	1.14\|179717\|43\|NC_020384\|CRT	179717-179759	43	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6890-6932	0	1.0
NC_020384_1	1.15\|179783\|44\|NC_020384\|CRT	179783-179826	44	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704993-705036	0	1.0
NC_020384_1	1.15\|179783\|44\|NC_020384\|CRT	179783-179826	44	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24531-24574	0	1.0
NC_020384_1	1.15\|179783\|44\|NC_020384\|CRT	179783-179826	44	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6757-6800	0	1.0
NC_020384_1	1.15\|179783\|44\|NC_020384\|CRT	179783-179826	44	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143392-143435	0	1.0
NC_020384_1	1.15\|179783\|44\|NC_020384\|CRT	179783-179826	44	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175558-175601	0	1.0
NC_020384_1	1.15\|179783\|44\|NC_020384\|CRT	179783-179826	44	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	179783-179826	0	1.0
NC_020384_1	1.15\|179783\|44\|NC_020384\|CRT	179783-179826	44	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140723-140766	0	1.0
NC_020384_1	1.15\|179783\|44\|NC_020384\|CRT	179783-179826	44	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135455-135498	0	1.0
NC_020384_1	1.16\|179850\|41\|NC_020384\|CRT	179850-179890	41	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143459-143499	0	1.0
NC_020384_1	1.16\|179850\|41\|NC_020384\|CRT	179850-179890	41	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175625-175665	0	1.0
NC_020384_1	1.16\|179850\|41\|NC_020384\|CRT	179850-179890	41	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	179850-179890	0	1.0
NC_020384_1	1.16\|179850\|41\|NC_020384\|CRT	179850-179890	41	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140790-140830	0	1.0
NC_020384_1	1.16\|179850\|41\|NC_020384\|CRT	179850-179890	41	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135522-135562	0	1.0
NC_020384_1	1.16\|179850\|41\|NC_020384\|CRT	179850-179890	41	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704929-704969	0	1.0
NC_020384_1	1.16\|179850\|41\|NC_020384\|CRT	179850-179890	41	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24467-24507	0	1.0
NC_020384_1	1.17\|179914\|42\|NC_020384\|CRT	179914-179955	42	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704864-704905	0	1.0
NC_020384_1	1.17\|179914\|42\|NC_020384\|CRT	179914-179955	42	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24402-24443	0	1.0
NC_020384_1	1.17\|179914\|42\|NC_020384\|CRT	179914-179955	42	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143523-143564	0	1.0
NC_020384_1	1.17\|179914\|42\|NC_020384\|CRT	179914-179955	42	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175689-175730	0	1.0
NC_020384_1	1.17\|179914\|42\|NC_020384\|CRT	179914-179955	42	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	179914-179955	0	1.0
NC_020384_1	1.17\|179914\|42\|NC_020384\|CRT	179914-179955	42	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	6988-7029	0	1.0
NC_020384_1	1.17\|179914\|42\|NC_020384\|CRT	179914-179955	42	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140854-140895	0	1.0
NC_020384_1	1.17\|179914\|42\|NC_020384\|CRT	179914-179955	42	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135586-135627	0	1.0
NC_020384_1	1.18\|179979\|42\|NC_020384\|CRT	179979-180020	42	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	151946-151987	0	1.0
NC_020384_1	1.18\|179979\|42\|NC_020384\|CRT	179979-180020	42	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704799-704840	0	1.0
NC_020384_1	1.18\|179979\|42\|NC_020384\|CRT	179979-180020	42	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24337-24378	0	1.0
NC_020384_1	1.18\|179979\|42\|NC_020384\|CRT	179979-180020	42	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	243847-243888	0	1.0
NC_020384_1	1.18\|179979\|42\|NC_020384\|CRT	179979-180020	42	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6692-6733	0	1.0
NC_020384_1	1.18\|179979\|42\|NC_020384\|CRT	179979-180020	42	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143588-143629	0	1.0
NC_020384_1	1.18\|179979\|42\|NC_020384\|CRT	179979-180020	42	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175754-175795	0	1.0
NC_020384_1	1.18\|179979\|42\|NC_020384\|CRT	179979-180020	42	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	179979-180020	0	1.0
NC_020384_1	1.18\|179979\|42\|NC_020384\|CRT	179979-180020	42	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	7053-7094	0	1.0
NC_020384_1	1.18\|179979\|42\|NC_020384\|CRT	179979-180020	42	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140919-140960	0	1.0
NC_020384_1	1.18\|179979\|42\|NC_020384\|CRT	179979-180020	42	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135651-135692	0	1.0
NC_020384_1	1.19\|180044\|43\|NC_020384\|CRT	180044-180086	43	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704733-704775	0	1.0
NC_020384_1	1.19\|180044\|43\|NC_020384\|CRT	180044-180086	43	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24271-24313	0	1.0
NC_020384_1	1.19\|180044\|43\|NC_020384\|CRT	180044-180086	43	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6626-6668	0	1.0
NC_020384_1	1.19\|180044\|43\|NC_020384\|CRT	180044-180086	43	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143653-143695	0	1.0
NC_020384_1	1.19\|180044\|43\|NC_020384\|CRT	180044-180086	43	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175819-175861	0	1.0
NC_020384_1	1.19\|180044\|43\|NC_020384\|CRT	180044-180086	43	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	180044-180086	0	1.0
NC_020384_1	1.19\|180044\|43\|NC_020384\|CRT	180044-180086	43	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140984-141026	0	1.0
NC_020384_1	1.19\|180044\|43\|NC_020384\|CRT	180044-180086	43	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135716-135758	0	1.0
NC_020384_1	1.20\|180110\|42\|NC_020384\|CRT	180110-180151	42	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143719-143760	0	1.0
NC_020384_1	1.20\|180110\|42\|NC_020384\|CRT	180110-180151	42	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175885-175926	0	1.0
NC_020384_1	1.20\|180110\|42\|NC_020384\|CRT	180110-180151	42	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	180110-180151	0	1.0
NC_020384_1	1.20\|180110\|42\|NC_020384\|CRT	180110-180151	42	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704668-704709	0	1.0
NC_020384_1	1.20\|180110\|42\|NC_020384\|CRT	180110-180151	42	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24206-24247	0	1.0
NC_020384_1	1.20\|180110\|42\|NC_020384\|CRT	180110-180151	42	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	141050-141091	0	1.0
NC_020384_1	1.20\|180110\|42\|NC_020384\|CRT	180110-180151	42	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6561-6602	0	1.0
NC_020384_1	1.20\|180110\|42\|NC_020384\|CRT	180110-180151	42	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135782-135823	0	1.0
NC_020384_1	1.21\|180175\|43\|NC_020384\|CRT	180175-180217	43	NZ_KX258624	Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence	50231-50273	0	1.0
NC_020384_1	1.21\|180175\|43\|NC_020384\|CRT	180175-180217	43	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704602-704644	0	1.0
NC_020384_1	1.21\|180175\|43\|NC_020384\|CRT	180175-180217	43	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24140-24182	0	1.0
NC_020384_1	1.21\|180175\|43\|NC_020384\|CRT	180175-180217	43	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6495-6537	0	1.0
NC_020384_1	1.21\|180175\|43\|NC_020384\|CRT	180175-180217	43	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143784-143826	0	1.0
NC_020384_1	1.21\|180175\|43\|NC_020384\|CRT	180175-180217	43	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175950-175992	0	1.0
NC_020384_1	1.21\|180175\|43\|NC_020384\|CRT	180175-180217	43	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	180175-180217	0	1.0
NC_020384_1	1.21\|180175\|43\|NC_020384\|CRT	180175-180217	43	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	7249-7291	0	1.0
NC_020384_1	1.21\|180175\|43\|NC_020384\|CRT	180175-180217	43	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	141115-141157	0	1.0
NC_020384_1	1.21\|180175\|43\|NC_020384\|CRT	180175-180217	43	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135847-135889	0	1.0
NC_020384_1	1.22\|180241\|42\|NC_020384\|CRT	180241-180282	42	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143850-143891	0	1.0
NC_020384_1	1.22\|180241\|42\|NC_020384\|CRT	180241-180282	42	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	176016-176057	0	1.0
NC_020384_1	1.22\|180241\|42\|NC_020384\|CRT	180241-180282	42	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	180241-180282	0	1.0
NC_020384_1	1.22\|180241\|42\|NC_020384\|CRT	180241-180282	42	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	7316-7357	0	1.0
NC_020384_1	1.22\|180241\|42\|NC_020384\|CRT	180241-180282	42	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	141181-141222	0	1.0
NC_020384_1	1.22\|180241\|42\|NC_020384\|CRT	180241-180282	42	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135913-135954	0	1.0
NC_020384_1	1.22\|180241\|42\|NC_020384\|CRT	180241-180282	42	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704537-704578	0	1.0
NC_020384_1	1.22\|180241\|42\|NC_020384\|CRT	180241-180282	42	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24075-24116	0	1.0
NC_020384_1	1.22\|180241\|42\|NC_020384\|CRT	180241-180282	42	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6430-6471	0	1.0
NC_020384_2	2.1\|187320\|35\|NC_020384\|CRT	187320-187354	35	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	151569-151603	0	1.0
NC_020384_2	2.1\|187320\|35\|NC_020384\|CRT	187320-187354	35	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	183095-183129	0	1.0
NC_020384_2	2.1\|187320\|35\|NC_020384\|CRT	187320-187354	35	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	187320-187354	0	1.0
NC_020384_2	2.1\|187320\|35\|NC_020384\|CRT	187320-187354	35	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	14386-14420	0	1.0
NC_020384_2	2.1\|187320\|35\|NC_020384\|CRT	187320-187354	35	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	148260-148294	0	1.0
NC_020384_2	2.1\|187320\|35\|NC_020384\|CRT	187320-187354	35	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	143021-143055	0	1.0
NC_020384_2	2.1\|187320\|35\|NC_020384\|CRT	187320-187354	35	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	697465-697499	0	1.0
NC_020384_2	2.1\|187320\|35\|NC_020384\|CRT	187320-187354	35	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	17003-17037	0	1.0
NC_020384_2	2.2\|187387\|34\|NC_020384\|CRT	187387-187420	34	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	151636-151669	0	1.0
NC_020384_2	2.2\|187387\|34\|NC_020384\|CRT	187387-187420	34	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	183162-183195	0	1.0
NC_020384_2	2.2\|187387\|34\|NC_020384\|CRT	187387-187420	34	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	187387-187420	0	1.0
NC_020384_2	2.2\|187387\|34\|NC_020384\|CRT	187387-187420	34	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	14453-14486	0	1.0
NC_020384_2	2.2\|187387\|34\|NC_020384\|CRT	187387-187420	34	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	148327-148360	0	1.0
NC_020384_2	2.2\|187387\|34\|NC_020384\|CRT	187387-187420	34	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	143088-143121	0	1.0
NC_020384_2	2.2\|187387\|34\|NC_020384\|CRT	187387-187420	34	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	697399-697432	0	1.0
NC_020384_2	2.2\|187387\|34\|NC_020384\|CRT	187387-187420	34	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	16937-16970	0	1.0
NC_020384_2	2.2\|187387\|34\|NC_020384\|CRT	187387-187420	34	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	292547-292580	0	1.0
NC_020384_2	2.3\|187453\|35\|NC_020384\|CRT	187453-187487	35	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	151702-151736	0	1.0
NC_020384_2	2.3\|187453\|35\|NC_020384\|CRT	187453-187487	35	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	183228-183262	0	1.0
NC_020384_2	2.3\|187453\|35\|NC_020384\|CRT	187453-187487	35	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	187453-187487	0	1.0
NC_020384_2	2.3\|187453\|35\|NC_020384\|CRT	187453-187487	35	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	14519-14553	0	1.0
NC_020384_2	2.3\|187453\|35\|NC_020384\|CRT	187453-187487	35	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	148393-148427	0	1.0
NC_020384_2	2.3\|187453\|35\|NC_020384\|CRT	187453-187487	35	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	143154-143188	0	1.0
NC_020384_2	2.3\|187453\|35\|NC_020384\|CRT	187453-187487	35	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	697332-697366	0	1.0
NC_020384_2	2.3\|187453\|35\|NC_020384\|CRT	187453-187487	35	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	16870-16904	0	1.0
NC_020384_2	2.3\|187453\|35\|NC_020384\|CRT	187453-187487	35	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	292480-292514	0	1.0
NC_020384_2	2.4\|187520\|33\|NC_020384\|CRT	187520-187552	33	NZ_CP047087	Bacillus paranthracis strain BC307 plasmid pCE2, complete sequence	65790-65822	0	1.0
NC_020384_2	2.4\|187520\|33\|NC_020384\|CRT	187520-187552	33	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	697267-697299	0	1.0
NC_020384_2	2.4\|187520\|33\|NC_020384\|CRT	187520-187552	33	NC_018510	Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence	186508-186540	0	1.0
NC_020384_2	2.4\|187520\|33\|NC_020384\|CRT	187520-187552	33	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	16805-16837	0	1.0
NC_020384_2	2.4\|187520\|33\|NC_020384\|CRT	187520-187552	33	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	292415-292447	0	1.0
NC_020384_2	2.4\|187520\|33\|NC_020384\|CRT	187520-187552	33	CP041751	Bacillus paranthracis strain NCCP 14796 plasmid unnamed1, complete sequence	5827-5859	0	1.0
NC_020384_2	2.4\|187520\|33\|NC_020384\|CRT	187520-187552	33	NZ_CP017573	Bacillus thuringiensis strain SCG04-02 plasmid PSCG61, complete sequence	10722-10754	0	1.0
NC_020384_2	2.4\|187520\|33\|NC_020384\|CRT	187520-187552	33	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	151769-151801	0	1.0
NC_020384_2	2.4\|187520\|33\|NC_020384\|CRT	187520-187552	33	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	183295-183327	0	1.0
NC_020384_2	2.4\|187520\|33\|NC_020384\|CRT	187520-187552	33	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	187520-187552	0	1.0
NC_020384_2	2.4\|187520\|33\|NC_020384\|CRT	187520-187552	33	NZ_CP029456	Bacillus cereus strain FORC087 plasmid pFORC087.2, complete sequence	42954-42986	0	1.0
NC_020384_2	2.4\|187520\|33\|NC_020384\|CRT	187520-187552	33	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	14586-14618	0	1.0
NC_020384_2	2.4\|187520\|33\|NC_020384\|CRT	187520-187552	33	NZ_CP013280	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence	80319-80351	0	1.0
NC_020384_2	2.4\|187520\|33\|NC_020384\|CRT	187520-187552	33	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	148460-148492	0	1.0
NC_020384_2	2.4\|187520\|33\|NC_020384\|CRT	187520-187552	33	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	57722-57754	0	1.0
NC_020384_2	2.4\|187520\|33\|NC_020384\|CRT	187520-187552	33	NC_011656	Bacillus cereus AH187 plasmid pAH187_45, complete sequence	9678-9710	0	1.0
NC_020384_2	2.4\|187520\|33\|NC_020384\|CRT	187520-187552	33	NZ_CP039726	Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence	89365-89397	0	1.0
NC_020384_2	2.4\|187520\|33\|NC_020384\|CRT	187520-187552	33	NC_018685	Bacillus thuringiensis MC28 plasmid pMC95, complete sequence	28739-28771	0	1.0
NC_020384_2	2.4\|187520\|33\|NC_020384\|CRT	187520-187552	33	NZ_CP009350	Bacillus thuringiensis HD1002 plasmid 4, complete sequence	1706-1738	0	1.0
NC_020384_2	2.4\|187520\|33\|NC_020384\|CRT	187520-187552	33	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	143221-143253	0	1.0
NC_020384_2	2.4\|187520\|33\|NC_020384\|CRT	187520-187552	33	NZ_CP033793	Bacillus sp. FDAARGOS_527 plasmid unnamed6, complete sequence	7582-7614	0	1.0
NC_020384_2	2.5\|187585\|33\|NC_020384\|CRT	187585-187617	33	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	151834-151866	0	1.0
NC_020384_2	2.5\|187585\|33\|NC_020384\|CRT	187585-187617	33	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	183360-183392	0	1.0
NC_020384_2	2.5\|187585\|33\|NC_020384\|CRT	187585-187617	33	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	187585-187617	0	1.0
NC_020384_2	2.5\|187585\|33\|NC_020384\|CRT	187585-187617	33	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	697202-697234	0	1.0
NC_020384_2	2.5\|187585\|33\|NC_020384\|CRT	187585-187617	33	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	14651-14683	0	1.0
NC_020384_2	2.5\|187585\|33\|NC_020384\|CRT	187585-187617	33	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	16740-16772	0	1.0
NC_020384_2	2.5\|187585\|33\|NC_020384\|CRT	187585-187617	33	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	148525-148557	0	1.0
NC_020384_2	2.5\|187585\|33\|NC_020384\|CRT	187585-187617	33	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	292350-292382	0	1.0
NC_020384_2	2.5\|187585\|33\|NC_020384\|CRT	187585-187617	33	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	143286-143318	0	1.0
NC_020384_2	2.6\|187650\|33\|NC_020384\|CRT	187650-187682	33	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	151899-151931	0	1.0
NC_020384_2	2.6\|187650\|33\|NC_020384\|CRT	187650-187682	33	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	183425-183457	0	1.0
NC_020384_2	2.6\|187650\|33\|NC_020384\|CRT	187650-187682	33	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	187650-187682	0	1.0
NC_020384_2	2.6\|187650\|33\|NC_020384\|CRT	187650-187682	33	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	14716-14748	0	1.0
NC_020384_2	2.6\|187650\|33\|NC_020384\|CRT	187650-187682	33	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	148590-148622	0	1.0
NC_020384_2	2.6\|187650\|33\|NC_020384\|CRT	187650-187682	33	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	143351-143383	0	1.0
NC_020384_2	2.6\|187650\|33\|NC_020384\|CRT	187650-187682	33	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	697137-697169	0	1.0
NC_020384_2	2.6\|187650\|33\|NC_020384\|CRT	187650-187682	33	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	16675-16707	0	1.0
NC_020384_2	2.6\|187650\|33\|NC_020384\|CRT	187650-187682	33	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	292285-292317	0	1.0
NC_020384_2	2.7\|187322\|43\|NC_020384\|CRISPRCasFinder	187322-187364	43	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	151571-151613	0	1.0
NC_020384_2	2.7\|187322\|43\|NC_020384\|CRISPRCasFinder	187322-187364	43	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	183097-183139	0	1.0
NC_020384_2	2.7\|187322\|43\|NC_020384\|CRISPRCasFinder	187322-187364	43	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	187322-187364	0	1.0
NC_020384_2	2.7\|187322\|43\|NC_020384\|CRISPRCasFinder	187322-187364	43	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	697455-697497	0	1.0
NC_020384_2	2.7\|187322\|43\|NC_020384\|CRISPRCasFinder	187322-187364	43	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	14388-14430	0	1.0
NC_020384_2	2.7\|187322\|43\|NC_020384\|CRISPRCasFinder	187322-187364	43	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	16993-17035	0	1.0
NC_020384_2	2.7\|187322\|43\|NC_020384\|CRISPRCasFinder	187322-187364	43	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	148262-148304	0	1.0
NC_020384_2	2.7\|187322\|43\|NC_020384\|CRISPRCasFinder	187322-187364	43	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	143023-143065	0	1.0
NC_020384_2	2.8\|187389\|42\|NC_020384\|CRISPRCasFinder	187389-187430	42	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	151638-151679	0	1.0
NC_020384_2	2.8\|187389\|42\|NC_020384\|CRISPRCasFinder	187389-187430	42	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	183164-183205	0	1.0
NC_020384_2	2.8\|187389\|42\|NC_020384\|CRISPRCasFinder	187389-187430	42	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	187389-187430	0	1.0
NC_020384_2	2.8\|187389\|42\|NC_020384\|CRISPRCasFinder	187389-187430	42	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	14455-14496	0	1.0
NC_020384_2	2.8\|187389\|42\|NC_020384\|CRISPRCasFinder	187389-187430	42	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	148329-148370	0	1.0
NC_020384_2	2.8\|187389\|42\|NC_020384\|CRISPRCasFinder	187389-187430	42	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	143090-143131	0	1.0
NC_020384_2	2.8\|187389\|42\|NC_020384\|CRISPRCasFinder	187389-187430	42	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	697389-697430	0	1.0
NC_020384_2	2.8\|187389\|42\|NC_020384\|CRISPRCasFinder	187389-187430	42	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	16927-16968	0	1.0
NC_020384_2	2.8\|187389\|42\|NC_020384\|CRISPRCasFinder	187389-187430	42	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	292537-292578	0	1.0
NC_020384_2	2.9\|187455\|43\|NC_020384\|CRISPRCasFinder	187455-187497	43	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	151704-151746	0	1.0
NC_020384_2	2.9\|187455\|43\|NC_020384\|CRISPRCasFinder	187455-187497	43	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	183230-183272	0	1.0
NC_020384_2	2.9\|187455\|43\|NC_020384\|CRISPRCasFinder	187455-187497	43	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	187455-187497	0	1.0
NC_020384_2	2.9\|187455\|43\|NC_020384\|CRISPRCasFinder	187455-187497	43	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	697322-697364	0	1.0
NC_020384_2	2.9\|187455\|43\|NC_020384\|CRISPRCasFinder	187455-187497	43	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	14521-14563	0	1.0
NC_020384_2	2.9\|187455\|43\|NC_020384\|CRISPRCasFinder	187455-187497	43	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	16860-16902	0	1.0
NC_020384_2	2.9\|187455\|43\|NC_020384\|CRISPRCasFinder	187455-187497	43	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	148395-148437	0	1.0
NC_020384_2	2.9\|187455\|43\|NC_020384\|CRISPRCasFinder	187455-187497	43	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	292470-292512	0	1.0
NC_020384_2	2.9\|187455\|43\|NC_020384\|CRISPRCasFinder	187455-187497	43	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	143156-143198	0	1.0
NC_020384_2	2.10\|187522\|41\|NC_020384\|CRISPRCasFinder	187522-187562	41	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	151771-151811	0	1.0
NC_020384_2	2.10\|187522\|41\|NC_020384\|CRISPRCasFinder	187522-187562	41	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	183297-183337	0	1.0
NC_020384_2	2.10\|187522\|41\|NC_020384\|CRISPRCasFinder	187522-187562	41	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	187522-187562	0	1.0
NC_020384_2	2.10\|187522\|41\|NC_020384\|CRISPRCasFinder	187522-187562	41	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	14588-14628	0	1.0
NC_020384_2	2.10\|187522\|41\|NC_020384\|CRISPRCasFinder	187522-187562	41	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	148462-148502	0	1.0
NC_020384_2	2.10\|187522\|41\|NC_020384\|CRISPRCasFinder	187522-187562	41	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	57724-57764	0	1.0
NC_020384_2	2.10\|187522\|41\|NC_020384\|CRISPRCasFinder	187522-187562	41	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	143223-143263	0	1.0
NC_020384_2	2.10\|187522\|41\|NC_020384\|CRISPRCasFinder	187522-187562	41	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	697257-697297	0	1.0
NC_020384_2	2.10\|187522\|41\|NC_020384\|CRISPRCasFinder	187522-187562	41	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	16795-16835	0	1.0
NC_020384_2	2.10\|187522\|41\|NC_020384\|CRISPRCasFinder	187522-187562	41	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	292405-292445	0	1.0
NC_020384_2	2.11\|187587\|41\|NC_020384\|CRISPRCasFinder	187587-187627	41	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	151836-151876	0	1.0
NC_020384_2	2.11\|187587\|41\|NC_020384\|CRISPRCasFinder	187587-187627	41	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	183362-183402	0	1.0
NC_020384_2	2.11\|187587\|41\|NC_020384\|CRISPRCasFinder	187587-187627	41	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	187587-187627	0	1.0
NC_020384_2	2.11\|187587\|41\|NC_020384\|CRISPRCasFinder	187587-187627	41	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	697192-697232	0	1.0
NC_020384_2	2.11\|187587\|41\|NC_020384\|CRISPRCasFinder	187587-187627	41	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	14653-14693	0	1.0
NC_020384_2	2.11\|187587\|41\|NC_020384\|CRISPRCasFinder	187587-187627	41	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	16730-16770	0	1.0
NC_020384_2	2.11\|187587\|41\|NC_020384\|CRISPRCasFinder	187587-187627	41	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	148527-148567	0	1.0
NC_020384_2	2.11\|187587\|41\|NC_020384\|CRISPRCasFinder	187587-187627	41	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	292340-292380	0	1.0
NC_020384_2	2.11\|187587\|41\|NC_020384\|CRISPRCasFinder	187587-187627	41	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	143288-143328	0	1.0
NC_020384_2	2.12\|187455\|32\|NC_020384\|PILER-CR	187455-187486	32	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	151704-151735	0	1.0
NC_020384_2	2.12\|187455\|32\|NC_020384\|PILER-CR	187455-187486	32	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	183230-183261	0	1.0
NC_020384_2	2.12\|187455\|32\|NC_020384\|PILER-CR	187455-187486	32	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	187455-187486	0	1.0
NC_020384_2	2.12\|187455\|32\|NC_020384\|PILER-CR	187455-187486	32	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	697333-697364	0	1.0
NC_020384_2	2.12\|187455\|32\|NC_020384\|PILER-CR	187455-187486	32	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	14521-14552	0	1.0
NC_020384_2	2.12\|187455\|32\|NC_020384\|PILER-CR	187455-187486	32	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	16871-16902	0	1.0
NC_020384_2	2.12\|187455\|32\|NC_020384\|PILER-CR	187455-187486	32	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	148395-148426	0	1.0
NC_020384_2	2.12\|187455\|32\|NC_020384\|PILER-CR	187455-187486	32	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	292481-292512	0	1.0
NC_020384_2	2.12\|187455\|32\|NC_020384\|PILER-CR	187455-187486	32	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	143156-143187	0	1.0
NC_020384_2	2.13\|187522\|30\|NC_020384\|PILER-CR	187522-187551	30	NZ_CP017573	Bacillus thuringiensis strain SCG04-02 plasmid PSCG61, complete sequence	10724-10753	0	1.0
NC_020384_2	2.13\|187522\|30\|NC_020384\|PILER-CR	187522-187551	30	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	151771-151800	0	1.0
NC_020384_2	2.13\|187522\|30\|NC_020384\|PILER-CR	187522-187551	30	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	183297-183326	0	1.0
NC_020384_2	2.13\|187522\|30\|NC_020384\|PILER-CR	187522-187551	30	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	187522-187551	0	1.0
NC_020384_2	2.13\|187522\|30\|NC_020384\|PILER-CR	187522-187551	30	NZ_CP029456	Bacillus cereus strain FORC087 plasmid pFORC087.2, complete sequence	42956-42985	0	1.0
NC_020384_2	2.13\|187522\|30\|NC_020384\|PILER-CR	187522-187551	30	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	14588-14617	0	1.0
NC_020384_2	2.13\|187522\|30\|NC_020384\|PILER-CR	187522-187551	30	NZ_CP013280	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence	80321-80350	0	1.0
NC_020384_2	2.13\|187522\|30\|NC_020384\|PILER-CR	187522-187551	30	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	148462-148491	0	1.0
NC_020384_2	2.13\|187522\|30\|NC_020384\|PILER-CR	187522-187551	30	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	57724-57753	0	1.0
NC_020384_2	2.13\|187522\|30\|NC_020384\|PILER-CR	187522-187551	30	NC_011656	Bacillus cereus AH187 plasmid pAH187_45, complete sequence	9680-9709	0	1.0
NC_020384_2	2.13\|187522\|30\|NC_020384\|PILER-CR	187522-187551	30	NZ_CP039726	Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence	89367-89396	0	1.0
NC_020384_2	2.13\|187522\|30\|NC_020384\|PILER-CR	187522-187551	30	NC_018685	Bacillus thuringiensis MC28 plasmid pMC95, complete sequence	28741-28770	0	1.0
NC_020384_2	2.13\|187522\|30\|NC_020384\|PILER-CR	187522-187551	30	NZ_CP009350	Bacillus thuringiensis HD1002 plasmid 4, complete sequence	1708-1737	0	1.0
NC_020384_2	2.13\|187522\|30\|NC_020384\|PILER-CR	187522-187551	30	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	143223-143252	0	1.0
NC_020384_2	2.13\|187522\|30\|NC_020384\|PILER-CR	187522-187551	30	NZ_CP033793	Bacillus sp. FDAARGOS_527 plasmid unnamed6, complete sequence	7584-7613	0	1.0
NC_020384_2	2.13\|187522\|30\|NC_020384\|PILER-CR	187522-187551	30	NZ_CP047087	Bacillus paranthracis strain BC307 plasmid pCE2, complete sequence	65791-65820	0	1.0
NC_020384_2	2.13\|187522\|30\|NC_020384\|PILER-CR	187522-187551	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	697268-697297	0	1.0
NC_020384_2	2.13\|187522\|30\|NC_020384\|PILER-CR	187522-187551	30	NC_018510	Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence	186509-186538	0	1.0
NC_020384_2	2.13\|187522\|30\|NC_020384\|PILER-CR	187522-187551	30	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	16806-16835	0	1.0
NC_020384_2	2.13\|187522\|30\|NC_020384\|PILER-CR	187522-187551	30	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	292416-292445	0	1.0
NC_020384_2	2.13\|187522\|30\|NC_020384\|PILER-CR	187522-187551	30	CP041751	Bacillus paranthracis strain NCCP 14796 plasmid unnamed1, complete sequence	5828-5857	0	1.0
NC_020384_2	2.14\|187587\|30\|NC_020384\|PILER-CR	187587-187616	30	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	151836-151865	0	1.0
NC_020384_2	2.14\|187587\|30\|NC_020384\|PILER-CR	187587-187616	30	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	183362-183391	0	1.0
NC_020384_2	2.14\|187587\|30\|NC_020384\|PILER-CR	187587-187616	30	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	187587-187616	0	1.0
NC_020384_2	2.14\|187587\|30\|NC_020384\|PILER-CR	187587-187616	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	697203-697232	0	1.0
NC_020384_2	2.14\|187587\|30\|NC_020384\|PILER-CR	187587-187616	30	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	14653-14682	0	1.0
NC_020384_2	2.14\|187587\|30\|NC_020384\|PILER-CR	187587-187616	30	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	16741-16770	0	1.0
NC_020384_2	2.14\|187587\|30\|NC_020384\|PILER-CR	187587-187616	30	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	148527-148556	0	1.0
NC_020384_2	2.14\|187587\|30\|NC_020384\|PILER-CR	187587-187616	30	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	292351-292380	0	1.0
NC_020384_2	2.14\|187587\|30\|NC_020384\|PILER-CR	187587-187616	30	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	143288-143317	0	1.0
NC_020384_1	1.3\|179660\|34\|NC_020384\|CRISPRCasFinder	179660-179693	34	NZ_CP010096	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMBLin15, complete sequence	12891-12924	1	0.971
NC_020384_1	1.5\|179792\|35\|NC_020384\|CRISPRCasFinder	179792-179826	35	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	6865-6899	1	0.971
NC_020384_1	1.8\|179988\|33\|NC_020384\|CRISPRCasFinder	179988-180020	33	NZ_CP010096	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMBLin15, complete sequence	10984-11016	1	0.97
NC_020384_1	1.10\|180119\|33\|NC_020384\|CRISPRCasFinder	180119-180151	33	NC_017206	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence	81662-81694	1	0.97
NC_020384_1	1.10\|180119\|33\|NC_020384\|CRISPRCasFinder	180119-180151	33	NZ_CP047087	Bacillus paranthracis strain BC307 plasmid pCE2, complete sequence	70876-70908	1	0.97
NC_020384_1	1.10\|180119\|33\|NC_020384\|CRISPRCasFinder	180119-180151	33	NC_018510	Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence	191924-191956	1	0.97
NC_020384_1	1.10\|180119\|33\|NC_020384\|CRISPRCasFinder	180119-180151	33	NC_022882	Bacillus thuringiensis YBT-1518 plasmid pBMB0233, complete sequence	142461-142493	1	0.97
NC_020384_1	1.10\|180119\|33\|NC_020384\|CRISPRCasFinder	180119-180151	33	NC_020383	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence	62525-62557	1	0.97
NC_020384_1	1.10\|180119\|33\|NC_020384\|CRISPRCasFinder	180119-180151	33	NZ_CP013280	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence	74903-74935	1	0.97
NC_020384_1	1.10\|180119\|33\|NC_020384\|CRISPRCasFinder	180119-180151	33	NZ_CP039726	Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence	83949-83981	1	0.97
NC_020384_1	1.10\|180119\|33\|NC_020384\|CRISPRCasFinder	180119-180151	33	NZ_CP009350	Bacillus thuringiensis HD1002 plasmid 4, complete sequence	103733-103765	1	0.97
NC_020384_1	1.10\|180119\|33\|NC_020384\|CRISPRCasFinder	180119-180151	33	NC_022877	Bacillus thuringiensis YBT-1518 plasmid pBMB0232, complete sequence	89648-89680	1	0.97
NC_020384_1	1.10\|180119\|33\|NC_020384\|CRISPRCasFinder	180119-180151	33	CP016198	Bacillus thuringiensis serovar coreanensis strain ST7 plasmid pST7-4, complete sequence	32033-32065	1	0.97
NC_020384_1	1.11\|180184\|34\|NC_020384\|CRISPRCasFinder	180184-180217	34	NZ_CP020748	Bacillus mycoides strain Gnyt1 plasmid unnamed5, complete sequence	17567-17600	1	0.971
NC_020384_1	1.11\|180184\|34\|NC_020384\|CRISPRCasFinder	180184-180217	34	NZ_CP011157	Bacillus cereus strain HN001 plasmid pRML02, complete sequence	11311-11344	1	0.971
NC_020384_2	2.1\|187320\|35\|NC_020384\|CRT	187320-187354	35	NZ_CP014286	Bacillus thuringiensis strain Bt185 plasmid pBT1850054, complete sequence	47292-47326	1	0.971
NC_020384_2	2.1\|187320\|35\|NC_020384\|CRT	187320-187354	35	NZ_CP032610	Bacillus thuringiensis strain QZL38 plasmid p.3, complete sequence	20761-20795	1	0.971
NC_020384_2	2.4\|187520\|33\|NC_020384\|CRT	187520-187552	33	NC_017206	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence	76593-76625	1	0.97
NC_020384_2	2.4\|187520\|33\|NC_020384\|CRT	187520-187552	33	NC_020383	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence	57456-57488	1	0.97
NC_020384_2	2.4\|187520\|33\|NC_020384\|CRT	187520-187552	33	CP024689	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-5-125K, complete sequence	14979-15011	1	0.97
NC_020384_2	2.6\|187650\|33\|NC_020384\|CRT	187650-187682	33	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	142698-142730	1	0.97
NC_020384_2	2.6\|187650\|33\|NC_020384\|CRT	187650-187682	33	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	234599-234631	1	0.97
NC_020384_2	2.13\|187522\|30\|NC_020384\|PILER-CR	187522-187551	30	CP024689	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-5-125K, complete sequence	14981-15010	1	0.967
NC_020384_2	2.13\|187522\|30\|NC_020384\|PILER-CR	187522-187551	30	NC_017206	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence	76594-76623	1	0.967
NC_020384_2	2.13\|187522\|30\|NC_020384\|PILER-CR	187522-187551	30	NC_020383	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence	57457-57486	1	0.967
NC_020384_1	1.9\|180053\|34\|NC_020384\|CRISPRCasFinder	180053-180086	34	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704602-704635	2	0.941
NC_020384_1	1.9\|180053\|34\|NC_020384\|CRISPRCasFinder	180053-180086	34	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24140-24173	2	0.941
NC_020384_1	1.9\|180053\|34\|NC_020384\|CRISPRCasFinder	180053-180086	34	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6495-6528	2	0.941
NC_020384_1	1.9\|180053\|34\|NC_020384\|CRISPRCasFinder	180053-180086	34	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143793-143826	2	0.941
NC_020384_1	1.9\|180053\|34\|NC_020384\|CRISPRCasFinder	180053-180086	34	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175959-175992	2	0.941
NC_020384_1	1.9\|180053\|34\|NC_020384\|CRISPRCasFinder	180053-180086	34	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	180184-180217	2	0.941
NC_020384_1	1.9\|180053\|34\|NC_020384\|CRISPRCasFinder	180053-180086	34	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	7258-7291	2	0.941
NC_020384_1	1.9\|180053\|34\|NC_020384\|CRISPRCasFinder	180053-180086	34	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	141124-141157	2	0.941
NC_020384_1	1.9\|180053\|34\|NC_020384\|CRISPRCasFinder	180053-180086	34	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135856-135889	2	0.941
NC_020384_1	1.9\|180053\|34\|NC_020384\|CRISPRCasFinder	180053-180086	34	NZ_KX258624	Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence	50231-50264	2	0.941
NC_020384_1	1.10\|180119\|33\|NC_020384\|CRISPRCasFinder	180119-180151	33	NC_022782	Bacillus toyonensis BCT-7112 plasmid pBCT77, complete sequence	48450-48482	2	0.939
NC_020384_1	1.10\|180119\|33\|NC_020384\|CRISPRCasFinder	180119-180151	33	NZ_CP017573	Bacillus thuringiensis strain SCG04-02 plasmid PSCG61, complete sequence	5936-5968	2	0.939
NC_020384_1	1.10\|180119\|33\|NC_020384\|CRISPRCasFinder	180119-180151	33	NZ_CP029456	Bacillus cereus strain FORC087 plasmid pFORC087.2, complete sequence	37904-37936	2	0.939
NC_020384_1	1.10\|180119\|33\|NC_020384\|CRISPRCasFinder	180119-180151	33	NC_011656	Bacillus cereus AH187 plasmid pAH187_45, complete sequence	4616-4648	2	0.939
NC_020384_1	1.11\|180184\|34\|NC_020384\|CRISPRCasFinder	180184-180217	34	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704733-704766	2	0.941
NC_020384_1	1.11\|180184\|34\|NC_020384\|CRISPRCasFinder	180184-180217	34	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24271-24304	2	0.941
NC_020384_1	1.11\|180184\|34\|NC_020384\|CRISPRCasFinder	180184-180217	34	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6626-6659	2	0.941
NC_020384_1	1.11\|180184\|34\|NC_020384\|CRISPRCasFinder	180184-180217	34	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143662-143695	2	0.941
NC_020384_1	1.11\|180184\|34\|NC_020384\|CRISPRCasFinder	180184-180217	34	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175828-175861	2	0.941
NC_020384_1	1.11\|180184\|34\|NC_020384\|CRISPRCasFinder	180184-180217	34	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	180053-180086	2	0.941
NC_020384_1	1.11\|180184\|34\|NC_020384\|CRISPRCasFinder	180184-180217	34	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	7126-7159	2	0.941
NC_020384_1	1.11\|180184\|34\|NC_020384\|CRISPRCasFinder	180184-180217	34	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140993-141026	2	0.941
NC_020384_1	1.11\|180184\|34\|NC_020384\|CRISPRCasFinder	180184-180217	34	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135725-135758	2	0.941
NC_020384_1	1.19\|180044\|43\|NC_020384\|CRT	180044-180086	43	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704602-704644	2	0.953
NC_020384_1	1.19\|180044\|43\|NC_020384\|CRT	180044-180086	43	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24140-24182	2	0.953
NC_020384_1	1.19\|180044\|43\|NC_020384\|CRT	180044-180086	43	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6495-6537	2	0.953
NC_020384_1	1.19\|180044\|43\|NC_020384\|CRT	180044-180086	43	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143784-143826	2	0.953
NC_020384_1	1.19\|180044\|43\|NC_020384\|CRT	180044-180086	43	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175950-175992	2	0.953
NC_020384_1	1.19\|180044\|43\|NC_020384\|CRT	180044-180086	43	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	180175-180217	2	0.953
NC_020384_1	1.19\|180044\|43\|NC_020384\|CRT	180044-180086	43	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	141115-141157	2	0.953
NC_020384_1	1.19\|180044\|43\|NC_020384\|CRT	180044-180086	43	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135847-135889	2	0.953
NC_020384_1	1.19\|180044\|43\|NC_020384\|CRT	180044-180086	43	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	7117-7159	2	0.953
NC_020384_1	1.19\|180044\|43\|NC_020384\|CRT	180044-180086	43	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	7249-7291	2	0.953
NC_020384_1	1.19\|180044\|43\|NC_020384\|CRT	180044-180086	43	NZ_KX258624	Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence	50231-50273	2	0.953
NC_020384_1	1.21\|180175\|43\|NC_020384\|CRT	180175-180217	43	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704733-704775	2	0.953
NC_020384_1	1.21\|180175\|43\|NC_020384\|CRT	180175-180217	43	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24271-24313	2	0.953
NC_020384_1	1.21\|180175\|43\|NC_020384\|CRT	180175-180217	43	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6626-6668	2	0.953
NC_020384_1	1.21\|180175\|43\|NC_020384\|CRT	180175-180217	43	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143653-143695	2	0.953
NC_020384_1	1.21\|180175\|43\|NC_020384\|CRT	180175-180217	43	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175819-175861	2	0.953
NC_020384_1	1.21\|180175\|43\|NC_020384\|CRT	180175-180217	43	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	180044-180086	2	0.953
NC_020384_1	1.21\|180175\|43\|NC_020384\|CRT	180175-180217	43	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140984-141026	2	0.953
NC_020384_1	1.21\|180175\|43\|NC_020384\|CRT	180175-180217	43	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135716-135758	2	0.953
NC_020384_2	2.1\|187320\|35\|NC_020384\|CRT	187320-187354	35	CP020757	Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-18, complete sequence	14280-14314	2	0.943
NC_020384_2	2.1\|187320\|35\|NC_020384\|CRT	187320-187354	35	CP020757	Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-18, complete sequence	73882-73916	2	0.943
NC_020384_2	2.1\|187320\|35\|NC_020384\|CRT	187320-187354	35	NZ_CP021064	Bacillus thuringiensis strain ATCC 10792 plasmid poh3, complete sequence	21545-21579	2	0.943
NC_020384_2	2.1\|187320\|35\|NC_020384\|CRT	187320-187354	35	NZ_CP021064	Bacillus thuringiensis strain ATCC 10792 plasmid poh3, complete sequence	81225-81259	2	0.943
NC_020384_2	2.1\|187320\|35\|NC_020384\|CRT	187320-187354	35	NC_017204	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT51, complete sequence	43937-43971	2	0.943
NC_020384_2	2.4\|187520\|33\|NC_020384\|CRT	187520-187552	33	NC_022882	Bacillus thuringiensis YBT-1518 plasmid pBMB0233, complete sequence	134342-134374	2	0.939
NC_020384_2	2.4\|187520\|33\|NC_020384\|CRT	187520-187552	33	NC_022782	Bacillus toyonensis BCT-7112 plasmid pBCT77, complete sequence	43135-43167	2	0.939
NC_020384_2	2.4\|187520\|33\|NC_020384\|CRT	187520-187552	33	NC_022877	Bacillus thuringiensis YBT-1518 plasmid pBMB0232, complete sequence	97767-97799	2	0.939
NC_020384_2	2.6\|187650\|33\|NC_020384\|CRT	187650-187682	33	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	53303-53335	2	0.939
NC_020384_2	2.13\|187522\|30\|NC_020384\|PILER-CR	187522-187551	30	NC_022877	Bacillus thuringiensis YBT-1518 plasmid pBMB0232, complete sequence	97769-97798	2	0.933
NC_020384_2	2.13\|187522\|30\|NC_020384\|PILER-CR	187522-187551	30	NC_022882	Bacillus thuringiensis YBT-1518 plasmid pBMB0233, complete sequence	134343-134372	2	0.933
NC_020384_2	2.13\|187522\|30\|NC_020384\|PILER-CR	187522-187551	30	NC_022782	Bacillus toyonensis BCT-7112 plasmid pBCT77, complete sequence	43136-43165	2	0.933
NC_020384_1	1.1\|179663\|30\|NC_020384\|PILER-CR	179663-179692	30	NZ_CP004882	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMBLin15, complete sequence	12815-12844	3	0.9
NC_020384_1	1.1\|179663\|30\|NC_020384\|PILER-CR	179663-179692	30	NZ_CP011355	Bacillus thuringiensis strain YC-10 plasmid pYC10, complete sequence	9711-9740	3	0.9
NC_020384_1	1.1\|179663\|30\|NC_020384\|PILER-CR	179663-179692	30	NC_006945	Bacillus phage GIL16c, complete genome	12806-12835	3	0.9
NC_020384_1	1.1\|179663\|30\|NC_020384\|PILER-CR	179663-179692	30	AY701338	Bacillus thuringiensis phage GIL16c, complete genome	12806-12835	3	0.9
NC_020384_1	1.8\|179988\|33\|NC_020384\|CRISPRCasFinder	179988-180020	33	NZ_AP014870	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK6	7217-7249	3	0.909
NC_020384_1	1.16\|179850\|41\|NC_020384\|CRT	179850-179890	41	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	6924-6964	3	0.927
NC_020384_2	2.2\|187387\|34\|NC_020384\|CRT	187387-187420	34	MH598512	Bacillus phage Wes44, complete genome	12676-12709	3	0.912
NC_020384_1	1.3\|179660\|34\|NC_020384\|CRISPRCasFinder	179660-179693	34	NZ_CP004882	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMBLin15, complete sequence	12814-12847	4	0.882
NC_020384_1	1.3\|179660\|34\|NC_020384\|CRISPRCasFinder	179660-179693	34	NZ_CP011355	Bacillus thuringiensis strain YC-10 plasmid pYC10, complete sequence	9710-9743	4	0.882
NC_020384_1	1.3\|179660\|34\|NC_020384\|CRISPRCasFinder	179660-179693	34	NC_006945	Bacillus phage GIL16c, complete genome	12805-12838	4	0.882
NC_020384_1	1.3\|179660\|34\|NC_020384\|CRISPRCasFinder	179660-179693	34	AY701338	Bacillus thuringiensis phage GIL16c, complete genome	12805-12838	4	0.882
NC_020384_1	1.16\|179850\|41\|NC_020384\|CRT	179850-179890	41	NZ_CP004871	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB46, complete sequence	26379-26419	4	0.902
NC_020384_1	1.16\|179850\|41\|NC_020384\|CRT	179850-179890	41	NZ_CP011352	Bacillus thuringiensis strain YC-10 plasmid pYC4, complete sequence	37039-37079	4	0.902
NC_020384_1	1.16\|179850\|41\|NC_020384\|CRT	179850-179890	41	NZ_CP013060	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-5, complete sequence	9623-9663	4	0.902
NC_020384_1	1.16\|179850\|41\|NC_020384\|CRT	179850-179890	41	NZ_CP010095	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB47, complete sequence	26379-26419	4	0.902
NC_020384_1	1.16\|179850\|41\|NC_020384\|CRT	179850-179890	41	MK843319	Bacillus phage vB_BthS-TP21T, complete genome	34434-34474	4	0.902
NC_020384_1	1.16\|179850\|41\|NC_020384\|CRT	179850-179890	41	KT970646	Bacillus phage phiS58, complete genome	34434-34474	4	0.902
NC_020384_1	1.16\|179850\|41\|NC_020384\|CRT	179850-179890	41	KJ024807	Bacillus phage vB_BtS_BMBtp3, complete genome	34633-34673	4	0.902
NC_020384_1	1.16\|179850\|41\|NC_020384\|CRT	179850-179890	41	NC_023074	Bacillus thuringiensis serovar tenebrionis str. YBT-1765 plasmid pBMB165, complete sequence	37573-37613	4	0.902
NC_020384_1	1.16\|179850\|41\|NC_020384\|CRT	179850-179890	41	NC_025424	Bacillus phage Waukesha92, complete genome	11483-11523	4	0.902
NC_020384_1	1.21\|180175\|43\|NC_020384\|CRT	180175-180217	43	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	7117-7159	4	0.907
NC_020384_1	1.8\|179988\|33\|NC_020384\|CRISPRCasFinder	179988-180020	33	NZ_CP004882	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMBLin15, complete sequence	10906-10938	5	0.848
NC_020384_1	1.8\|179988\|33\|NC_020384\|CRISPRCasFinder	179988-180020	33	NZ_CP011355	Bacillus thuringiensis strain YC-10 plasmid pYC10, complete sequence	7802-7834	5	0.848
NC_020384_1	1.8\|179988\|33\|NC_020384\|CRISPRCasFinder	179988-180020	33	NC_006945	Bacillus phage GIL16c, complete genome	10897-10929	5	0.848
NC_020384_1	1.8\|179988\|33\|NC_020384\|CRISPRCasFinder	179988-180020	33	AY701338	Bacillus thuringiensis phage GIL16c, complete genome	10897-10929	5	0.848
NC_020384_1	1.11\|180184\|34\|NC_020384\|CRISPRCasFinder	180184-180217	34	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	151419-151452	5	0.853
NC_020384_1	1.11\|180184\|34\|NC_020384\|CRISPRCasFinder	180184-180217	34	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	243320-243353	5	0.853
NC_020384_1	1.20\|180110\|42\|NC_020384\|CRT	180110-180151	42	CP041751	Bacillus paranthracis strain NCCP 14796 plasmid unnamed1, complete sequence	10904-10945	5	0.881
NC_020384_1	1.20\|180110\|42\|NC_020384\|CRT	180110-180151	42	NZ_CP033793	Bacillus sp. FDAARGOS_527 plasmid unnamed6, complete sequence	2200-2241	5	0.881
NC_020384_1	1.20\|180110\|42\|NC_020384\|CRT	180110-180151	42	NC_017206	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence	81653-81694	5	0.881
NC_020384_1	1.20\|180110\|42\|NC_020384\|CRT	180110-180151	42	NC_018510	Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence	191915-191956	5	0.881
NC_020384_1	1.20\|180110\|42\|NC_020384\|CRT	180110-180151	42	NZ_CP013280	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence	74903-74944	5	0.881
NC_020384_1	1.20\|180110\|42\|NC_020384\|CRT	180110-180151	42	NZ_CP039726	Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence	83949-83990	5	0.881
NC_020384_1	1.20\|180110\|42\|NC_020384\|CRT	180110-180151	42	NC_022882	Bacillus thuringiensis YBT-1518 plasmid pBMB0233, complete sequence	142452-142493	5	0.881
NC_020384_1	1.20\|180110\|42\|NC_020384\|CRT	180110-180151	42	NZ_CP009350	Bacillus thuringiensis HD1002 plasmid 4, complete sequence	103733-103774	5	0.881
NC_020384_1	1.20\|180110\|42\|NC_020384\|CRT	180110-180151	42	NC_022877	Bacillus thuringiensis YBT-1518 plasmid pBMB0232, complete sequence	89648-89689	5	0.881
NC_020384_1	1.20\|180110\|42\|NC_020384\|CRT	180110-180151	42	NC_020383	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence	62516-62557	5	0.881
NC_020384_1	1.21\|180175\|43\|NC_020384\|CRT	180175-180217	43	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	151419-151461	5	0.884
NC_020384_1	1.21\|180175\|43\|NC_020384\|CRT	180175-180217	43	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	243320-243362	5	0.884
NC_020384_1	1.20\|180110\|42\|NC_020384\|CRT	180110-180151	42	CP024689	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-5-125K, complete sequence	6571-6612	6	0.857
NC_020384_1	1.20\|180110\|42\|NC_020384\|CRT	180110-180151	42	NC_018685	Bacillus thuringiensis MC28 plasmid pMC95, complete sequence	23122-23163	6	0.857
NC_020384_1	1.20\|180110\|42\|NC_020384\|CRT	180110-180151	42	NZ_CP047087	Bacillus paranthracis strain BC307 plasmid pCE2, complete sequence	70867-70908	6	0.857
NC_020384_1	1.20\|180110\|42\|NC_020384\|CRT	180110-180151	42	CP016198	Bacillus thuringiensis serovar coreanensis strain ST7 plasmid pST7-4, complete sequence	32033-32074	6	0.857
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	MN692959	Marine virus AFVG_117M52, complete genome	47041-47072	7	0.781
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	MN855765	Myoviridae sp. isolate 14, complete genome	5886-5917	7	0.781
NC_020384_1	1.20\|180110\|42\|NC_020384\|CRT	180110-180151	42	NZ_CP017573	Bacillus thuringiensis strain SCG04-02 plasmid PSCG61, complete sequence	5936-5977	7	0.833
NC_020384_1	1.20\|180110\|42\|NC_020384\|CRT	180110-180151	42	NZ_CP029456	Bacillus cereus strain FORC087 plasmid pFORC087.2, complete sequence	37904-37945	7	0.833
NC_020384_1	1.20\|180110\|42\|NC_020384\|CRT	180110-180151	42	NC_011656	Bacillus cereus AH187 plasmid pAH187_45, complete sequence	4616-4657	7	0.833
NC_020384_1	1.20\|180110\|42\|NC_020384\|CRT	180110-180151	42	NC_022782	Bacillus toyonensis BCT-7112 plasmid pBCT77, complete sequence	48441-48482	7	0.833
NC_020384_1	1.21\|180175\|43\|NC_020384\|CRT	180175-180217	43	NZ_CP020748	Bacillus mycoides strain Gnyt1 plasmid unnamed5, complete sequence	17567-17609	7	0.837
NC_020384_1	1.21\|180175\|43\|NC_020384\|CRT	180175-180217	43	NZ_CP011157	Bacillus cereus strain HN001 plasmid pRML02, complete sequence	11311-11353	7	0.837
NC_020384_2	2.7\|187322\|43\|NC_020384\|CRISPRCasFinder	187322-187364	43	NZ_CP014286	Bacillus thuringiensis strain Bt185 plasmid pBT1850054, complete sequence	47294-47336	7	0.837
NC_020384_2	2.7\|187322\|43\|NC_020384\|CRISPRCasFinder	187322-187364	43	NZ_CP032610	Bacillus thuringiensis strain QZL38 plasmid p.3, complete sequence	20751-20793	7	0.837
NC_020384_2	2.10\|187522\|41\|NC_020384\|CRISPRCasFinder	187522-187562	41	NZ_CP017573	Bacillus thuringiensis strain SCG04-02 plasmid PSCG61, complete sequence	10724-10764	7	0.829
NC_020384_2	2.10\|187522\|41\|NC_020384\|CRISPRCasFinder	187522-187562	41	NZ_CP029456	Bacillus cereus strain FORC087 plasmid pFORC087.2, complete sequence	42956-42996	7	0.829
NC_020384_2	2.10\|187522\|41\|NC_020384\|CRISPRCasFinder	187522-187562	41	NZ_CP013280	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence	80321-80361	7	0.829
NC_020384_2	2.10\|187522\|41\|NC_020384\|CRISPRCasFinder	187522-187562	41	NC_011656	Bacillus cereus AH187 plasmid pAH187_45, complete sequence	9680-9720	7	0.829
NC_020384_2	2.10\|187522\|41\|NC_020384\|CRISPRCasFinder	187522-187562	41	NZ_CP039726	Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence	89367-89407	7	0.829
NC_020384_2	2.10\|187522\|41\|NC_020384\|CRISPRCasFinder	187522-187562	41	NC_018685	Bacillus thuringiensis MC28 plasmid pMC95, complete sequence	28741-28781	7	0.829
NC_020384_2	2.10\|187522\|41\|NC_020384\|CRISPRCasFinder	187522-187562	41	NZ_CP009350	Bacillus thuringiensis HD1002 plasmid 4, complete sequence	1708-1748	7	0.829
NC_020384_2	2.10\|187522\|41\|NC_020384\|CRISPRCasFinder	187522-187562	41	NZ_CP033793	Bacillus sp. FDAARGOS_527 plasmid unnamed6, complete sequence	7584-7624	7	0.829
NC_020384_2	2.10\|187522\|41\|NC_020384\|CRISPRCasFinder	187522-187562	41	NZ_CP047087	Bacillus paranthracis strain BC307 plasmid pCE2, complete sequence	65780-65820	7	0.829
NC_020384_2	2.10\|187522\|41\|NC_020384\|CRISPRCasFinder	187522-187562	41	NC_018510	Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence	186498-186538	7	0.829
NC_020384_2	2.10\|187522\|41\|NC_020384\|CRISPRCasFinder	187522-187562	41	CP041751	Bacillus paranthracis strain NCCP 14796 plasmid unnamed1, complete sequence	5817-5857	7	0.829
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	KF114879	Leptospira phage LbrZ_5399, complete genome	54875-54906	8	0.75
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	KF114880	Leptospira phage LinZ_10, complete genome	63450-63481	8	0.75
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	KX656785	UNVERIFIED: Leptospira phage Lin_34, complete genome	44219-44250	8	0.75
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	MN693414	Marine virus AFVG_25M246, complete genome	29744-29775	8	0.75
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	MN693468	Marine virus AFVG_25M247, complete genome	26957-26988	8	0.75
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	MN693065	Marine virus AFVG_25M245, complete genome	32108-32139	8	0.75
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	MN693042	Marine virus AFVG_25M244, complete genome	2781-2812	8	0.75
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	410251-410282	8	0.75
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	1331287-1331318	8	0.75
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	245907-245938	8	0.75
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	396540-396571	8	0.75
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	1397510-1397541	8	0.75
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	1648116-1648147	8	0.75
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NZ_CP053834	Arcobacter cloacae strain LMG 26153 plasmid pACLO, complete sequence	67012-67043	8	0.75
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NZ_CP013276	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-1-360K, complete sequence	321345-321376	8	0.75
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	391492-391523	8	0.75
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NZ_CP039722	Bacillus thuringiensis strain BT-59 plasmid p1, complete sequence	99134-99165	8	0.75
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	751194-751225	8	0.75
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	657098-657129	8	0.75
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	1017333-1017364	8	0.75
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	286611-286642	8	0.75
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	557921-557952	8	0.75
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	1180286-1180317	8	0.75
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	608940-608971	8	0.75
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NZ_CP009349	Bacillus thuringiensis HD1002 plasmid 1, complete sequence	37875-37906	8	0.75
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	545410-545441	8	0.75
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	408365-408396	8	0.75
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	1449741-1449772	8	0.75
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NZ_CP045023	Bacillus thuringiensis strain JW-1 plasmid p1, complete sequence	321346-321377	8	0.75
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	1226034-1226065	8	0.75
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	1331293-1331324	8	0.75
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	AJ748296	Sulfolobus islandicus rudivirus 1 variant XX, complete genome	8874-8905	8	0.75
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	L35061	Bacteriophage phi-41 orfs L1-12, complete cds's, orf 13, 5' end	1064-1095	8	0.75
NC_020384_1	1.13\|179651\|43\|NC_020384\|CRT	179651-179693	43	NZ_CP010096	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMBLin15, complete sequence	12891-12933	8	0.814
NC_020384_1	1.18\|179979\|42\|NC_020384\|CRT	179979-180020	42	NZ_CP053974	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed5, complete sequence	2157-2198	8	0.81
NC_020384_1	1.18\|179979\|42\|NC_020384\|CRT	179979-180020	42	NZ_CP009346	Bacillus thuringiensis HD1002 plasmid 5, complete sequence	3933-3974	8	0.81
NC_020384_1	1.18\|179979\|42\|NC_020384\|CRT	179979-180020	42	NZ_CP045027	Bacillus thuringiensis strain JW-1 plasmid p5, complete sequence	3931-3972	8	0.81
NC_020384_1	1.18\|179979\|42\|NC_020384\|CRT	179979-180020	42	CP013282	Bacillus phage pGIL02, complete sequence	3933-3974	8	0.81
NC_020384_1	1.18\|179979\|42\|NC_020384\|CRT	179979-180020	42	NC_005258	Bacillus phage Bam35c, complete genome	10962-11003	8	0.81
NC_020384_1	1.18\|179979\|42\|NC_020384\|CRT	179979-180020	42	AY257527	Bacillus thuringiensis bacteriophage Bam35c, complete genome	10962-11003	8	0.81
NC_020384_1	1.18\|179979\|42\|NC_020384\|CRT	179979-180020	42	AJ536073	Bacillus phage pGIL01, complete genome	10960-11001	8	0.81
NC_020384_2	2.7\|187322\|43\|NC_020384\|CRISPRCasFinder	187322-187364	43	NC_017204	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT51, complete sequence	43927-43969	8	0.814
NC_020384_2	2.7\|187322\|43\|NC_020384\|CRISPRCasFinder	187322-187364	43	CP020757	Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-18, complete sequence	14282-14324	8	0.814
NC_020384_2	2.7\|187322\|43\|NC_020384\|CRISPRCasFinder	187322-187364	43	CP020757	Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-18, complete sequence	73884-73926	8	0.814
NC_020384_2	2.7\|187322\|43\|NC_020384\|CRISPRCasFinder	187322-187364	43	NZ_CP021064	Bacillus thuringiensis strain ATCC 10792 plasmid poh3, complete sequence	21547-21589	8	0.814
NC_020384_2	2.7\|187322\|43\|NC_020384\|CRISPRCasFinder	187322-187364	43	NZ_CP021064	Bacillus thuringiensis strain ATCC 10792 plasmid poh3, complete sequence	81227-81269	8	0.814
NC_020384_2	2.10\|187522\|41\|NC_020384\|CRISPRCasFinder	187522-187562	41	CP024689	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-5-125K, complete sequence	14981-15021	8	0.805
NC_020384_2	2.10\|187522\|41\|NC_020384\|CRISPRCasFinder	187522-187562	41	NC_017206	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence	76583-76623	8	0.805
NC_020384_2	2.10\|187522\|41\|NC_020384\|CRISPRCasFinder	187522-187562	41	NC_020383	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence	57446-57486	8	0.805
NC_020384_2	2.14\|187587\|30\|NC_020384\|PILER-CR	187587-187616	30	MN694586	Marine virus AFVG_250M370, complete genome	30059-30088	8	0.733
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	AP013489	Uncultured Mediterranean phage uvMED DNA, complete genome, group G19, isolate: uvMED-CGR-C30A-MedDCM-OCT-S45-C81	28802-28833	9	0.719
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	MN698245	Pelagibacter phage HTVC111P, complete genome	31276-31307	9	0.719
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	AP013487	Uncultured Mediterranean phage uvMED DNA, complete genome, group G19, isolate: uvMED-CGR-C30A-MedDCM-OCT-S33-C83	14788-14819	9	0.719
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NC_021794	Cellulophaga phage phi18:3, complete genome	54281-54312	9	0.719
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	1024589-1024620	9	0.719
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	MN693376	Marine virus AFVG_25M306, complete genome	10198-10229	9	0.719
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	KY065482	Streptococcus phage IPP42, complete genome	11351-11382	9	0.719
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	KY065483	Streptococcus phage IPP43, complete genome	11953-11984	9	0.719
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	MH853357	Streptococcus phage LF3, partial genome	31519-31550	9	0.719
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	KY363359	Streptococcus phage Str03, complete genome	32004-32035	9	0.719
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	MK448731	Streptococcus phage Javan33, complete genome	16103-16134	9	0.719
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	KY065489	Streptococcus phage IPP51, complete genome	11789-11820	9	0.719
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	KY065484	Streptococcus phage IPP44, complete genome	11670-11701	9	0.719
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	MK448992	Streptococcus phage Javan6, complete genome	14110-14141	9	0.719
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	MT774388	CrAssphage cr112_1, complete genome	69862-69893	9	0.719
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NC_030946	Streptococcus phage phiARI0923, complete genome	21680-21711	9	0.719
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	MK448734	Streptococcus phage Javan347, complete genome	11840-11871	9	0.719
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	MN693062	Marine virus AFVG_25M389, complete genome	27193-27224	9	0.719
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	KY065481	Streptococcus phage IPP41, complete genome	11172-11203	9	0.719
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	MK448888	Streptococcus phage Javan26, complete genome	14075-14106	9	0.719
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	MK448863	Streptococcus phage Javan18, complete genome	12322-12353	9	0.719
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	NC_027396	Streptococcus phage SpSL1, complete genome	32940-32971	9	0.719
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	KY065449	Streptococcus phage IPP5, complete genome	12549-12580	9	0.719
NC_020384_1	1.18\|179979\|42\|NC_020384\|CRT	179979-180020	42	NZ_CP010096	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMBLin15, complete sequence	10975-11016	9	0.786
NC_020384_2	2.8\|187389\|42\|NC_020384\|CRISPRCasFinder	187389-187430	42	MH598512	Bacillus phage Wes44, complete genome	12666-12707	9	0.786
NC_020384_2	2.10\|187522\|41\|NC_020384\|CRISPRCasFinder	187522-187562	41	NC_022877	Bacillus thuringiensis YBT-1518 plasmid pBMB0232, complete sequence	97769-97809	9	0.78
NC_020384_2	2.10\|187522\|41\|NC_020384\|CRISPRCasFinder	187522-187562	41	NC_022882	Bacillus thuringiensis YBT-1518 plasmid pBMB0233, complete sequence	134332-134372	9	0.78
NC_020384_2	2.10\|187522\|41\|NC_020384\|CRISPRCasFinder	187522-187562	41	NC_022782	Bacillus toyonensis BCT-7112 plasmid pBCT77, complete sequence	43125-43165	9	0.78
NC_020384_1	1.6\|179859\|32\|NC_020384\|CRISPRCasFinder	179859-179890	32	AP014291	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S25-C40, * SEQUENCING IN PROGRESS *	18771-18802	10	0.688

1. spacer 1.1|179663|30|NC_020384|PILER-CR matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

agatacgagaatttaatgacgtcacccaca	CRISPR spacer
agatacgagaatttaatgacgtcacccaca	Protospacer
******************************

2. spacer 1.1|179663|30|NC_020384|PILER-CR matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

agatacgagaatttaatgacgtcacccaca	CRISPR spacer
agatacgagaatttaatgacgtcacccaca	Protospacer
******************************

3. spacer 1.1|179663|30|NC_020384|PILER-CR matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

agatacgagaatttaatgacgtcacccaca	CRISPR spacer
agatacgagaatttaatgacgtcacccaca	Protospacer
******************************

4. spacer 1.1|179663|30|NC_020384|PILER-CR matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

agatacgagaatttaatgacgtcacccaca	CRISPR spacer
agatacgagaatttaatgacgtcacccaca	Protospacer
******************************

5. spacer 1.1|179663|30|NC_020384|PILER-CR matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

agatacgagaatttaatgacgtcacccaca	CRISPR spacer
agatacgagaatttaatgacgtcacccaca	Protospacer
******************************

6. spacer 1.1|179663|30|NC_020384|PILER-CR matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

agatacgagaatttaatgacgtcacccaca	CRISPR spacer
agatacgagaatttaatgacgtcacccaca	Protospacer
******************************

7. spacer 1.1|179663|30|NC_020384|PILER-CR matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

agatacgagaatttaatgacgtcacccaca	CRISPR spacer
agatacgagaatttaatgacgtcacccaca	Protospacer
******************************

8. spacer 1.1|179663|30|NC_020384|PILER-CR matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

agatacgagaatttaatgacgtcacccaca	CRISPR spacer
agatacgagaatttaatgacgtcacccaca	Protospacer
******************************

9. spacer 1.1|179663|30|NC_020384|PILER-CR matches to NZ_CP010096 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMBLin15, complete sequence) position: , mismatch: 0, identity: 1.0

agatacgagaatttaatgacgtcacccaca	CRISPR spacer
agatacgagaatttaatgacgtcacccaca	Protospacer
******************************

10. spacer 1.2|179729|33|NC_020384|PILER-CR matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

tattgttacacctttagagtatccgagtaaaaa	CRISPR spacer
tattgttacacctttagagtatccgagtaaaaa	Protospacer
*********************************

11. spacer 1.2|179729|33|NC_020384|PILER-CR matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

tattgttacacctttagagtatccgagtaaaaa	CRISPR spacer
tattgttacacctttagagtatccgagtaaaaa	Protospacer
*********************************

12. spacer 1.2|179729|33|NC_020384|PILER-CR matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

tattgttacacctttagagtatccgagtaaaaa	CRISPR spacer
tattgttacacctttagagtatccgagtaaaaa	Protospacer
*********************************

13. spacer 1.2|179729|33|NC_020384|PILER-CR matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

tattgttacacctttagagtatccgagtaaaaa	CRISPR spacer
tattgttacacctttagagtatccgagtaaaaa	Protospacer
*********************************

14. spacer 1.2|179729|33|NC_020384|PILER-CR matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

tattgttacacctttagagtatccgagtaaaaa	CRISPR spacer
tattgttacacctttagagtatccgagtaaaaa	Protospacer
*********************************

15. spacer 1.2|179729|33|NC_020384|PILER-CR matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

tattgttacacctttagagtatccgagtaaaaa	CRISPR spacer
tattgttacacctttagagtatccgagtaaaaa	Protospacer
*********************************

16. spacer 1.2|179729|33|NC_020384|PILER-CR matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

tattgttacacctttagagtatccgagtaaaaa	CRISPR spacer
tattgttacacctttagagtatccgagtaaaaa	Protospacer
*********************************

17. spacer 1.2|179729|33|NC_020384|PILER-CR matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

tattgttacacctttagagtatccgagtaaaaa	CRISPR spacer
tattgttacacctttagagtatccgagtaaaaa	Protospacer
*********************************

18. spacer 1.3|179660|34|NC_020384|CRISPRCasFinder matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

acaagatacgagaatttaatgacgtcacccacat	CRISPR spacer
acaagatacgagaatttaatgacgtcacccacat	Protospacer
**********************************

19. spacer 1.3|179660|34|NC_020384|CRISPRCasFinder matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

acaagatacgagaatttaatgacgtcacccacat	CRISPR spacer
acaagatacgagaatttaatgacgtcacccacat	Protospacer
**********************************

20. spacer 1.3|179660|34|NC_020384|CRISPRCasFinder matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

acaagatacgagaatttaatgacgtcacccacat	CRISPR spacer
acaagatacgagaatttaatgacgtcacccacat	Protospacer
**********************************

21. spacer 1.3|179660|34|NC_020384|CRISPRCasFinder matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

acaagatacgagaatttaatgacgtcacccacat	CRISPR spacer
acaagatacgagaatttaatgacgtcacccacat	Protospacer
**********************************

22. spacer 1.3|179660|34|NC_020384|CRISPRCasFinder matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

acaagatacgagaatttaatgacgtcacccacat	CRISPR spacer
acaagatacgagaatttaatgacgtcacccacat	Protospacer
**********************************

23. spacer 1.3|179660|34|NC_020384|CRISPRCasFinder matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

acaagatacgagaatttaatgacgtcacccacat	CRISPR spacer
acaagatacgagaatttaatgacgtcacccacat	Protospacer
**********************************

24. spacer 1.3|179660|34|NC_020384|CRISPRCasFinder matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

acaagatacgagaatttaatgacgtcacccacat	CRISPR spacer
acaagatacgagaatttaatgacgtcacccacat	Protospacer
**********************************

25. spacer 1.3|179660|34|NC_020384|CRISPRCasFinder matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

acaagatacgagaatttaatgacgtcacccacat	CRISPR spacer
acaagatacgagaatttaatgacgtcacccacat	Protospacer
**********************************

26. spacer 1.4|179726|34|NC_020384|CRISPRCasFinder matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

tattgttacacctttagagtatccgagtaaaaaa	CRISPR spacer
tattgttacacctttagagtatccgagtaaaaaa	Protospacer
**********************************

27. spacer 1.4|179726|34|NC_020384|CRISPRCasFinder matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

tattgttacacctttagagtatccgagtaaaaaa	CRISPR spacer
tattgttacacctttagagtatccgagtaaaaaa	Protospacer
**********************************

28. spacer 1.4|179726|34|NC_020384|CRISPRCasFinder matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

tattgttacacctttagagtatccgagtaaaaaa	CRISPR spacer
tattgttacacctttagagtatccgagtaaaaaa	Protospacer
**********************************

29. spacer 1.4|179726|34|NC_020384|CRISPRCasFinder matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

tattgttacacctttagagtatccgagtaaaaaa	CRISPR spacer
tattgttacacctttagagtatccgagtaaaaaa	Protospacer
**********************************

30. spacer 1.4|179726|34|NC_020384|CRISPRCasFinder matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

tattgttacacctttagagtatccgagtaaaaaa	CRISPR spacer
tattgttacacctttagagtatccgagtaaaaaa	Protospacer
**********************************

31. spacer 1.4|179726|34|NC_020384|CRISPRCasFinder matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

tattgttacacctttagagtatccgagtaaaaaa	CRISPR spacer
tattgttacacctttagagtatccgagtaaaaaa	Protospacer
**********************************

32. spacer 1.4|179726|34|NC_020384|CRISPRCasFinder matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

tattgttacacctttagagtatccgagtaaaaaa	CRISPR spacer
tattgttacacctttagagtatccgagtaaaaaa	Protospacer
**********************************

33. spacer 1.4|179726|34|NC_020384|CRISPRCasFinder matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

tattgttacacctttagagtatccgagtaaaaaa	CRISPR spacer
tattgttacacctttagagtatccgagtaaaaaa	Protospacer
**********************************

34. spacer 1.5|179792|35|NC_020384|CRISPRCasFinder matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

acaatgggaaagtgttaggttatgcacgttttaaa	CRISPR spacer
acaatgggaaagtgttaggttatgcacgttttaaa	Protospacer
***********************************

35. spacer 1.5|179792|35|NC_020384|CRISPRCasFinder matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

acaatgggaaagtgttaggttatgcacgttttaaa	CRISPR spacer
acaatgggaaagtgttaggttatgcacgttttaaa	Protospacer
***********************************

36. spacer 1.5|179792|35|NC_020384|CRISPRCasFinder matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

acaatgggaaagtgttaggttatgcacgttttaaa	CRISPR spacer
acaatgggaaagtgttaggttatgcacgttttaaa	Protospacer
***********************************

37. spacer 1.5|179792|35|NC_020384|CRISPRCasFinder matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

acaatgggaaagtgttaggttatgcacgttttaaa	CRISPR spacer
acaatgggaaagtgttaggttatgcacgttttaaa	Protospacer
***********************************

38. spacer 1.5|179792|35|NC_020384|CRISPRCasFinder matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

acaatgggaaagtgttaggttatgcacgttttaaa	CRISPR spacer
acaatgggaaagtgttaggttatgcacgttttaaa	Protospacer
***********************************

39. spacer 1.5|179792|35|NC_020384|CRISPRCasFinder matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

acaatgggaaagtgttaggttatgcacgttttaaa	CRISPR spacer
acaatgggaaagtgttaggttatgcacgttttaaa	Protospacer
***********************************

40. spacer 1.5|179792|35|NC_020384|CRISPRCasFinder matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

acaatgggaaagtgttaggttatgcacgttttaaa	CRISPR spacer
acaatgggaaagtgttaggttatgcacgttttaaa	Protospacer
***********************************

41. spacer 1.5|179792|35|NC_020384|CRISPRCasFinder matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

acaatgggaaagtgttaggttatgcacgttttaaa	CRISPR spacer
acaatgggaaagtgttaggttatgcacgttttaaa	Protospacer
***********************************

42. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NZ_CP004871 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB46, complete sequence) position: , mismatch: 0, identity: 1.0

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
gaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
********************************

43. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
gaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
********************************

44. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
gaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
********************************

45. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
gaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
********************************

46. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NC_023074 (Bacillus thuringiensis serovar tenebrionis str. YBT-1765 plasmid pBMB165, complete sequence) position: , mismatch: 0, identity: 1.0

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
gaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
********************************

47. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
gaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
********************************

48. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NZ_CP011352 (Bacillus thuringiensis strain YC-10 plasmid pYC4, complete sequence) position: , mismatch: 0, identity: 1.0

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
gaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
********************************

49. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
gaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
********************************

50. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
gaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
********************************

51. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NZ_CP013060 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-5, complete sequence) position: , mismatch: 0, identity: 1.0

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
gaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
********************************

52. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
gaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
********************************

53. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
gaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
********************************

54. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NZ_CP010095 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB47, complete sequence) position: , mismatch: 0, identity: 1.0

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
gaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
********************************

55. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to MK843319 (Bacillus phage vB_BthS-TP21T, complete genome) position: , mismatch: 0, identity: 1.0

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
gaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
********************************

56. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to KT970646 (Bacillus phage phiS58, complete genome) position: , mismatch: 0, identity: 1.0

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
gaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
********************************

57. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to KJ024807 (Bacillus phage vB_BtS_BMBtp3, complete genome) position: , mismatch: 0, identity: 1.0

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
gaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
********************************

58. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NC_025424 (Bacillus phage Waukesha92, complete genome) position: , mismatch: 0, identity: 1.0

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
gaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
********************************

59. spacer 1.7|179923|33|NC_020384|CRISPRCasFinder matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

tttgttgctccagtcgttatgatcgtctttgca	CRISPR spacer
tttgttgctccagtcgttatgatcgtctttgca	Protospacer
*********************************

60. spacer 1.7|179923|33|NC_020384|CRISPRCasFinder matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

tttgttgctccagtcgttatgatcgtctttgca	CRISPR spacer
tttgttgctccagtcgttatgatcgtctttgca	Protospacer
*********************************

61. spacer 1.7|179923|33|NC_020384|CRISPRCasFinder matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

tttgttgctccagtcgttatgatcgtctttgca	CRISPR spacer
tttgttgctccagtcgttatgatcgtctttgca	Protospacer
*********************************

62. spacer 1.7|179923|33|NC_020384|CRISPRCasFinder matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

tttgttgctccagtcgttatgatcgtctttgca	CRISPR spacer
tttgttgctccagtcgttatgatcgtctttgca	Protospacer
*********************************

63. spacer 1.7|179923|33|NC_020384|CRISPRCasFinder matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

tttgttgctccagtcgttatgatcgtctttgca	CRISPR spacer
tttgttgctccagtcgttatgatcgtctttgca	Protospacer
*********************************

64. spacer 1.7|179923|33|NC_020384|CRISPRCasFinder matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

tttgttgctccagtcgttatgatcgtctttgca	CRISPR spacer
tttgttgctccagtcgttatgatcgtctttgca	Protospacer
*********************************

65. spacer 1.7|179923|33|NC_020384|CRISPRCasFinder matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

tttgttgctccagtcgttatgatcgtctttgca	CRISPR spacer
tttgttgctccagtcgttatgatcgtctttgca	Protospacer
*********************************

66. spacer 1.7|179923|33|NC_020384|CRISPRCasFinder matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

tttgttgctccagtcgttatgatcgtctttgca	CRISPR spacer
tttgttgctccagtcgttatgatcgtctttgca	Protospacer
*********************************

67. spacer 1.8|179988|33|NC_020384|CRISPRCasFinder matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 0, identity: 1.0

taggagttattaatggctttagatgttagacca	CRISPR spacer
taggagttattaatggctttagatgttagacca	Protospacer
*********************************

68. spacer 1.8|179988|33|NC_020384|CRISPRCasFinder matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

taggagttattaatggctttagatgttagacca	CRISPR spacer
taggagttattaatggctttagatgttagacca	Protospacer
*********************************

69. spacer 1.8|179988|33|NC_020384|CRISPRCasFinder matches to NZ_CP053974 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

taggagttattaatggctttagatgttagacca	CRISPR spacer
taggagttattaatggctttagatgttagacca	Protospacer
*********************************

70. spacer 1.8|179988|33|NC_020384|CRISPRCasFinder matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

taggagttattaatggctttagatgttagacca	CRISPR spacer
taggagttattaatggctttagatgttagacca	Protospacer
*********************************

71. spacer 1.8|179988|33|NC_020384|CRISPRCasFinder matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 0, identity: 1.0

taggagttattaatggctttagatgttagacca	CRISPR spacer
taggagttattaatggctttagatgttagacca	Protospacer
*********************************

72. spacer 1.8|179988|33|NC_020384|CRISPRCasFinder matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

taggagttattaatggctttagatgttagacca	CRISPR spacer
taggagttattaatggctttagatgttagacca	Protospacer
*********************************

73. spacer 1.8|179988|33|NC_020384|CRISPRCasFinder matches to NZ_CP009346 (Bacillus thuringiensis HD1002 plasmid 5, complete sequence) position: , mismatch: 0, identity: 1.0

taggagttattaatggctttagatgttagacca	CRISPR spacer
taggagttattaatggctttagatgttagacca	Protospacer
*********************************

74. spacer 1.8|179988|33|NC_020384|CRISPRCasFinder matches to NZ_CP045027 (Bacillus thuringiensis strain JW-1 plasmid p5, complete sequence) position: , mismatch: 0, identity: 1.0

taggagttattaatggctttagatgttagacca	CRISPR spacer
taggagttattaatggctttagatgttagacca	Protospacer
*********************************

75. spacer 1.8|179988|33|NC_020384|CRISPRCasFinder matches to CP013282 (Bacillus phage pGIL02, complete sequence) position: , mismatch: 0, identity: 1.0

taggagttattaatggctttagatgttagacca	CRISPR spacer
taggagttattaatggctttagatgttagacca	Protospacer
*********************************

76. spacer 1.8|179988|33|NC_020384|CRISPRCasFinder matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

taggagttattaatggctttagatgttagacca	CRISPR spacer
taggagttattaatggctttagatgttagacca	Protospacer
*********************************

77. spacer 1.8|179988|33|NC_020384|CRISPRCasFinder matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

taggagttattaatggctttagatgttagacca	CRISPR spacer
taggagttattaatggctttagatgttagacca	Protospacer
*********************************

78. spacer 1.8|179988|33|NC_020384|CRISPRCasFinder matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

taggagttattaatggctttagatgttagacca	CRISPR spacer
taggagttattaatggctttagatgttagacca	Protospacer
*********************************

79. spacer 1.8|179988|33|NC_020384|CRISPRCasFinder matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

taggagttattaatggctttagatgttagacca	CRISPR spacer
taggagttattaatggctttagatgttagacca	Protospacer
*********************************

80. spacer 1.8|179988|33|NC_020384|CRISPRCasFinder matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

taggagttattaatggctttagatgttagacca	CRISPR spacer
taggagttattaatggctttagatgttagacca	Protospacer
*********************************

81. spacer 1.8|179988|33|NC_020384|CRISPRCasFinder matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

taggagttattaatggctttagatgttagacca	CRISPR spacer
taggagttattaatggctttagatgttagacca	Protospacer
*********************************

82. spacer 1.8|179988|33|NC_020384|CRISPRCasFinder matches to NC_005258 (Bacillus phage Bam35c, complete genome) position: , mismatch: 0, identity: 1.0

taggagttattaatggctttagatgttagacca	CRISPR spacer
taggagttattaatggctttagatgttagacca	Protospacer
*********************************

83. spacer 1.8|179988|33|NC_020384|CRISPRCasFinder matches to AY257527 (Bacillus thuringiensis bacteriophage Bam35c, complete genome) position: , mismatch: 0, identity: 1.0

taggagttattaatggctttagatgttagacca	CRISPR spacer
taggagttattaatggctttagatgttagacca	Protospacer
*********************************

84. spacer 1.8|179988|33|NC_020384|CRISPRCasFinder matches to AJ536073 (Bacillus phage pGIL01, complete genome) position: , mismatch: 0, identity: 1.0

taggagttattaatggctttagatgttagacca	CRISPR spacer
taggagttattaatggctttagatgttagacca	Protospacer
*********************************

85. spacer 1.9|180053|34|NC_020384|CRISPRCasFinder matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

tacctcgggtttatatttatctggaatgcccata	CRISPR spacer
tacctcgggtttatatttatctggaatgcccata	Protospacer
**********************************

86. spacer 1.9|180053|34|NC_020384|CRISPRCasFinder matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

tacctcgggtttatatttatctggaatgcccata	CRISPR spacer
tacctcgggtttatatttatctggaatgcccata	Protospacer
**********************************

87. spacer 1.9|180053|34|NC_020384|CRISPRCasFinder matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

tacctcgggtttatatttatctggaatgcccata	CRISPR spacer
tacctcgggtttatatttatctggaatgcccata	Protospacer
**********************************

88. spacer 1.9|180053|34|NC_020384|CRISPRCasFinder matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

tacctcgggtttatatttatctggaatgcccata	CRISPR spacer
tacctcgggtttatatttatctggaatgcccata	Protospacer
**********************************

89. spacer 1.9|180053|34|NC_020384|CRISPRCasFinder matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

tacctcgggtttatatttatctggaatgcccata	CRISPR spacer
tacctcgggtttatatttatctggaatgcccata	Protospacer
**********************************

90. spacer 1.9|180053|34|NC_020384|CRISPRCasFinder matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

tacctcgggtttatatttatctggaatgcccata	CRISPR spacer
tacctcgggtttatatttatctggaatgcccata	Protospacer
**********************************

91. spacer 1.9|180053|34|NC_020384|CRISPRCasFinder matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

tacctcgggtttatatttatctggaatgcccata	CRISPR spacer
tacctcgggtttatatttatctggaatgcccata	Protospacer
**********************************

92. spacer 1.9|180053|34|NC_020384|CRISPRCasFinder matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

tacctcgggtttatatttatctggaatgcccata	CRISPR spacer
tacctcgggtttatatttatctggaatgcccata	Protospacer
**********************************

93. spacer 1.9|180053|34|NC_020384|CRISPRCasFinder matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

tacctcgggtttatatttatctggaatgcccata	CRISPR spacer
tacctcgggtttatatttatctggaatgcccata	Protospacer
**********************************

94. spacer 1.10|180119|33|NC_020384|CRISPRCasFinder matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
tttgcaactagctcaattgtttttccgttttca	Protospacer
*********************************

95. spacer 1.10|180119|33|NC_020384|CRISPRCasFinder matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
tttgcaactagctcaattgtttttccgttttca	Protospacer
*********************************

96. spacer 1.10|180119|33|NC_020384|CRISPRCasFinder matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
tttgcaactagctcaattgtttttccgttttca	Protospacer
*********************************

97. spacer 1.10|180119|33|NC_020384|CRISPRCasFinder matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
tttgcaactagctcaattgtttttccgttttca	Protospacer
*********************************

98. spacer 1.10|180119|33|NC_020384|CRISPRCasFinder matches to CP041751 (Bacillus paranthracis strain NCCP 14796 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
tttgcaactagctcaattgtttttccgttttca	Protospacer
*********************************

99. spacer 1.10|180119|33|NC_020384|CRISPRCasFinder matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
tttgcaactagctcaattgtttttccgttttca	Protospacer
*********************************

100. spacer 1.10|180119|33|NC_020384|CRISPRCasFinder matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
tttgcaactagctcaattgtttttccgttttca	Protospacer
*********************************

101. spacer 1.10|180119|33|NC_020384|CRISPRCasFinder matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
tttgcaactagctcaattgtttttccgttttca	Protospacer
*********************************

102. spacer 1.10|180119|33|NC_020384|CRISPRCasFinder matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
tttgcaactagctcaattgtttttccgttttca	Protospacer
*********************************

103. spacer 1.10|180119|33|NC_020384|CRISPRCasFinder matches to CP024689 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-5-125K, complete sequence) position: , mismatch: 0, identity: 1.0

tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
tttgcaactagctcaattgtttttccgttttca	Protospacer
*********************************

104. spacer 1.10|180119|33|NC_020384|CRISPRCasFinder matches to NC_018685 (Bacillus thuringiensis MC28 plasmid pMC95, complete sequence) position: , mismatch: 0, identity: 1.0

tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
tttgcaactagctcaattgtttttccgttttca	Protospacer
*********************************

105. spacer 1.10|180119|33|NC_020384|CRISPRCasFinder matches to NZ_CP033793 (Bacillus sp. FDAARGOS_527 plasmid unnamed6, complete sequence) position: , mismatch: 0, identity: 1.0

tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
tttgcaactagctcaattgtttttccgttttca	Protospacer
*********************************

106. spacer 1.11|180184|34|NC_020384|CRISPRCasFinder matches to NZ_KX258624 (Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence) position: , mismatch: 0, identity: 1.0

tacctcgggtttatatttatctggaacgctcata	CRISPR spacer
tacctcgggtttatatttatctggaacgctcata	Protospacer
**********************************

107. spacer 1.11|180184|34|NC_020384|CRISPRCasFinder matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

tacctcgggtttatatttatctggaacgctcata	CRISPR spacer
tacctcgggtttatatttatctggaacgctcata	Protospacer
**********************************

108. spacer 1.11|180184|34|NC_020384|CRISPRCasFinder matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

tacctcgggtttatatttatctggaacgctcata	CRISPR spacer
tacctcgggtttatatttatctggaacgctcata	Protospacer
**********************************

109. spacer 1.11|180184|34|NC_020384|CRISPRCasFinder matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

tacctcgggtttatatttatctggaacgctcata	CRISPR spacer
tacctcgggtttatatttatctggaacgctcata	Protospacer
**********************************

110. spacer 1.11|180184|34|NC_020384|CRISPRCasFinder matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

tacctcgggtttatatttatctggaacgctcata	CRISPR spacer
tacctcgggtttatatttatctggaacgctcata	Protospacer
**********************************

111. spacer 1.11|180184|34|NC_020384|CRISPRCasFinder matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

tacctcgggtttatatttatctggaacgctcata	CRISPR spacer
tacctcgggtttatatttatctggaacgctcata	Protospacer
**********************************

112. spacer 1.11|180184|34|NC_020384|CRISPRCasFinder matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

tacctcgggtttatatttatctggaacgctcata	CRISPR spacer
tacctcgggtttatatttatctggaacgctcata	Protospacer
**********************************

113. spacer 1.11|180184|34|NC_020384|CRISPRCasFinder matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

tacctcgggtttatatttatctggaacgctcata	CRISPR spacer
tacctcgggtttatatttatctggaacgctcata	Protospacer
**********************************

114. spacer 1.11|180184|34|NC_020384|CRISPRCasFinder matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

tacctcgggtttatatttatctggaacgctcata	CRISPR spacer
tacctcgggtttatatttatctggaacgctcata	Protospacer
**********************************

115. spacer 1.11|180184|34|NC_020384|CRISPRCasFinder matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

tacctcgggtttatatttatctggaacgctcata	CRISPR spacer
tacctcgggtttatatttatctggaacgctcata	Protospacer
**********************************

116. spacer 1.12|180250|33|NC_020384|CRISPRCasFinder matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

ataatatcacaattttgacaaaattcagtcatg	CRISPR spacer
ataatatcacaattttgacaaaattcagtcatg	Protospacer
*********************************

117. spacer 1.12|180250|33|NC_020384|CRISPRCasFinder matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

ataatatcacaattttgacaaaattcagtcatg	CRISPR spacer
ataatatcacaattttgacaaaattcagtcatg	Protospacer
*********************************

118. spacer 1.12|180250|33|NC_020384|CRISPRCasFinder matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

ataatatcacaattttgacaaaattcagtcatg	CRISPR spacer
ataatatcacaattttgacaaaattcagtcatg	Protospacer
*********************************

119. spacer 1.12|180250|33|NC_020384|CRISPRCasFinder matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

ataatatcacaattttgacaaaattcagtcatg	CRISPR spacer
ataatatcacaattttgacaaaattcagtcatg	Protospacer
*********************************

120. spacer 1.12|180250|33|NC_020384|CRISPRCasFinder matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

ataatatcacaattttgacaaaattcagtcatg	CRISPR spacer
ataatatcacaattttgacaaaattcagtcatg	Protospacer
*********************************

121. spacer 1.12|180250|33|NC_020384|CRISPRCasFinder matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

ataatatcacaattttgacaaaattcagtcatg	CRISPR spacer
ataatatcacaattttgacaaaattcagtcatg	Protospacer
*********************************

122. spacer 1.12|180250|33|NC_020384|CRISPRCasFinder matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

ataatatcacaattttgacaaaattcagtcatg	CRISPR spacer
ataatatcacaattttgacaaaattcagtcatg	Protospacer
*********************************

123. spacer 1.12|180250|33|NC_020384|CRISPRCasFinder matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

ataatatcacaattttgacaaaattcagtcatg	CRISPR spacer
ataatatcacaattttgacaaaattcagtcatg	Protospacer
*********************************

124. spacer 1.12|180250|33|NC_020384|CRISPRCasFinder matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

ataatatcacaattttgacaaaattcagtcatg	CRISPR spacer
ataatatcacaattttgacaaaattcagtcatg	Protospacer
*********************************

125. spacer 1.13|179651|43|NC_020384|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaatacaagatacgagaatttaatgacgtcacccacat	CRISPR spacer
gattgaaatacaagatacgagaatttaatgacgtcacccacat	Protospacer
*******************************************

126. spacer 1.13|179651|43|NC_020384|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaatacaagatacgagaatttaatgacgtcacccacat	CRISPR spacer
gattgaaatacaagatacgagaatttaatgacgtcacccacat	Protospacer
*******************************************

127. spacer 1.13|179651|43|NC_020384|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaatacaagatacgagaatttaatgacgtcacccacat	CRISPR spacer
gattgaaatacaagatacgagaatttaatgacgtcacccacat	Protospacer
*******************************************

128. spacer 1.13|179651|43|NC_020384|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaatacaagatacgagaatttaatgacgtcacccacat	CRISPR spacer
gattgaaatacaagatacgagaatttaatgacgtcacccacat	Protospacer
*******************************************

129. spacer 1.13|179651|43|NC_020384|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaatacaagatacgagaatttaatgacgtcacccacat	CRISPR spacer
gattgaaatacaagatacgagaatttaatgacgtcacccacat	Protospacer
*******************************************

130. spacer 1.13|179651|43|NC_020384|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaatacaagatacgagaatttaatgacgtcacccacat	CRISPR spacer
gattgaaatacaagatacgagaatttaatgacgtcacccacat	Protospacer
*******************************************

131. spacer 1.13|179651|43|NC_020384|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaatacaagatacgagaatttaatgacgtcacccacat	CRISPR spacer
gattgaaatacaagatacgagaatttaatgacgtcacccacat	Protospacer
*******************************************

132. spacer 1.13|179651|43|NC_020384|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaatacaagatacgagaatttaatgacgtcacccacat	CRISPR spacer
gattgaaatacaagatacgagaatttaatgacgtcacccacat	Protospacer
*******************************************

133. spacer 1.14|179717|43|NC_020384|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattattgttacacctttagagtatccgagtaaaaaa	CRISPR spacer
gattgaaattattgttacacctttagagtatccgagtaaaaaa	Protospacer
*******************************************

134. spacer 1.14|179717|43|NC_020384|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattattgttacacctttagagtatccgagtaaaaaa	CRISPR spacer
gattgaaattattgttacacctttagagtatccgagtaaaaaa	Protospacer
*******************************************

135. spacer 1.14|179717|43|NC_020384|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattattgttacacctttagagtatccgagtaaaaaa	CRISPR spacer
gattgaaattattgttacacctttagagtatccgagtaaaaaa	Protospacer
*******************************************

136. spacer 1.14|179717|43|NC_020384|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattattgttacacctttagagtatccgagtaaaaaa	CRISPR spacer
gattgaaattattgttacacctttagagtatccgagtaaaaaa	Protospacer
*******************************************

137. spacer 1.14|179717|43|NC_020384|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattattgttacacctttagagtatccgagtaaaaaa	CRISPR spacer
gattgaaattattgttacacctttagagtatccgagtaaaaaa	Protospacer
*******************************************

138. spacer 1.14|179717|43|NC_020384|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattattgttacacctttagagtatccgagtaaaaaa	CRISPR spacer
gattgaaattattgttacacctttagagtatccgagtaaaaaa	Protospacer
*******************************************

139. spacer 1.14|179717|43|NC_020384|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattattgttacacctttagagtatccgagtaaaaaa	CRISPR spacer
gattgaaattattgttacacctttagagtatccgagtaaaaaa	Protospacer
*******************************************

140. spacer 1.14|179717|43|NC_020384|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattattgttacacctttagagtatccgagtaaaaaa	CRISPR spacer
gattgaaattattgttacacctttagagtatccgagtaaaaaa	Protospacer
*******************************************

141. spacer 1.15|179783|44|NC_020384|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaatacaatgggaaagtgttaggttatgcacgttttaaa	CRISPR spacer
gattgaaatacaatgggaaagtgttaggttatgcacgttttaaa	Protospacer
********************************************

142. spacer 1.15|179783|44|NC_020384|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaatacaatgggaaagtgttaggttatgcacgttttaaa	CRISPR spacer
gattgaaatacaatgggaaagtgttaggttatgcacgttttaaa	Protospacer
********************************************

143. spacer 1.15|179783|44|NC_020384|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaatacaatgggaaagtgttaggttatgcacgttttaaa	CRISPR spacer
gattgaaatacaatgggaaagtgttaggttatgcacgttttaaa	Protospacer
********************************************

144. spacer 1.15|179783|44|NC_020384|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaatacaatgggaaagtgttaggttatgcacgttttaaa	CRISPR spacer
gattgaaatacaatgggaaagtgttaggttatgcacgttttaaa	Protospacer
********************************************

145. spacer 1.15|179783|44|NC_020384|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaatacaatgggaaagtgttaggttatgcacgttttaaa	CRISPR spacer
gattgaaatacaatgggaaagtgttaggttatgcacgttttaaa	Protospacer
********************************************

146. spacer 1.15|179783|44|NC_020384|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaatacaatgggaaagtgttaggttatgcacgttttaaa	CRISPR spacer
gattgaaatacaatgggaaagtgttaggttatgcacgttttaaa	Protospacer
********************************************

147. spacer 1.15|179783|44|NC_020384|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaatacaatgggaaagtgttaggttatgcacgttttaaa	CRISPR spacer
gattgaaatacaatgggaaagtgttaggttatgcacgttttaaa	Protospacer
********************************************

148. spacer 1.15|179783|44|NC_020384|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaatacaatgggaaagtgttaggttatgcacgttttaaa	CRISPR spacer
gattgaaatacaatgggaaagtgttaggttatgcacgttttaaa	Protospacer
********************************************

149. spacer 1.16|179850|41|NC_020384|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

aattgaaatgaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
aattgaaatgaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
*****************************************

150. spacer 1.16|179850|41|NC_020384|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

aattgaaatgaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
aattgaaatgaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
*****************************************

151. spacer 1.16|179850|41|NC_020384|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

aattgaaatgaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
aattgaaatgaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
*****************************************

152. spacer 1.16|179850|41|NC_020384|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

aattgaaatgaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
aattgaaatgaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
*****************************************

153. spacer 1.16|179850|41|NC_020384|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

aattgaaatgaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
aattgaaatgaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
*****************************************

154. spacer 1.16|179850|41|NC_020384|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

aattgaaatgaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
aattgaaatgaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
*****************************************

155. spacer 1.16|179850|41|NC_020384|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

aattgaaatgaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
aattgaaatgaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
*****************************************

156. spacer 1.17|179914|42|NC_020384|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

aattgaaattttgttgctccagtcgttatgatcgtctttgca	CRISPR spacer
aattgaaattttgttgctccagtcgttatgatcgtctttgca	Protospacer
******************************************

157. spacer 1.17|179914|42|NC_020384|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

aattgaaattttgttgctccagtcgttatgatcgtctttgca	CRISPR spacer
aattgaaattttgttgctccagtcgttatgatcgtctttgca	Protospacer
******************************************

158. spacer 1.17|179914|42|NC_020384|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

aattgaaattttgttgctccagtcgttatgatcgtctttgca	CRISPR spacer
aattgaaattttgttgctccagtcgttatgatcgtctttgca	Protospacer
******************************************

159. spacer 1.17|179914|42|NC_020384|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

aattgaaattttgttgctccagtcgttatgatcgtctttgca	CRISPR spacer
aattgaaattttgttgctccagtcgttatgatcgtctttgca	Protospacer
******************************************

160. spacer 1.17|179914|42|NC_020384|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

aattgaaattttgttgctccagtcgttatgatcgtctttgca	CRISPR spacer
aattgaaattttgttgctccagtcgttatgatcgtctttgca	Protospacer
******************************************

161. spacer 1.17|179914|42|NC_020384|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

aattgaaattttgttgctccagtcgttatgatcgtctttgca	CRISPR spacer
aattgaaattttgttgctccagtcgttatgatcgtctttgca	Protospacer
******************************************

162. spacer 1.17|179914|42|NC_020384|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

aattgaaattttgttgctccagtcgttatgatcgtctttgca	CRISPR spacer
aattgaaattttgttgctccagtcgttatgatcgtctttgca	Protospacer
******************************************

163. spacer 1.17|179914|42|NC_020384|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

aattgaaattttgttgctccagtcgttatgatcgtctttgca	CRISPR spacer
aattgaaattttgttgctccagtcgttatgatcgtctttgca	Protospacer
******************************************

164. spacer 1.18|179979|42|NC_020384|CRT matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattaggagttattaatggctttagatgttagacca	CRISPR spacer
gattgaaattaggagttattaatggctttagatgttagacca	Protospacer
******************************************

165. spacer 1.18|179979|42|NC_020384|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattaggagttattaatggctttagatgttagacca	CRISPR spacer
gattgaaattaggagttattaatggctttagatgttagacca	Protospacer
******************************************

166. spacer 1.18|179979|42|NC_020384|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattaggagttattaatggctttagatgttagacca	CRISPR spacer
gattgaaattaggagttattaatggctttagatgttagacca	Protospacer
******************************************

167. spacer 1.18|179979|42|NC_020384|CRT matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattaggagttattaatggctttagatgttagacca	CRISPR spacer
gattgaaattaggagttattaatggctttagatgttagacca	Protospacer
******************************************

168. spacer 1.18|179979|42|NC_020384|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattaggagttattaatggctttagatgttagacca	CRISPR spacer
gattgaaattaggagttattaatggctttagatgttagacca	Protospacer
******************************************

169. spacer 1.18|179979|42|NC_020384|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattaggagttattaatggctttagatgttagacca	CRISPR spacer
gattgaaattaggagttattaatggctttagatgttagacca	Protospacer
******************************************

170. spacer 1.18|179979|42|NC_020384|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattaggagttattaatggctttagatgttagacca	CRISPR spacer
gattgaaattaggagttattaatggctttagatgttagacca	Protospacer
******************************************

171. spacer 1.18|179979|42|NC_020384|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattaggagttattaatggctttagatgttagacca	CRISPR spacer
gattgaaattaggagttattaatggctttagatgttagacca	Protospacer
******************************************

172. spacer 1.18|179979|42|NC_020384|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattaggagttattaatggctttagatgttagacca	CRISPR spacer
gattgaaattaggagttattaatggctttagatgttagacca	Protospacer
******************************************

173. spacer 1.18|179979|42|NC_020384|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattaggagttattaatggctttagatgttagacca	CRISPR spacer
gattgaaattaggagttattaatggctttagatgttagacca	Protospacer
******************************************

174. spacer 1.18|179979|42|NC_020384|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattaggagttattaatggctttagatgttagacca	CRISPR spacer
gattgaaattaggagttattaatggctttagatgttagacca	Protospacer
******************************************

175. spacer 1.19|180044|43|NC_020384|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattacctcgggtttatatttatctggaatgcccata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaatgcccata	Protospacer
*******************************************

176. spacer 1.19|180044|43|NC_020384|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattacctcgggtttatatttatctggaatgcccata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaatgcccata	Protospacer
*******************************************

177. spacer 1.19|180044|43|NC_020384|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattacctcgggtttatatttatctggaatgcccata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaatgcccata	Protospacer
*******************************************

178. spacer 1.19|180044|43|NC_020384|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattacctcgggtttatatttatctggaatgcccata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaatgcccata	Protospacer
*******************************************

179. spacer 1.19|180044|43|NC_020384|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattacctcgggtttatatttatctggaatgcccata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaatgcccata	Protospacer
*******************************************

180. spacer 1.19|180044|43|NC_020384|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattacctcgggtttatatttatctggaatgcccata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaatgcccata	Protospacer
*******************************************

181. spacer 1.19|180044|43|NC_020384|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattacctcgggtttatatttatctggaatgcccata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaatgcccata	Protospacer
*******************************************

182. spacer 1.19|180044|43|NC_020384|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattacctcgggtttatatttatctggaatgcccata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaatgcccata	Protospacer
*******************************************

183. spacer 1.20|180110|42|NC_020384|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattttgcaactagctcaattgtttttccgttttca	CRISPR spacer
gattgaaattttgcaactagctcaattgtttttccgttttca	Protospacer
******************************************

184. spacer 1.20|180110|42|NC_020384|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattttgcaactagctcaattgtttttccgttttca	CRISPR spacer
gattgaaattttgcaactagctcaattgtttttccgttttca	Protospacer
******************************************

185. spacer 1.20|180110|42|NC_020384|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattttgcaactagctcaattgtttttccgttttca	CRISPR spacer
gattgaaattttgcaactagctcaattgtttttccgttttca	Protospacer
******************************************

186. spacer 1.20|180110|42|NC_020384|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattttgcaactagctcaattgtttttccgttttca	CRISPR spacer
gattgaaattttgcaactagctcaattgtttttccgttttca	Protospacer
******************************************

187. spacer 1.20|180110|42|NC_020384|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattttgcaactagctcaattgtttttccgttttca	CRISPR spacer
gattgaaattttgcaactagctcaattgtttttccgttttca	Protospacer
******************************************

188. spacer 1.20|180110|42|NC_020384|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattttgcaactagctcaattgtttttccgttttca	CRISPR spacer
gattgaaattttgcaactagctcaattgtttttccgttttca	Protospacer
******************************************

189. spacer 1.20|180110|42|NC_020384|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattttgcaactagctcaattgtttttccgttttca	CRISPR spacer
gattgaaattttgcaactagctcaattgtttttccgttttca	Protospacer
******************************************

190. spacer 1.20|180110|42|NC_020384|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattttgcaactagctcaattgtttttccgttttca	CRISPR spacer
gattgaaattttgcaactagctcaattgtttttccgttttca	Protospacer
******************************************

191. spacer 1.21|180175|43|NC_020384|CRT matches to NZ_KX258624 (Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattacctcgggtttatatttatctggaacgctcata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaacgctcata	Protospacer
*******************************************

192. spacer 1.21|180175|43|NC_020384|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattacctcgggtttatatttatctggaacgctcata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaacgctcata	Protospacer
*******************************************

193. spacer 1.21|180175|43|NC_020384|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattacctcgggtttatatttatctggaacgctcata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaacgctcata	Protospacer
*******************************************

194. spacer 1.21|180175|43|NC_020384|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattacctcgggtttatatttatctggaacgctcata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaacgctcata	Protospacer
*******************************************

195. spacer 1.21|180175|43|NC_020384|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattacctcgggtttatatttatctggaacgctcata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaacgctcata	Protospacer
*******************************************

196. spacer 1.21|180175|43|NC_020384|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattacctcgggtttatatttatctggaacgctcata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaacgctcata	Protospacer
*******************************************

197. spacer 1.21|180175|43|NC_020384|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattacctcgggtttatatttatctggaacgctcata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaacgctcata	Protospacer
*******************************************

198. spacer 1.21|180175|43|NC_020384|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattacctcgggtttatatttatctggaacgctcata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaacgctcata	Protospacer
*******************************************

199. spacer 1.21|180175|43|NC_020384|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattacctcgggtttatatttatctggaacgctcata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaacgctcata	Protospacer
*******************************************

200. spacer 1.21|180175|43|NC_020384|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaattacctcgggtttatatttatctggaacgctcata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaacgctcata	Protospacer
*******************************************

201. spacer 1.22|180241|42|NC_020384|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaatataatatcacaattttgacaaaattcagtcatg	CRISPR spacer
gattgaaatataatatcacaattttgacaaaattcagtcatg	Protospacer
******************************************

202. spacer 1.22|180241|42|NC_020384|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaatataatatcacaattttgacaaaattcagtcatg	CRISPR spacer
gattgaaatataatatcacaattttgacaaaattcagtcatg	Protospacer
******************************************

203. spacer 1.22|180241|42|NC_020384|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaatataatatcacaattttgacaaaattcagtcatg	CRISPR spacer
gattgaaatataatatcacaattttgacaaaattcagtcatg	Protospacer
******************************************

204. spacer 1.22|180241|42|NC_020384|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaatataatatcacaattttgacaaaattcagtcatg	CRISPR spacer
gattgaaatataatatcacaattttgacaaaattcagtcatg	Protospacer
******************************************

205. spacer 1.22|180241|42|NC_020384|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaatataatatcacaattttgacaaaattcagtcatg	CRISPR spacer
gattgaaatataatatcacaattttgacaaaattcagtcatg	Protospacer
******************************************

206. spacer 1.22|180241|42|NC_020384|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaatataatatcacaattttgacaaaattcagtcatg	CRISPR spacer
gattgaaatataatatcacaattttgacaaaattcagtcatg	Protospacer
******************************************

207. spacer 1.22|180241|42|NC_020384|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaatataatatcacaattttgacaaaattcagtcatg	CRISPR spacer
gattgaaatataatatcacaattttgacaaaattcagtcatg	Protospacer
******************************************

208. spacer 1.22|180241|42|NC_020384|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaatataatatcacaattttgacaaaattcagtcatg	CRISPR spacer
gattgaaatataatatcacaattttgacaaaattcagtcatg	Protospacer
******************************************

209. spacer 1.22|180241|42|NC_020384|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

gattgaaatataatatcacaattttgacaaaattcagtcatg	CRISPR spacer
gattgaaatataatatcacaattttgacaaaattcagtcatg	Protospacer
******************************************

210. spacer 2.1|187320|35|NC_020384|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

cattggcggtagttcataagtaacaacaaatggat	CRISPR spacer
cattggcggtagttcataagtaacaacaaatggat	Protospacer
***********************************

211. spacer 2.1|187320|35|NC_020384|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

cattggcggtagttcataagtaacaacaaatggat	CRISPR spacer
cattggcggtagttcataagtaacaacaaatggat	Protospacer
***********************************

212. spacer 2.1|187320|35|NC_020384|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

cattggcggtagttcataagtaacaacaaatggat	CRISPR spacer
cattggcggtagttcataagtaacaacaaatggat	Protospacer
***********************************

213. spacer 2.1|187320|35|NC_020384|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

cattggcggtagttcataagtaacaacaaatggat	CRISPR spacer
cattggcggtagttcataagtaacaacaaatggat	Protospacer
***********************************

214. spacer 2.1|187320|35|NC_020384|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

cattggcggtagttcataagtaacaacaaatggat	CRISPR spacer
cattggcggtagttcataagtaacaacaaatggat	Protospacer
***********************************

215. spacer 2.1|187320|35|NC_020384|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

cattggcggtagttcataagtaacaacaaatggat	CRISPR spacer
cattggcggtagttcataagtaacaacaaatggat	Protospacer
***********************************

216. spacer 2.1|187320|35|NC_020384|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

cattggcggtagttcataagtaacaacaaatggat	CRISPR spacer
cattggcggtagttcataagtaacaacaaatggat	Protospacer
***********************************

217. spacer 2.1|187320|35|NC_020384|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

cattggcggtagttcataagtaacaacaaatggat	CRISPR spacer
cattggcggtagttcataagtaacaacaaatggat	Protospacer
***********************************

218. spacer 2.2|187387|34|NC_020384|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

atgatattcaaagagcctgaacaagtggaatcga	CRISPR spacer
atgatattcaaagagcctgaacaagtggaatcga	Protospacer
**********************************

219. spacer 2.2|187387|34|NC_020384|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

atgatattcaaagagcctgaacaagtggaatcga	CRISPR spacer
atgatattcaaagagcctgaacaagtggaatcga	Protospacer
**********************************

220. spacer 2.2|187387|34|NC_020384|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

atgatattcaaagagcctgaacaagtggaatcga	CRISPR spacer
atgatattcaaagagcctgaacaagtggaatcga	Protospacer
**********************************

221. spacer 2.2|187387|34|NC_020384|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

atgatattcaaagagcctgaacaagtggaatcga	CRISPR spacer
atgatattcaaagagcctgaacaagtggaatcga	Protospacer
**********************************

222. spacer 2.2|187387|34|NC_020384|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

atgatattcaaagagcctgaacaagtggaatcga	CRISPR spacer
atgatattcaaagagcctgaacaagtggaatcga	Protospacer
**********************************

223. spacer 2.2|187387|34|NC_020384|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

atgatattcaaagagcctgaacaagtggaatcga	CRISPR spacer
atgatattcaaagagcctgaacaagtggaatcga	Protospacer
**********************************

224. spacer 2.2|187387|34|NC_020384|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

atgatattcaaagagcctgaacaagtggaatcga	CRISPR spacer
atgatattcaaagagcctgaacaagtggaatcga	Protospacer
**********************************

225. spacer 2.2|187387|34|NC_020384|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

atgatattcaaagagcctgaacaagtggaatcga	CRISPR spacer
atgatattcaaagagcctgaacaagtggaatcga	Protospacer
**********************************

226. spacer 2.2|187387|34|NC_020384|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

atgatattcaaagagcctgaacaagtggaatcga	CRISPR spacer
atgatattcaaagagcctgaacaagtggaatcga	Protospacer
**********************************

227. spacer 2.3|187453|35|NC_020384|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

ataattgaatatgagctgccgccgatggaagggac	CRISPR spacer
ataattgaatatgagctgccgccgatggaagggac	Protospacer
***********************************

228. spacer 2.3|187453|35|NC_020384|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

ataattgaatatgagctgccgccgatggaagggac	CRISPR spacer
ataattgaatatgagctgccgccgatggaagggac	Protospacer
***********************************

229. spacer 2.3|187453|35|NC_020384|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

ataattgaatatgagctgccgccgatggaagggac	CRISPR spacer
ataattgaatatgagctgccgccgatggaagggac	Protospacer
***********************************

230. spacer 2.3|187453|35|NC_020384|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

ataattgaatatgagctgccgccgatggaagggac	CRISPR spacer
ataattgaatatgagctgccgccgatggaagggac	Protospacer
***********************************

231. spacer 2.3|187453|35|NC_020384|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

ataattgaatatgagctgccgccgatggaagggac	CRISPR spacer
ataattgaatatgagctgccgccgatggaagggac	Protospacer
***********************************

232. spacer 2.3|187453|35|NC_020384|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

ataattgaatatgagctgccgccgatggaagggac	CRISPR spacer
ataattgaatatgagctgccgccgatggaagggac	Protospacer
***********************************

233. spacer 2.3|187453|35|NC_020384|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

ataattgaatatgagctgccgccgatggaagggac	CRISPR spacer
ataattgaatatgagctgccgccgatggaagggac	Protospacer
***********************************

234. spacer 2.3|187453|35|NC_020384|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

ataattgaatatgagctgccgccgatggaagggac	CRISPR spacer
ataattgaatatgagctgccgccgatggaagggac	Protospacer
***********************************

235. spacer 2.3|187453|35|NC_020384|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

ataattgaatatgagctgccgccgatggaagggac	CRISPR spacer
ataattgaatatgagctgccgccgatggaagggac	Protospacer
***********************************

236. spacer 2.4|187520|33|NC_020384|CRT matches to NZ_CP047087 (Bacillus paranthracis strain BC307 plasmid pCE2, complete sequence) position: , mismatch: 0, identity: 1.0

atggaaatggaacgttcttacggatcaaaagaa	CRISPR spacer
atggaaatggaacgttcttacggatcaaaagaa	Protospacer
*********************************

237. spacer 2.4|187520|33|NC_020384|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

atggaaatggaacgttcttacggatcaaaagaa	CRISPR spacer
atggaaatggaacgttcttacggatcaaaagaa	Protospacer
*********************************

238. spacer 2.4|187520|33|NC_020384|CRT matches to NC_018510 (Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence) position: , mismatch: 0, identity: 1.0

atggaaatggaacgttcttacggatcaaaagaa	CRISPR spacer
atggaaatggaacgttcttacggatcaaaagaa	Protospacer
*********************************

239. spacer 2.4|187520|33|NC_020384|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

atggaaatggaacgttcttacggatcaaaagaa	CRISPR spacer
atggaaatggaacgttcttacggatcaaaagaa	Protospacer
*********************************

240. spacer 2.4|187520|33|NC_020384|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

atggaaatggaacgttcttacggatcaaaagaa	CRISPR spacer
atggaaatggaacgttcttacggatcaaaagaa	Protospacer
*********************************

241. spacer 2.4|187520|33|NC_020384|CRT matches to CP041751 (Bacillus paranthracis strain NCCP 14796 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

atggaaatggaacgttcttacggatcaaaagaa	CRISPR spacer
atggaaatggaacgttcttacggatcaaaagaa	Protospacer
*********************************

242. spacer 2.4|187520|33|NC_020384|CRT matches to NZ_CP017573 (Bacillus thuringiensis strain SCG04-02 plasmid PSCG61, complete sequence) position: , mismatch: 0, identity: 1.0

atggaaatggaacgttcttacggatcaaaagaa	CRISPR spacer
atggaaatggaacgttcttacggatcaaaagaa	Protospacer
*********************************

243. spacer 2.4|187520|33|NC_020384|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

atggaaatggaacgttcttacggatcaaaagaa	CRISPR spacer
atggaaatggaacgttcttacggatcaaaagaa	Protospacer
*********************************

244. spacer 2.4|187520|33|NC_020384|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

atggaaatggaacgttcttacggatcaaaagaa	CRISPR spacer
atggaaatggaacgttcttacggatcaaaagaa	Protospacer
*********************************

245. spacer 2.4|187520|33|NC_020384|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

atggaaatggaacgttcttacggatcaaaagaa	CRISPR spacer
atggaaatggaacgttcttacggatcaaaagaa	Protospacer
*********************************

246. spacer 2.4|187520|33|NC_020384|CRT matches to NZ_CP029456 (Bacillus cereus strain FORC087 plasmid pFORC087.2, complete sequence) position: , mismatch: 0, identity: 1.0

atggaaatggaacgttcttacggatcaaaagaa	CRISPR spacer
atggaaatggaacgttcttacggatcaaaagaa	Protospacer
*********************************

247. spacer 2.4|187520|33|NC_020384|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

atggaaatggaacgttcttacggatcaaaagaa	CRISPR spacer
atggaaatggaacgttcttacggatcaaaagaa	Protospacer
*********************************

248. spacer 2.4|187520|33|NC_020384|CRT matches to NZ_CP013280 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence) position: , mismatch: 0, identity: 1.0

atggaaatggaacgttcttacggatcaaaagaa	CRISPR spacer
atggaaatggaacgttcttacggatcaaaagaa	Protospacer
*********************************

249. spacer 2.4|187520|33|NC_020384|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

atggaaatggaacgttcttacggatcaaaagaa	CRISPR spacer
atggaaatggaacgttcttacggatcaaaagaa	Protospacer
*********************************

250. spacer 2.4|187520|33|NC_020384|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 0, identity: 1.0

atggaaatggaacgttcttacggatcaaaagaa	CRISPR spacer
atggaaatggaacgttcttacggatcaaaagaa	Protospacer
*********************************

251. spacer 2.4|187520|33|NC_020384|CRT matches to NC_011656 (Bacillus cereus AH187 plasmid pAH187_45, complete sequence) position: , mismatch: 0, identity: 1.0

atggaaatggaacgttcttacggatcaaaagaa	CRISPR spacer
atggaaatggaacgttcttacggatcaaaagaa	Protospacer
*********************************

252. spacer 2.4|187520|33|NC_020384|CRT matches to NZ_CP039726 (Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence) position: , mismatch: 0, identity: 1.0

atggaaatggaacgttcttacggatcaaaagaa	CRISPR spacer
atggaaatggaacgttcttacggatcaaaagaa	Protospacer
*********************************

253. spacer 2.4|187520|33|NC_020384|CRT matches to NC_018685 (Bacillus thuringiensis MC28 plasmid pMC95, complete sequence) position: , mismatch: 0, identity: 1.0

atggaaatggaacgttcttacggatcaaaagaa	CRISPR spacer
atggaaatggaacgttcttacggatcaaaagaa	Protospacer
*********************************

254. spacer 2.4|187520|33|NC_020384|CRT matches to NZ_CP009350 (Bacillus thuringiensis HD1002 plasmid 4, complete sequence) position: , mismatch: 0, identity: 1.0

atggaaatggaacgttcttacggatcaaaagaa	CRISPR spacer
atggaaatggaacgttcttacggatcaaaagaa	Protospacer
*********************************

255. spacer 2.4|187520|33|NC_020384|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

atggaaatggaacgttcttacggatcaaaagaa	CRISPR spacer
atggaaatggaacgttcttacggatcaaaagaa	Protospacer
*********************************

256. spacer 2.4|187520|33|NC_020384|CRT matches to NZ_CP033793 (Bacillus sp. FDAARGOS_527 plasmid unnamed6, complete sequence) position: , mismatch: 0, identity: 1.0

atggaaatggaacgttcttacggatcaaaagaa	CRISPR spacer
atggaaatggaacgttcttacggatcaaaagaa	Protospacer
*********************************

257. spacer 2.5|187585|33|NC_020384|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

atgtagctggtattaatgctttgtgaaaaacaa	CRISPR spacer
atgtagctggtattaatgctttgtgaaaaacaa	Protospacer
*********************************

258. spacer 2.5|187585|33|NC_020384|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

atgtagctggtattaatgctttgtgaaaaacaa	CRISPR spacer
atgtagctggtattaatgctttgtgaaaaacaa	Protospacer
*********************************

259. spacer 2.5|187585|33|NC_020384|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

atgtagctggtattaatgctttgtgaaaaacaa	CRISPR spacer
atgtagctggtattaatgctttgtgaaaaacaa	Protospacer
*********************************

260. spacer 2.5|187585|33|NC_020384|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

atgtagctggtattaatgctttgtgaaaaacaa	CRISPR spacer
atgtagctggtattaatgctttgtgaaaaacaa	Protospacer
*********************************

261. spacer 2.5|187585|33|NC_020384|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

atgtagctggtattaatgctttgtgaaaaacaa	CRISPR spacer
atgtagctggtattaatgctttgtgaaaaacaa	Protospacer
*********************************

262. spacer 2.5|187585|33|NC_020384|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

atgtagctggtattaatgctttgtgaaaaacaa	CRISPR spacer
atgtagctggtattaatgctttgtgaaaaacaa	Protospacer
*********************************

263. spacer 2.5|187585|33|NC_020384|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

atgtagctggtattaatgctttgtgaaaaacaa	CRISPR spacer
atgtagctggtattaatgctttgtgaaaaacaa	Protospacer
*********************************

264. spacer 2.5|187585|33|NC_020384|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

atgtagctggtattaatgctttgtgaaaaacaa	CRISPR spacer
atgtagctggtattaatgctttgtgaaaaacaa	Protospacer
*********************************

265. spacer 2.5|187585|33|NC_020384|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

atgtagctggtattaatgctttgtgaaaaacaa	CRISPR spacer
atgtagctggtattaatgctttgtgaaaaacaa	Protospacer
*********************************

266. spacer 2.6|187650|33|NC_020384|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

taaattacttgctgccttatctagattactttc	CRISPR spacer
taaattacttgctgccttatctagattactttc	Protospacer
*********************************

267. spacer 2.6|187650|33|NC_020384|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

taaattacttgctgccttatctagattactttc	CRISPR spacer
taaattacttgctgccttatctagattactttc	Protospacer
*********************************

268. spacer 2.6|187650|33|NC_020384|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

taaattacttgctgccttatctagattactttc	CRISPR spacer
taaattacttgctgccttatctagattactttc	Protospacer
*********************************

269. spacer 2.6|187650|33|NC_020384|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

taaattacttgctgccttatctagattactttc	CRISPR spacer
taaattacttgctgccttatctagattactttc	Protospacer
*********************************

270. spacer 2.6|187650|33|NC_020384|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

taaattacttgctgccttatctagattactttc	CRISPR spacer
taaattacttgctgccttatctagattactttc	Protospacer
*********************************

271. spacer 2.6|187650|33|NC_020384|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

taaattacttgctgccttatctagattactttc	CRISPR spacer
taaattacttgctgccttatctagattactttc	Protospacer
*********************************

272. spacer 2.6|187650|33|NC_020384|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

taaattacttgctgccttatctagattactttc	CRISPR spacer
taaattacttgctgccttatctagattactttc	Protospacer
*********************************

273. spacer 2.6|187650|33|NC_020384|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

taaattacttgctgccttatctagattactttc	CRISPR spacer
taaattacttgctgccttatctagattactttc	Protospacer
*********************************

274. spacer 2.6|187650|33|NC_020384|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

taaattacttgctgccttatctagattactttc	CRISPR spacer
taaattacttgctgccttatctagattactttc	Protospacer
*********************************

275. spacer 2.7|187322|43|NC_020384|CRISPRCasFinder matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

ttggcggtagttcataagtaacaacaaatggatgtcgcacctc	CRISPR spacer
ttggcggtagttcataagtaacaacaaatggatgtcgcacctc	Protospacer
*******************************************

276. spacer 2.7|187322|43|NC_020384|CRISPRCasFinder matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

ttggcggtagttcataagtaacaacaaatggatgtcgcacctc	CRISPR spacer
ttggcggtagttcataagtaacaacaaatggatgtcgcacctc	Protospacer
*******************************************

277. spacer 2.7|187322|43|NC_020384|CRISPRCasFinder matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

ttggcggtagttcataagtaacaacaaatggatgtcgcacctc	CRISPR spacer
ttggcggtagttcataagtaacaacaaatggatgtcgcacctc	Protospacer
*******************************************

278. spacer 2.7|187322|43|NC_020384|CRISPRCasFinder matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

ttggcggtagttcataagtaacaacaaatggatgtcgcacctc	CRISPR spacer
ttggcggtagttcataagtaacaacaaatggatgtcgcacctc	Protospacer
*******************************************

279. spacer 2.7|187322|43|NC_020384|CRISPRCasFinder matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

ttggcggtagttcataagtaacaacaaatggatgtcgcacctc	CRISPR spacer
ttggcggtagttcataagtaacaacaaatggatgtcgcacctc	Protospacer
*******************************************

280. spacer 2.7|187322|43|NC_020384|CRISPRCasFinder matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

ttggcggtagttcataagtaacaacaaatggatgtcgcacctc	CRISPR spacer
ttggcggtagttcataagtaacaacaaatggatgtcgcacctc	Protospacer
*******************************************

281. spacer 2.7|187322|43|NC_020384|CRISPRCasFinder matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

ttggcggtagttcataagtaacaacaaatggatgtcgcacctc	CRISPR spacer
ttggcggtagttcataagtaacaacaaatggatgtcgcacctc	Protospacer
*******************************************

282. spacer 2.7|187322|43|NC_020384|CRISPRCasFinder matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

ttggcggtagttcataagtaacaacaaatggatgtcgcacctc	CRISPR spacer
ttggcggtagttcataagtaacaacaaatggatgtcgcacctc	Protospacer
*******************************************

283. spacer 2.8|187389|42|NC_020384|CRISPRCasFinder matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

gatattcaaagagcctgaacaagtggaatcgagtcgcacctt	CRISPR spacer
gatattcaaagagcctgaacaagtggaatcgagtcgcacctt	Protospacer
******************************************

284. spacer 2.8|187389|42|NC_020384|CRISPRCasFinder matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

gatattcaaagagcctgaacaagtggaatcgagtcgcacctt	CRISPR spacer
gatattcaaagagcctgaacaagtggaatcgagtcgcacctt	Protospacer
******************************************

285. spacer 2.8|187389|42|NC_020384|CRISPRCasFinder matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

gatattcaaagagcctgaacaagtggaatcgagtcgcacctt	CRISPR spacer
gatattcaaagagcctgaacaagtggaatcgagtcgcacctt	Protospacer
******************************************

286. spacer 2.8|187389|42|NC_020384|CRISPRCasFinder matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

gatattcaaagagcctgaacaagtggaatcgagtcgcacctt	CRISPR spacer
gatattcaaagagcctgaacaagtggaatcgagtcgcacctt	Protospacer
******************************************

287. spacer 2.8|187389|42|NC_020384|CRISPRCasFinder matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

gatattcaaagagcctgaacaagtggaatcgagtcgcacctt	CRISPR spacer
gatattcaaagagcctgaacaagtggaatcgagtcgcacctt	Protospacer
******************************************

288. spacer 2.8|187389|42|NC_020384|CRISPRCasFinder matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

gatattcaaagagcctgaacaagtggaatcgagtcgcacctt	CRISPR spacer
gatattcaaagagcctgaacaagtggaatcgagtcgcacctt	Protospacer
******************************************

289. spacer 2.8|187389|42|NC_020384|CRISPRCasFinder matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

gatattcaaagagcctgaacaagtggaatcgagtcgcacctt	CRISPR spacer
gatattcaaagagcctgaacaagtggaatcgagtcgcacctt	Protospacer
******************************************

290. spacer 2.8|187389|42|NC_020384|CRISPRCasFinder matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

gatattcaaagagcctgaacaagtggaatcgagtcgcacctt	CRISPR spacer
gatattcaaagagcctgaacaagtggaatcgagtcgcacctt	Protospacer
******************************************

291. spacer 2.8|187389|42|NC_020384|CRISPRCasFinder matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

gatattcaaagagcctgaacaagtggaatcgagtcgcacctt	CRISPR spacer
gatattcaaagagcctgaacaagtggaatcgagtcgcacctt	Protospacer
******************************************

292. spacer 2.9|187455|43|NC_020384|CRISPRCasFinder matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

aattgaatatgagctgccgccgatggaagggacgtcgcacctt	CRISPR spacer
aattgaatatgagctgccgccgatggaagggacgtcgcacctt	Protospacer
*******************************************

293. spacer 2.9|187455|43|NC_020384|CRISPRCasFinder matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

aattgaatatgagctgccgccgatggaagggacgtcgcacctt	CRISPR spacer
aattgaatatgagctgccgccgatggaagggacgtcgcacctt	Protospacer
*******************************************

294. spacer 2.9|187455|43|NC_020384|CRISPRCasFinder matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

aattgaatatgagctgccgccgatggaagggacgtcgcacctt	CRISPR spacer
aattgaatatgagctgccgccgatggaagggacgtcgcacctt	Protospacer
*******************************************

295. spacer 2.9|187455|43|NC_020384|CRISPRCasFinder matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

aattgaatatgagctgccgccgatggaagggacgtcgcacctt	CRISPR spacer
aattgaatatgagctgccgccgatggaagggacgtcgcacctt	Protospacer
*******************************************

296. spacer 2.9|187455|43|NC_020384|CRISPRCasFinder matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

aattgaatatgagctgccgccgatggaagggacgtcgcacctt	CRISPR spacer
aattgaatatgagctgccgccgatggaagggacgtcgcacctt	Protospacer
*******************************************

297. spacer 2.9|187455|43|NC_020384|CRISPRCasFinder matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

aattgaatatgagctgccgccgatggaagggacgtcgcacctt	CRISPR spacer
aattgaatatgagctgccgccgatggaagggacgtcgcacctt	Protospacer
*******************************************

298. spacer 2.9|187455|43|NC_020384|CRISPRCasFinder matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

aattgaatatgagctgccgccgatggaagggacgtcgcacctt	CRISPR spacer
aattgaatatgagctgccgccgatggaagggacgtcgcacctt	Protospacer
*******************************************

299. spacer 2.9|187455|43|NC_020384|CRISPRCasFinder matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

aattgaatatgagctgccgccgatggaagggacgtcgcacctt	CRISPR spacer
aattgaatatgagctgccgccgatggaagggacgtcgcacctt	Protospacer
*******************************************

300. spacer 2.9|187455|43|NC_020384|CRISPRCasFinder matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

aattgaatatgagctgccgccgatggaagggacgtcgcacctt	CRISPR spacer
aattgaatatgagctgccgccgatggaagggacgtcgcacctt	Protospacer
*******************************************

301. spacer 2.10|187522|41|NC_020384|CRISPRCasFinder matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	CRISPR spacer
ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	Protospacer
*****************************************

302. spacer 2.10|187522|41|NC_020384|CRISPRCasFinder matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	CRISPR spacer
ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	Protospacer
*****************************************

303. spacer 2.10|187522|41|NC_020384|CRISPRCasFinder matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	CRISPR spacer
ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	Protospacer
*****************************************

304. spacer 2.10|187522|41|NC_020384|CRISPRCasFinder matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	CRISPR spacer
ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	Protospacer
*****************************************

305. spacer 2.10|187522|41|NC_020384|CRISPRCasFinder matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	CRISPR spacer
ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	Protospacer
*****************************************

306. spacer 2.10|187522|41|NC_020384|CRISPRCasFinder matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 0, identity: 1.0

ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	CRISPR spacer
ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	Protospacer
*****************************************

307. spacer 2.10|187522|41|NC_020384|CRISPRCasFinder matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	CRISPR spacer
ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	Protospacer
*****************************************

308. spacer 2.10|187522|41|NC_020384|CRISPRCasFinder matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	CRISPR spacer
ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	Protospacer
*****************************************

309. spacer 2.10|187522|41|NC_020384|CRISPRCasFinder matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	CRISPR spacer
ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	Protospacer
*****************************************

310. spacer 2.10|187522|41|NC_020384|CRISPRCasFinder matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	CRISPR spacer
ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	Protospacer
*****************************************

311. spacer 2.11|187587|41|NC_020384|CRISPRCasFinder matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

gtagctggtattaatgctttgtgaaaaacaagtcgcacctt	CRISPR spacer
gtagctggtattaatgctttgtgaaaaacaagtcgcacctt	Protospacer
*****************************************

312. spacer 2.11|187587|41|NC_020384|CRISPRCasFinder matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

gtagctggtattaatgctttgtgaaaaacaagtcgcacctt	CRISPR spacer
gtagctggtattaatgctttgtgaaaaacaagtcgcacctt	Protospacer
*****************************************

313. spacer 2.11|187587|41|NC_020384|CRISPRCasFinder matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

gtagctggtattaatgctttgtgaaaaacaagtcgcacctt	CRISPR spacer
gtagctggtattaatgctttgtgaaaaacaagtcgcacctt	Protospacer
*****************************************

314. spacer 2.11|187587|41|NC_020384|CRISPRCasFinder matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

gtagctggtattaatgctttgtgaaaaacaagtcgcacctt	CRISPR spacer
gtagctggtattaatgctttgtgaaaaacaagtcgcacctt	Protospacer
*****************************************

315. spacer 2.11|187587|41|NC_020384|CRISPRCasFinder matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

gtagctggtattaatgctttgtgaaaaacaagtcgcacctt	CRISPR spacer
gtagctggtattaatgctttgtgaaaaacaagtcgcacctt	Protospacer
*****************************************

316. spacer 2.11|187587|41|NC_020384|CRISPRCasFinder matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtagctggtattaatgctttgtgaaaaacaagtcgcacctt	CRISPR spacer
gtagctggtattaatgctttgtgaaaaacaagtcgcacctt	Protospacer
*****************************************

317. spacer 2.11|187587|41|NC_020384|CRISPRCasFinder matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

gtagctggtattaatgctttgtgaaaaacaagtcgcacctt	CRISPR spacer
gtagctggtattaatgctttgtgaaaaacaagtcgcacctt	Protospacer
*****************************************

318. spacer 2.11|187587|41|NC_020384|CRISPRCasFinder matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

gtagctggtattaatgctttgtgaaaaacaagtcgcacctt	CRISPR spacer
gtagctggtattaatgctttgtgaaaaacaagtcgcacctt	Protospacer
*****************************************

319. spacer 2.11|187587|41|NC_020384|CRISPRCasFinder matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

gtagctggtattaatgctttgtgaaaaacaagtcgcacctt	CRISPR spacer
gtagctggtattaatgctttgtgaaaaacaagtcgcacctt	Protospacer
*****************************************

320. spacer 2.12|187455|32|NC_020384|PILER-CR matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

aattgaatatgagctgccgccgatggaaggga	CRISPR spacer
aattgaatatgagctgccgccgatggaaggga	Protospacer
********************************

321. spacer 2.12|187455|32|NC_020384|PILER-CR matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

aattgaatatgagctgccgccgatggaaggga	CRISPR spacer
aattgaatatgagctgccgccgatggaaggga	Protospacer
********************************

322. spacer 2.12|187455|32|NC_020384|PILER-CR matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

aattgaatatgagctgccgccgatggaaggga	CRISPR spacer
aattgaatatgagctgccgccgatggaaggga	Protospacer
********************************

323. spacer 2.12|187455|32|NC_020384|PILER-CR matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

aattgaatatgagctgccgccgatggaaggga	CRISPR spacer
aattgaatatgagctgccgccgatggaaggga	Protospacer
********************************

324. spacer 2.12|187455|32|NC_020384|PILER-CR matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

aattgaatatgagctgccgccgatggaaggga	CRISPR spacer
aattgaatatgagctgccgccgatggaaggga	Protospacer
********************************

325. spacer 2.12|187455|32|NC_020384|PILER-CR matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

aattgaatatgagctgccgccgatggaaggga	CRISPR spacer
aattgaatatgagctgccgccgatggaaggga	Protospacer
********************************

326. spacer 2.12|187455|32|NC_020384|PILER-CR matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

aattgaatatgagctgccgccgatggaaggga	CRISPR spacer
aattgaatatgagctgccgccgatggaaggga	Protospacer
********************************

327. spacer 2.12|187455|32|NC_020384|PILER-CR matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

aattgaatatgagctgccgccgatggaaggga	CRISPR spacer
aattgaatatgagctgccgccgatggaaggga	Protospacer
********************************

328. spacer 2.12|187455|32|NC_020384|PILER-CR matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

aattgaatatgagctgccgccgatggaaggga	CRISPR spacer
aattgaatatgagctgccgccgatggaaggga	Protospacer
********************************

329. spacer 2.13|187522|30|NC_020384|PILER-CR matches to NZ_CP017573 (Bacillus thuringiensis strain SCG04-02 plasmid PSCG61, complete sequence) position: , mismatch: 0, identity: 1.0

ggaaatggaacgttcttacggatcaaaaga	CRISPR spacer
ggaaatggaacgttcttacggatcaaaaga	Protospacer
******************************

330. spacer 2.13|187522|30|NC_020384|PILER-CR matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

ggaaatggaacgttcttacggatcaaaaga	CRISPR spacer
ggaaatggaacgttcttacggatcaaaaga	Protospacer
******************************

331. spacer 2.13|187522|30|NC_020384|PILER-CR matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

ggaaatggaacgttcttacggatcaaaaga	CRISPR spacer
ggaaatggaacgttcttacggatcaaaaga	Protospacer
******************************

332. spacer 2.13|187522|30|NC_020384|PILER-CR matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

ggaaatggaacgttcttacggatcaaaaga	CRISPR spacer
ggaaatggaacgttcttacggatcaaaaga	Protospacer
******************************

333. spacer 2.13|187522|30|NC_020384|PILER-CR matches to NZ_CP029456 (Bacillus cereus strain FORC087 plasmid pFORC087.2, complete sequence) position: , mismatch: 0, identity: 1.0

ggaaatggaacgttcttacggatcaaaaga	CRISPR spacer
ggaaatggaacgttcttacggatcaaaaga	Protospacer
******************************

334. spacer 2.13|187522|30|NC_020384|PILER-CR matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

ggaaatggaacgttcttacggatcaaaaga	CRISPR spacer
ggaaatggaacgttcttacggatcaaaaga	Protospacer
******************************

335. spacer 2.13|187522|30|NC_020384|PILER-CR matches to NZ_CP013280 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence) position: , mismatch: 0, identity: 1.0

ggaaatggaacgttcttacggatcaaaaga	CRISPR spacer
ggaaatggaacgttcttacggatcaaaaga	Protospacer
******************************

336. spacer 2.13|187522|30|NC_020384|PILER-CR matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

ggaaatggaacgttcttacggatcaaaaga	CRISPR spacer
ggaaatggaacgttcttacggatcaaaaga	Protospacer
******************************

337. spacer 2.13|187522|30|NC_020384|PILER-CR matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 0, identity: 1.0

ggaaatggaacgttcttacggatcaaaaga	CRISPR spacer
ggaaatggaacgttcttacggatcaaaaga	Protospacer
******************************

338. spacer 2.13|187522|30|NC_020384|PILER-CR matches to NC_011656 (Bacillus cereus AH187 plasmid pAH187_45, complete sequence) position: , mismatch: 0, identity: 1.0

ggaaatggaacgttcttacggatcaaaaga	CRISPR spacer
ggaaatggaacgttcttacggatcaaaaga	Protospacer
******************************

339. spacer 2.13|187522|30|NC_020384|PILER-CR matches to NZ_CP039726 (Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence) position: , mismatch: 0, identity: 1.0

ggaaatggaacgttcttacggatcaaaaga	CRISPR spacer
ggaaatggaacgttcttacggatcaaaaga	Protospacer
******************************

340. spacer 2.13|187522|30|NC_020384|PILER-CR matches to NC_018685 (Bacillus thuringiensis MC28 plasmid pMC95, complete sequence) position: , mismatch: 0, identity: 1.0

ggaaatggaacgttcttacggatcaaaaga	CRISPR spacer
ggaaatggaacgttcttacggatcaaaaga	Protospacer
******************************

341. spacer 2.13|187522|30|NC_020384|PILER-CR matches to NZ_CP009350 (Bacillus thuringiensis HD1002 plasmid 4, complete sequence) position: , mismatch: 0, identity: 1.0

ggaaatggaacgttcttacggatcaaaaga	CRISPR spacer
ggaaatggaacgttcttacggatcaaaaga	Protospacer
******************************

342. spacer 2.13|187522|30|NC_020384|PILER-CR matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

ggaaatggaacgttcttacggatcaaaaga	CRISPR spacer
ggaaatggaacgttcttacggatcaaaaga	Protospacer
******************************

343. spacer 2.13|187522|30|NC_020384|PILER-CR matches to NZ_CP033793 (Bacillus sp. FDAARGOS_527 plasmid unnamed6, complete sequence) position: , mismatch: 0, identity: 1.0

ggaaatggaacgttcttacggatcaaaaga	CRISPR spacer
ggaaatggaacgttcttacggatcaaaaga	Protospacer
******************************

344. spacer 2.13|187522|30|NC_020384|PILER-CR matches to NZ_CP047087 (Bacillus paranthracis strain BC307 plasmid pCE2, complete sequence) position: , mismatch: 0, identity: 1.0

ggaaatggaacgttcttacggatcaaaaga	CRISPR spacer
ggaaatggaacgttcttacggatcaaaaga	Protospacer
******************************

345. spacer 2.13|187522|30|NC_020384|PILER-CR matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

ggaaatggaacgttcttacggatcaaaaga	CRISPR spacer
ggaaatggaacgttcttacggatcaaaaga	Protospacer
******************************

346. spacer 2.13|187522|30|NC_020384|PILER-CR matches to NC_018510 (Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence) position: , mismatch: 0, identity: 1.0

ggaaatggaacgttcttacggatcaaaaga	CRISPR spacer
ggaaatggaacgttcttacggatcaaaaga	Protospacer
******************************

347. spacer 2.13|187522|30|NC_020384|PILER-CR matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

ggaaatggaacgttcttacggatcaaaaga	CRISPR spacer
ggaaatggaacgttcttacggatcaaaaga	Protospacer
******************************

348. spacer 2.13|187522|30|NC_020384|PILER-CR matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

ggaaatggaacgttcttacggatcaaaaga	CRISPR spacer
ggaaatggaacgttcttacggatcaaaaga	Protospacer
******************************

349. spacer 2.13|187522|30|NC_020384|PILER-CR matches to CP041751 (Bacillus paranthracis strain NCCP 14796 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ggaaatggaacgttcttacggatcaaaaga	CRISPR spacer
ggaaatggaacgttcttacggatcaaaaga	Protospacer
******************************

350. spacer 2.14|187587|30|NC_020384|PILER-CR matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

gtagctggtattaatgctttgtgaaaaaca	CRISPR spacer
gtagctggtattaatgctttgtgaaaaaca	Protospacer
******************************

351. spacer 2.14|187587|30|NC_020384|PILER-CR matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

gtagctggtattaatgctttgtgaaaaaca	CRISPR spacer
gtagctggtattaatgctttgtgaaaaaca	Protospacer
******************************

352. spacer 2.14|187587|30|NC_020384|PILER-CR matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

gtagctggtattaatgctttgtgaaaaaca	CRISPR spacer
gtagctggtattaatgctttgtgaaaaaca	Protospacer
******************************

353. spacer 2.14|187587|30|NC_020384|PILER-CR matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

gtagctggtattaatgctttgtgaaaaaca	CRISPR spacer
gtagctggtattaatgctttgtgaaaaaca	Protospacer
******************************

354. spacer 2.14|187587|30|NC_020384|PILER-CR matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

gtagctggtattaatgctttgtgaaaaaca	CRISPR spacer
gtagctggtattaatgctttgtgaaaaaca	Protospacer
******************************

355. spacer 2.14|187587|30|NC_020384|PILER-CR matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtagctggtattaatgctttgtgaaaaaca	CRISPR spacer
gtagctggtattaatgctttgtgaaaaaca	Protospacer
******************************

356. spacer 2.14|187587|30|NC_020384|PILER-CR matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

gtagctggtattaatgctttgtgaaaaaca	CRISPR spacer
gtagctggtattaatgctttgtgaaaaaca	Protospacer
******************************

357. spacer 2.14|187587|30|NC_020384|PILER-CR matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

gtagctggtattaatgctttgtgaaaaaca	CRISPR spacer
gtagctggtattaatgctttgtgaaaaaca	Protospacer
******************************

358. spacer 2.14|187587|30|NC_020384|PILER-CR matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

gtagctggtattaatgctttgtgaaaaaca	CRISPR spacer
gtagctggtattaatgctttgtgaaaaaca	Protospacer
******************************

359. spacer 1.3|179660|34|NC_020384|CRISPRCasFinder matches to NZ_CP010096 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMBLin15, complete sequence) position: , mismatch: 1, identity: 0.971

acaagatacgagaatttaatgacgtcacccacat	CRISPR spacer
actagatacgagaatttaatgacgtcacccacat	Protospacer
** *******************************

360. spacer 1.5|179792|35|NC_020384|CRISPRCasFinder matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 1, identity: 0.971

-acaatgggaaagtgttaggttatgcacgttttaaa	CRISPR spacer
tacaatggg-aagtgttaggttatgcacgttttaaa	Protospacer
 ******** **************************

361. spacer 1.8|179988|33|NC_020384|CRISPRCasFinder matches to NZ_CP010096 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMBLin15, complete sequence) position: , mismatch: 1, identity: 0.97

taggagttattaatggctttagatgttagacca	CRISPR spacer
aaggagttattaatggctttagatgttagacca	Protospacer
 ********************************

362. spacer 1.10|180119|33|NC_020384|CRISPRCasFinder matches to NC_017206 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence) position: , mismatch: 1, identity: 0.97

tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
tttgcaactagctcaattgttttcccgttttca	Protospacer
***********************.*********

363. spacer 1.10|180119|33|NC_020384|CRISPRCasFinder matches to NZ_CP047087 (Bacillus paranthracis strain BC307 plasmid pCE2, complete sequence) position: , mismatch: 1, identity: 0.97

tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
tttgcaactagctcaattgttttcccgttttca	Protospacer
***********************.*********

364. spacer 1.10|180119|33|NC_020384|CRISPRCasFinder matches to NC_018510 (Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence) position: , mismatch: 1, identity: 0.97

tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
tttgcaactagctcaattgttttcccgttttca	Protospacer
***********************.*********

365. spacer 1.10|180119|33|NC_020384|CRISPRCasFinder matches to NC_022882 (Bacillus thuringiensis YBT-1518 plasmid pBMB0233, complete sequence) position: , mismatch: 1, identity: 0.97

tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
tttgcaactagctcaattgtttttccattttca	Protospacer
**************************.******

366. spacer 1.10|180119|33|NC_020384|CRISPRCasFinder matches to NC_020383 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence) position: , mismatch: 1, identity: 0.97

tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
tttgcaactagctcaattgttttcccgttttca	Protospacer
***********************.*********

367. spacer 1.10|180119|33|NC_020384|CRISPRCasFinder matches to NZ_CP013280 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence) position: , mismatch: 1, identity: 0.97

tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
tttgcaactagctcaattgttttcccgttttca	Protospacer
***********************.*********

368. spacer 1.10|180119|33|NC_020384|CRISPRCasFinder matches to NZ_CP039726 (Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence) position: , mismatch: 1, identity: 0.97

tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
tttgcaactagctcaattgttttcccgttttca	Protospacer
***********************.*********

369. spacer 1.10|180119|33|NC_020384|CRISPRCasFinder matches to NZ_CP009350 (Bacillus thuringiensis HD1002 plasmid 4, complete sequence) position: , mismatch: 1, identity: 0.97

tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
tttgcaactagctcaattgttttcccgttttca	Protospacer
***********************.*********

370. spacer 1.10|180119|33|NC_020384|CRISPRCasFinder matches to NC_022877 (Bacillus thuringiensis YBT-1518 plasmid pBMB0232, complete sequence) position: , mismatch: 1, identity: 0.97

tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
tttgcaactagctcaattgtttttccattttca	Protospacer
**************************.******

371. spacer 1.10|180119|33|NC_020384|CRISPRCasFinder matches to CP016198 (Bacillus thuringiensis serovar coreanensis strain ST7 plasmid pST7-4, complete sequence) position: , mismatch: 1, identity: 0.97

tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
tttgcaactagctcaattgttttcccgttttca	Protospacer
***********************.*********

372. spacer 1.11|180184|34|NC_020384|CRISPRCasFinder matches to NZ_CP020748 (Bacillus mycoides strain Gnyt1 plasmid unnamed5, complete sequence) position: , mismatch: 1, identity: 0.971

tacctcgggtttatatttatctggaacgctcata	CRISPR spacer
tacctcgggtttatatttatctgggacgctcata	Protospacer
************************.*********

373. spacer 1.11|180184|34|NC_020384|CRISPRCasFinder matches to NZ_CP011157 (Bacillus cereus strain HN001 plasmid pRML02, complete sequence) position: , mismatch: 1, identity: 0.971

tacctcgggtttatatttatctggaacgctcata	CRISPR spacer
tacctcgggtttatatttatctgggacgctcata	Protospacer
************************.*********

374. spacer 2.1|187320|35|NC_020384|CRT matches to NZ_CP014286 (Bacillus thuringiensis strain Bt185 plasmid pBT1850054, complete sequence) position: , mismatch: 1, identity: 0.971

cattggcggtagttcataagtaacaacaaatggat	CRISPR spacer
cattggcggtagttcataagtaacaacaaatgtat	Protospacer
******************************** **

375. spacer 2.1|187320|35|NC_020384|CRT matches to NZ_CP032610 (Bacillus thuringiensis strain QZL38 plasmid p.3, complete sequence) position: , mismatch: 1, identity: 0.971

cattggcggtagttcataagtaacaacaaatggat	CRISPR spacer
cattggcggtagttcataagtaacaacaaatgtat	Protospacer
******************************** **

376. spacer 2.4|187520|33|NC_020384|CRT matches to NC_017206 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence) position: , mismatch: 1, identity: 0.97

atggaaatggaacgttcttacggatcaaaagaa	CRISPR spacer
atggaaatggaacgtttttacggatcaaaagaa	Protospacer
****************.****************

377. spacer 2.4|187520|33|NC_020384|CRT matches to NC_020383 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence) position: , mismatch: 1, identity: 0.97

atggaaatggaacgttcttacggatcaaaagaa	CRISPR spacer
atggaaatggaacgtttttacggatcaaaagaa	Protospacer
****************.****************

378. spacer 2.4|187520|33|NC_020384|CRT matches to CP024689 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-5-125K, complete sequence) position: , mismatch: 1, identity: 0.97

atggaaatggaacgttcttacggatcaaaagaa	CRISPR spacer
atggaaatggaacgttcttatggatcaaaagaa	Protospacer
********************.************

379. spacer 2.6|187650|33|NC_020384|CRT matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 1, identity: 0.97

taaattacttgctgccttatctagattactttc	CRISPR spacer
gaaattacttgctgccttatctagattactttc	Protospacer
 ********************************

380. spacer 2.6|187650|33|NC_020384|CRT matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 1, identity: 0.97

taaattacttgctgccttatctagattactttc	CRISPR spacer
gaaattacttgctgccttatctagattactttc	Protospacer
 ********************************

381. spacer 2.13|187522|30|NC_020384|PILER-CR matches to CP024689 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-5-125K, complete sequence) position: , mismatch: 1, identity: 0.967

ggaaatggaacgttcttacggatcaaaaga	CRISPR spacer
ggaaatggaacgttcttatggatcaaaaga	Protospacer
******************.***********

382. spacer 2.13|187522|30|NC_020384|PILER-CR matches to NC_017206 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence) position: , mismatch: 1, identity: 0.967

ggaaatggaacgttcttacggatcaaaaga	CRISPR spacer
ggaaatggaacgtttttacggatcaaaaga	Protospacer
**************.***************

383. spacer 2.13|187522|30|NC_020384|PILER-CR matches to NC_020383 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence) position: , mismatch: 1, identity: 0.967

ggaaatggaacgttcttacggatcaaaaga	CRISPR spacer
ggaaatggaacgtttttacggatcaaaaga	Protospacer
**************.***************

384. spacer 1.9|180053|34|NC_020384|CRISPRCasFinder matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 2, identity: 0.941

tacctcgggtttatatttatctggaatgcccata	CRISPR spacer
tacctcgggtttatatttatctggaacgctcata	Protospacer
**************************.**.****

385. spacer 1.9|180053|34|NC_020384|CRISPRCasFinder matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 2, identity: 0.941

tacctcgggtttatatttatctggaatgcccata	CRISPR spacer
tacctcgggtttatatttatctggaacgctcata	Protospacer
**************************.**.****

386. spacer 1.9|180053|34|NC_020384|CRISPRCasFinder matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 2, identity: 0.941

tacctcgggtttatatttatctggaatgcccata	CRISPR spacer
tacctcgggtttatatttatctggaacgctcata	Protospacer
**************************.**.****

387. spacer 1.9|180053|34|NC_020384|CRISPRCasFinder matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 2, identity: 0.941

tacctcgggtttatatttatctggaatgcccata	CRISPR spacer
tacctcgggtttatatttatctggaacgctcata	Protospacer
**************************.**.****

388. spacer 1.9|180053|34|NC_020384|CRISPRCasFinder matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 2, identity: 0.941

tacctcgggtttatatttatctggaatgcccata	CRISPR spacer
tacctcgggtttatatttatctggaacgctcata	Protospacer
**************************.**.****

389. spacer 1.9|180053|34|NC_020384|CRISPRCasFinder matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 2, identity: 0.941

tacctcgggtttatatttatctggaatgcccata	CRISPR spacer
tacctcgggtttatatttatctggaacgctcata	Protospacer
**************************.**.****

390. spacer 1.9|180053|34|NC_020384|CRISPRCasFinder matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 2, identity: 0.941

tacctcgggtttatatttatctggaatgcccata	CRISPR spacer
tacctcgggtttatatttatctggaacgctcata	Protospacer
**************************.**.****

391. spacer 1.9|180053|34|NC_020384|CRISPRCasFinder matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 2, identity: 0.941

tacctcgggtttatatttatctggaatgcccata	CRISPR spacer
tacctcgggtttatatttatctggaacgctcata	Protospacer
**************************.**.****

392. spacer 1.9|180053|34|NC_020384|CRISPRCasFinder matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 2, identity: 0.941

tacctcgggtttatatttatctggaatgcccata	CRISPR spacer
tacctcgggtttatatttatctggaacgctcata	Protospacer
**************************.**.****

393. spacer 1.9|180053|34|NC_020384|CRISPRCasFinder matches to NZ_KX258624 (Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence) position: , mismatch: 2, identity: 0.941

tacctcgggtttatatttatctggaatgcccata	CRISPR spacer
tacctcgggtttatatttatctggaacgctcata	Protospacer
**************************.**.****

394. spacer 1.10|180119|33|NC_020384|CRISPRCasFinder matches to NC_022782 (Bacillus toyonensis BCT-7112 plasmid pBCT77, complete sequence) position: , mismatch: 2, identity: 0.939

tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
tttgcaactagctcaattgttttcccattttca	Protospacer
***********************.**.******

395. spacer 1.10|180119|33|NC_020384|CRISPRCasFinder matches to NZ_CP017573 (Bacillus thuringiensis strain SCG04-02 plasmid PSCG61, complete sequence) position: , mismatch: 2, identity: 0.939

tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
tttgcaactagctcaattattttcccgttttca	Protospacer
******************.****.*********

396. spacer 1.10|180119|33|NC_020384|CRISPRCasFinder matches to NZ_CP029456 (Bacillus cereus strain FORC087 plasmid pFORC087.2, complete sequence) position: , mismatch: 2, identity: 0.939

tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
tttgcaactagctcaattattttcccgttttca	Protospacer
******************.****.*********

397. spacer 1.10|180119|33|NC_020384|CRISPRCasFinder matches to NC_011656 (Bacillus cereus AH187 plasmid pAH187_45, complete sequence) position: , mismatch: 2, identity: 0.939

tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
tttgcaaccagctcaattgttttcccgttttca	Protospacer
********.**************.*********

398. spacer 1.11|180184|34|NC_020384|CRISPRCasFinder matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 2, identity: 0.941

tacctcgggtttatatttatctggaacgctcata	CRISPR spacer
tacctcgggtttatatttatctggaatgcccata	Protospacer
**************************.**.****

399. spacer 1.11|180184|34|NC_020384|CRISPRCasFinder matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 2, identity: 0.941

tacctcgggtttatatttatctggaacgctcata	CRISPR spacer
tacctcgggtttatatttatctggaatgcccata	Protospacer
**************************.**.****

400. spacer 1.11|180184|34|NC_020384|CRISPRCasFinder matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 2, identity: 0.941

tacctcgggtttatatttatctggaacgctcata	CRISPR spacer
tacctcgggtttatatttatctggaatgcccata	Protospacer
**************************.**.****

401. spacer 1.11|180184|34|NC_020384|CRISPRCasFinder matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 2, identity: 0.941

tacctcgggtttatatttatctggaacgctcata	CRISPR spacer
tacctcgggtttatatttatctggaatgcccata	Protospacer
**************************.**.****

402. spacer 1.11|180184|34|NC_020384|CRISPRCasFinder matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 2, identity: 0.941

tacctcgggtttatatttatctggaacgctcata	CRISPR spacer
tacctcgggtttatatttatctggaatgcccata	Protospacer
**************************.**.****

403. spacer 1.11|180184|34|NC_020384|CRISPRCasFinder matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 2, identity: 0.941

tacctcgggtttatatttatctggaacgctcata	CRISPR spacer
tacctcgggtttatatttatctggaatgcccata	Protospacer
**************************.**.****

404. spacer 1.11|180184|34|NC_020384|CRISPRCasFinder matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 2, identity: 0.941

tacctcgggtttatatttatctggaacgctcata	CRISPR spacer
tacctcgggtttatatttatctggaatgcccata	Protospacer
**************************.**.****

405. spacer 1.11|180184|34|NC_020384|CRISPRCasFinder matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 2, identity: 0.941

tacctcgggtttatatttatctggaacgctcata	CRISPR spacer
tacctcgggtttatatttatctggaatgcccata	Protospacer
**************************.**.****

406. spacer 1.11|180184|34|NC_020384|CRISPRCasFinder matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 2, identity: 0.941

tacctcgggtttatatttatctggaacgctcata	CRISPR spacer
tacctcgggtttatatttatctggaatgcccata	Protospacer
**************************.**.****

407. spacer 1.19|180044|43|NC_020384|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 2, identity: 0.953

gattgaaattacctcgggtttatatttatctggaatgcccata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaacgctcata	Protospacer
***********************************.**.****

408. spacer 1.19|180044|43|NC_020384|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 2, identity: 0.953

gattgaaattacctcgggtttatatttatctggaatgcccata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaacgctcata	Protospacer
***********************************.**.****

409. spacer 1.19|180044|43|NC_020384|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 2, identity: 0.953

gattgaaattacctcgggtttatatttatctggaatgcccata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaacgctcata	Protospacer
***********************************.**.****

410. spacer 1.19|180044|43|NC_020384|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 2, identity: 0.953

gattgaaattacctcgggtttatatttatctggaatgcccata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaacgctcata	Protospacer
***********************************.**.****

411. spacer 1.19|180044|43|NC_020384|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 2, identity: 0.953

gattgaaattacctcgggtttatatttatctggaatgcccata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaacgctcata	Protospacer
***********************************.**.****

412. spacer 1.19|180044|43|NC_020384|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 2, identity: 0.953

gattgaaattacctcgggtttatatttatctggaatgcccata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaacgctcata	Protospacer
***********************************.**.****

413. spacer 1.19|180044|43|NC_020384|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 2, identity: 0.953

gattgaaattacctcgggtttatatttatctggaatgcccata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaacgctcata	Protospacer
***********************************.**.****

414. spacer 1.19|180044|43|NC_020384|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 2, identity: 0.953

gattgaaattacctcgggtttatatttatctggaatgcccata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaacgctcata	Protospacer
***********************************.**.****

415. spacer 1.19|180044|43|NC_020384|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 2, identity: 0.953

gattgaaattacctcgggtttatatttatctggaatgcccata	CRISPR spacer
ggatgaaattacctcgggtttatatttatctggaatgcccata	Protospacer
*. ****************************************

416. spacer 1.19|180044|43|NC_020384|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 2, identity: 0.953

gattgaaattacctcgggtttatatttatctggaatgcccata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaacgctcata	Protospacer
***********************************.**.****

417. spacer 1.19|180044|43|NC_020384|CRT matches to NZ_KX258624 (Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence) position: , mismatch: 2, identity: 0.953

gattgaaattacctcgggtttatatttatctggaatgcccata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaacgctcata	Protospacer
***********************************.**.****

418. spacer 1.21|180175|43|NC_020384|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 2, identity: 0.953

gattgaaattacctcgggtttatatttatctggaacgctcata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaatgcccata	Protospacer
***********************************.**.****

419. spacer 1.21|180175|43|NC_020384|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 2, identity: 0.953

gattgaaattacctcgggtttatatttatctggaacgctcata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaatgcccata	Protospacer
***********************************.**.****

420. spacer 1.21|180175|43|NC_020384|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 2, identity: 0.953

gattgaaattacctcgggtttatatttatctggaacgctcata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaatgcccata	Protospacer
***********************************.**.****

421. spacer 1.21|180175|43|NC_020384|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 2, identity: 0.953

gattgaaattacctcgggtttatatttatctggaacgctcata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaatgcccata	Protospacer
***********************************.**.****

422. spacer 1.21|180175|43|NC_020384|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 2, identity: 0.953

gattgaaattacctcgggtttatatttatctggaacgctcata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaatgcccata	Protospacer
***********************************.**.****

423. spacer 1.21|180175|43|NC_020384|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 2, identity: 0.953

gattgaaattacctcgggtttatatttatctggaacgctcata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaatgcccata	Protospacer
***********************************.**.****

424. spacer 1.21|180175|43|NC_020384|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 2, identity: 0.953

gattgaaattacctcgggtttatatttatctggaacgctcata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaatgcccata	Protospacer
***********************************.**.****

425. spacer 1.21|180175|43|NC_020384|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 2, identity: 0.953

gattgaaattacctcgggtttatatttatctggaacgctcata	CRISPR spacer
gattgaaattacctcgggtttatatttatctggaatgcccata	Protospacer
***********************************.**.****

426. spacer 2.1|187320|35|NC_020384|CRT matches to CP020757 (Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-18, complete sequence) position: , mismatch: 2, identity: 0.943

cattggcggtagttcataagtaacaacaaatggat	CRISPR spacer
cattggcggtaattcataagtaacaacaaatgtat	Protospacer
***********.******************** **

427. spacer 2.1|187320|35|NC_020384|CRT matches to CP020757 (Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-18, complete sequence) position: , mismatch: 2, identity: 0.943

cattggcggtagttcataagtaacaacaaatggat	CRISPR spacer
cattggcggtaattcataagtaacaacaaatgtat	Protospacer
***********.******************** **

428. spacer 2.1|187320|35|NC_020384|CRT matches to NZ_CP021064 (Bacillus thuringiensis strain ATCC 10792 plasmid poh3, complete sequence) position: , mismatch: 2, identity: 0.943

cattggcggtagttcataagtaacaacaaatggat	CRISPR spacer
cattggcggtaattcataagtaacaacaaatgtat	Protospacer
***********.******************** **

429. spacer 2.1|187320|35|NC_020384|CRT matches to NZ_CP021064 (Bacillus thuringiensis strain ATCC 10792 plasmid poh3, complete sequence) position: , mismatch: 2, identity: 0.943

cattggcggtagttcataagtaacaacaaatggat	CRISPR spacer
cattggcggtaattcataagtaacaacaaatgtat	Protospacer
***********.******************** **

430. spacer 2.1|187320|35|NC_020384|CRT matches to NC_017204 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT51, complete sequence) position: , mismatch: 2, identity: 0.943

cattggcggtagttcataagtaacaacaaatggat	CRISPR spacer
cattggcggtaattcataagtaacaacaaatgtat	Protospacer
***********.******************** **

431. spacer 2.4|187520|33|NC_020384|CRT matches to NC_022882 (Bacillus thuringiensis YBT-1518 plasmid pBMB0233, complete sequence) position: , mismatch: 2, identity: 0.939

atggaaatggaacgttcttacggatcaaaagaa	CRISPR spacer
atggaaatggaacgatcttatggatcaaaagaa	Protospacer
************** *****.************

432. spacer 2.4|187520|33|NC_020384|CRT matches to NC_022782 (Bacillus toyonensis BCT-7112 plasmid pBCT77, complete sequence) position: , mismatch: 2, identity: 0.939

atggaaatggaacgttcttacggatcaaaagaa	CRISPR spacer
atggaaatggaacgatcttatggatcaaaagaa	Protospacer
************** *****.************

433. spacer 2.4|187520|33|NC_020384|CRT matches to NC_022877 (Bacillus thuringiensis YBT-1518 plasmid pBMB0232, complete sequence) position: , mismatch: 2, identity: 0.939

atggaaatggaacgttcttacggatcaaaagaa	CRISPR spacer
atggaaatggaacgatcttatggatcaaaagaa	Protospacer
************** *****.************

434. spacer 2.6|187650|33|NC_020384|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 2, identity: 0.939

taaattacttgctgccttatctagattactttc	CRISPR spacer
gaaattacttgctgccttatctaaattactttc	Protospacer
 **********************.*********

435. spacer 2.13|187522|30|NC_020384|PILER-CR matches to NC_022877 (Bacillus thuringiensis YBT-1518 plasmid pBMB0232, complete sequence) position: , mismatch: 2, identity: 0.933

ggaaatggaacgttcttacggatcaaaaga	CRISPR spacer
ggaaatggaacgatcttatggatcaaaaga	Protospacer
************ *****.***********

436. spacer 2.13|187522|30|NC_020384|PILER-CR matches to NC_022882 (Bacillus thuringiensis YBT-1518 plasmid pBMB0233, complete sequence) position: , mismatch: 2, identity: 0.933

ggaaatggaacgttcttacggatcaaaaga	CRISPR spacer
ggaaatggaacgatcttatggatcaaaaga	Protospacer
************ *****.***********

437. spacer 2.13|187522|30|NC_020384|PILER-CR matches to NC_022782 (Bacillus toyonensis BCT-7112 plasmid pBCT77, complete sequence) position: , mismatch: 2, identity: 0.933

ggaaatggaacgttcttacggatcaaaaga	CRISPR spacer
ggaaatggaacgatcttatggatcaaaaga	Protospacer
************ *****.***********

438. spacer 1.1|179663|30|NC_020384|PILER-CR matches to NZ_CP004882 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMBLin15, complete sequence) position: , mismatch: 3, identity: 0.9

agatacgagaatttaatgacgtcacccaca	CRISPR spacer
aagtacgagaatttaatgacgtcacctaca	Protospacer
*..***********************.***

439. spacer 1.1|179663|30|NC_020384|PILER-CR matches to NZ_CP011355 (Bacillus thuringiensis strain YC-10 plasmid pYC10, complete sequence) position: , mismatch: 3, identity: 0.9

agatacgagaatttaatgacgtcacccaca	CRISPR spacer
aagtacgagaatttaatgacgtcacctaca	Protospacer
*..***********************.***

440. spacer 1.1|179663|30|NC_020384|PILER-CR matches to NC_006945 (Bacillus phage GIL16c, complete genome) position: , mismatch: 3, identity: 0.9

agatacgagaatttaatgacgtcacccaca	CRISPR spacer
aagtacgagaatttaatgacgtcacctaca	Protospacer
*..***********************.***

441. spacer 1.1|179663|30|NC_020384|PILER-CR matches to AY701338 (Bacillus thuringiensis phage GIL16c, complete genome) position: , mismatch: 3, identity: 0.9

agatacgagaatttaatgacgtcacccaca	CRISPR spacer
aagtacgagaatttaatgacgtcacctaca	Protospacer
*..***********************.***

442. spacer 1.8|179988|33|NC_020384|CRISPRCasFinder matches to NZ_AP014870 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK6) position: , mismatch: 3, identity: 0.909

taggagttattaatggctttagatgttagacca	CRISPR spacer
tcgtagttattaatggctttagatgttagaccg	Protospacer
* * ****************************.

443. spacer 1.16|179850|41|NC_020384|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 3, identity: 0.927

aattgaaatgaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
attgaaaatgaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
* * .************************************

444. spacer 2.2|187387|34|NC_020384|CRT matches to MH598512 (Bacillus phage Wes44, complete genome) position: , mismatch: 3, identity: 0.912

atgatattcaaagagcctgaacaagtggaatcga	CRISPR spacer
gtggtattcaatgagcctgaacaagtggaatcga	Protospacer
.**.******* **********************

445. spacer 1.3|179660|34|NC_020384|CRISPRCasFinder matches to NZ_CP004882 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMBLin15, complete sequence) position: , mismatch: 4, identity: 0.882

acaagatacgagaatttaatgacgtcacccacat	CRISPR spacer
actaagtacgagaatttaatgacgtcacctacat	Protospacer
** *..***********************.****

446. spacer 1.3|179660|34|NC_020384|CRISPRCasFinder matches to NZ_CP011355 (Bacillus thuringiensis strain YC-10 plasmid pYC10, complete sequence) position: , mismatch: 4, identity: 0.882

acaagatacgagaatttaatgacgtcacccacat	CRISPR spacer
actaagtacgagaatttaatgacgtcacctacat	Protospacer
** *..***********************.****

447. spacer 1.3|179660|34|NC_020384|CRISPRCasFinder matches to NC_006945 (Bacillus phage GIL16c, complete genome) position: , mismatch: 4, identity: 0.882

acaagatacgagaatttaatgacgtcacccacat	CRISPR spacer
actaagtacgagaatttaatgacgtcacctacat	Protospacer
** *..***********************.****

448. spacer 1.3|179660|34|NC_020384|CRISPRCasFinder matches to AY701338 (Bacillus thuringiensis phage GIL16c, complete genome) position: , mismatch: 4, identity: 0.882

acaagatacgagaatttaatgacgtcacccacat	CRISPR spacer
actaagtacgagaatttaatgacgtcacctacat	Protospacer
** *..***********************.****

449. spacer 1.16|179850|41|NC_020384|CRT matches to NZ_CP004871 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB46, complete sequence) position: , mismatch: 4, identity: 0.902

aattgaaat--gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
--tggaagttcgaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
  * ***.*  ********************************

450. spacer 1.16|179850|41|NC_020384|CRT matches to NZ_CP011352 (Bacillus thuringiensis strain YC-10 plasmid pYC4, complete sequence) position: , mismatch: 4, identity: 0.902

aattgaaat--gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
--tggaagttcgaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
  * ***.*  ********************************

451. spacer 1.16|179850|41|NC_020384|CRT matches to NZ_CP013060 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-5, complete sequence) position: , mismatch: 4, identity: 0.902

aattgaaat--gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
--tggaagttcgaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
  * ***.*  ********************************

452. spacer 1.16|179850|41|NC_020384|CRT matches to NZ_CP010095 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB47, complete sequence) position: , mismatch: 4, identity: 0.902

aattgaaat--gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
--tggaagttcgaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
  * ***.*  ********************************

453. spacer 1.16|179850|41|NC_020384|CRT matches to MK843319 (Bacillus phage vB_BthS-TP21T, complete genome) position: , mismatch: 4, identity: 0.902

aattgaaat--gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
--tggaagttcgaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
  * ***.*  ********************************

454. spacer 1.16|179850|41|NC_020384|CRT matches to KT970646 (Bacillus phage phiS58, complete genome) position: , mismatch: 4, identity: 0.902

aattgaaat--gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
--tggaagttcgaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
  * ***.*  ********************************

455. spacer 1.16|179850|41|NC_020384|CRT matches to KJ024807 (Bacillus phage vB_BtS_BMBtp3, complete genome) position: , mismatch: 4, identity: 0.902

aattgaaat--gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
--tggaagttcgaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
  * ***.*  ********************************

456. spacer 1.16|179850|41|NC_020384|CRT matches to NC_023074 (Bacillus thuringiensis serovar tenebrionis str. YBT-1765 plasmid pBMB165, complete sequence) position: , mismatch: 4, identity: 0.902

aattgaaat--gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
--tggaagttcgaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
  * ***.*  ********************************

457. spacer 1.16|179850|41|NC_020384|CRT matches to NC_025424 (Bacillus phage Waukesha92, complete genome) position: , mismatch: 4, identity: 0.902

aattgaaat--gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
--tggaagttcgaagatagtagaagaaatcaaaaaaagtgtat	Protospacer
  * ***.*  ********************************

458. spacer 1.21|180175|43|NC_020384|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 4, identity: 0.907

gattgaaattacctcgggtttatatttatctggaacgctcata	CRISPR spacer
ggatgaaattacctcgggtttatatttatctggaatgcccata	Protospacer
*. ********************************.**.****

459. spacer 1.8|179988|33|NC_020384|CRISPRCasFinder matches to NZ_CP004882 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMBLin15, complete sequence) position: , mismatch: 5, identity: 0.848

taggagtt----attaatggctttagatgttagacca	CRISPR spacer
----agttattaattaatggctctagatgttagacca	Protospacer
    ****    **********.**************

460. spacer 1.8|179988|33|NC_020384|CRISPRCasFinder matches to NZ_CP011355 (Bacillus thuringiensis strain YC-10 plasmid pYC10, complete sequence) position: , mismatch: 5, identity: 0.848

taggagtt----attaatggctttagatgttagacca	CRISPR spacer
----agttattaattaatggctctagatgttagacca	Protospacer
    ****    **********.**************

461. spacer 1.8|179988|33|NC_020384|CRISPRCasFinder matches to NC_006945 (Bacillus phage GIL16c, complete genome) position: , mismatch: 5, identity: 0.848

taggagtt----attaatggctttagatgttagacca	CRISPR spacer
----agttattaattaatggctctagatgttagacca	Protospacer
    ****    **********.**************

462. spacer 1.8|179988|33|NC_020384|CRISPRCasFinder matches to AY701338 (Bacillus thuringiensis phage GIL16c, complete genome) position: , mismatch: 5, identity: 0.848

taggagtt----attaatggctttagatgttagacca	CRISPR spacer
----agttattaattaatggctctagatgttagacca	Protospacer
    ****    **********.**************

463. spacer 1.11|180184|34|NC_020384|CRISPRCasFinder matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 5, identity: 0.853

tacctcgggtttatatttatctggaacgctcata	CRISPR spacer
tacctcgagtttatatttatctgcaacgctctat	Protospacer
*******.*************** *******

464. spacer 1.11|180184|34|NC_020384|CRISPRCasFinder matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 5, identity: 0.853

tacctcgggtttatatttatctggaacgctcata	CRISPR spacer
tacctcgagtttatatttatctgcaacgctctat	Protospacer
*******.*************** *******

465. spacer 1.20|180110|42|NC_020384|CRT matches to CP041751 (Bacillus paranthracis strain NCCP 14796 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.881

gattgaaat--tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
--ttcgtattctttgcaactagctcaattgtttttccgttttca	Protospacer
  ** . **  *********************************

466. spacer 1.20|180110|42|NC_020384|CRT matches to NZ_CP033793 (Bacillus sp. FDAARGOS_527 plasmid unnamed6, complete sequence) position: , mismatch: 5, identity: 0.881

gattgaaat--tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
--ttcgtattctttgcaactagctcaattgtttttccgttttca	Protospacer
  ** . **  *********************************

467. spacer 1.20|180110|42|NC_020384|CRT matches to NC_017206 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence) position: , mismatch: 5, identity: 0.881

gattgaaat-tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
-tttgtattctttgcaactagctcaattgttttcccgttttca	Protospacer
  *** * * ***********************.*********

468. spacer 1.20|180110|42|NC_020384|CRT matches to NC_018510 (Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence) position: , mismatch: 5, identity: 0.881

gattgaaat-tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
-tttgtattctttgcaactagctcaattgttttcccgttttca	Protospacer
  *** * * ***********************.*********

469. spacer 1.20|180110|42|NC_020384|CRT matches to NZ_CP013280 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence) position: , mismatch: 5, identity: 0.881

gattgaaat-tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
-tttgtattctttgcaactagctcaattgttttcccgttttca	Protospacer
  *** * * ***********************.*********

470. spacer 1.20|180110|42|NC_020384|CRT matches to NZ_CP039726 (Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence) position: , mismatch: 5, identity: 0.881

gattgaaat-tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
-tttgtattctttgcaactagctcaattgttttcccgttttca	Protospacer
  *** * * ***********************.*********

471. spacer 1.20|180110|42|NC_020384|CRT matches to NC_022882 (Bacillus thuringiensis YBT-1518 plasmid pBMB0233, complete sequence) position: , mismatch: 5, identity: 0.881

gattgaaat-tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
-tttgtattctttgcaactagctcaattgtttttccattttca	Protospacer
  *** * * **************************.******

472. spacer 1.20|180110|42|NC_020384|CRT matches to NZ_CP009350 (Bacillus thuringiensis HD1002 plasmid 4, complete sequence) position: , mismatch: 5, identity: 0.881

gattgaaat-tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
-tttgtattctttgcaactagctcaattgttttcccgttttca	Protospacer
  *** * * ***********************.*********

473. spacer 1.20|180110|42|NC_020384|CRT matches to NC_022877 (Bacillus thuringiensis YBT-1518 plasmid pBMB0232, complete sequence) position: , mismatch: 5, identity: 0.881

gattgaaat-tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
-tttgtattctttgcaactagctcaattgtttttccattttca	Protospacer
  *** * * **************************.******

474. spacer 1.20|180110|42|NC_020384|CRT matches to NC_020383 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence) position: , mismatch: 5, identity: 0.881

gattgaaat-tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
-tttgtattctttgcaactagctcaattgttttcccgttttca	Protospacer
  *** * * ***********************.*********

475. spacer 1.21|180175|43|NC_020384|CRT matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 5, identity: 0.884

gattgaaattacctcgggtttatatttatctggaacgctcata	CRISPR spacer
gattgaaattacctcgagtttatatttatctgcaacgctctat	Protospacer
****************.*************** *******

476. spacer 1.21|180175|43|NC_020384|CRT matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 5, identity: 0.884

gattgaaattacctcgggtttatatttatctggaacgctcata	CRISPR spacer
gattgaaattacctcgagtttatatttatctgcaacgctctat	Protospacer
****************.*************** *******

477. spacer 1.20|180110|42|NC_020384|CRT matches to CP024689 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-5-125K, complete sequence) position: , mismatch: 6, identity: 0.857

gattgaaattttgcaactagctcaattgtttttccgttttca	CRISPR spacer
tttgtattttttgcaactagctcaattgtttttccgttttca	Protospacer
  *  *  **********************************

478. spacer 1.20|180110|42|NC_020384|CRT matches to NC_018685 (Bacillus thuringiensis MC28 plasmid pMC95, complete sequence) position: , mismatch: 6, identity: 0.857

gattgaaattttgcaactagctcaattgtttttccgttttca	CRISPR spacer
tttgtattttttgcaactagctcaattgtttttccgttttca	Protospacer
  *  *  **********************************

479. spacer 1.20|180110|42|NC_020384|CRT matches to NZ_CP047087 (Bacillus paranthracis strain BC307 plasmid pCE2, complete sequence) position: , mismatch: 6, identity: 0.857

gattgaaat--tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
--ttcgtattctttgcaactagctcaattgttttcccgttttca	Protospacer
  ** . **  ***********************.*********

480. spacer 1.20|180110|42|NC_020384|CRT matches to CP016198 (Bacillus thuringiensis serovar coreanensis strain ST7 plasmid pST7-4, complete sequence) position: , mismatch: 6, identity: 0.857

gattgaaat--tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
--ttcgtattctttgcaactagctcaattgttttcccgttttca	Protospacer
  ** . **  ***********************.*********

481. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to MN692959 (Marine virus AFVG_117M52, complete genome) position: , mismatch: 7, identity: 0.781

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
agagatattataagaaatcaaaaaaaatattt	Protospacer
..***** ** ***************.*.* *

482. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to MN855765 (Myoviridae sp. isolate 14, complete genome) position: , mismatch: 7, identity: 0.781

gaagatagt--agaagaaatcaaaaaaagtgtat	CRISPR spacer
--aaatcatcaagatgaaatcaaaaacagtgtat	Protospacer
  *.** .*  *** *********** *******

483. spacer 1.20|180110|42|NC_020384|CRT matches to NZ_CP017573 (Bacillus thuringiensis strain SCG04-02 plasmid PSCG61, complete sequence) position: , mismatch: 7, identity: 0.833

gattgaaat--tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
--ttcgtattctttgcaactagctcaattattttcccgttttca	Protospacer
  ** . **  ******************.****.*********

484. spacer 1.20|180110|42|NC_020384|CRT matches to NZ_CP029456 (Bacillus cereus strain FORC087 plasmid pFORC087.2, complete sequence) position: , mismatch: 7, identity: 0.833

gattgaaat--tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
--ttcgtattctttgcaactagctcaattattttcccgttttca	Protospacer
  ** . **  ******************.****.*********

485. spacer 1.20|180110|42|NC_020384|CRT matches to NC_011656 (Bacillus cereus AH187 plasmid pAH187_45, complete sequence) position: , mismatch: 7, identity: 0.833

gattgaaat--tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
--ttcgtattctttgcaaccagctcaattgttttcccgttttca	Protospacer
  ** . **  ********.**************.*********

486. spacer 1.20|180110|42|NC_020384|CRT matches to NC_022782 (Bacillus toyonensis BCT-7112 plasmid pBCT77, complete sequence) position: , mismatch: 7, identity: 0.833

gattgaaat--tttgcaactagctcaattgtttttccgttttca	CRISPR spacer
--ttcgtattctttgcaactagctcaattgttttcccattttca	Protospacer
  ** . **  ***********************.**.******

487. spacer 1.21|180175|43|NC_020384|CRT matches to NZ_CP020748 (Bacillus mycoides strain Gnyt1 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.837

gattgaaat--tacctcgggtttatatttatctggaacgctcata	CRISPR spacer
--ctcacgttctacctcgggtttatatttatctgggacgctcata	Protospacer
  .* * .*  ************************.*********

488. spacer 1.21|180175|43|NC_020384|CRT matches to NZ_CP011157 (Bacillus cereus strain HN001 plasmid pRML02, complete sequence) position: , mismatch: 7, identity: 0.837

gattgaaat--tacctcgggtttatatttatctggaacgctcata	CRISPR spacer
--ctcacgttctacctcgggtttatatttatctgggacgctcata	Protospacer
  .* * .*  ************************.*********

489. spacer 2.7|187322|43|NC_020384|CRISPRCasFinder matches to NZ_CP014286 (Bacillus thuringiensis strain Bt185 plasmid pBT1850054, complete sequence) position: , mismatch: 7, identity: 0.837

ttggcggtagttcataagtaacaacaaatggatgtcgcacctc---	CRISPR spacer
ttggcggtagttcataagtaacaacaaatgtat---acatatcaat	Protospacer
****************************** **   .**. **

490. spacer 2.7|187322|43|NC_020384|CRISPRCasFinder matches to NZ_CP032610 (Bacillus thuringiensis strain QZL38 plasmid p.3, complete sequence) position: , mismatch: 7, identity: 0.837

ttggcggtagttcataagtaacaacaaatggatgtcgcacctc---	CRISPR spacer
ttggcggtagttcataagtaacaacaaatgtat---acatatcaat	Protospacer
****************************** **   .**. **

491. spacer 2.10|187522|41|NC_020384|CRISPRCasFinder matches to NZ_CP017573 (Bacillus thuringiensis strain SCG04-02 plasmid PSCG61, complete sequence) position: , mismatch: 7, identity: 0.829

ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	CRISPR spacer
ggaaatggaacgttcttacggatcaaaagaagtattagaaa	Protospacer
*********************************  .*

492. spacer 2.10|187522|41|NC_020384|CRISPRCasFinder matches to NZ_CP029456 (Bacillus cereus strain FORC087 plasmid pFORC087.2, complete sequence) position: , mismatch: 7, identity: 0.829

ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	CRISPR spacer
ggaaatggaacgttcttacggatcaaaagaagtattagaaa	Protospacer
*********************************  .*

493. spacer 2.10|187522|41|NC_020384|CRISPRCasFinder matches to NZ_CP013280 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence) position: , mismatch: 7, identity: 0.829

ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	CRISPR spacer
ggaaatggaacgttcttacggatcaaaagaagtattagaaa	Protospacer
*********************************  .*

494. spacer 2.10|187522|41|NC_020384|CRISPRCasFinder matches to NC_011656 (Bacillus cereus AH187 plasmid pAH187_45, complete sequence) position: , mismatch: 7, identity: 0.829

ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	CRISPR spacer
ggaaatggaacgttcttacggatcaaaagaagtattagaaa	Protospacer
*********************************  .*

495. spacer 2.10|187522|41|NC_020384|CRISPRCasFinder matches to NZ_CP039726 (Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence) position: , mismatch: 7, identity: 0.829

ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	CRISPR spacer
ggaaatggaacgttcttacggatcaaaagaagtattagaaa	Protospacer
*********************************  .*

496. spacer 2.10|187522|41|NC_020384|CRISPRCasFinder matches to NC_018685 (Bacillus thuringiensis MC28 plasmid pMC95, complete sequence) position: , mismatch: 7, identity: 0.829

ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	CRISPR spacer
ggaaatggaacgttcttacggatcaaaagaagtattagaaa	Protospacer
*********************************  .*

497. spacer 2.10|187522|41|NC_020384|CRISPRCasFinder matches to NZ_CP009350 (Bacillus thuringiensis HD1002 plasmid 4, complete sequence) position: , mismatch: 7, identity: 0.829

ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	CRISPR spacer
ggaaatggaacgttcttacggatcaaaagaagtattagaaa	Protospacer
*********************************  .*

498. spacer 2.10|187522|41|NC_020384|CRISPRCasFinder matches to NZ_CP033793 (Bacillus sp. FDAARGOS_527 plasmid unnamed6, complete sequence) position: , mismatch: 7, identity: 0.829

ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	CRISPR spacer
ggaaatggaacgttcttacggatcaaaagaagtattagaaa	Protospacer
*********************************  .*

499. spacer 2.10|187522|41|NC_020384|CRISPRCasFinder matches to NZ_CP047087 (Bacillus paranthracis strain BC307 plasmid pCE2, complete sequence) position: , mismatch: 7, identity: 0.829

ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	CRISPR spacer
ggaaatggaacgttcttacggatcaaaagaagtattagaaa	Protospacer
*********************************  .*

500. spacer 2.10|187522|41|NC_020384|CRISPRCasFinder matches to NC_018510 (Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence) position: , mismatch: 7, identity: 0.829

ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	CRISPR spacer
ggaaatggaacgttcttacggatcaaaagaagtattagaaa	Protospacer
*********************************  .*

501. spacer 2.10|187522|41|NC_020384|CRISPRCasFinder matches to CP041751 (Bacillus paranthracis strain NCCP 14796 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.829

ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	CRISPR spacer
ggaaatggaacgttcttacggatcaaaagaagtattagaaa	Protospacer
*********************************  .*

502. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to KF114879 (Leptospira phage LbrZ_5399, complete genome) position: , mismatch: 8, identity: 0.75

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
gtggattgtagaagaaatcaaaaaaaaacatt	Protospacer
* .*** *******************.    *

503. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to KF114880 (Leptospira phage LinZ_10, complete genome) position: , mismatch: 8, identity: 0.75

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
gtggattgtagaagaaatcaaaaaaaaacatt	Protospacer
* .*** *******************.    *

504. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to KX656785 (UNVERIFIED: Leptospira phage Lin_34, complete genome) position: , mismatch: 8, identity: 0.75

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
gtggattgtagaagaaatcaaaaaaaaacatt	Protospacer
* .*** *******************.    *

505. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to MN693414 (Marine virus AFVG_25M246, complete genome) position: , mismatch: 8, identity: 0.75

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
aaaaatagaagaagaaatcaaaaaagaattag	Protospacer
.**.**** ****************..  **

506. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to MN693468 (Marine virus AFVG_25M247, complete genome) position: , mismatch: 8, identity: 0.75

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
aaaaatagaagaagaaatcaaaaaagaattag	Protospacer
.**.**** ****************..  **

507. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to MN693065 (Marine virus AFVG_25M245, complete genome) position: , mismatch: 8, identity: 0.75

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
aaaaatagaagaagaaatcaaaaaagaattag	Protospacer
.**.**** ****************..  **

508. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to MN693042 (Marine virus AFVG_25M244, complete genome) position: , mismatch: 8, identity: 0.75

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
aaaaatagaagaagaaatcaaaaaagaattag	Protospacer
.**.**** ****************..  **

509. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 8, identity: 0.75

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
agagcaagtagaagatatcaaaaagagtgagt	Protospacer
..**  ********* ********.**** .*

510. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
agagcaagtagaagatatcaaaaagagtgagt	Protospacer
..**  ********* ********.**** .*

511. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 8, identity: 0.75

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
taagagattagaagaaatcaaaaacaatacag	Protospacer
 **** * **************** *.*..*

512. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 8, identity: 0.75

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
agagcaagtagaagatatcaaaaagagtgagt	Protospacer
..**  ********* ********.**** .*

513. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
agagcaagtagaagatatcaaaaagagtgagt	Protospacer
..**  ********* ********.**** .*

514. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 8, identity: 0.75

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
agagcaagtagaagatatcaaaaagagtgagt	Protospacer
..**  ********* ********.**** .*

515. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NZ_CP053834 (Arcobacter cloacae strain LMG 26153 plasmid pACLO, complete sequence) position: , mismatch: 8, identity: 0.75

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
tcagatagaagaagaaatcaataaagaaggat	Protospacer
  ****** ************ ***.. * **

516. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NZ_CP013276 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-1-360K, complete sequence) position: , mismatch: 8, identity: 0.75

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
taagagattagaagaaatcaaaaacaatacac	Protospacer
 **** * **************** *.*..*.

517. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 8, identity: 0.75

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
agagcaagtagaagatatcaaaaagagtgagt	Protospacer
..**  ********* ********.**** .*

518. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NZ_CP039722 (Bacillus thuringiensis strain BT-59 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
taagagattagaagaaatcaaaaacaatacac	Protospacer
 **** * **************** *.*..*.

519. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
agagcaagtagaagatatcaaaaagagtgagt	Protospacer
..**  ********* ********.**** .*

520. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
agagcaagtagaagatatcaaaaagagtgagt	Protospacer
..**  ********* ********.**** .*

521. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
agagcaagtagaagatatcaaaaagagtgagt	Protospacer
..**  ********* ********.**** .*

522. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
agagcaagtagaagatatcaaaaagagtgagt	Protospacer
..**  ********* ********.**** .*

523. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
agagcaagtagaagatatcaaaaagagtgagt	Protospacer
..**  ********* ********.**** .*

524. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
agagcaagtagaagatatcaaaaagagtgagt	Protospacer
..**  ********* ********.**** .*

525. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
agagcaagtagaagatatcaaaaagagtgagt	Protospacer
..**  ********* ********.**** .*

526. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NZ_CP009349 (Bacillus thuringiensis HD1002 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.75

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
taagagattagaagaaatcaaaaacaatacac	Protospacer
 **** * **************** *.*..*.

527. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
agagcaagtagaagatatcaaaaagagtgagt	Protospacer
..**  ********* ********.**** .*

528. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
agagcaagtagaagatatcaaaaagagtgagt	Protospacer
..**  ********* ********.**** .*

529. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
agagcaagtagaagatatcaaaaagagtgagt	Protospacer
..**  ********* ********.**** .*

530. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NZ_CP045023 (Bacillus thuringiensis strain JW-1 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
taagagattagaagaaatcaaaaacaatacac	Protospacer
 **** * **************** *.*..*.

531. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 8, identity: 0.75

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
agagcaagtagaagatatcaaaaagagtgagt	Protospacer
..**  ********* ********.**** .*

532. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
agagcaagtagaagatatcaaaaagagtgagt	Protospacer
..**  ********* ********.**** .*

533. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to AJ748296 (Sulfolobus islandicus rudivirus 1 variant XX, complete genome) position: , mismatch: 8, identity: 0.75

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
gagtcaaatagaagaaatcataaaaagtttaa	Protospacer
**.   *.************ ******* **

534. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to L35061 (Bacteriophage phi-41 orfs L1-12, complete cds's, orf 13, 5' end) position: , mismatch: 8, identity: 0.75

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
gaagataggagaagaaataaaaattaaagaaa	Protospacer
******** ********* ****  *. * *

535. spacer 1.13|179651|43|NC_020384|CRT matches to NZ_CP010096 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMBLin15, complete sequence) position: , mismatch: 8, identity: 0.814

gattgaaatacaagatacgagaatttaatgacgtcacccacat	CRISPR spacer
ccctcattcactagatacgagaatttaatgacgtcacccacat	Protospacer
  .* *  .** *******************************

536. spacer 1.18|179979|42|NC_020384|CRT matches to NZ_CP053974 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed5, complete sequence) position: , mismatch: 8, identity: 0.81

gattgaaattaggagttattaatggctttagatgttagacca	CRISPR spacer
cgcacattctaggagttattaatggctttagatgttagacca	Protospacer
 ..  *  .*********************************

537. spacer 1.18|179979|42|NC_020384|CRT matches to NZ_CP009346 (Bacillus thuringiensis HD1002 plasmid 5, complete sequence) position: , mismatch: 8, identity: 0.81

gattgaaattaggagttattaatggctttagatgttagacca	CRISPR spacer
cgcacattctaggagttattaatggctttagatgttagacca	Protospacer
 ..  *  .*********************************

538. spacer 1.18|179979|42|NC_020384|CRT matches to NZ_CP045027 (Bacillus thuringiensis strain JW-1 plasmid p5, complete sequence) position: , mismatch: 8, identity: 0.81

gattgaaattaggagttattaatggctttagatgttagacca	CRISPR spacer
cgcacattctaggagttattaatggctttagatgttagacca	Protospacer
 ..  *  .*********************************

539. spacer 1.18|179979|42|NC_020384|CRT matches to CP013282 (Bacillus phage pGIL02, complete sequence) position: , mismatch: 8, identity: 0.81

gattgaaattaggagttattaatggctttagatgttagacca	CRISPR spacer
cgcacattctaggagttattaatggctttagatgttagacca	Protospacer
 ..  *  .*********************************

540. spacer 1.18|179979|42|NC_020384|CRT matches to NC_005258 (Bacillus phage Bam35c, complete genome) position: , mismatch: 8, identity: 0.81

gattgaaattaggagttattaatggctttagatgttagacca	CRISPR spacer
cgcacattctaggagttattaatggctttagatgttagacca	Protospacer
 ..  *  .*********************************

541. spacer 1.18|179979|42|NC_020384|CRT matches to AY257527 (Bacillus thuringiensis bacteriophage Bam35c, complete genome) position: , mismatch: 8, identity: 0.81

gattgaaattaggagttattaatggctttagatgttagacca	CRISPR spacer
cgcacattctaggagttattaatggctttagatgttagacca	Protospacer
 ..  *  .*********************************

542. spacer 1.18|179979|42|NC_020384|CRT matches to AJ536073 (Bacillus phage pGIL01, complete genome) position: , mismatch: 8, identity: 0.81

gattgaaattaggagttattaatggctttagatgttagacca	CRISPR spacer
cgcacattctaggagttattaatggctttagatgttagacca	Protospacer
 ..  *  .*********************************

543. spacer 2.7|187322|43|NC_020384|CRISPRCasFinder matches to NC_017204 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT51, complete sequence) position: , mismatch: 8, identity: 0.814

ttggcggtagttcataagtaacaacaaatggatgtcgcacctc---	CRISPR spacer
ttggcggtaattcataagtaacaacaaatgtat---acatatcaat	Protospacer
*********.******************** **   .**. **

544. spacer 2.7|187322|43|NC_020384|CRISPRCasFinder matches to CP020757 (Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-18, complete sequence) position: , mismatch: 8, identity: 0.814

ttggcggtagttcataagtaacaacaaatggatgtcgcacctc---	CRISPR spacer
ttggcggtaattcataagtaacaacaaatgtat---acatatcaat	Protospacer
*********.******************** **   .**. **

545. spacer 2.7|187322|43|NC_020384|CRISPRCasFinder matches to CP020757 (Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-18, complete sequence) position: , mismatch: 8, identity: 0.814

ttggcggtagttcataagtaacaacaaatggatgtcgcacctc---	CRISPR spacer
ttggcggtaattcataagtaacaacaaatgtat---acatatcaat	Protospacer
*********.******************** **   .**. **

546. spacer 2.7|187322|43|NC_020384|CRISPRCasFinder matches to NZ_CP021064 (Bacillus thuringiensis strain ATCC 10792 plasmid poh3, complete sequence) position: , mismatch: 8, identity: 0.814

ttggcggtagttcataagtaacaacaaatggatgtcgcacctc---	CRISPR spacer
ttggcggtaattcataagtaacaacaaatgtat---acatatcaat	Protospacer
*********.******************** **   .**. **

547. spacer 2.7|187322|43|NC_020384|CRISPRCasFinder matches to NZ_CP021064 (Bacillus thuringiensis strain ATCC 10792 plasmid poh3, complete sequence) position: , mismatch: 8, identity: 0.814

ttggcggtagttcataagtaacaacaaatggatgtcgcacctc---	CRISPR spacer
ttggcggtaattcataagtaacaacaaatgtat---acatatcaat	Protospacer
*********.******************** **   .**. **

548. spacer 2.10|187522|41|NC_020384|CRISPRCasFinder matches to CP024689 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-5-125K, complete sequence) position: , mismatch: 8, identity: 0.805

ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	CRISPR spacer
ggaaatggaacgttcttatggatcaaaagaagtattagaaa	Protospacer
******************.**************  .*

549. spacer 2.10|187522|41|NC_020384|CRISPRCasFinder matches to NC_017206 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence) position: , mismatch: 8, identity: 0.805

ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	CRISPR spacer
ggaaatggaacgtttttacggatcaaaagaagtattagaaa	Protospacer
**************.******************  .*

550. spacer 2.10|187522|41|NC_020384|CRISPRCasFinder matches to NC_020383 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence) position: , mismatch: 8, identity: 0.805

ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	CRISPR spacer
ggaaatggaacgtttttacggatcaaaagaagtattagaaa	Protospacer
**************.******************  .*

551. spacer 2.14|187587|30|NC_020384|PILER-CR matches to MN694586 (Marine virus AFVG_250M370, complete genome) position: , mismatch: 8, identity: 0.733

gtagctggtattaatgctttgtgaaaaaca	CRISPR spacer
gaaaatggtattaatgctttgagaaattat	Protospacer
* *. **************** ****

552. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to AP013489 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G19, isolate: uvMED-CGR-C30A-MedDCM-OCT-S45-C81) position: , mismatch: 9, identity: 0.719

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
tgagatggtcgaagaaatcaaaaaaagaaatg	Protospacer
 .****.** ***************** .

553. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to MN698245 (Pelagibacter phage HTVC111P, complete genome) position: , mismatch: 9, identity: 0.719

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
tgagatggtcgaagaaatcaaaaaaagaaatg	Protospacer
 .****.** ***************** .

554. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to AP013487 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G19, isolate: uvMED-CGR-C30A-MedDCM-OCT-S33-C83) position: , mismatch: 9, identity: 0.719

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
tgagatggtcgaagaaatcaaaaaaagaaatg	Protospacer
 .****.** ***************** .

555. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NC_021794 (Cellulophaga phage phi18:3, complete genome) position: , mismatch: 9, identity: 0.719

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
aaatatagtagaagaaatcaataaacaataag	Protospacer
.** ***************** *** .   *

556. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
agtgcaagtagaagatatcaaaaagagtgagt	Protospacer
.. *  ********* ********.**** .*

557. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to MN693376 (Marine virus AFVG_25M306, complete genome) position: , mismatch: 9, identity: 0.719

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
agagatagtagaagaaaccaacaaatagattt	Protospacer
..***************.*** *** . .* *

558. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to KY065482 (Streptococcus phage IPP42, complete genome) position: , mismatch: 9, identity: 0.719

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
atggatagttgaaaaaatcaaaaaaatattag	Protospacer
. .****** ***.************   **

559. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to KY065483 (Streptococcus phage IPP43, complete genome) position: , mismatch: 9, identity: 0.719

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
atggatagttgaaaaaatcaaaaaaatattag	Protospacer
. .****** ***.************   **

560. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to MH853357 (Streptococcus phage LF3, partial genome) position: , mismatch: 9, identity: 0.719

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
atggatagttgaaaaaatcaaaaaaatattag	Protospacer
. .****** ***.************   **

561. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to KY363359 (Streptococcus phage Str03, complete genome) position: , mismatch: 9, identity: 0.719

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
atggatagttgaaaaaatcaaaaaaatattag	Protospacer
. .****** ***.************   **

562. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to MK448731 (Streptococcus phage Javan33, complete genome) position: , mismatch: 9, identity: 0.719

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
atggatagttgaaaaaatcaaaaaaatattag	Protospacer
. .****** ***.************   **

563. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to KY065489 (Streptococcus phage IPP51, complete genome) position: , mismatch: 9, identity: 0.719

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
atggatagttgaaaaaatcaaaaaaatattag	Protospacer
. .****** ***.************   **

564. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to KY065484 (Streptococcus phage IPP44, complete genome) position: , mismatch: 9, identity: 0.719

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
atggatagttgaaaaaatcaaaaaaatattag	Protospacer
. .****** ***.************   **

565. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to MK448992 (Streptococcus phage Javan6, complete genome) position: , mismatch: 9, identity: 0.719

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
atggatagttgaaaaaatcaaaaaaatattag	Protospacer
. .****** ***.************   **

566. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to MT774388 (CrAssphage cr112_1, complete genome) position: , mismatch: 9, identity: 0.719

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
gaaggtagcagaagaaatcaaaaggttaatac	Protospacer
****.***.**************..   .**.

567. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NC_030946 (Streptococcus phage phiARI0923, complete genome) position: , mismatch: 9, identity: 0.719

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
atggatagttgaaaaaatcaaaaaaatattag	Protospacer
. .****** ***.************   **

568. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to MK448734 (Streptococcus phage Javan347, complete genome) position: , mismatch: 9, identity: 0.719

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
atggatagttgaaaaaatcaaaaaaatattag	Protospacer
. .****** ***.************   **

569. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to MN693062 (Marine virus AFVG_25M389, complete genome) position: , mismatch: 9, identity: 0.719

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
agagatagtagaagaaaccaacaaattgattt	Protospacer
..***************.*** ***   .* *

570. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to KY065481 (Streptococcus phage IPP41, complete genome) position: , mismatch: 9, identity: 0.719

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
atggatagttgaaaaaatcaaaaaaatattag	Protospacer
. .****** ***.************   **

571. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to MK448888 (Streptococcus phage Javan26, complete genome) position: , mismatch: 9, identity: 0.719

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
atggatagttgaaaaaatcaaaaaaatattag	Protospacer
. .****** ***.************   **

572. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to MK448863 (Streptococcus phage Javan18, complete genome) position: , mismatch: 9, identity: 0.719

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
atggatagttgaaaaaatcaaaaaaatattag	Protospacer
. .****** ***.************   **

573. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to NC_027396 (Streptococcus phage SpSL1, complete genome) position: , mismatch: 9, identity: 0.719

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
atggatagttgaaaaaatcaaaaaaatattag	Protospacer
. .****** ***.************   **

574. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to KY065449 (Streptococcus phage IPP5, complete genome) position: , mismatch: 9, identity: 0.719

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
atggatagttgaaaaaatcaaaaaaatattag	Protospacer
. .****** ***.************   **

575. spacer 1.18|179979|42|NC_020384|CRT matches to NZ_CP010096 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMBLin15, complete sequence) position: , mismatch: 9, identity: 0.786

gattgaaattaggagttattaatggctttagatgttagacca	CRISPR spacer
cgcacactcaaggagttattaatggctttagatgttagacca	Protospacer
 ..  *  . ********************************

576. spacer 2.8|187389|42|NC_020384|CRISPRCasFinder matches to MH598512 (Bacillus phage Wes44, complete genome) position: , mismatch: 9, identity: 0.786

gatattcaaagagcctgaacaagtggaatcgagtcgcacctt	CRISPR spacer
ggtattcaatgagcctgaacaagtggaatcgaagggcatgag	Protospacer
*.******* **********************.  ***.

577. spacer 2.10|187522|41|NC_020384|CRISPRCasFinder matches to NC_022877 (Bacillus thuringiensis YBT-1518 plasmid pBMB0232, complete sequence) position: , mismatch: 9, identity: 0.78

ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	CRISPR spacer
ggaaatggaacgatcttatggatcaaaagaagtattagaaa	Protospacer
************ *****.**************  .*

578. spacer 2.10|187522|41|NC_020384|CRISPRCasFinder matches to NC_022882 (Bacillus thuringiensis YBT-1518 plasmid pBMB0233, complete sequence) position: , mismatch: 9, identity: 0.78

ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	CRISPR spacer
ggaaatggaacgatcttatggatcaaaagaagtattagaaa	Protospacer
************ *****.**************  .*

579. spacer 2.10|187522|41|NC_020384|CRISPRCasFinder matches to NC_022782 (Bacillus toyonensis BCT-7112 plasmid pBCT77, complete sequence) position: , mismatch: 9, identity: 0.78

ggaaatggaacgttcttacggatcaaaagaagtcgcacctt	CRISPR spacer
ggaaatggaacgatcttatggatcaaaagaagtattagaaa	Protospacer
************ *****.**************  .*

580. spacer 1.6|179859|32|NC_020384|CRISPRCasFinder matches to AP014291 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S25-C40, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 10, identity: 0.688

gaagatagtagaagaaatcaaaaaaagtgtat	CRISPR spacer
acaccatatagaagaaatcaaaacaagagtag	Protospacer
. *    .*************** *** ***

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

384 : 56915

Bacillus_phage(50.0%)

transposase,bacteriocin,integrase,holin

attL 47130:47148|attR 61754:61772

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000275580.1\|384_1680_+\|transposase	IS21-like element IS232 family transposase	A0A059NT83	Lactococcus_phage	1.0e-42	31.0
WP_000798699.1\|1669_2422_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	7.0e-57	47.3
WP_033679389.1\|4893_5145_-	hypothetical protein	NA	NA	NA	NA
WP_000892197.1\|5505_5928_-\|holin	phage holin family protein	A0A0S2MVC4	Bacillus_phage	1.3e-52	77.3
WP_000495521.1\|8421_8826_-	DUF3221 domain-containing protein	NA	NA	NA	NA
WP_001243454.1\|10021_11071_+	Fic family protein	NA	NA	NA	NA
WP_001252813.1\|11236_11584_-	hypothetical protein	A0A0S2MVJ2	Bacillus_phage	3.2e-20	49.5
WP_015406602.1\|12989_14108_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	3.7e-171	80.6
WP_000762719.1\|14506_14905_+\|transposase	IS200/IS605 family transposase	A0A286QN76	Streptococcus_phage	7.0e-48	65.9
WP_003319651.1\|15631_15994_+\|transposase	IS3 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	6.0e-14	45.7
WP_001255046.1\|16186_16534_-	DUF4064 domain-containing protein	A0A0S2MVJ2	Bacillus_phage	2.5e-25	54.1
WP_000954716.1\|16823_17666_-	arylamine N-acetyltransferase	NA	NA	NA	NA
WP_015406604.1\|18420_18567_+	hypothetical protein	NA	NA	NA	NA
WP_000116413.1\|18657_20079_-\|transposase	IS4-like element ISBth4 family transposase	NA	NA	NA	NA
WP_000240401.1\|20191_20410_-	hypothetical protein	NA	NA	NA	NA
WP_014481859.1\|21233_21770_+	ADP-ribosyltransferase	NA	NA	NA	NA
WP_014481860.1\|21729_22041_+	mono-ADP-ribosyltransferase C3 (Exoenzyme C3)	NA	NA	NA	NA
WP_000116994.1\|22416_23847_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_000520933.1\|24310_25183_-	DMT family transporter	NA	NA	NA	NA
WP_015406607.1\|27332_28349_-	exosporium leader peptide-containing protein	NA	NA	NA	NA
WP_001032039.1\|28915_29215_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000845491.1\|29767_29977_-	hypothetical protein	NA	NA	NA	NA
WP_000844156.1\|30113_30362_-	hypothetical protein	NA	NA	NA	NA
WP_001103226.1\|30706_31801_+	tetratricopeptide repeat protein	A0A2H4J8G3	uncultured_Caudovirales_phage	1.5e-92	48.8
WP_000737574.1\|31797_31935_+	hypothetical protein	NA	NA	NA	NA
WP_014481861.1\|32058_32223_-	hypothetical protein	NA	NA	NA	NA
WP_000456645.1\|32242_33136_-	SEC-C motif-containing protein	NA	NA	NA	NA
WP_000065268.1\|33315_33540_+	hypothetical protein	NA	NA	NA	NA
WP_000798699.1\|34243_34996_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	7.0e-57	47.3
WP_000275580.1\|34985_36281_-\|transposase	IS21-like element IS232 family transposase	A0A059NT83	Lactococcus_phage	1.0e-42	31.0
WP_000790837.1\|37361_37754_+	DUF4878 domain-containing protein	NA	NA	NA	NA
WP_000128275.1\|37827_38046_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_000532004.1\|38068_39373_-	WXG100 family type VII secretion target	NA	NA	NA	NA
WP_000346798.1\|39838_40003_-	hypothetical protein	NA	NA	NA	NA
WP_000121085.1\|40581_41094_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_000149389.1\|41115_41466_-	zinc-finger domain-containing protein	NA	NA	NA	NA
WP_001021539.1\|41697_42741_+\|integrase	tyrosine-type recombinase/integrase	A0A0E3T6D9	Bacillus_phage	1.2e-09	23.1
WP_000019020.1\|42954_43281_+	helix-turn-helix transcriptional regulator	A0A0A7AQV8	Bacillus_phage	2.4e-22	51.0
WP_000734601.1\|43613_43766_-	hypothetical protein	NA	NA	NA	NA
WP_001001083.1\|43762_44986_-	hypothetical protein	A0A1B1P895	Bacillus_phage	6.1e-151	66.1
WP_000475295.1\|45192_46836_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
47130:47148	attL	NA	NA	NA	NA
WP_000843046.1\|47537_47816_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	2.3e-13	59.0
WP_014481865.1\|47882_48023_-	hypothetical protein	NA	NA	NA	NA
WP_031303430.1\|48297_48492_+	hypothetical protein	NA	NA	NA	NA
WP_001043935.1\|48738_49011_+	HU family DNA-binding protein	A7KV42	Bacillus_phage	3.3e-25	68.9
WP_000914524.1\|49500_50016_-	hypothetical protein	NA	NA	NA	NA
WP_001053969.1\|50120_51557_+\|transposase	IS4-like element IS231C family transposase	NA	NA	NA	NA
WP_000272577.1\|52365_53631_+	Y-family DNA polymerase	O64031	Bacillus_phage	4.2e-102	46.7
WP_000477499.1\|53811_54909_+\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	6.5e-11	30.3
WP_001028065.1\|54905_56915_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
61754:61772	attR	NA	NA	NA	NA

DBSCAN-SWA_2

164104 : 236038

Bacillus_phage(22.22%)

transposase,integrase

attL 224030:224047|attR 244849:244866

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000041871.1\|164104_165052_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_000217299.1\|165192_165336_-	hypothetical protein	NA	NA	NA	NA
WP_000520262.1\|166278_167988_-	hypothetical protein	NA	NA	NA	NA
WP_000372779.1\|168674_170144_+	hypothetical protein	NA	NA	NA	NA
WP_000372481.1\|170179_171904_+	hypothetical protein	NA	NA	NA	NA
WP_000459233.1\|172285_173095_-	hypothetical protein	NA	NA	NA	NA
WP_000724860.1\|174892_175285_+	hypothetical protein	NA	NA	NA	NA
WP_000610947.1\|175377_176160_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_000373088.1\|176174_177092_+	hypothetical protein	NA	NA	NA	NA
WP_000335059.1\|177501_179304_+	hypothetical protein	NA	NA	NA	NA
WP_014481878.1\|180397_182767_+	CRISPR-associated helicase/endonuclease Cas3	NA	NA	NA	NA
WP_003319726.1\|182972_183692_+	type I-C CRISPR-associated protein Cas5	NA	NA	NA	NA
WP_000118651.1\|183692_185612_+	type I-C CRISPR-associated protein Cas8c/Csd1	NA	NA	NA	NA
WP_000853368.1\|185614_186475_+	type I-C CRISPR-associated protein Cas7/Csd2	NA	NA	NA	NA
WP_130055909.1\|186765_186930_+	type I CRISPR-associated protein Cas7	NA	NA	NA	NA
WP_071686409.1\|186981_187215_+	type I CRISPR-associated protein Cas7	NA	NA	NA	NA
WP_000710696.1\|189674_190100_+	hypothetical protein	NA	NA	NA	NA
WP_000710813.1\|190121_190259_+	hypothetical protein	NA	NA	NA	NA
WP_001219637.1\|190363_191455_+	methyltransferase	NA	NA	NA	NA
WP_000114815.1\|191470_191698_+	hypothetical protein	NA	NA	NA	NA
WP_000654328.1\|193424_195290_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.4e-37	30.9
WP_103653709.1\|195567_197970_+	DEAD/DEAH box helicase	NA	NA	NA	NA
WP_000494364.1\|197986_198700_+	hypothetical protein	NA	NA	NA	NA
WP_001024816.1\|199036_199666_+	hypothetical protein	NA	NA	NA	NA
WP_000817905.1\|199665_200301_+	hypothetical protein	NA	NA	NA	NA
WP_078405438.1\|200351_200930_-	hypothetical protein	NA	NA	NA	NA
WP_000916413.1\|200949_201534_-	hypothetical protein	NA	NA	NA	NA
WP_015406623.1\|201659_202043_+	hypothetical protein	NA	NA	NA	NA
WP_000866011.1\|202059_202698_+	NERD domain-containing protein	A0A2R2ZH57	Clostridioides_phage	3.3e-23	35.6
WP_000312314.1\|203283_203484_-	hypothetical protein	NA	NA	NA	NA
WP_003319769.1\|203829_204003_-	hypothetical protein	NA	NA	NA	NA
WP_000520732.1\|204455_207119_+	type IA DNA topoisomerase	A0A1V0SIB2	Klosneuvirus	4.5e-13	20.9
WP_000708139.1\|207547_208192_+	thermonuclease family protein	A0A2P1JU10	Anoxybacillus_phage	3.7e-06	34.0
WP_001014119.1\|208224_208425_+	hypothetical protein	NA	NA	NA	NA
WP_000081052.1\|208500_208788_+	hypothetical protein	NA	NA	NA	NA
WP_000887510.1\|208811_209270_+	hypothetical protein	NA	NA	NA	NA
WP_000420420.1\|209260_209698_+	disulfide bond formation protein B	NA	NA	NA	NA
WP_000207869.1\|209771_210065_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_001017354.1\|210254_211346_+	tetratricopeptide repeat protein	A0A2H4J8G3	uncultured_Caudovirales_phage	9.2e-90	45.6
WP_024927926.1\|211653_211971_+	hypothetical protein	NA	NA	NA	NA
WP_000682816.1\|211967_212345_+	hypothetical protein	NA	NA	NA	NA
WP_000763085.1\|212428_212944_+	hypothetical protein	NA	NA	NA	NA
WP_033679394.1\|214461_214764_-	hypothetical protein	NA	NA	NA	NA
WP_001206763.1\|215481_215895_+	hypothetical protein	NA	NA	NA	NA
WP_000954720.1\|216291_217107_+	arylamine N-acetyltransferase	NA	NA	NA	NA
WP_071686411.1\|217287_217416_+	RNA chaperone Hfq	NA	NA	NA	NA
WP_087942375.1\|217699_219261_-\|transposase	IS3 family transposase	A0A0C5AEA5	Paenibacillus_phage	4.9e-68	57.6
WP_000762722.1\|219673_220078_+\|transposase	IS200/IS605 family transposase	A0A286QN76	Streptococcus_phage	6.5e-41	67.6
WP_000929144.1\|221326_221623_+	hypothetical protein	NA	NA	NA	NA
WP_015406625.1\|222739_223858_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	3.0e-173	81.5
224030:224047	attL	NA	NA	NA	NA
WP_000701098.1\|225214_226288_+	hypothetical protein	NA	NA	NA	NA
WP_000369347.1\|226399_227311_+	DMT family transporter	NA	NA	NA	NA
WP_000981146.1\|227991_229110_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	5.4e-170	80.4
WP_000790998.1\|229867_231187_+	HBL/NHE enterotoxin family protein	NA	NA	NA	NA
WP_000975321.1\|231249_232479_+	alpha-helical pore-forming toxin family protein	NA	NA	NA	NA
WP_001063469.1\|232510_233644_+	alpha-helical pore-forming toxin family protein	NA	NA	NA	NA
WP_003319867.1\|235771_236038_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
244849:244866	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

7. NC_020383

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_020383_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_020383_1

37002-37168

Orphan

Consensus_repeat	Method
ACCAAATTTGTTATCTTTAAAACCATTTTTGTTATAGAT	CRISPRCasFinder

2 spacers

The CRISPR arrays of NC_020383_1

>merge|NC_020383|1|37002-37168|CRISPRCasFinder
ACCAAATTTGTTATCTTTAAAACCATTTTTGTTATAGATGAAATAAAATTTGTTATCTTTAGAACCGTTTTTGTTATAGATGAAACCAAATTTGTTATCTTTAAAACCGTTTTTGTTATAGATAGGCAACCAAATTTGTTATCTTTAAAACCGTTTTTGTTATAGAT

>NC_020383|1|1|37002-37168|CRISPRCasFinder
ACCAAATTTGTTATCTTTAAAACCATTTTTGTTATAGAT	GAAATAAAATTTGTTATCTTTAGA
ACCGTTTTTGTTATAGATGAAACCAAATTTGTTATCTTT	AAAACCGTTTTTGTTATAGATAGGCA
ACCAAATTTGTTATCTTTAAAACCGTTTTTGTTATAGAT

Protein	Signature genes	Signature genes Name	Protein_function
NC_020383.1\|WP_000448698.1\|26078_26411_-\|hypothetical-protein	unknown	unknown	unknown
NC_020383.1\|WP_003275923.1\|29663_30251_-\|hypothetical-protein	unknown	unknown	unknown
NC_020383.1\|WP_000473548.1\|34997_35315_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|180618
NC_020383.1\|WP_024927989.1\|35585_36797_-\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376444
NC_020383.1\|WP_004426833.1\|42408_42621_-\|hypothetical-protein	unknown	unknown	unknown
NC_020383.1\|WP_015406585.1\|40620_41598_-\|DUF4179-domain-containing-protein	unknown	unknown	gnl\|CDD\|379219
NC_020383.1\|WP_000575866.1\|42652_42973_-\|hypothetical-protein	unknown	unknown	unknown
NC_020383.1\|WP_000983736.1\|37582_38083_-\|hypothetical-protein	unknown	unknown	unknown
NC_020383.1\|WP_000053744.1\|25195_25789_-\|cell-division-protein-FtsN	unknown	unknown	gnl\|CDD\|372085
NC_020383.1\|WP_000715299.1\|30449_30785_-\|hypothetical-protein	unknown	unknown	unknown
NC_020383.1\|WP_000499443.1\|33300_34404_+\|ThiF-family-adenylyltransferase	unknown	unknown	gnl\|CDD\|366360
NC_020383.1\|WP_000451648.1\|40037_40196_-\|hypothetical-protein	unknown	unknown	unknown
NC_020383.1\|WP_000658136.1\|39716_39890_+\|hypothetical-protein	unknown	unknown	unknown
NC_020383.1\|WP_000790476.1\|38962_39472_-\|DUF4367-domain-containing-protein	unknown	unknown	gnl\|CDD\|379540
NC_020383.1\|WP_000854274.1\|38509_38920_+\|hypothetical-protein	unknown	unknown	unknown
NC_020383.1\|WP_003275920.1\|27121_27799_+\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NC_020383.1\|WP_000955500.1\|41601_42132_-\|RNA-polymerase-sigma-factor-SigX	unknown	unknown	gnl\|CDD\|236602
NC_020383.1\|WP_001023533.1\|32358_32520_+\|hypothetical-protein	unknown	unknown	unknown
NC_020383.1\|WP_024927862.1\|43423_43744_-\|hypothetical-protein	unknown	unknown	unknown
NC_020383.1\|WP_000694313.1\|26523_26823_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_020383.1\|WP_000955500.1\|41601_42132_-\|RNA-polymerase-sigma-factor-SigX	gnl\|CDD\|236602	PRK09639, PRK09639, RNA polymerase sigma factor SigX; Provisional.	6.28761e-84
NC_020383.1\|WP_000499443.1\|33300_34404_+\|ThiF-family-adenylyltransferase	gnl\|CDD\|366360	pfam00899, ThiF, ThiF family. This domain is found in ubiquitin activating E1 family and members of the bacterial ThiF/MoeB/HesA family. It is repeated in Ubiquitin-activating enzyme E1.	4.69669e-42
NC_020383.1\|WP_000473548.1\|34997_35315_+\|hypothetical-protein	gnl\|CDD\|180618	PRK06552, PRK06552, keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional.	0.00650882
NC_020383.1\|WP_024927989.1\|35585_36797_-\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	8.00783e-59
NC_020383.1\|WP_003275920.1\|27121_27799_+\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	4.3005e-32
NC_020383.1\|WP_015406585.1\|40620_41598_-\|DUF4179-domain-containing-protein	gnl\|CDD\|379219	pfam13490, zf-HC2, Putative zinc-finger. This is a putative zinc-finger found in some anti-sigma factor proteins.	1.94821e-07
NC_020383.1\|WP_000053744.1\|25195_25789_-\|cell-division-protein-FtsN	gnl\|CDD\|372085	pfam12389, Peptidase_M73, Camelysin metallo-endopeptidase.	1.15311e-89
NC_020383.1\|WP_000790476.1\|38962_39472_-\|DUF4367-domain-containing-protein	gnl\|CDD\|379540	pfam14285, DUF4367, Domain of unknown function (DUF4367). This family of proteins is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 229 and 435 amino acids in length.	0.00220642

>NC_020383.1|WP_024927989.1|35585_36797_-|replication-initiation-protein
MSINQDLQIKENNIVSKSNTLIEANSRLNLVEQKMLLCLASNIEPNDRDFKTYTFPIKQFHDLLGLNGSTKYTELSKITKELLSKVIEIRAGEELIQVSWLSSAIYNRNKGTIDMRFDPLLKPFLLELSSKFTSYRLANVVKLKSTYAIRIYELLKQYEDLRERTISLENLRYYLDAMDVYPNYANFKQRVLKPSQKELNQKTDISFEFEEIKLGRKVQKIRFIIRSQKKKDSDLVHFEKKLDKFQQPNTFEQKIKRFEERCKEKVFPKVFEKWAVHKEIVLEIIEDIRFRSDIESPIGYVEFILNSRLKELADKKILNESNQSEDKSNNNLIETNTIIDSVITKYSTSTGAVATFLVKDTAIEELVRVVTLEEAEVIWKEREEFIMDKIYRFIKRNRSKKKY
>NC_020383.1|WP_000473548.1|34997_35315_+|hypothetical-protein
MFKKIVVSALTLGGLVIGGISAHADEHDRYFGGCKNVTQNVETNEYVKSCVKIFPNSPLGPNVIKIPKSIPYDDGTYQGILYLVSQNNTMYSIVANYEGTLKKFK
>NC_020383.1|WP_000499443.1|33300_34404_+|ThiF-family-adenylyltransferase
MFYKIKDIHPVTYISDTEIIIGKDRNFMSVLKDSDGFLKELLNLLDGNKSVREIFKILHSKFPSLTIQDVWDTIKELNNYGHVEQCLPNPNIDNNRHLTNLHFFSNFSSMDNSAGNILKELQELKIGIIGLGGLGSNLLLQLAGLGVNTIYVVDPDKIEYKNLNRQFLYKLSDIGEYKVKSAINNIKAFNDEISITGFTKSINSVEDLLEIFPEDIDILVCAADSPPIYIQLWSNLFSQIRNIPLITGGLGCVTGQILTSIPNQTPCLECFYHDLLGNNSLKKEKLLELESKTITTAIGPYISLIANLICTEIINYSLKHPLASSGKKLLINYLTLEITHEKEWPPNINCICKTKQFDSNKILLERF
>NC_020383.1|WP_001023533.1|32358_32520_+|hypothetical-protein
MNILLALFFIILFIVALLNLLKEFKKKKANTALIVFEIVVMIGALWWLIKTFK
>NC_020383.1|WP_000715299.1|30449_30785_-|hypothetical-protein
MKKGIILTTTMALGLLSATAVSANSDVSYTPKNMESATVEKSGDIEERSWAQVGRFAGEAVACWGVGKALDWAVDNVKEGAARNKGAGVDTSYKFGMSKLDRENFQEAFGR
>NC_020383.1|WP_003275923.1|29663_30251_-|hypothetical-protein
MYFSQINNYMNPLFKQNWRLFAPNPISSNQHLWTRGEIINEQGEKSFTEWVNVSEPLITAVHKNRFTPMRLISATNSSVIGQVVNKYNRDPEEYKKDINISKSDLNKLPSDLLILHRIACDALKKSYPNAKLGNVENRIVITSFKEFTGINDEESNKEGKEGKEGKEGKEGKEGKEGNVLYLDIPTLPYTKVVSF
>NC_020383.1|WP_003275920.1|27121_27799_+|recombinase-family-protein
MVTNVRRIQNVANIYGYIRVSTKDQNEQRQLHKMMERGVEARRIFVDKASGRHFDRPQYQLLRKILSTGDIVYIDALDRMGRNYDEVISEWKYITRELQADIVVLENETLFDSRKFREMGDMGRLMEDQFLSLLSYVADQERKKIRQRQAEGIAVAKSQGKHLGRPQLNLSTLSTKQLFIIEETFPKWKNREITGVQFMDLLELKKNTFYKILKEYEENKVATNS
>NC_020383.1|WP_000694313.1|26523_26823_-|hypothetical-protein
MKIKKRQLVATIYPGQLFSTATLPEGTSFLKWELAGSGDLDDILFDVMEDKFWDIDDLIFSDVLHENRTEVVQNKELYIDNVRNATSLVGIHIYALIYE
>NC_020383.1|WP_000448698.1|26078_26411_-|hypothetical-protein
METKSTVEIARVRSGKEPQPGQKNRSSGNFSTENLPAGTKYLKWEVIGGGDPDFISFNVMEDKSAATDPTHFSGVLSGNRTSVISKRSLYIANPKNATSEFTVIVSAMVQ
>NC_020383.1|WP_000053744.1|25195_25789_-|cell-division-protein-FtsN
MSLKKKLGMGVVSAALGLSLIGGGTYAYFSDQVVTNNTLAAGTLDLAMQPTTSLNLDNLKPGDKILKKFNLKNSGTLDIKDVLMKVDYTVNDLKRDNQEDDFGKHIKVQFLWDWDPAKSPVYETTLAELKSQNPEVTSHKVFLAKWAETGGLKAGKMDWFWIKFIFEDNNMDQNMFQGDSIAMKMEFQANQTEGQER
>NC_020383.1|WP_000983736.1|37582_38083_-|hypothetical-protein
MMQSIKKIVLTVVLIGMVVGMVILYLYINALQETVQKVTQDPIYGSVVSQDFAMLSEKDGSYVYTIMNDNEKRSLDQANTENKFKSYPFQTGKIATTQAMTIKKNNVLYHIVSKDEDSDKPYLVQYQEENGVLKVIKVDEYQEKLSQELSIPAFHFLEANEIKNRK
>NC_020383.1|WP_000854274.1|38509_38920_+|hypothetical-protein
MKTLKRNVFMLFAFIIGFTTIGVSSASAYTSEKFPVRPERYGEWDGVTISKHVGGDIAVRVWQQGVHSGQQAETQWVLTSWETGKRYTQYLKYDYDGAFTFKNVPYGSYSLTWTSLTGAKTEGWFYVAMPGGSVYK
>NC_020383.1|WP_000790476.1|38962_39472_-|DUF4367-domain-containing-protein
MKNIVFKLMTVLFLFMTGSLFNSNVYAENVDIVNKGFSLNELKGKTSFNCFIPKEIAKDWNIELKYPEQVHKNMEKVQIHFLNRAGTQLKVAIIESAATDNDIQPGEHGERVKINNINGVFHPLTPTKRIKDVQGGQLMWVQDGTMIELFSSRISKQELITIAQSMQKL
>NC_020383.1|WP_000658136.1|39716_39890_+|hypothetical-protein
MKEHNEQKSYYIREYTLRDKSTKSIRVEPWRSFKEEMKVLGITDNDIFQIQLIKKRV
>NC_020383.1|WP_000451648.1|40037_40196_-|hypothetical-protein
MEVFLEFLKEIIKAVLREVTAHVFKKKFLDKRKTTLSSSRPKRKKKGGFRKR
>NC_020383.1|WP_015406585.1|40620_41598_-|DUF4179-domain-containing-protein
MKCYDIGFIQTYIDGELSHDTRKEFTKHLDTCEACQDLLVEISKLNQWENVMLDEESAHSPQEIKIDVEQAWKTFESRSKLDNVSNINHKKQQKKGIFTNMNKKSKRFIYTAVAAAGLFTTAMIPQVQVAATNVASYFSNAVTNDKVVNEGGTDENGVTIDGMKNGKYIPIDEKITDQGITVHFKELYIADSRISVHYRMEKADGSLVPFEFDTTGLELGSDGKVNGQQEENPELKNGEVISFIQDSDDRLPFELMVAGKKLEHIGIRDKDKPEGVVTFVEGPEGKDAFKQPLTLDVNINKIGKVAGSWKGEIQIDTSHLKNKTN
>NC_020383.1|WP_000955500.1|41601_42132_-|RNA-polymerase-sigma-factor-SigX
MLTIENEESHASDMTFEDLFKQYYAYAVKQIIWIVKDQSIAEELAQEVFLQLYRSDWKAIENIPGWLIKSSTYVAYNHLRSEKRHQAKIDKEIQYHDVQNVSSLDDDWIRKEEITKVQTILNKMNERERTLLLMKFSGFQYKEVAEILQIEISSIGTLLVRAKMKFRKIYKQMEEA
>NC_020383.1|WP_004426833.1|42408_42621_-|hypothetical-protein
MIHQYELNFSVMYSGKVTGSQSTIIPASSLEEANEKLHSEVKRRLGKCRIKVNTVSLCVSEDSRYTIEQK
>NC_020383.1|WP_000575866.1|42652_42973_-|hypothetical-protein
MIFFKVIAYILLSIGVCTLVLAGIAAIVKKQMIIANINLLLAMYYFCSGSLLYLCTLWETQDIFLQAFLILIVGIAIIRLRKSWYVPQMRTYLQKLQEQATNKNDL
>NC_020383.1|WP_024927862.1|43423_43744_-|hypothetical-protein
MVNQNVLHHIGYEILQETFVLIRNVFSYSSQDESSVTYVREIADALHNIPHSIQKQHDTFLEFEFKLLEETLMQMDFGKVAAKNIPYFKMYAARVQQLLQKRYKEV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_020383_1	1.1\|37041\|24\|NC_020383\|CRISPRCasFinder	37041-37064	24	NC_017206	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence	56170-56193	0	1.0
NC_020383_1	1.1\|37041\|24\|NC_020383\|CRISPRCasFinder	37041-37064	24	NC_020383	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence	37041-37064	0	1.0
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NC_017206	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence	56233-56258	0	1.0
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NC_020383	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence	37104-37129	0	1.0
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NC_017206	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence	56319-56344	2	0.923
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NC_020383	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence	37190-37215	2	0.923
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NC_018510	Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence	166908-166933	2	0.923
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NZ_CP013280	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence	68-93	2	0.923
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NZ_CP039726	Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence	1351-1376	2	0.923
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NZ_CP009350	Bacillus thuringiensis HD1002 plasmid 4, complete sequence	21448-21473	2	0.923
NC_020383_1	1.1\|37041\|24\|NC_020383\|CRISPRCasFinder	37041-37064	24	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	373364-373387	3	0.875
NC_020383_1	1.1\|37041\|24\|NC_020383\|CRISPRCasFinder	37041-37064	24	NZ_CP044979	Bacillus thuringiensis strain BT62 plasmid pBT62A, complete sequence	136263-136286	3	0.875
NC_020383_1	1.1\|37041\|24\|NC_020383\|CRISPRCasFinder	37041-37064	24	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	12690-12713	3	0.875
NC_020383_1	1.1\|37041\|24\|NC_020383\|CRISPRCasFinder	37041-37064	24	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	12812-12835	3	0.875
NC_020383_1	1.1\|37041\|24\|NC_020383\|CRISPRCasFinder	37041-37064	24	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	12934-12957	3	0.875
NC_020383_1	1.1\|37041\|24\|NC_020383\|CRISPRCasFinder	37041-37064	24	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	13056-13079	3	0.875
NC_020383_1	1.1\|37041\|24\|NC_020383\|CRISPRCasFinder	37041-37064	24	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	235060-235083	3	0.875
NC_020383_1	1.1\|37041\|24\|NC_020383\|CRISPRCasFinder	37041-37064	24	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	235182-235205	3	0.875
NC_020383_1	1.1\|37041\|24\|NC_020383\|CRISPRCasFinder	37041-37064	24	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	235304-235327	3	0.875
NC_020383_1	1.1\|37041\|24\|NC_020383\|CRISPRCasFinder	37041-37064	24	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	235426-235449	3	0.875
NC_020383_1	1.1\|37041\|24\|NC_020383\|CRISPRCasFinder	37041-37064	24	NC_007021	Staphylococcus phage Twort, complete genome	35829-35852	3	0.875
NC_020383_1	1.1\|37041\|24\|NC_020383\|CRISPRCasFinder	37041-37064	24	MT151386	Staphylococcus virus Twort, complete genome	78358-78381	3	0.875
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NC_018510	Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence	166822-166847	3	0.885
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NC_018510	Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence	166994-167019	3	0.885
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NZ_CP013280	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence	154-179	3	0.885
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NZ_CP039726	Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence	1265-1290	3	0.885
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NZ_CP039726	Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence	1437-1462	3	0.885
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NZ_CP009350	Bacillus thuringiensis HD1002 plasmid 4, complete sequence	21362-21387	3	0.885
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NZ_CP009350	Bacillus thuringiensis HD1002 plasmid 4, complete sequence	21534-21559	3	0.885
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	AY543070	Bacteriophage T5, complete genome	2957-2982	3	0.885
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	AY543070	Bacteriophage T5, complete genome	114488-114513	3	0.885
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	AY587007	Bacteriophage T5 strain ATCC 11303-B5, complete genome	2957-2982	3	0.885
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	AY587007	Bacteriophage T5 strain ATCC 11303-B5, complete genome	114570-114595	3	0.885
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	AY692264	Bacteriophage T5 strain st0 deletion mutant, complete genome	2957-2982	3	0.885
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	AY692264	Bacteriophage T5 strain st0 deletion mutant, complete genome	106446-106471	3	0.885
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NC_005859	Enterobacteria phage T5, complete genome	2957-2982	3	0.885
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NC_005859	Enterobacteria phage T5, complete genome	114488-114513	3	0.885
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NZ_CP043834	Bacillus sp. BS98 plasmid unnamed4	12055-12080	3	0.885
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NZ_CP043834	Bacillus sp. BS98 plasmid unnamed4	12141-12166	3	0.885
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NZ_CP020436	Bacillus sp. FDAARGOS_235 plasmid 2, complete sequence	25393-25418	3	0.885
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NZ_CP020436	Bacillus sp. FDAARGOS_235 plasmid 2, complete sequence	25479-25504	3	0.885
NC_020383_1	1.1\|37041\|24\|NC_020383\|CRISPRCasFinder	37041-37064	24	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	182937-182960	4	0.833
NC_020383_1	1.1\|37041\|24\|NC_020383\|CRISPRCasFinder	37041-37064	24	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	224521-224544	4	0.833
NC_020383_1	1.1\|37041\|24\|NC_020383\|CRISPRCasFinder	37041-37064	24	MN693322	Marine virus AFVG_25M496, complete genome	13290-13313	4	0.833
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	AP019559	Escherichia phage SP15 DNA, complete genome	2943-2968	4	0.846
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NZ_CP043834	Bacillus sp. BS98 plasmid unnamed4	11969-11994	4	0.846
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NZ_CP020436	Bacillus sp. FDAARGOS_235 plasmid 2, complete sequence	25307-25332	4	0.846
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NC_047835	Escherichia phage OSYSP, complete genome	83708-83733	4	0.846
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	MH370378	Salmonella phage S131, complete genome	103804-103829	4	0.846
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	MH370377	Salmonella phage S130, partial genome	103804-103829	4	0.846
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NC_048871	Salmonella phage oselot, complete genome	5730-5755	4	0.846
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NC_047822	Escherichia phage phiLLS, complete genome	80701-80726	4	0.846
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	MT074447	Salmonella phage phagemcphageface, complete genome	3047-3072	4	0.846
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NC_048866	Salmonella phage bombadil, complete genome	5640-5665	4	0.846
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	LR027384	Escherichia virus vB_Eco_mar004NP2 genome assembly, chromosome: 1	60418-60443	4	0.846
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	MK568540	Vibrio phage ValB1 HC, complete genome	66803-66828	4	0.846
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	KP671755	Vibrio phage ValKK3, complete genome	119990-120015	4	0.846
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	KT919973	Vibrio phage phi-ST2, complete genome	181887-181912	4	0.846
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NC_023568	Vibrio phage VH7D, complete genome	193685-193710	4	0.846
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	MT612989	Vibrio phage vB_ValM_R11Z, complete genome	86221-86246	4	0.846
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	MT612988	Vibrio phage vB_ValM_R10Z, complete genome	86766-86791	4	0.846
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	KT919972	Vibrio phage phi-Grn1, complete genome	122356-122381	4	0.846
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NC_017206	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence	56277-56302	5	0.808
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NC_020383	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence	37148-37173	5	0.808
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NZ_CP021438	Bacillus thuringiensis strain C15 plasmid pBMB172, complete sequence	137354-137379	5	0.808
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	MG065692	UNVERIFIED: Campylobacter phage C13, complete genome	92973-92998	5	0.808
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NZ_CP029456	Bacillus cereus strain FORC087 plasmid pFORC087.2, complete sequence	65408-65433	5	0.808
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NC_017206	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence	56149-56174	6	0.769
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NC_017206	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence	56191-56216	6	0.769
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NC_020383	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence	37020-37045	6	0.769
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NC_020383	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence	37062-37087	6	0.769
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NC_018510	Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence	166952-166977	6	0.769
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NZ_CP013280	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence	24-49	6	0.769
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NZ_CP039726	Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence	1307-1332	6	0.769
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NZ_CP009350	Bacillus thuringiensis HD1002 plasmid 4, complete sequence	21404-21429	6	0.769
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NZ_CP043834	Bacillus sp. BS98 plasmid unnamed4	11927-11952	6	0.769
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NZ_CP043834	Bacillus sp. BS98 plasmid unnamed4	12013-12038	6	0.769
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NZ_CP043834	Bacillus sp. BS98 plasmid unnamed4	12099-12124	6	0.769
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NZ_CP020436	Bacillus sp. FDAARGOS_235 plasmid 2, complete sequence	25265-25290	6	0.769
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NZ_CP020436	Bacillus sp. FDAARGOS_235 plasmid 2, complete sequence	25351-25376	6	0.769
NC_020383_1	1.2\|37104\|26\|NC_020383\|CRISPRCasFinder	37104-37129	26	NZ_CP020436	Bacillus sp. FDAARGOS_235 plasmid 2, complete sequence	25437-25462	6	0.769

1. spacer 1.1|37041|24|NC_020383|CRISPRCasFinder matches to NC_017206 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence) position: , mismatch: 0, identity: 1.0

gaaataaaatttgttatctttaga	CRISPR spacer
gaaataaaatttgttatctttaga	Protospacer
************************

2. spacer 1.1|37041|24|NC_020383|CRISPRCasFinder matches to NC_020383 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence) position: , mismatch: 0, identity: 1.0

gaaataaaatttgttatctttaga	CRISPR spacer
gaaataaaatttgttatctttaga	Protospacer
************************

3. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NC_017206 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccgtttttgttatagataggca	Protospacer
**************************

4. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NC_020383 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccgtttttgttatagataggca	Protospacer
**************************

5. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NC_017206 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence) position: , mismatch: 2, identity: 0.923

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccgtttttgttatagataagta	Protospacer
**********************.*.*

6. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NC_020383 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence) position: , mismatch: 2, identity: 0.923

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccgtttttgttatagataagta	Protospacer
**********************.*.*

7. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NC_018510 (Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence) position: , mismatch: 2, identity: 0.923

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccatttttgttatagataagca	Protospacer
******.***************.***

8. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NZ_CP013280 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence) position: , mismatch: 2, identity: 0.923

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccatttttgttatagataagca	Protospacer
******.***************.***

9. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NZ_CP039726 (Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence) position: , mismatch: 2, identity: 0.923

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccatttttgttatagataagca	Protospacer
******.***************.***

10. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NZ_CP009350 (Bacillus thuringiensis HD1002 plasmid 4, complete sequence) position: , mismatch: 2, identity: 0.923

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccatttttgttatagataagca	Protospacer
******.***************.***

11. spacer 1.1|37041|24|NC_020383|CRISPRCasFinder matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 3, identity: 0.875

gaaataaaatttgttatctttaga	CRISPR spacer
aaaaccaaatttgttatctttaga	Protospacer
.***. ******************

12. spacer 1.1|37041|24|NC_020383|CRISPRCasFinder matches to NZ_CP044979 (Bacillus thuringiensis strain BT62 plasmid pBT62A, complete sequence) position: , mismatch: 3, identity: 0.875

gaaataaaatttgttatctttaga	CRISPR spacer
gaaaaaaaatttgttatcttttta	Protospacer
**** ****************  *

13. spacer 1.1|37041|24|NC_020383|CRISPRCasFinder matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.875

gaaataaaatttgttatctttaga	CRISPR spacer
aaaatcaaatttgttatttttaga	Protospacer
.**** ***********.******

14. spacer 1.1|37041|24|NC_020383|CRISPRCasFinder matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.875

gaaataaaatttgttatctttaga	CRISPR spacer
aaaatcaaatttgttatttttaga	Protospacer
.**** ***********.******

15. spacer 1.1|37041|24|NC_020383|CRISPRCasFinder matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.875

gaaataaaatttgttatctttaga	CRISPR spacer
aaaatcaaatttgttatttttaga	Protospacer
.**** ***********.******

16. spacer 1.1|37041|24|NC_020383|CRISPRCasFinder matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.875

gaaataaaatttgttatctttaga	CRISPR spacer
aaaatcaaatttgttatttttaga	Protospacer
.**** ***********.******

17. spacer 1.1|37041|24|NC_020383|CRISPRCasFinder matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.875

gaaataaaatttgttatctttaga	CRISPR spacer
aaaatcaaatttgttatttttaga	Protospacer
.**** ***********.******

18. spacer 1.1|37041|24|NC_020383|CRISPRCasFinder matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.875

gaaataaaatttgttatctttaga	CRISPR spacer
aaaatcaaatttgttatttttaga	Protospacer
.**** ***********.******

19. spacer 1.1|37041|24|NC_020383|CRISPRCasFinder matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.875

gaaataaaatttgttatctttaga	CRISPR spacer
aaaatcaaatttgttatttttaga	Protospacer
.**** ***********.******

20. spacer 1.1|37041|24|NC_020383|CRISPRCasFinder matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.875

gaaataaaatttgttatctttaga	CRISPR spacer
aaaatcaaatttgttatttttaga	Protospacer
.**** ***********.******

21. spacer 1.1|37041|24|NC_020383|CRISPRCasFinder matches to NC_007021 (Staphylococcus phage Twort, complete genome) position: , mismatch: 3, identity: 0.875

gaaataaaatttgttatctttaga	CRISPR spacer
aaaataaaatttgtaatctttata	Protospacer
.************* ******* *

22. spacer 1.1|37041|24|NC_020383|CRISPRCasFinder matches to MT151386 (Staphylococcus virus Twort, complete genome) position: , mismatch: 3, identity: 0.875

gaaataaaatttgttatctttaga	CRISPR spacer
aaaataaaatttgtaatctttata	Protospacer
.************* ******* *

23. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NC_018510 (Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence) position: , mismatch: 3, identity: 0.885

aaaaccgtttttgttatagataggca	CRISPR spacer
agaaccgtttttgttataggtaggta	Protospacer
*.*****************.****.*

24. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NC_018510 (Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence) position: , mismatch: 3, identity: 0.885

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccatttttgttatagataagta	Protospacer
******.***************.*.*

25. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NZ_CP013280 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence) position: , mismatch: 3, identity: 0.885

aaaaccgtttttgttatagataggca	CRISPR spacer
agaaccgtttttgttataggtaggta	Protospacer
*.*****************.****.*

26. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NZ_CP039726 (Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence) position: , mismatch: 3, identity: 0.885

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccatttttgttatagataagta	Protospacer
******.***************.*.*

27. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NZ_CP039726 (Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence) position: , mismatch: 3, identity: 0.885

aaaaccgtttttgttatagataggca	CRISPR spacer
agaaccgtttttgttataggtaggta	Protospacer
*.*****************.****.*

28. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NZ_CP009350 (Bacillus thuringiensis HD1002 plasmid 4, complete sequence) position: , mismatch: 3, identity: 0.885

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccatttttgttatagataagta	Protospacer
******.***************.*.*

29. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NZ_CP009350 (Bacillus thuringiensis HD1002 plasmid 4, complete sequence) position: , mismatch: 3, identity: 0.885

aaaaccgtttttgttatagataggca	CRISPR spacer
agaaccgtttttgttataggtaggta	Protospacer
*.*****************.****.*

30. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to AY543070 (Bacteriophage T5, complete genome) position: , mismatch: 3, identity: 0.885

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccgtttttgttatagataaact	Protospacer
**********************..*

31. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to AY543070 (Bacteriophage T5, complete genome) position: , mismatch: 3, identity: 0.885

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccgtttttgttatagataaact	Protospacer
**********************..*

32. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to AY587007 (Bacteriophage T5 strain ATCC 11303-B5, complete genome) position: , mismatch: 3, identity: 0.885

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccgtttttgttatagataaact	Protospacer
**********************..*

33. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to AY587007 (Bacteriophage T5 strain ATCC 11303-B5, complete genome) position: , mismatch: 3, identity: 0.885

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccgtttttgttatagataaact	Protospacer
**********************..*

34. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to AY692264 (Bacteriophage T5 strain st0 deletion mutant, complete genome) position: , mismatch: 3, identity: 0.885

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccgtttttgttatagataaact	Protospacer
**********************..*

35. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to AY692264 (Bacteriophage T5 strain st0 deletion mutant, complete genome) position: , mismatch: 3, identity: 0.885

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccgtttttgttatagataaact	Protospacer
**********************..*

36. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NC_005859 (Enterobacteria phage T5, complete genome) position: , mismatch: 3, identity: 0.885

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccgtttttgttatagataaact	Protospacer
**********************..*

37. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NC_005859 (Enterobacteria phage T5, complete genome) position: , mismatch: 3, identity: 0.885

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccgtttttgttatagataaact	Protospacer
**********************..*

38. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NZ_CP043834 (Bacillus sp. BS98 plasmid unnamed4) position: , mismatch: 3, identity: 0.885

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccatttttgttatagatagata	Protospacer
******.****************..*

39. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NZ_CP043834 (Bacillus sp. BS98 plasmid unnamed4) position: , mismatch: 3, identity: 0.885

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccatttttgttatagataagta	Protospacer
******.***************.*.*

40. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NZ_CP020436 (Bacillus sp. FDAARGOS_235 plasmid 2, complete sequence) position: , mismatch: 3, identity: 0.885

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccatttttgttatagatagata	Protospacer
******.****************..*

41. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NZ_CP020436 (Bacillus sp. FDAARGOS_235 plasmid 2, complete sequence) position: , mismatch: 3, identity: 0.885

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccatttttgttatagataagta	Protospacer
******.***************.*.*

42. spacer 1.1|37041|24|NC_020383|CRISPRCasFinder matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 4, identity: 0.833

gaaataaaatttgttatctttaga	CRISPR spacer
ccattaaaatttgttatctttagt	Protospacer
  * *******************

43. spacer 1.1|37041|24|NC_020383|CRISPRCasFinder matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.833

gaaataaaatttgttatctttaga	CRISPR spacer
ccattaaaatttgttatctttagt	Protospacer
  * *******************

44. spacer 1.1|37041|24|NC_020383|CRISPRCasFinder matches to MN693322 (Marine virus AFVG_25M496, complete genome) position: , mismatch: 4, identity: 0.833

gaaataaaatttgttatctttaga	CRISPR spacer
gaaataaaatttgttatttttctt	Protospacer
*****************.***

45. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to AP019559 (Escherichia phage SP15 DNA, complete genome) position: , mismatch: 4, identity: 0.846

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccgtttttgttatagatatatt	Protospacer
********************** ..

46. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NZ_CP043834 (Bacillus sp. BS98 plasmid unnamed4) position: , mismatch: 4, identity: 0.846

aaaaccgtttttgttatagataggca	CRISPR spacer
gaaaccatttttgttatagatagata	Protospacer
.*****.****************..*

47. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NZ_CP020436 (Bacillus sp. FDAARGOS_235 plasmid 2, complete sequence) position: , mismatch: 4, identity: 0.846

aaaaccgtttttgttatagataggca	CRISPR spacer
gaaaccatttttgttatagatagata	Protospacer
.*****.****************..*

48. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NC_047835 (Escherichia phage OSYSP, complete genome) position: , mismatch: 4, identity: 0.846

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccgtttttgttataaataaact	Protospacer
******************.***..*

49. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to MH370378 (Salmonella phage S131, complete genome) position: , mismatch: 4, identity: 0.846

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccgtttttgttataaataaact	Protospacer
******************.***..*

50. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to MH370377 (Salmonella phage S130, partial genome) position: , mismatch: 4, identity: 0.846

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccgtttttgttataaataaact	Protospacer
******************.***..*

51. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NC_048871 (Salmonella phage oselot, complete genome) position: , mismatch: 4, identity: 0.846

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccgtttttgttataaatatact	Protospacer
******************.*** .*

52. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NC_047822 (Escherichia phage phiLLS, complete genome) position: , mismatch: 4, identity: 0.846

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccgtttttgttataaataaact	Protospacer
******************.***..*

53. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to MT074447 (Salmonella phage phagemcphageface, complete genome) position: , mismatch: 4, identity: 0.846

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccgtttttgttataaatatact	Protospacer
******************.*** .*

54. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NC_048866 (Salmonella phage bombadil, complete genome) position: , mismatch: 4, identity: 0.846

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccgtttttgttataaatatact	Protospacer
******************.*** .*

55. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to LR027384 (Escherichia virus vB_Eco_mar004NP2 genome assembly, chromosome: 1) position: , mismatch: 4, identity: 0.846

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccgtttttgttataaataaact	Protospacer
******************.***..*

56. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to MK568540 (Vibrio phage ValB1 HC, complete genome) position: , mismatch: 4, identity: 0.846

aaaaccgtttttgttatagataggca	CRISPR spacer
caaaccttctttgttatagataggta	Protospacer
 ***** *.***************.*

57. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to KP671755 (Vibrio phage ValKK3, complete genome) position: , mismatch: 4, identity: 0.846

aaaaccgtttttgttatagataggca	CRISPR spacer
caaaccttctttgttatagataggta	Protospacer
 ***** *.***************.*

58. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to KT919973 (Vibrio phage phi-ST2, complete genome) position: , mismatch: 4, identity: 0.846

aaaaccgtttttgttatagataggca	CRISPR spacer
caaaccttctttgttatagataggta	Protospacer
 ***** *.***************.*

59. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NC_023568 (Vibrio phage VH7D, complete genome) position: , mismatch: 4, identity: 0.846

aaaaccgtttttgttatagataggca	CRISPR spacer
caaaccttctttgttatagataggta	Protospacer
 ***** *.***************.*

60. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to MT612989 (Vibrio phage vB_ValM_R11Z, complete genome) position: , mismatch: 4, identity: 0.846

aaaaccgtttttgttatagataggca	CRISPR spacer
caaaccttctttgttatagataggta	Protospacer
 ***** *.***************.*

61. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to MT612988 (Vibrio phage vB_ValM_R10Z, complete genome) position: , mismatch: 4, identity: 0.846

aaaaccgtttttgttatagataggca	CRISPR spacer
caaaccttctttgttatagataggta	Protospacer
 ***** *.***************.*

62. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to KT919972 (Vibrio phage phi-Grn1, complete genome) position: , mismatch: 4, identity: 0.846

aaaaccgtttttgttatagataggca	CRISPR spacer
caaaccttctttgttatagataggta	Protospacer
 ***** *.***************.*

63. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NC_017206 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence) position: , mismatch: 5, identity: 0.808

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccgtttttgttatagatgaaac	Protospacer
*********************...

64. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NC_020383 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence) position: , mismatch: 5, identity: 0.808

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccgtttttgttatagatgaaac	Protospacer
*********************...

65. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NZ_CP021438 (Bacillus thuringiensis strain C15 plasmid pBMB172, complete sequence) position: , mismatch: 5, identity: 0.808

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccgtttttgttatagttaaaac	Protospacer
******************* **..

66. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to MG065692 (UNVERIFIED: Campylobacter phage C13, complete genome) position: , mismatch: 5, identity: 0.808

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccgtttttattatagatatatt	Protospacer
************.********* ..

67. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NZ_CP029456 (Bacillus cereus strain FORC087 plasmid pFORC087.2, complete sequence) position: , mismatch: 5, identity: 0.808

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccatttttgttatagaaagaac	Protospacer
******.************* **.

68. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NC_017206 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence) position: , mismatch: 6, identity: 0.769

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccatttttgttatagatgaaat	Protospacer
******.**************...

69. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NC_017206 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence) position: , mismatch: 6, identity: 0.769

aaaaccgtttttgttatagataggca	CRISPR spacer
agaaccgtttttgttatagatgaaac	Protospacer
*.*******************...

70. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NC_020383 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence) position: , mismatch: 6, identity: 0.769

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccatttttgttatagatgaaat	Protospacer
******.**************...

71. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NC_020383 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence) position: , mismatch: 6, identity: 0.769

aaaaccgtttttgttatagataggca	CRISPR spacer
agaaccgtttttgttatagatgaaac	Protospacer
*.*******************...

72. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NC_018510 (Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence) position: , mismatch: 6, identity: 0.769

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccatttttgttatagatgcaac	Protospacer
******.**************. .

73. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NZ_CP013280 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence) position: , mismatch: 6, identity: 0.769

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccatttttgttatagatgcaac	Protospacer
******.**************. .

74. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NZ_CP039726 (Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence) position: , mismatch: 6, identity: 0.769

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccatttttgttatagatgcaac	Protospacer
******.**************. .

75. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NZ_CP009350 (Bacillus thuringiensis HD1002 plasmid 4, complete sequence) position: , mismatch: 6, identity: 0.769

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccatttttgttatagatgcaac	Protospacer
******.**************. .

76. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NZ_CP043834 (Bacillus sp. BS98 plasmid unnamed4) position: , mismatch: 6, identity: 0.769

aaaaccgtttttgttatagataggca	CRISPR spacer
agaaccgtttttgttatagatgaaac	Protospacer
*.*******************...

77. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NZ_CP043834 (Bacillus sp. BS98 plasmid unnamed4) position: , mismatch: 6, identity: 0.769

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccatttttgttatagatgaaac	Protospacer
******.**************...

78. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NZ_CP043834 (Bacillus sp. BS98 plasmid unnamed4) position: , mismatch: 6, identity: 0.769

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccatttttgttatagatgaaac	Protospacer
******.**************...

79. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NZ_CP020436 (Bacillus sp. FDAARGOS_235 plasmid 2, complete sequence) position: , mismatch: 6, identity: 0.769

aaaaccgtttttgttatagataggca	CRISPR spacer
agaaccgtttttgttatagatgaaac	Protospacer
*.*******************...

80. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NZ_CP020436 (Bacillus sp. FDAARGOS_235 plasmid 2, complete sequence) position: , mismatch: 6, identity: 0.769

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccatttttgttatagatgaaac	Protospacer
******.**************...

81. spacer 1.2|37104|26|NC_020383|CRISPRCasFinder matches to NZ_CP020436 (Bacillus sp. FDAARGOS_235 plasmid 2, complete sequence) position: , mismatch: 6, identity: 0.769

aaaaccgtttttgttatagataggca	CRISPR spacer
aaaaccatttttgttatagatgaaac	Protospacer
******.**************...

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

8. NC_020381

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 6773

Bacillus_phage(85.71%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000382147.1\|2239_3094_-	TnP I resolvase	S5M9V8	Brevibacillus_phage	4.4e-23	26.4
WP_015406549.1\|3209_3452_-	hypothetical protein	NA	NA	NA	NA
WP_015406550.1\|3481_4222_-	hypothetical protein	A0A0S2MVI5	Bacillus_phage	3.2e-86	67.0
WP_001017952.1\|4246_4675_-	hypothetical protein	A0A0S2MVA8	Bacillus_phage	3.2e-30	47.1
WP_000016917.1\|4697_5393_-	Rha family transcriptional regulator	A0A0S2MVD8	Bacillus_phage	4.8e-44	43.8
WP_000786982.1\|5397_5583_-	helix-turn-helix transcriptional regulator	A0A0M3ULF9	Bacillus_phage	1.0e-09	59.0
WP_000028578.1\|5856_6294_+	helix-turn-helix transcriptional regulator	A0A1C8E9A4	Bacillus_phage	9.8e-35	56.2
WP_000542658.1\|6314_6773_+	ImmA/IrrE family metallo-endopeptidase	Q9T201	Bacillus_phage	5.8e-30	47.8

DBSCAN-SWA_2

11772 : 38002

Bacillus_phage(53.33%)

transposase,tail,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001246650.1\|11772_12051_+	hypothetical protein	A0A0S2MVK9	Bacillus_phage	8.7e-37	79.1
WP_000477695.1\|12193_12445_+	hypothetical protein	NA	NA	NA	NA
WP_000379283.1\|13016_13631_+	DUF3967 domain-containing protein	NA	NA	NA	NA
WP_000365196.1\|13788_14772_+	ParM/StbA family protein	A0A0S2MVG2	Bacillus_phage	1.8e-52	38.0
WP_000664560.1\|14768_15134_+	hypothetical protein	NA	NA	NA	NA
WP_000072432.1\|15228_15465_+	hypothetical protein	A0A1B1P789	Bacillus_phage	2.2e-17	50.6
WP_000734385.1\|15518_15764_-	hypothetical protein	A0A2H4JBB8	uncultured_Caudovirales_phage	6.7e-17	75.4
WP_000558422.1\|15763_16879_-	tetratricopeptide repeat protein	A0A2H4J8G3	uncultured_Caudovirales_phage	1.2e-105	54.1
WP_003275239.1\|17386_18109_-	hypothetical protein	NA	NA	NA	NA
WP_000276342.1\|18124_18337_-	hypothetical protein	A0A1Z1LZP5	Bacillus_phage	4.3e-28	94.3
WP_002175753.1\|18329_18557_-	hypothetical protein	NA	NA	NA	NA
WP_000383999.1\|18583_18736_-	hypothetical protein	NA	NA	NA	NA
WP_000742982.1\|18884_19943_-	N-acetylmuramoyl-L-alanine amidase	A0A1B1P7Q1	Bacillus_phage	2.0e-150	75.4
WP_000439587.1\|20022_20520_-\|holin	phage holin family protein	A0A0M4R5G6	Bacillus_phage	1.2e-25	42.8
WP_000499525.1\|20815_22012_+\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	5.6e-24	25.9
WP_000152790.1\|22265_22514_-	hypothetical protein	NA	NA	NA	NA
WP_000182359.1\|22527_23478_-	hypothetical protein	NA	NA	NA	NA
WP_000537585.1\|23493_23874_-	hypothetical protein	G3MAB0	Bacillus_virus	5.9e-12	33.3
WP_000013278.1\|23886_25887_-	hypothetical protein	A0A2H4J270	uncultured_Caudovirales_phage	4.0e-14	33.5
WP_001291956.1\|25902_28416_-	hypothetical protein	NA	NA	NA	NA
WP_000264171.1\|28437_30174_-	hypothetical protein	A0A0K2CNY7	Brevibacillus_phage	4.8e-125	43.6
WP_000332096.1\|30188_31538_-	hypothetical protein	A0A0K2CP42	Brevibacillus_phage	1.1e-73	34.0
WP_000006647.1\|31551_31929_-	hypothetical protein	NA	NA	NA	NA
WP_000464284.1\|31941_32316_-	hypothetical protein	A0A0K2CPR2	Brevibacillus_phage	1.1e-15	38.5
WP_000605842.1\|32360_32744_-	hypothetical protein	NA	NA	NA	NA
WP_001206677.1\|32754_34302_-	hypothetical protein	NA	NA	NA	NA
WP_000025600.1\|34298_34982_-	hypothetical protein	NA	NA	NA	NA
WP_000947773.1\|34978_38002_-\|tail	phage tail tape measure protein	A0A1B1P7P9	Bacillus_phage	4.3e-89	56.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage