CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NC_020128	Lawsonia intracellularis N343 plasmid 1, complete sequence	0 crisprs	NA	0	0
NC_020130	Lawsonia intracellularis N343 plasmid 3, complete sequence	0 crisprs	NA	0	1
NC_020129	Lawsonia intracellularis N343 plasmid 2, complete sequence	1 crisprs	NA	2	0
NC_020127	Lawsonia intracellularis N343, complete sequence	2 crisprs	NA	0	3

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

122004 : 141005

uncultured_Caudovirales_phage(25.0%)

protease,head,plate,tail,holin

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011527385.1\|122004_123144_+\|protease	phage protease	J9SH47	Pseudomonas_phage	2.3e-35	34.4
WP_011527386.1\|123239_124103_+\|head	Mu-like prophage major head subunit gpT family protein	L7P7Y9	Pseudomonas_phage	1.2e-76	50.4
WP_011527387.1\|124105_124555_+	DUF1320 domain-containing protein	A0A2I7S9E9	Vibrio_phage	5.8e-06	27.4
WP_011527388.1\|124577_125222_+	DUF1834 family protein	NA	NA	NA	NA
WP_011527389.1\|125299_126715_+\|tail	phage tail sheath subtilisin-like domain-containing protein	B7SDP8	Haemophilus_phage	1.2e-84	42.3
WP_011527390.1\|126977_127367_+	hypothetical protein	A0A0M3LRV6	Mannheimia_phage	3.7e-17	40.0
WP_011527391.1\|127368_127692_+	hypothetical protein	NA	NA	NA	NA
WP_155800204.1\|127685_127838_+	hypothetical protein	NA	NA	NA	NA
WP_011527392.1\|127944_128814_+	hypothetical protein	NA	NA	NA	NA
WP_011527393.1\|129126_130392_+	DNA circularization N-terminal domain-containing protein	A0A2H4JGT4	uncultured_Caudovirales_phage	2.0e-24	41.3
WP_011527394.1\|130512_131544_+\|tail	phage tail protein	A0A2H4J9E6	uncultured_Caudovirales_phage	4.5e-54	34.9
WP_011527395.1\|131607_132204_+\|plate	phage baseplate assembly protein	A0A0M3LPA3	Mannheimia_phage	2.0e-22	34.8
WP_011527396.1\|132348_133044_-	queuosine precursor transporter	A0A2H4J2N7	uncultured_Caudovirales_phage	1.7e-09	27.2
WP_011527397.1\|133371_133758_-	RidA family protein	NA	NA	NA	NA
WP_011527398.1\|134034_135027_-	hypothetical protein	NA	NA	NA	NA
WP_011527399.1\|135112_136054_-	GDP-L-fucose synthase	M1HKX0	Paramecium_bursaria_Chlorella_virus	9.6e-104	59.4
WP_011527400.1\|136416_137775_-	replicative DNA helicase	O80281	Escherichia_phage	3.9e-90	46.3
WP_041817127.1\|138611_139757_+	GDP-mannose 4,6-dehydratase	M1HKK4	Acanthocystis_turfacea_Chlorella_virus	1.4e-128	61.9
WP_011527402.1\|140147_140474_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011527403.1\|140630_141005_+\|holin	putative holin	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_020129

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_020129_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_020129_1

6761-6936

Orphan

Consensus_repeat	Method
GTTCCGACATTAAGGTTAGTAATATT	CRISPRCasFinder

2 spacers

The CRISPR arrays of NC_020129_1

>merge|NC_020129|1|6761-6936|CRISPRCasFinder
GTTCCGACATTAAGGTTAGTAATATTGCCACTATTAATGATTACAGAGGCATTCTCAGTTACTCCAAGTCCATTGAAGGTTCCGACATTAAGGTTAGTAATATTACTATCAGTAACAGTTGCTGTAGTTGATATTGTATGACCTTCGACACTACCAAGGTTTAAGTTAGTAATGTT

>NC_020129|1|1|6761-6936|CRISPRCasFinder
GTTCCGACATTAAGGTTAGTAATATT	GCCACTATTAATGATTACAGAGGCATTCTCAGTTACTCCAAGTCCATTGAAG
GTTCCGACATTAAGGTTAGTAATATT	ACTATCAGTAACAGTTGCTGTAGTTGATATTGTATGACCTTCGACA
CTACCAAGGTTTAAGTTAGTAATGTT

Protein	Signature genes	Signature genes Name	Protein_function
NC_020129.1\|WP_155800203.1\|4752_4923_+\|hypothetical-protein	unknown	unknown	unknown
NC_020129.1\|WP_015353848.1\|8373_9504_-\|HD-domain-containing-protein	unknown	unknown	gnl\|CDD\|224004
NC_020129.1\|WP_011527297.1\|2271_2553_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NC_020129.1\|WP_015353847.1\|718_1015_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|368240
NC_020129.1\|WP_011527306.1\|17666_18566_-\|radical-SAM-protein	unknown	unknown	gnl\|CDD\|275121
NC_020129.1\|WP_011527304.1\|15492_16509_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369777
NC_020129.1\|WP_011527308.1\|19407_20637_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226988
NC_020129.1\|WP_011527301.1\|10475_12647_+\|autotransporter-domain-containing-protein	unknown	unknown	gnl\|CDD\|214872
NC_020129.1\|WP_011527307.1\|18627_19278_-\|acetyltransferase	unknown	unknown	gnl\|CDD\|274656
NC_020129.1\|WP_011527302.1\|12811_14692_-\|asparagine-synthase-(glutamine-hydrolyzing)	unknown	unknown	gnl\|CDD\|132152
NC_020129.1\|WP_011527296.1\|443_731_+\|CopG-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|226420
NC_020129.1\|WP_011527309.1\|20796_21627_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NC_020129.1\|WP_011527298.1\|2824_3862_+\|hypothetical-protein	unknown	unknown	unknown
NC_020129.1\|WP_011527305.1\|16521_17646_-\|DegT/DnrJ/EryC1/StrS-family-aminotransferase	unknown	unknown	gnl\|CDD\|99740
NC_020129.1\|WP_011527303.1\|14707_15499_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|200546

Protein	Function_ID	Function_description	E-value
NC_020129.1\|WP_015353848.1\|8373_9504_-\|HD-domain-containing-protein	gnl\|CDD\|224004	COG1078, COG1078, HD superfamily phosphohydrolases [General function prediction only].	1.27997e-10
NC_020129.1\|WP_011527297.1\|2271_2553_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.06055e-10
NC_020129.1\|WP_015353847.1\|718_1015_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|368240	pfam05016, ParE_toxin, ParE toxin of type II toxin-antitoxin system, parDE. ParE is the toxin family of a type II toxin-antitoxin family. It is toxic towards DNA gyrase, but is neutralized by the antitoxin ParD. The family also encompasses RelE/ParE described in.	7.77381e-09
NC_020129.1\|WP_011527306.1\|17666_18566_-\|radical-SAM-protein	gnl\|CDD\|275121	TIGR04317, W_rSAM_matur, tungsten cofactor oxidoreducase radical SAM maturase. Members of this family are radical SAM enzymes involved in the maturation of tungsten (W)-containing cofactors in the enzymes aldehyde ferredoxin oxidoreductase, formaldehyde ferredoxin oxidoreductase, and others, and tend to be encoded by an adjacent gene.	2.58943e-22
NC_020129.1\|WP_011527304.1\|15492_16509_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	3.23669e-20
NC_020129.1\|WP_011527308.1\|19407_20637_+\|hypothetical-protein	gnl\|CDD\|226988	COG4641, COG4641, Uncharacterized protein conserved in bacteria [Function unknown].	0.00786135
NC_020129.1\|WP_011527296.1\|443_731_+\|CopG-family-transcriptional-regulator	gnl\|CDD\|226420	COG3905, COG3905, Predicted transcriptional regulator [Transcription].	1.25477e-10
NC_020129.1\|WP_011527303.1\|14707_15499_-\|hypothetical-protein	gnl\|CDD\|200546	cd10920, CE4_WbmS, Catalytic domain of a putative polysaccharide deacetylase WbmS from Bordetella bronchiseptica and similar proteins. This family is represented by a putative polysaccharide deacetylase encoded by the O-antigen-related gene wbmS in Bordetella bronchiseptica. Although its precise function remains unknown, it has been suggested that WbmS might be involved in the biosynthesis of O-antigen, an important component of the gram-negative bacterial outer membrane, and may also play a role in sugar phosphate transfer. Structural superposition and sequence comparison show that WbmS consists of a conserved domain similar to the 7-stranded barrel catalytic domain of polysaccharide deacetylases (DACs) from the carbohydrate esterase 4 (CE4) superfamily, which removes N-linked acetyl groups from cell wall polysaccharides.	2.48976e-122
NC_020129.1\|WP_011527302.1\|12811_14692_-\|asparagine-synthase-(glutamine-hydrolyzing)	gnl\|CDD\|132152	TIGR03108, eps_aminotran_1, exosortase A system-associated amidotransferase 1. The predicted protein-sorting transpeptidase that we call exosortase (see TIGR02602) has distinct subclasses that associated with different types of exopolysaccharide production loci. This model represents a distinct clade among a set of amidotransferases largely annotated (not necessarily accurately) as glutatime-hydrolyzing asparagine synthases. Members of this clade are essentially restricted to the characteristic exopolysaccharide (EPS) regions that contain the exosortase 1 genome (xrtA), in genomes that also have numbers of PEP-CTERM domain (TIGR02595) proteins.	6.0806e-130
NC_020129.1\|WP_011527301.1\|10475_12647_+\|autotransporter-domain-containing-protein	gnl\|CDD\|214872	smart00869, Autotransporter, Autotransporter beta-domain. Secretion of protein products occurs by a number of different pathways in bacteria. One of these pathways known as the type IV pathway was first described for the IgA1 protease. The protein component that mediates secretion through the outer membrane is contained within the secreted protein itself, hence the proteins secreted in this way are called autotransporters. This family corresponds to the presumed integral membrane beta-barrel domain that transports the protein. This domain is found at the C-terminus of the proteins it occurs in. The N-terminus contains the variable passenger domain that is translocated across the membrane. Once the passenger domain is exported it is cleaved auto-catalytically in some proteins, in others a different peptidase is used and in some cases no cleavage occurs.	5.40851e-10
NC_020129.1\|WP_011527309.1\|20796_21627_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	2.39901e-10
NC_020129.1\|WP_011527305.1\|16521_17646_-\|DegT/DnrJ/EryC1/StrS-family-aminotransferase	gnl\|CDD\|99740	cd00616, AHBA_syn, 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn). AHBA_syn family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The members of this CD are involved in various biosynthetic pathways for secondary metabolites. Some well studied proteins in this CD are AHBA_synthase, protein product of pleiotropic regulatory gene degT, Arnb aminotransferase and pilin glycosylation protein. The prototype of this family, the AHBA_synthase, is a dimeric PLP dependent enzyme. AHBA_syn is the terminal enzyme of 3-amino-5-hydroxybenzoic acid (AHBA) formation which is involved in the biosynthesis of ansamycin antibiotics, including rifamycin B. Some members of this CD are involved in 4-amino-6-deoxy-monosaccharide D-perosamine synthesis. Perosamine is an important element in the glycosylation of several cell products, such as antibiotics and lipopolysaccharides of gram-positive and gram-negative bacteria. The pilin glycosylation protein encoded by gene pglA, is a galactosyltransferase involved in pilin glycosylation. Additionally, this CD consists of ArnB (PmrH) aminotransferase, a 4-amino-4-deoxy-L-arabinose lipopolysaccharide-modifying enzyme. This CD also consists of several predicted pyridoxal phosphate-dependent enzymes apparently involved in regulation of cell wall biogenesis. The catalytic lysine which is present in all characterized PLP dependent enzymes is replaced by histidine in some members of this CD.	4.16357e-128
NC_020129.1\|WP_011527307.1\|18627_19278_-\|acetyltransferase	gnl\|CDD\|274656	TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family. This family of proteins includes the characterized NeuD sialic acid O-acetyltransferase enzymes from E. coli and Streptococcus agalactiae (group B strep). These two are quite closely related to one another, so extension of this annotation to other members of the family in unsupported without additional independent evidence. The neuD gene is often observed in close proximity to the neuABC genes for the biosynthesis of CMP-N-acetylneuraminic acid (CMP-sialic acid), and NeuD sequences from these organisms were used to construct the seed for this model. Nevertheless, there are numerous instances of sequences identified by this model which are observed in a different genomic context (although almost universally in exopolysaccharide biosynthesis-related loci), as well as in genomes for which the biosynthesis of sialic acid (SA) is undemonstrated. Even in the cases where the association with SA biosynthesis is strong, it is unclear in the literature whether the biological substrate is SA iteself, CMP-SA, or a polymer containing SA. Similarly, it is unclear to what extent the enzyme has a preference for acetylation at the 7, 8 or 9 positions. In the absence of evidence of association with SA, members of this family may be involved with the acetylation of differring sugar substrates, or possibly the delivery of alternative acyl groups. The closest related sequences to this family (and those used to root the phylogenetic tree constructed to create this model) are believed to be succinyltransferases involved in lysine biosynthesis. These proteins contain repeats of the bacterial transferase hexapeptide (pfam00132), although often these do not register above the trusted cutoff.	2.21033e-65

>NC_020129.1|WP_155800203.1|4752_4923_+|hypothetical-protein
MDFEFSFRDIDKVVKDVEDMYEKDDTLSLDLLDYFPGVEEDEEDRDFEVLTEYDTD
>NC_020129.1|WP_011527298.1|2824_3862_+|hypothetical-protein
MNLDIELTPEEEEELATINPKLLEELKTGSPIGKAWLASIQRSRELNELALEQAKEIREEVAKAAPEQNSLMTWCGYPTDITRCSPFFPMGPKEISHRPYLENFIITSANWGEITYTGPKLSTYEEDALMALLAILNSVSEYRQTTEVEGSKTYTYKGPMLPLLKLLGHERPGKANYNHLLLALQRLMSAVVKLSISVGKTKSGKRKEPKKIDMTTMLAHVHWDEEKKELSATINPFFYESYYAGTVTMIDVLKRAGLKGSIAKALYRFVQSHRKNPVFTGHFLTLADALNMDRDQPSKKTRQLLKTAILELIKHSILSPESRFIDQDIVKLERVQVMVCDKLKV
>NC_020129.1|WP_011527297.1|2271_2553_-|helix-turn-helix-transcriptional-regulator
MAKKFFKSIGLVIRNYRKTAKLTQARLGEKLGVKGNYIGEIERGEEHPSVEMLVKFSLHMKVRPGELLDTIVEQEVESGNEDFPWITLYNEID
>NC_020129.1|WP_015353847.1|718_1015_+|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MSSIKIEFMPYAIECINKIYTFLEKSDKEAAKNIAKIILNKIRILEKFPNLGRSSIDLEPEQRELIVPFGATGYVILYTLQHNIIFILSVRHQKEVGY
>NC_020129.1|WP_011527296.1|443_731_+|CopG-family-transcriptional-regulator
MKTLSNTTSVKLEDSVKTRIKNLAAIRKRTPHSIMVEAIEEYIDKAEKREAFRQEGINVYNDYLNNGLHLPVEEAIAWLNELANGNYVEPPKCHL
>NC_020129.1|WP_015353848.1|8373_9504_-|HD-domain-containing-protein
MSFFSKKRHQSLIKGYNTIFLKFITITLLSTTFILGTLLQQALGTVTIQTVWGECTFEHPILKKIIEHNTLQRLKYVDQSGPITYFGYMPYFNRYEHSIGVLALLQKANAPLNEQVAGLLHDVSHTVFSHIADHLLYKSNLEKSYQDTIHLKFLKTMHVQKVTEPYGIFLKDLDPDNPSYSALEQPLPNLCADRIQYLLHTGVIVEKISCNQAKMVIDNLKFQDGIWFFLNKKPAKIIGMLSLEFTQELYGAPWNFAFYEYFTEILKEALKIKLITLSEIKYGTDKNVLHLLESSNNKFINKGMKHLKDVHNIFKEYPFGQGELNIKPKFRGVDPLIKVGENFVRLSAIDPNFKEKFEEVKKWCNTGYGIRFVITK
>NC_020129.1|WP_011527301.1|10475_12647_+|autotransporter-domain-containing-protein
MIVNKLSIFIYNYTTKVRHYINCIYHTCVSYSQIFRSWLWYRRQLRIGLLFFLYLVSVYGLSFSKSPEENEEEAKGRQRVQAMELSFHNAAISQEVNETVSSMEAELEEESAYATELEILVDETVKTFFETTDIVTDDVVSVMLQGIDETASDLENSEVRARKNLEKLKQLTEHKKFLIGQNKLRLSNHCCRLQEVILENSDITHLEDAVKRNRQRLAHQEVMLKQLEEICSRTQEKQLFQEERNNSIMAEVASLEDLFYTQCSGEEDHDENTASTEGNYTQEGSFDDMPPLEGEEDEDITDQPQPLSLQENQGNQSSTIQEDQEGNSSQGGSVSGPHFMSSSGSNNSQGGASGGTSTLIPGYNVHSQMSSLQGLQCVLLSAVEQVAENLKVLILKAINVSKENKFNVASFNYRTSKKNTSSQKHFSANVPANKQGVDSRIVSSLDKFHVFAVMDSYLMNLESKVRSGQLGIITNIFSDLSIGLAYAHNNSSSKEHIGAMFGSVIGSAKAKMNTNALSAIFIWNTNKTGFSGCISSYYGWGQMKNARQYLHTEEIISSKGSPDIMLGGGLIQLGYNCFISKSVMITPYIEYLFITTGWKEYNEITGTLPSHISSTKEQLISKNIGIRSRINLMGNSQLQTWVTGAFGQRKLGTITAQPLKSTNSIYKAMVQKAKNKYVQGEGGLSYEIIVTNNCKIGLSGDVQFEKNRPLKNGNVRCFFHLTY
>NC_020129.1|WP_011527302.1|12811_14692_-|asparagine-synthase-(glutamine-hydrolyzing)
MCGVCGIICLDGDKPSKEVLSHMLDAIRHRGPDKANVVVDGCIALGHCRLAILDLTDAAAQPMSTSDKLFTIVYNGEIYNFEEIRRELIKLGHTFISRSDTEVILHAYIQWGAQCVTKFNGMFVFVIYDVIRKQIFIARDRYGIKPLYYTIIQNNFLFSSEAKAFLRYPQFCTKLDYEALLEYFTFQNILTDKTLLHNVYIFPPGHYAILPLNTGQLTFSQYWDYCFDESKNIHSDKEYEEELTYLIQQAVQRQLQSDVELGTYLSGGMDSGSITALASKRFPYIKSFTCGFDLHSISGLELAFDERNAAEAMSYLFKTEHYEMVLKSGDMERVFPRLAWHIEEPRTGQSYPNFCIAHLVSKFVKVVLAGTGSDELFGGYPWRYYRALGEKGENSFEKYIDRYYLFWQRLIPNRYLLSMFKPIETHVRHVRTRDIFRNIFGDNNSPVTSHEESINRSLYFEAKTFLHGLLVVEDKLSMAHSLETRLPFLDNDLVDFAMRLPVRCKIHRLNETLRINENESAKASRYYKKTNDGKWLLRRAMERYVPTHIIEAVKQGFSAPDASWFRGESIDFVHRYLFSQNVRLYEYFDRKVVHELVTEHLEGNANRRLFIWSLLSFEEWLHQYLP
>NC_020129.1|WP_011527303.1|14707_15499_-|hypothetical-protein
MLTDCFGNPIQTQNAIAITFDTDWAPDWCIALCFELCLQFDITATFFVTNTSPILKKIASNDRFELGIHPNFLVNHNIKKDNTLFYQNILKSYLQIVPEAKSIRSHSLYRDSRLFVYIEEQVPSICNEVSTFLPGHIGLQPVPIRFSPHGRSLLHFSCIWEDDIAILEPQRWLTPLFNSALPGVYIFNFHPIHIALNSCSPEQYSNLRKFYNIPDVTPEDCNKFANKTLFGVKDYFERLIESVINSFPPFPSFRTINSISQNY
>NC_020129.1|WP_011527304.1|15492_16509_-|class-I-SAM-dependent-methyltransferase
MSLISLPEWFKKNTGCFLKNDILLSADRQKKYIMDDGVWKSTTNSNSNKQLQTSNIFSYKWNQEKTYTSPALLKKTQEWLKSRYDYIYIYLKAIQDHPIFLDAGCGAAFSTLELLGDCFHQLNYIGVDISDAITIARRRIQDAGYDGIFLQENLMDLPFKPESIDIIFSEGVLHHTDSTKEAITKLTPLLRNGGLFLFYVYAKKSPIREFSDDYLREQLHKLSPKQAWDALKPLTELGIQLGESNMELNLPNGIELLDVPAGKIKLQEFFYWYILKAFYAKELDFDAMQHINFDWYAPQNAHRQTPEQISQWCDELNLNILSMKTELSGITVVAKRQC
>NC_020129.1|WP_011527305.1|16521_17646_-|DegT/DnrJ/EryC1/StrS-family-aminotransferase
MFRIPLMKPYIPNSSKKNVLDVLNSGVLTEGIYTQRLEKAFTQYIGTSYAIGVTSCTTGLELVLRALHIGPGDEVIVPDYTYPATAFAPMLLGATAVIVDISPNTMLIDYNAIKQAITAKTKAIIPVSLFGNPLNWDELLCIKKEYPNINIIEDAACSLGSQFRNIKTGAWGDAAVFSMHPRKNITTGEGGMITTNNKELAESIQSIKHFGMDISKKLKGETIFIQLGTNYKLSNIQSAIGEGQIQLIDSILKQRATQVQLYKELLKSLPIEIPETTSHSTHAWQSFCIITPQRDQLLDHMRKAGIEIQIGTYALHLQPVFQQHPLCKIKGEMNGSQKAFTHCCTLPLFHTMTVAEQKEVISILAENLSSSNLM
>NC_020129.1|WP_011527306.1|17666_18566_-|radical-SAM-protein
MNLSSFPSRITLELTNYCNLSCKFCPRHHMEQEFGIMDVALAHELIKEMASYKPVTVVPFFRGESLMHPQWDIILQYLMEYNVGPIQLTTNATLLTHENTEKLLNVGLDFLSFSIDTIDPKCYQEIRGMDYNIILNNILYFLQRQEERQVPIVVQVSAVKTEKNASDIQNFIDFWLPKVDRVRIYEEHSKDGKIGSLKQPTKIARKACHKVFEDMVIYWNGDVALCNHDWTRRVTGQHIANVRNKGIAVCWNSPTYNSIRQAHENINLSGVMPCESCDHWVVSYLPENHIGQIFYKQPK
>NC_020129.1|WP_011527307.1|18627_19278_-|acetyltransferase
MDKTIIILGARGNSIDILDTIKDINIRNSNLSCVGFLDDSSMLQSTKVHNLPILGKLKDAIKFQHTFFVNSIGSPKNYTQKQNIIRSSGLKDHQFLSIISPYAYVARSAIIGHGSTALVGSVIAAETTIGNHVLILQNTIINHNTIIEDFVSLAAGVSIAGDCYIKQGAYIGTNACIRGGITIGEYALIGMGAVVTKDVKPGATVVGNPAKILHKI
>NC_020129.1|WP_011527308.1|19407_20637_+|hypothetical-protein
MFPSRKIFIGLEDIASIIENYTLGFNSLGFDVFSVVNSQASICASPCDIVLKDHLPPLRRRMTMRQKQEYIQKRINLIRKVFEKAIKECDIFLFIWSSFSPDYSDLPILKALGKKIIFVFVGSDCRWRTAYNQDMLQHGLDILPPGFNDGEQQLKEITLRLIMAEKYADALFNTPSQAGLALRPYYNYLQYPLNAKKYESNNPQNKIPVILHAPSDRFKKGSDMIEAIFLQLQKDGLQFTPRVVQGVPHNKAIEIYKEVDILAGQLGTVTGGKQERELMACRKVVVSGLKPEDYPQLLSPDCPNVRSHSLRDMYMALKMLIPNVSLREKIASCGPSYVRTYHDPSTACAKYLDAINGTTSPDFIPRFLRDTFVPEKKYLPVYNTRIKLVQDCPWYKEYIEPGTRLGLVF
>NC_020129.1|WP_011527309.1|20796_21627_+|class-I-SAM-dependent-methyltransferase
MLGFSPHTLPGHEDNAIWNNTKLGQLAQRKYSTTAWETDFLEQLLPSLITSHNLCIDIPFIDVGCGDGRITYLLHRVGFNKLVGIDLDEINVRNAASQTPSSSLNNIVFMTGDALSLPFKHNTLQQIFISGLPSLSNVFLNIYPFLTDSSMGGGGILLCLTATALEAALIYALTRGDWKEFIHIIETQTRAASWENKNIRYPITIVENVINEAKQAGFSLEAKYGIPIFASLVFGALCQQQTLNEDDKELLYNILYTIPSINLHFMRQSLLIFRKQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Identity
NC_020129_1	1.1\|6787\|52\|NC_020129\|CRISPRCasFinder	6787-6838	52	NC_008013	Lawsonia intracellularis PHE/MN1-00 plasmid 2, complete sequence	6747-6798	1.0
NC_020129_1	1.1\|6787\|52\|NC_020129\|CRISPRCasFinder	6787-6838	52	NC_020129	Lawsonia intracellularis N343 plasmid 2, complete sequence	6787-6838	1.0
NC_020129_1	1.2\|6865\|46\|NC_020129\|CRISPRCasFinder	6865-6910	46	NC_008013	Lawsonia intracellularis PHE/MN1-00 plasmid 2, complete sequence	6825-6870	1.0
NC_020129_1	1.2\|6865\|46\|NC_020129\|CRISPRCasFinder	6865-6910	46	NC_020129	Lawsonia intracellularis N343 plasmid 2, complete sequence	6865-6910	1.0

1. spacer 1.1|6787|52|NC_020129|CRISPRCasFinder matches to NC_008013 (Lawsonia intracellularis PHE/MN1-00 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

gccactattaatgattacagaggcattctcagttactccaagtccattgaag	CRISPR spacer
gccactattaatgattacagaggcattctcagttactccaagtccattgaag	Protospacer
****************************************************

2. spacer 1.1|6787|52|NC_020129|CRISPRCasFinder matches to NC_020129 (Lawsonia intracellularis N343 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

gccactattaatgattacagaggcattctcagttactccaagtccattgaag	CRISPR spacer
gccactattaatgattacagaggcattctcagttactccaagtccattgaag	Protospacer
****************************************************

3. spacer 1.2|6865|46|NC_020129|CRISPRCasFinder matches to NC_008013 (Lawsonia intracellularis PHE/MN1-00 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

actatcagtaacagttgctgtagttgatattgtatgaccttcgaca	CRISPR spacer
actatcagtaacagttgctgtagttgatattgtatgaccttcgaca	Protospacer
**********************************************

4. spacer 1.2|6865|46|NC_020129|CRISPRCasFinder matches to NC_020129 (Lawsonia intracellularis N343 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

actatcagtaacagttgctgtagttgatattgtatgaccttcgaca	CRISPR spacer
actatcagtaacagttgctgtagttgatattgtatgaccttcgaca	Protospacer
**********************************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NC_020127

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_020127_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_020127_1

93372-93470

Orphan

Consensus_repeat	Method
CCAGATTCAGATCCAATTTATGAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_020127_1

>merge|NC_020127|1|93372-93470|CRISPRCasFinder
CCAGATTCAGATCCAATTTATGATGTGCCTCATGGAGTGGGGAGTACATCACCTTCTTTACTTCCACATGGTAAACCAGATACAGATCCAATTTATGAT

>NC_020127|1|1|93372-93470|CRISPRCasFinder
CCAGATTCAGATCCAATTTATGAT	GTGCCTCATGGAGTGGGGAGTACATCACCTTCTTTACTTCCACATGGTAAA
CCAGATACAGATCCAATTTATGAT

Protein	Signature genes	Signature genes Name	Protein_function
NC_020127.1\|WP_041817027.1\|92567_92771_+\|hypothetical-protein	unknown	unknown	unknown
NC_020127.1\|WP_011526154.1\|94276_94825_+\|hypothetical-protein	unknown	unknown	unknown
NC_020127.1\|WP_011526151.1\|90794_91403_+\|YihA-family-ribosome-biogenesis-GTP-binding-protein	unknown	unknown	gnl\|CDD\|234770
NC_020127.1\|WP_041817026.1\|91759_92047_+\|hypothetical-protein	unknown	unknown	unknown
NC_020127.1\|WP_015353666.1\|84532_85213_+\|hypothetical-protein	unknown	unknown	unknown
NC_020127.1\|WP_011526159.1\|99005_100055_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226359
NC_020127.1\|WP_011526157.1\|97530_97953_-\|rhodanese-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|238089
NC_020127.1\|WP_011526155.1\|94912_95371_+\|hypothetical-protein	unknown	unknown	unknown
NC_020127.1\|WP_011526149.1\|87166_89854_-\|DNA-translocase-FtsK	unknown	unknown	gnl\|CDD\|224588
NC_020127.1\|WP_011526145.1\|83389_84082_-\|nicotinate-(nicotinamide)-nucleotide-adenylyltransferase	unknown	unknown	gnl\|CDD\|185680
NC_020127.1\|WP_011526156.1\|95588_96065_+\|hypothetical-protein	unknown	unknown	unknown
NC_020127.1\|WP_011526158.1\|98184_98988_+\|phosphodiesterase	unknown	unknown	gnl\|CDD\|277347
NC_020127.1\|WP_011526148.1\|86413_87163_-\|outer-membrane-lipoprotein-chaperone-LolA	unknown	unknown	gnl\|CDD\|367558
NC_020127.1\|WP_011526150.1\|89930_90488_-\|elongation-factor-P	unknown	unknown	gnl\|CDD\|234788
NC_020127.1\|WP_011526147.1\|85837_86236_+\|MucR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|368446
NC_020127.1\|WP_011526153.1\|93722_94148_+\|hypothetical-protein	unknown	unknown	unknown
NC_020127.1\|WP_155800192.1\|96206_96377_+\|hypothetical-protein	unknown	unknown	unknown
NC_020127.1\|WP_011526160.1\|100187_101483_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270451
NC_020127.1\|WP_011526161.1\|101545_102433_+\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224096
NC_020127.1\|WP_011526144.1\|82553_82874_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_020127.1\|WP_011526149.1\|87166_89854_-\|DNA-translocase-FtsK	gnl\|CDD\|224588	COG1674, FtsK, DNA segregation ATPase FtsK/SpoIIIE and related proteins [Cell division and chromosome partitioning].	1.23158e-163
NC_020127.1\|WP_011526151.1\|90794_91403_+\|YihA-family-ribosome-biogenesis-GTP-binding-protein	gnl\|CDD\|234770	PRK00454, engB, GTP-binding protein YsxC; Reviewed.	6.97495e-84
NC_020127.1\|WP_011526160.1\|100187_101483_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270451	cd14748, PBP2_UgpB, The periplasmic-binding component of ABC transport system specific for sn-glycerol-3-phosphate; possesses type 2 periplasmic binding fold. This group includes the periplasmic component of an ABC transport system specific for sn-glycerol-3-phosphate (G3P) and closely related proteins from archaea and bacteria. Under phophate starvation conditions, Escherichia coli can utilize G3P as phosphate source when exclusively imported by an ATP-binding cassette (ABC) transporter composed of the periplasmic binding protein, UgpB, the transmembrane subunits, UgpA and UgpE, and a homodimer of the nucleotide binding subunit, UgpC. Members of this group belong to the type 2 periplasmic-binding fold superfamily. PBP2 proteins are comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.69101e-118
NC_020127.1\|WP_011526148.1\|86413_87163_-\|outer-membrane-lipoprotein-chaperone-LolA	gnl\|CDD\|367558	pfam03548, LolA, Outer membrane lipoprotein carrier protein LolA.	3.37983e-30
NC_020127.1\|WP_011526150.1\|89930_90488_-\|elongation-factor-P	gnl\|CDD\|234788	PRK00529, PRK00529, elongation factor P; Validated.	3.92656e-102
NC_020127.1\|WP_011526147.1\|85837_86236_+\|MucR-family-transcriptional-regulator	gnl\|CDD\|368446	pfam05443, ROS_MUCR, ROS/MUCR transcriptional regulator protein. This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti. This gene encodes a 15.5-kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid and is necessary for succinoglycan production. Sinorhizobium meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of alfalfa nodules. MucR from Sinorhizobium meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan.	3.76005e-48
NC_020127.1\|WP_011526159.1\|99005_100055_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226359	COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism].	2.24934e-149
NC_020127.1\|WP_011526161.1\|101545_102433_+\|sugar-ABC-transporter-permease	gnl\|CDD\|224096	COG1175, UgpA, ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism].	2.73729e-69
NC_020127.1\|WP_011526157.1\|97530_97953_-\|rhodanese-like-domain-containing-protein	gnl\|CDD\|238089	cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein. The cysteine containing enzymatically active version of the domain is also found in the Cdc25 class of protein phosphatases and a variety of proteins such as sulfide dehydrogenases and certain stress proteins such as senesence specific protein 1 in plants, PspE and GlpE in bacteria and cyanide and arsenate resistance proteins. Inactive versions (no active site cysteine) are also seen in dual specificity phosphatases, ubiquitin hydrolases from yeast and in sulfuryltransferases, where they are believed to play a regulatory role in multidomain proteins.	3.22272e-10
NC_020127.1\|WP_011526158.1\|98184_98988_+\|phosphodiesterase	gnl\|CDD\|277347	cd07402, MPP_GpdQ, Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain. GpdQ (glycerophosphodiesterase Q, also known as Rv0805 in Mycobacterium tuberculosis) is a binuclear metallophosphoesterase from Enterobacter aerogenes that catalyzes the hydrolysis of mono-, di-, and triester substrates, including some organophosphate pesticides and products of the degradation of nerve agents. The GpdQ homolog, Rv0805, has 2',3'-cyclic nucleotide phosphodiesterase activity. GpdQ and Rv0805 belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	4.51933e-72
NC_020127.1\|WP_011526145.1\|83389_84082_-\|nicotinate-(nicotinamide)-nucleotide-adenylyltransferase	gnl\|CDD\|185680	cd02165, NMNAT, Nicotinamide/nicotinate mononucleotide adenylyltransferase. Nicotinamide/nicotinate mononucleotide (NMN/ NaMN)adenylyltransferase (NMNAT). NMNAT represents the primary bacterial and eukaryotic adenylyltransferases for nicotinamide-nucleotide and for the deamido form, nicotinate nucleotide. It is an indispensable enzyme in the biosynthesis of NAD(+) and NADP(+). Nicotinamide-nucleotide adenylyltransferase synthesizes NAD via the salvage pathway, while nicotinate-nucleotide adenylyltransferase synthesizes the immediate precursor of NAD via the de novo pathway. Human NMNAT displays unique dual substrate specificity toward both NMN and NaMN, and can participate in both de novo and salvage pathways of NAD synthesis.	2.63892e-39

>NC_020127.1|WP_041817027.1|92567_92771_+|hypothetical-protein
MKFFYQLDKVTLNDFQVIEPTNDTRIFKDSEYKDKYEQCTKMTIVMDNVTLKVVTLGVSELILENIQ
>NC_020127.1|WP_041817026.1|91759_92047_+|hypothetical-protein
MNEFIQRNGFYGNSILENYSLQTETQADTHSNIASCALFWKKFKTTCQSTYNIVSFFLYETFIPSIYQSNKYIACYCAIQSSSIPMLQKDKQCRF
>NC_020127.1|WP_011526151.1|90794_91403_+|YihA-family-ribosome-biogenesis-GTP-binding-protein
MMTQYKLQLEATNFTKQQLQQQLDILEQNNILQIALAGRSNVGKSSLINALAGRKQLAKTSGTPGKTRSINFYAVYPNTFMLVDLPGYGYAQCSKIERQHWAMLIEYYLKNCSKLKAFVLLIDCRIPPQKLDYELAEFATSYCIPLIPVLTKIDKCKLVEQNKRQKEWRALLNNTQPLLVSSKNMKGVQQLWERIQYTIDSY
>NC_020127.1|WP_011526150.1|89930_90488_-|elongation-factor-P
MYSTTDFRKGLKIEIDGVPYDIIDFQHFKPGKGGAMVRTKLRNILNGRVIDNTFRSGEKVERPNLESRDMQFLYHEGSELIFMDLTNYEQLHMSEDVTNGKSEFLKDGQQCRVLLYNEKPIDIDIPLTLILEVIETETAIKGDTVSNVTKPAKLETGVVIQVPIFINIGERIKVDTRTKEYIGRE
>NC_020127.1|WP_011526149.1|87166_89854_-|DNA-translocase-FtsK
MIYSGKENKSTRNLSLQQSRPNNETPPEDNNQKLARELFGLFLIFWGLLVLLSLLSHDQRDPSLNHVVSNFSKAHNQAGIFGAYISGLLVDIFGFSAIVWPAIFIAWGAGCITTWLTIPWWRWLGFFILSFCLISFGAAWNFGIGDVRGGGIIGMTIYKQSSIIFGTIGSTLIWLFLFFISLEFAFGIAWLNILHRLQNIIKNKIEKYDISLKTICSICLNYNWLCFIQNYFPFKKQEEYIDIIPLYEIHNPTLQPAYPYDSSLLHNTLAHQYTGIATLSSYRSERIQYSHTSNNQLWNIPHSLQETLKKSHKKSIISTTYNEFTSPDITPLTLEDDTFEDTHIDIDKLENLDTIDITTHPLITSPTTNKYEEQIQHTSSNNLPKLLESFSETSSIPTSTALRQTTNLVKHKLPLPSLSLLHSSTENDILPSQLTLKEKSKKVMDCLSDFNIQGELVRVTPGPVITLFEIRPAPGVRVSRIANLSDDLARSLMAEAVRIQAPVPGSDTVGIEIPNENRSLVSFKTLIQSKAFKNSSSPLSMALGKDIEGKSTVKDLATMPHILVAGTTGAGKSVCLNTILLSFLYNATPTDLKLILIDPKRVELAMYTQLPHLIHPVVTEPALAKVALEWAVYEMDRRYNCLARLGVKHFNEFNKKLLSIGNNKPEEFADLTYLPYLVVIIDELADLMMTAGKEVEGSIVRLAQLARAAGIHLIVATQRPSVDVVTGLIKANFPSRIAFQVANKYDSRTILDATGAEQLLGKGDMLFKPNGGKIQRLHGAFVTDEEVTAVTEYWRKQQAPVYEVDFSNWNNPLNINNTTTSNTNTKTPFSSSDEESLYAEAITFVQEQGRMSISLLQRRFRIGFNKAARFVERMEEEGILPPTIRGNRSRTIRSN
>NC_020127.1|WP_011526148.1|86413_87163_-|outer-membrane-lipoprotein-chaperone-LolA
MKNIINTIIFPKQRNKKMSQKFSMLQLILFFLTFIFYSYITDSYAESIPIVKELQQSYQSIKNFSATFTQELTHQESGSKETRIGKLFFKKPLLVRWETNTPHEELLLINTNAVWDYLPDENLVYKYSTDIVKDSTSIIQVITGQVRLDKNFSIIENNNNNNNELIFLKLYPKEPTTQMVEAFLWINKKSLLIHKVQSIDFYGNTNTITFINITPNTHIDNNIFQFTPPKDVTIENLQDSSTPERPLFN
>NC_020127.1|WP_011526147.1|85837_86236_+|MucR-family-transcriptional-regulator
MDDFLKEALDIVKAQASVRVMAEDEIISMVRRLSSGIKVVSEGDCIQEEQAPTELQMDPRKSVKEKSITCLECGRTFKILTRKHLRSHGLDANEYREKWGLKKDTPLVCKSLQRERRNKMKDMKLWEKRRKS
>NC_020127.1|WP_015353666.1|84532_85213_+|hypothetical-protein
MIIPFRHKEQNSSLEQIADPQVEYIENSSPLLSFIIRHSKTIIAFFLILLSIVIIAGVWSWYSSREEIKAQAALGQILINSVSTEQFDTLIKFEKTAPTALQKGIILQLAFWAVQLEQYQKAAEEYGILYNKDPKGAIGILSGLNQADLLQRTGNWKEALNVLLSLEEVASNPILTGIYESQAICAEHIGEKNIAISAYKKLIDELNITGVDATYYENKLTILSNS
>NC_020127.1|WP_011526145.1|83389_84082_-|nicotinate-(nicotinamide)-nucleotide-adenylyltransferase
MKLSIMNQKLIGILGGTFNPVHSAHINIALAAIKYMHLEQIQFIPCMVPPHKTTKNVIPFQLRVDLLQAAIQGNPLLSINTIESILPQPSYTWNMLNYWKKLHTLHQPLFILSDEDFAMLDTWYNGLELPSITNFLIIPRSTNKKQSFSSTLKRFWNCTTIIQDRHNKMVSYASIFKNLYCFFLNTPIMDIRSSNIRSAWKGGVYLNHTMPTPVTKMLEYHQNILKKLWK
>NC_020127.1|WP_011526144.1|82553_82874_-|hypothetical-protein
MKIDNAPSVQSMLLGRSQKNTNSSTFSSQLKEQVDTSTNNITIQQTTPNIKGNISLPDVNIISREATPFLSKEEVDFFEKMMQKNINLQGGYKTYSTQQSSINIKT
>NC_020127.1|WP_011526153.1|93722_94148_+|hypothetical-protein
MKIYNEPTWYDGIKKENELIEKEKPLEDISSYWEFCNIELGIVARVIVGIFTLGLSEAVFKCMRMYKAKKSEIYGPPIVKGVSWYENGKKKRVWDDNQSHSEEAQSQPQRNRSRRNRQLGSRAPNRYGLMYRNGMPTRFWV
>NC_020127.1|WP_011526154.1|94276_94825_+|hypothetical-protein
MMRVDAGQRINQALMADTTQATSTNETSEAQNTEKTEGSKGSSKLCGMNCKKGLKLAGRIALAVLTLGISEGVRKGIEAYQARQVKSEGARMGKLWETGKPSFPEKSGIHNPSATDDNDKNLWTSSSQKNSGGVNSFGKESPSPSSGSSGSHFVFHDSPQKPSSGITAETTLKTNSGGATGE
>NC_020127.1|WP_011526155.1|94912_95371_+|hypothetical-protein
MPITITLNAPRPQDFEDNTSVNRDNRTENTRQTQETSSKSATSSSASSFLHGLCSNCRQLGGAMARVGSSVLASATLTVRNLGVRAVNSYAATQVRSGISRLADLISLRDSQSGPRGPEITVSYNKDQDKVTFHDPYNRGGFSSSGSSGVSG
>NC_020127.1|WP_011526156.1|95588_96065_+|hypothetical-protein
MPPIDPAIAAKISAAMNQGLYDYANRNSNDSSSASSTSSASSTSSLSSSSPLYTANCKQGLKMAARVGLAVISLGFSELIMKGISLYKSRQATQNPQPRVVNVFESQPPLEISRRSSTDSTSSSGSVSSRTQLIFEQSSHMPTSGITAEMSLTRGSND
>NC_020127.1|WP_155800192.1|96206_96377_+|hypothetical-protein
MEKNNILSEQKLIVTIHPKSVFHICGRAILTILTFGISEYLLSAISSSKVVQSDLN
>NC_020127.1|WP_011526157.1|97530_97953_-|rhodanese-like-domain-containing-protein
MEITMSYITILIPALLIVLIWLILQSKTLANIHDHLAITDNDELEILLTKVSAVTLIDVRSSQEFNVGHLTGAINIPLKFLKKSIDTLETTKPIILIGNNSKKLQKVAILLQKRRPDLTLQYIKGTLVHTLDNNIIIKWD
>NC_020127.1|WP_011526158.1|98184_98988_+|phosphodiesterase
MQSIIKFIHISDTHISAQGCLVYDNNPRVKLQTCIDEIKRDHLDAAFLILTGDVTNDGSMECFSFLQEVLSELPMPWYLVMGNHDLKQSLFTAIPEYPRDPNGFVQFTVDTPVGLCIILDTTIANQSSGILCAARLDWLANELKQATKPVLLFFHHPPFSLGIPSMDAIVHSLKNSEEFFAVLKPYKDKIRHMFVGHIHRPICGSWNGIPFSCAPSTAHQIALNFQSDKSVLGFKEPSGYSIVLVNNDQLIVHFQECNKTPNIIIKA
>NC_020127.1|WP_011526159.1|99005_100055_+|ABC-transporter-ATP-binding-protein
MSAICLNNVCKYWDTSKAVDDINFKVESGNLLVLLGPSGCGKTTTLRLIAGLEKVTSGQIIIDDCDVTYLPPSKRHLSMVFQSYALFPHLTVQENILFGLKVRKVPKQEQKKRLDNAVAMLNLYGLLGRKPSMLSGGQQQRVALGRALVANASVCLMDEPLSNLDAQLRNDMRKEIREIQQALKMTMVYVTHDQVEAMSIADQVILMNKGVIVQHAVPEDMYIKPQTIFAASFIGTPPMNIINLSQKDGKLIISGSQDIFIPQVPEGATVIGVRPEHLQISSVGWPSIVLSNEYHGAVSLVTCKVGSEKIIFIQHGNVTCSPGEIVYLSCSPEHMHFFNGDTGNRITRH
>NC_020127.1|WP_011526160.1|100187_101483_+|ABC-transporter-substrate-binding-protein
MVRQFIHKIYYIGFVLSFIIVVPTFAIALDKVHLTFCFPVAVSGPITKIIEDMTAEFMRTYPDIVIKPIYTGTYKDTITKVLTAMHGGEPPHVAVLLACDIYSLIDENAIIAYEDLPGGAELSHDYFPVFMKNSQAQGKTWGIPFQRSTIVMFWNKEAFTKAGLNPTAPPQTWQELIDISKKLVNRDSSGKVTQWGISIPTTGYAYWMFQALCIQNGLELANSEGTKVYFNDPRAVEALQFLVDLSYKYGVMEKGTIEWSTIPRDFLEGKTAMMWTTTGNLTNIQENTTFDYGVSMLPKHIRLGSPTGGGNFYILKKTTEAERDAALKFVKWMTDKERAAQWSIDTGYVLVRPDACQTENMKRYIKEFPYLDVALEQLKYGVAELSTHANQRVTKVLEDAIQSAVTGTKTPSLALEEAQKDAERILLRYSN
>NC_020127.1|WP_011526161.1|101545_102433_+|sugar-ABC-transporter-permease
MILLRHYIISQVNAWLLLLPAFIIIFVFSLLPITSTIINSFFMNGDGGAVSKFVGIDNYLYLLEDKVFRKALWNNFIFVMSVIPCSMILALIMALWVNTKLAGRSLLRLAYFVPTILPMIAVANIWLFFFTPQYGLIEQIRSFFGLSGINWLGSESTALFCVIVVGIWKDAGFFMIFYLAALQHIPPSLGEAAILEGASRFYYLRRIVVPLLMPTTLFILINATINAFRMIDHLFILTKGGPNNASMLLLYYIYEVSFQFWDTGYGSVLTVTLLIILGFIALFQFGILERKVHYQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_020127_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_020127_2

698545-698685

Orphan

Consensus_repeat	Method
TGCACCCTGTATTTTATTAAGAGTTTCACTAGCTACGTCTTGTTGTTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_020127_2

>merge|NC_020127|2|698545-698685|CRISPRCasFinder
TGCACCCTGTATTTTATTAAGAGTTTCACTAGCTACGTCTTGTTGTTGAGTATTAGCTATTCCATTTTTTGTAACTGTATCCTGAGTTTGTTCTGCACCCTGTATTTTATTAAGAGTTTCACTAGCTACGTCTTGTTGTTG

>NC_020127|2|2|698545-698685|CRISPRCasFinder
TGCACCCTGTATTTTATTAAGAGTTTCACTAGCTACGTCTTGTTGTTG	AGTATTAGCTATTCCATTTTTTGTAACTGTATCCTGAGTTTGTTC
TGCACCCTGTATTTTATTAAGAGTTTCACTAGCTACGTCTTGTTGTTG

Protein	Signature genes	Signature genes Name	Protein_function
NC_020127.1\|WP_011526643.1\|689296_689689_+\|30S-ribosomal-protein-S9	unknown	unknown	gnl\|CDD\|178888
NC_020127.1\|WP_011526649.1\|694774_696847_-\|flagellar-hook-basal-body-complex-protein	unknown	unknown	gnl\|CDD\|235557
NC_020127.1\|WP_011526650.1\|696930_697770_-\|flagellar-hook-assembly-protein-FlgD	unknown	unknown	gnl\|CDD\|224756
NC_020127.1\|WP_011526659.1\|707510_708923_-\|23S-rRNA-(uracil(1939)-C(5))-methyltransferase-RlmD	unknown	unknown	gnl\|CDD\|225174
NC_020127.1\|WP_011526660.1\|708958_709837_-\|glucose-1-phosphate-thymidylyltransferase-RfbA	unknown	unknown	gnl\|CDD\|130274
NC_020127.1\|WP_015353754.1\|705478_705727_-\|30S-ribosomal-protein-S16	unknown	unknown	gnl\|CDD\|234588
NC_020127.1\|WP_011526646.1\|693084_693444_-\|hypothetical-protein	unknown	unknown	unknown
NC_020127.1\|WP_011526647.1\|693560_694052_+\|phosphatidylglycerophosphatase-A	unknown	unknown	gnl\|CDD\|368021
NC_020127.1\|WP_011526653.1\|701957_702842_+\|flagellin	unknown	unknown	gnl\|CDD\|139237
NC_020127.1\|WP_011526644.1\|689867_691523_+\|ribonuclease-J	unknown	unknown	gnl\|CDD\|223668
NC_020127.1\|WP_011526655.1\|703880_704216_+\|hypothetical-protein	unknown	unknown	unknown
NC_020127.1\|WP_011526642.1\|688843_689278_+\|50S-ribosomal-protein-L13	unknown	unknown	gnl\|CDD\|181703
NC_020127.1\|WP_011526658.1\|705859_707374_-\|signal-recognition-particle-protein	unknown	unknown	gnl\|CDD\|236780
NC_020127.1\|WP_011526645.1\|691764_692793_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227603
NC_020127.1\|WP_011526656.1\|704638_705160_-\|16S-rRNA-processing-protein-RimM	unknown	unknown	gnl\|CDD\|234650
NC_020127.1\|WP_011526654.1\|703045_703747_-\|ribonuclease-III	unknown	unknown	gnl\|CDD\|234633
NC_020127.1\|WP_011526641.1\|687406_688678_-\|HD-domain-containing-protein	unknown	unknown	gnl\|CDD\|372434
NC_020127.1\|WP_011526652.1\|699819_701229_-\|ADP-heptose--LPS-heptosyltransferase	unknown	unknown	gnl\|CDD\|340821
NC_020127.1\|WP_011526648.1\|694165_694642_+\|hypothetical-protein	unknown	unknown	unknown
NC_020127.1\|WP_011526657.1\|705169_705403_-\|KH-domain-containing-protein	unknown	unknown	gnl\|CDD\|224750

Protein	Function_ID	Function_description	E-value
NC_020127.1\|WP_011526643.1\|689296_689689_+\|30S-ribosomal-protein-S9	gnl\|CDD\|178888	PRK00132, rpsI, 30S ribosomal protein S9; Reviewed.	1.53912e-79
NC_020127.1\|WP_011526649.1\|694774_696847_-\|flagellar-hook-basal-body-complex-protein	gnl\|CDD\|235557	PRK05682, flgE, flagellar hook protein FlgE; Validated.	1.24416e-47
NC_020127.1\|WP_011526650.1\|696930_697770_-\|flagellar-hook-assembly-protein-FlgD	gnl\|CDD\|224756	COG1843, FlgD, Flagellar hook capping protein [Cell motility and secretion].	1.25392e-42
NC_020127.1\|WP_011526659.1\|707510_708923_-\|23S-rRNA-(uracil(1939)-C(5))-methyltransferase-RlmD	gnl\|CDD\|225174	COG2265, TrmA, SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis].	1.04885e-118
NC_020127.1\|WP_011526660.1\|708958_709837_-\|glucose-1-phosphate-thymidylyltransferase-RfbA	gnl\|CDD\|130274	TIGR01207, Glucose-1-phosphate_thymidylyltransferase_1, glucose-1-phosphate thymidylyltransferase, short form. Alternate name: dTDP-D-glucose synthase homotetramer This model describes a tightly conserved but broadly distributed subfamily (here designated as short form) of known and putative bacterial glucose-1-phosphate thymidylyltransferases. It is well characterized in several species as the first of four enzymes involved in the biosynthesis of dTDP-L-rhamnose, a cell wall constituent and a feedback inhibitor of the enzyme. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	9.15797e-159
NC_020127.1\|WP_015353754.1\|705478_705727_-\|30S-ribosomal-protein-S16	gnl\|CDD\|234588	PRK00040, rpsP, 30S ribosomal protein S16; Reviewed.	2.28411e-37
NC_020127.1\|WP_011526652.1\|699819_701229_-\|ADP-heptose--LPS-heptosyltransferase	gnl\|CDD\|340821	cd03789, GT9_LPS_heptosyltransferase, lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.	1.67542e-33
NC_020127.1\|WP_011526647.1\|693560_694052_+\|phosphatidylglycerophosphatase-A	gnl\|CDD\|368021	pfam04608, PgpA, Phosphatidylglycerophosphatase A. This family represents a family of bacterial phosphatidylglycerophosphatases (EC:3.1.3.27), known as PgpA. It appears that bacteria possess several phosphatidylglycerophosphatases, and thus, PgpA is not essential in Escherichia coli.	1.82454e-34
NC_020127.1\|WP_011526644.1\|689867_691523_+\|ribonuclease-J	gnl\|CDD\|223668	COG0595, COG0595, mRNA degradation ribonucleases J1/J2 (metallo-beta-lactamase superfamily) [Translation, ribosomal structure and biogenesis; Replication, recombination and repair].	0
NC_020127.1\|WP_011526642.1\|688843_689278_+\|50S-ribosomal-protein-L13	gnl\|CDD\|181703	PRK09216, rplM, 50S ribosomal protein L13; Reviewed.	7.42281e-92
NC_020127.1\|WP_011526658.1\|705859_707374_-\|signal-recognition-particle-protein	gnl\|CDD\|236780	PRK10867, PRK10867, signal recognition particle protein; Provisional.	0
NC_020127.1\|WP_011526645.1\|691764_692793_+\|hypothetical-protein	gnl\|CDD\|227603	COG5278, COG5278, Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms].	0.00145913
NC_020127.1\|WP_011526656.1\|704638_705160_-\|16S-rRNA-processing-protein-RimM	gnl\|CDD\|234650	PRK00122, rimM, 16S rRNA-processing protein RimM; Provisional.	1.35138e-46
NC_020127.1\|WP_011526654.1\|703045_703747_-\|ribonuclease-III	gnl\|CDD\|234633	PRK00102, rnc, ribonuclease III; Reviewed.	9.43384e-109
NC_020127.1\|WP_011526641.1\|687406_688678_-\|HD-domain-containing-protein	gnl\|CDD\|372434	pfam13023, HD_3, HD domain. HD domains are metal dependent phosphohydrolases.	1.07409e-30
NC_020127.1\|WP_011526653.1\|701957_702842_+\|flagellin	gnl\|CDD\|139237	PRK12802, PRK12802, flagellin; Provisional.	2.51796e-52
NC_020127.1\|WP_011526657.1\|705169_705403_-\|KH-domain-containing-protein	gnl\|CDD\|224750	COG1837, COG1837, Predicted RNA-binding protein (contains KH domain) [General function prediction only].	6.35315e-27

>NC_020127.1|WP_011526650.1|696930_697770_-|flagellar-hook-assembly-protein-FlgD
MPTNGASGVSSATGIFSQQAGKSELGKEDFLKLLVTQFKYQDPLNPMEDKEFIAQLAQFSALEQQMSTNEKMESLLNLQTQQQMISAASFIGKEVAARGYGVSVKGDTISNIQYAINEEMVKGYVNIFDASNQLITTVQLDSKAPGIHDFDWDGLLPNGSKVSDGVYTVNIAGQNSAGAPVLVDTSVSGKVEAVTMYQGDQLLRLSDGRLVALSNVREVVQPKTVEPGDDTDSGDSEDGESGGGDNSDPGETNGTEGSEGSGMQDLYQLLPTIKEKLSR
>NC_020127.1|WP_011526649.1|694774_696847_-|flagellar-hook-basal-body-complex-protein
MSLTAGMWTGVSGLLSHGEKMNVIGNNIANVNTVGFKGQRMDFADFIYQDGFSTAGITQIGRGVGIGAVMGNFGQGSFETTTEATDLAIGGRGFFKVKPQGSETSYYTRAGNFRFNNDGYLVDPHGYALQGWKIDNTEGPQRISGGVNPGTNTSQIMGTGEPTDIRLDTWTVAPLQTTNVSFNVNLSSDKSGDKSQNVNSPFTSLFNIWNGKQPSEPNNPPMPESAYSYQTSIKVYDEAGGTHTLTVYFDQVSPKDYKGGGSGESVWEYVVTMDPSEDNRQVSVGGNIVDIKDTKAAGMLMSGTLSFDSSGKLANQSAYSLNGSRKPAVDPATGALINGNGFTIDRDGNAIPILNIDNPAENFYPAEVSNNGFPMIVANFTGVPGKNTAGSVGDATTFFTEIDFGLKATDLDNTWKNANEPLSSLSYKKTHNPMDVAGGWTVGGYKTPAPSVTELGMAQILENPAGVMPQYYFGNPNYDNTVPQSPPYVYKNEASYQAAYKTALTAAGGTAADIKKEHWPHNAASGILEANDPPNVKDLANMNGTPNRLSNAFTNYAGGSSTKSASQNGYGFGDLMNYSVNAEGVLFGVYSNGVQLPLYQVALYDFNSKQGLRREGGNLFSQTRESGDPSSGAANTSGFGSINANTLEGSNVDISTEFVSMIATQRGFQSNSKIVTTIDQMLETVVNMKR
>NC_020127.1|WP_011526648.1|694165_694642_+|hypothetical-protein
MALLRYYLTIGIIFITLLSSATATQPKTESPESILNKPEKSTKRNTTISIEFEGTDSIGSKLSTRIKELMNASNLFTLTEKDSPKIRILLATMSEFSQRPSIGSVYSVVWLFSQSETTLKHFLAKKIGVLTADEVDQVAAMIVEQTDTLAVRYGYLLP
>NC_020127.1|WP_011526647.1|693560_694052_+|phosphatidylglycerophosphatase-A
MGINELKRLCIISYARLGIAGLSPIMPGSCGSLIAAILAPWLFIPFSTFTRILILIFIFWTGSLVGTIIEQLLQKKDPKEVVIDELLGLWIVLLPFKNPGWIFIGLAFILFRIFDIIKIWPVNASENWLPGGYGIMIDDVFAGLQALLIISILYWTGYLNQWL
>NC_020127.1|WP_011526646.1|693084_693444_-|hypothetical-protein
MAYLPYEYFCYFVYDIELSYEEIMSKEERLTFFVQQILNSFDAIHLDFTPVGDGLQVQCSFEDMNDRKYNELCEALSNYTCDGINGKFLLISRDLNQLQGVVASDKTFQKYTFTIPPWN
>NC_020127.1|WP_011526645.1|691764_692793_+|hypothetical-protein
MSKNVHIDLKIGISFAISTGTFLILGLYILLSIQPIIDQFKITILETSDAISITTRLLITMKEASINFRSYTVRADQSFYDNFTKNIHLFNTALEHAQNLNDDSISLKILNKNLPQVIALKKEYKEVGQKVYDLTEMFKQNTPKLAFLLSAFINDIEEFLKTLEELVRNTGGKDAEAFKLIVDLNQLIETSLLARGDFWRGVSNANSNAFETCLKILKGSISHMEAIKEANSVKEFTAPFESLIFSMKNLENIFVTIINNYELAQENIQNQDAIVQSILTLLNEILEENMDKIGIESKSAVENLKLIRNIVLMLVAIGVIFTNTVGFIVAKKIGEKTYTPSK
>NC_020127.1|WP_011526644.1|689867_691523_+|ribonuclease-J
MKDEFLTITPLGGLEEIGLNCQLWETSKGVVLIDCGIMFPNEQHLGIDVIIPPIDPILHVKNRLLGVVLTHGHEDHIGAIPWLVCFIPGLKIYGSPFTLALVEHKLKERNLLSSAQLIAVTPKTKLNLGNLYFQFISVSHSIPQSYALAVTTPVGKIIHSGDFKIDPTPSDGIGTDLQSIKEFAGNDGIRLFLSDSTNADEQGHNLSEQYIKKNFYEIFSEAKGRIIVTLFASNIERIQTVCDLVKVFNKKLVVTGRSLINNIEKAKELGFLNIPYKFFTDQNVPDLSPEQTVIITTGSQGEPLSALVRIISGEHRYLSIHEGDTVIMSSRVLPNSTLAVNRLINRIYRLGATVCLNGQKAIHVSGHARQDELKILLTVVNPQYFVPIHGEYRQLFRHKELAMQHGIPSENIFILDDGEPLTLLPTKVRKEKKIPLKSILIDGKGIGDVDSSVLRDRQLLGGDGVVVVSLTRDKGTGSVMQGPSILSRGLIFEKKLNCLIEEAKQVVIEILQSDLTLTTQKLEKKICTSLHSFFRNVIGREPIIIPIITEN
>NC_020127.1|WP_011526643.1|689296_689689_+|30S-ribosomal-protein-S9
MSTEFNYATGRRKTAVARTRLYPGNGTIKINGRPLENYFPRKSLQMIIRQPLVHTKLLDKYDIKINVSGGGVSGQAEAVRHGISRALLEVNPELRSLLKPVGFLTRDARQKERKKYGLRAARAKYQYSKR
>NC_020127.1|WP_011526642.1|688843_689278_+|50S-ribosomal-protein-L13
MKTFSPKPEHISHQWFLVDAHNKILGRLAAQIAHRLRGKHKPEFAPHIDNGDYIVVVNCEQIKVTGNKQEQKKYYRHSGYVGGLKETTLKTLLEKKPAEVLIHAVRGMLPKNRLGRAMLKKLKVYAGPEHQHIAQQPIPLSLPY
>NC_020127.1|WP_011526641.1|687406_688678_-|HD-domain-containing-protein
MSSIRKSLLQIMFLGASMRRWNDKLRPIELYEVDKQGHKMIIAWMLTLLNSRHASESEKIALQQTVIERGLFDYLFGLIVTDITPQIFHRICEHHIHKRQLTDWVLNKLKPIVEPLSRDFWDRMVKYHYQTDRTELADKIIKAARLYASGWEFALIQPFNTFDEETKNISHFFISELFALKELTGVQDLIQGEAFFIENPTALGHFARLSGQLRFQIRWSDTPRVPETSVLGHMFLVAGYVYFCSLVIGCCPARCVNNFFAGLFHDLPELLTRDIITPVKRSVDQFSILLKEYELQELERRIFVPLRKSGYIDLVHRLQYYLGLLGEDVTSEFQETIQDSSGVKRIKNFEELQLFNNKDEFDPKDGQLLKACDSLAAFLEAHTSIYKGISSPVLHAAVARIHADFHNLTFGTLSFGTLLADFD
>NC_020127.1|WP_011526652.1|699819_701229_-|ADP-heptose--LPS-heptosyltransferase
MTQSPTLIIQLQRMGDLILSFHLCKRLLMLEPNHPLWVLAEPHFFKELITVAPQVVFFDHSMIPNLKLRNYRRVINLSHRDIAAQLTGVLTTEEKIGIFNQEDFLYIAGDWRLYRSSIVNNNRHNLFHWSDLEALGLIPEQSFKEVIWPPLRNIGSSGHIGLFVGASEAGKRPNAQFWGLLARYLIRHNLYPIFLGGPNDRSLAQECIDIAQLNSSNNFAGKFNLSELVLFSQKLDLFVTPDTGPMHLAAWTGTPVLNLSMGNVNPWETAPASPGHIVVRPAMSCVGCWNCEGRDFSCRSLFTPGKIGRLIVHLIENSSLEKSIFSGLHIYKTSRDERGLFTLVPLLPNIEHQRHLLGLFWKEWFIAMLGGMSDKLIPVSKLFFENAPHMCNPMQKTLLSLSKNVAKVLKKGSDIVPSKYWFSVMPALRPATGYIDLLLQNNKFSNKAWKKTGTLLSSLIETFSFASQC
>NC_020127.1|WP_011526653.1|701957_702842_+|flagellin
MSLVINNNMMAANAARNLNESYSRLSQSTRRLSSGLRVGTAADDSAGLAIRELMRADIKTFQQGARNANDAISLVQVADGALGVIDEKLIRMKELAEQAATGTYNSTQRLIIESEYQAMASEITRISVATEFNGIKLLDGSLSGPHKGTNLQQTGALRVHFGPGNSSAEDYYEISIHSATASALGLGNGTTGPGATISTQAAAQAALDAINDAIVSKDNIRASLGTLQNRLEATITNLNTQAENLQAAESRISDIDVSTEMTEFVRNQILTQSGVAMLSQANSLPKMASQLISG
>NC_020127.1|WP_011526654.1|703045_703747_-|ribonuclease-III
MDLKELQEDLGYYFKDEQLLITALTHSSWVNENDVTAEHNERLEFLGDAVLEICISEELFKRHPEAREGELTRMRSNLVNTKMLVLLARELKLNQYLLLARGEENQGGRQRNTLLADTMEAVFGAVFVDGDLFYARKVISKSYDNFWPKKSAALVKDFKTRLQEETQRHIKGLPKYILEGMHGPEHEKIFEVCVELPDGQVFRASGTGLKRAEQEAARIALESLMHCQSVNDK
>NC_020127.1|WP_011526655.1|703880_704216_+|hypothetical-protein
MSYTIRMVKLFTGELVLGKFDPEKNILKDVALLQVIPTQQGAQMMMLPYGYPFEQEFSGTIEAKFFIYEYKKVPEDLETKYLEACTNLTLSTAGVTLTGATPSGNPTGLIK
>NC_020127.1|WP_011526656.1|704638_705160_-|16S-rRNA-processing-protein-RimM
MSEQLVAVGVLSRPHGIKGEIRLIRYTDSIDVFLGEVFLQKSNSLPKKAEIISSRIHQGVALVCFKGFSDRSAVEVLRGQTLLVSRSFLPEIESNESYLCDLLGFSVVLDNTDEVIGKLEYVSFPGGQELWSIITPEGKEVLLPAIPEFVLEVDTNAQLIRINPPKGLLELYK
>NC_020127.1|WP_011526657.1|705169_705403_-|KH-domain-containing-protein
MLKSFVEFVAKSLVDNPEEVQVCEVEGEQTSVLELRVAKEDLGKVIGRQGRTARAIRTLLGAASSKAQKRTMLEILE
>NC_020127.1|WP_015353754.1|705478_705727_-|30S-ribosomal-protein-S16
MSVKLRLTRMGNKKRPFYRIVAINSHTRRDGRPLDYLGYYNPQTNPSAIKVDVEKVEKWLSIGAQPSDTVRSIIKAYSKVNV
>NC_020127.1|WP_011526658.1|705859_707374_-|signal-recognition-particle-protein
MFESLSERLSSVLHAIGKRGQLTEDNIRDGLREVRLALLEADVNFNVVKKFIEHVKEKVVGQAIEKHLTPAQQFIKVFHEELVNLLGGKSTKLDVTHFPLSVIMLVGLQGSGKTTSTGKLASLLQSQGLRPYLVPVDIYRPAAIEQLQTLATQLNIPCFASNAAMKPLDIINAALHEAKEKEYTVVLLDTAGRLHIDEPLMQELTDIKLVAHPQEILFVADAMTGQDVVTVAEEFNKKLSLTGAILTKMDGDARGGAALSICSSTGVPVKYVGTGEKLSDFEVFHPDRIAGRILGMGDMLTLIEKAQSTFEDDELKAITEKIQKATFNFEDFFSQIRRMKQLGSLSSLMKLIPGFGSAVSKFRVAIPEDEFSYTEAIINSMTIKERRNPDLLNTSRRQRIARGAGVTLNKVNQTIQKFDQMKQMMQRVVSDNSLMKNAESGEGGFGLGSFFGEGGIGFSALPGIPGLFGRPVLRSTSIGGVNGSGKSATKKKKEKKKHKNKKRK
>NC_020127.1|WP_011526659.1|707510_708923_-|23S-rRNA-(uracil(1939)-C(5))-methyltransferase-RlmD
MNNNKKDMNYLQHQLVLDITSIVSDGRGLGRFENKVVFVPHTVPGQKVLVNITSVHSKFLEGEVKQIIKPSKYEREPICIHAIQCGGCTWQHIQYKHQIIWKKQIIQDALERIGKVNNPVILDVIPSPCEWRYRNKMVFAFAPSPCLSTVLLGLKRVDSHEVIPVTDCLLQSKNTMKIVEIVRHWVRHEQTSLEKKILTLKYFRFLIIRETITGDILVELIVNKKNTLIENKFDEQALGKRLAQCLKGVEAIKGIILSRRTQVSDIAYSEYIIWHEGERFLEEQVGDIVLSRGNDNFFQINTKATEILYSKILSMAQLTGKELVWDLYTGVGSIALFLAPFSLKVIGVESIAASINLANKNRLSLGYTNCSFIQDDAFSFIRSQIQKGITPDIVIVDPPRAGLDKKVIELLIRLAPRRCIYVSCNPGTFARDIAMLSPHFVIQQTQPVDLFPHTPHVETVSYLLYNNAFS
>NC_020127.1|WP_011526660.1|708958_709837_-|glucose-1-phosphate-thymidylyltransferase-RfbA
MKGIILAGGSGTRLYPITRGVCKQLIPIFDKPMVYYPLSILMQAGIREICFITTPHHQQDFINLFGDGSQLGLQLTYIKQSFPNGLAEAFILARNFIAGEPCCLVLGDNLFHGDKLYCMLEDCTGLEYGGKVFAYRVKDPERYGIVSFDENNKVLTIEEKPQNPKSHYAVTGLYFYDGDVSNKAASLKPSARGELEITDLNNIYLQDSGLSVEIFGRGVAWLDTGTFESMHQAAAFVQAVQERQGAKVGCIEEIAWRKGYIDDVQLKKLAEPMHKNEYGEYLFSLLEQNNER

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

185905 : 201646

Staphylococcus_phage(36.36%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011526231.1\|185905_188398_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	2.0e-185	44.4
WP_011526232.1\|188435_189116_-	RadC family protein	A0A1B2LRS6	Wolbachia_phage	7.6e-18	29.4
WP_011526233.1\|189210_190188_-	hypothetical protein	NA	NA	NA	NA
WP_011526234.1\|190208_190736_-	hypothetical protein	NA	NA	NA	NA
WP_011526235.1\|190746_193254_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	1.5e-199	44.2
WP_011526236.1\|193264_193750_-	transcription antitermination factor NusB	NA	NA	NA	NA
WP_011526237.1\|193759_194233_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	7.4e-28	41.6
WP_015353676.1\|194319_195552_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	2.8e-95	45.4
WP_011526239.1\|195572_196238_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	2.2e-25	33.5
WP_015353677.1\|196241_197378_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	9.7e-42	34.1
WP_015353678.1\|197361_197853_-	cytidine/deoxycytidylate deaminase family protein	A7KUY9	Bacillus_phage	5.3e-21	41.4
WP_011526241.1\|197925_199164_-	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	2.6e-93	51.7
WP_011526242.1\|199232_200483_-	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_015353679.1\|200560_200800_-	acyl carrier protein	M4QDG5	Prochlorococcus_phage	4.0e-06	50.0
WP_011526243.1\|200902_201646_-	3-oxoacyl-[acyl-carrier-protein] reductase	Q06VL0	Trichoplusia_ni_ascovirus	5.4e-17	30.5

DBSCAN-SWA_2

707510 : 714246

Erysipelothrix_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011526659.1\|707510_708923_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	8.3e-51	29.8
WP_011526660.1\|708958_709837_-	glucose-1-phosphate thymidylyltransferase RfbA	A0A291LA53	Escherichia_phage	3.3e-90	55.6
WP_011526661.1\|709984_710578_+	IMP cyclohydrolase	E3SNU8	Prochlorococcus_phage	1.7e-37	44.7
WP_011526662.1\|710793_711201_+	(deoxy)nucleoside triphosphate pyrophosphohydrolase	G8DF69	Emiliania_huxleyi_virus	4.4e-05	29.0
WP_011526663.1\|711301_712312_-	NAD-dependent epimerase	A0A2K9L4U8	Tupanvirus	6.0e-35	30.7
WP_011526664.1\|712324_713056_-	hypothetical protein	NA	NA	NA	NA
WP_011526665.1\|713037_714246_-	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	1.8e-30	29.2

DBSCAN-SWA_3

1029708 : 1037144

Mycoplasma_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011526912.1\|1029708_1030815_+	spermidine/putrescine ABC transporter ATP-binding protein PotA	Q6GZ03	Mycoplasma_phage	4.9e-30	39.5
WP_011526913.1\|1030801_1031686_+	ABC transporter permease subunit	Q6GZ02	Mycoplasma_phage	7.8e-15	25.2
WP_011526914.1\|1031685_1032462_+	spermidine/putrescine ABC transporter permease PotC	NA	NA	NA	NA
WP_015353789.1\|1032534_1033572_+	spermidine/putrescine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011526916.1\|1033747_1035016_-	DUF935 domain-containing protein	A0A0M3LRU4	Mannheimia_phage	9.0e-89	43.0
WP_011526917.1\|1035035_1035479_-	hypothetical protein	A0A0A1IWZ1	Pseudomonas_phage	1.1e-06	27.2
WP_011526918.1\|1035523_1036168_-	DUF3164 family protein	A0A2P9JZH0	Alteromonadaceae_phage	5.9e-44	42.4
WP_011526919.1\|1036403_1037144_+	helix-turn-helix transcriptional regulator	A0A0N7C1P9	Escherichia_phage	1.7e-15	34.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_020130

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_020129

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NC_020127

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection