CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_018649	Leptospirillum ferriphilum ML-04, complete sequence	2 crisprs	csa3,Cas9_archaeal,csx1,cas3,DEDDh	0	1	7	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_018649_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_018649_1

521147-521238

Orphan

Consensus_repeat	Method
AAGTCTTCCTCACGCCCGTGGGGGTGTTTCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_018649_1

>merge|NC_018649|1|521147-521238|CRISPRCasFinder
AAGTCTTCCTCACGCCCGTGGGGGTGTTTCGACTGTTTTGACGATTTCCATCAGTTGGTCAAAGTCTTCCTCACGCCCGTGGGGGTGTTTCG

>NC_018649|1|1|521147-521238|CRISPRCasFinder
AAGTCTTCCTCACGCCCGTGGGGGTGTTTCG	ACTGTTTTGACGATTTCCATCAGTTGGTCA
AAGTCTTCCTCACGCCCGTGGGGGTGTTTCG

Protein	Signature genes	Signature genes Name	Protein_function
NC_018649.1\|WP_014959795.1\|527149_528208_+\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|226077
NC_018649.1\|WP_101494908.1\|515213_515633_-\|CoA-binding-protein	unknown	unknown	gnl\|CDD\|224745
NC_018649.1\|WP_014960317.1\|512067_512997_+\|hypothetical-protein	unknown	unknown	unknown
NC_018649.1\|WP_014960326.1\|517786_518959_+\|aminotransferase-class-V-fold-PLP-dependent-enzyme	unknown	unknown	gnl\|CDD\|224029
NC_018649.1\|WP_014960318.1\|513005_513929_-\|NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224995
NC_018649.1\|WP_014959793.1\|528603_529821_+\|IS256-family-transposase	unknown	unknown	gnl\|CDD\|307151
NC_018649.1\|WP_014960330.1\|524710_524971_-\|hypothetical-protein	unknown	unknown	unknown
NC_018649.1\|WP_014960334.1\|526735_526924_+\|hypothetical-protein	unknown	unknown	unknown
NC_018649.1\|WP_014960327.1\|518997_519897_+\|complex-I-NDUFA9-subunit-family-protein	unknown	unknown	gnl\|CDD\|187579
NC_018649.1\|WP_014960336.1\|532215_533646_+\|type-IV-secretion-system-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|313610
NC_018649.1\|WP_038504639.1\|520034_520247_+\|hypothetical-protein	unknown	unknown	unknown
NC_018649.1\|WP_014960331.1\|525242_525980_+\|hypothetical-protein	unknown	unknown	unknown
NC_018649.1\|WP_014960075.1\|529977_531123_+\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|226077
NC_018649.1\|WP_014960338.1\|533911_534403_+\|relaxase-domain-containing-protein	unknown	unknown	gnl\|CDD\|378042
NC_018649.1\|WP_148274270.1\|531875_532223_+\|hypothetical-protein	unknown	unknown	unknown
NC_018649.1\|WP_038504635.1\|514620_514866_-\|Dyp-type-peroxidase	unknown	unknown	gnl\|CDD\|225393
NC_018649.1\|WP_014960325.1\|517200_517794_+\|DUF3501-family-protein	unknown	unknown	gnl\|CDD\|378790
NC_018649.1\|WP_187288715.1\|521552_524522_+\|toprim-domain-containing-protein	unknown	unknown	gnl\|CDD\|372578
NC_018649.1\|WP_179110183.1\|513925_514501_-\|redoxin-domain-containing-protein	unknown	unknown	gnl\|CDD\|239315
NC_018649.1\|WP_038504638.1\|515853_517116_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236869

Protein	Function_ID	Function_description	E-value
NC_018649.1\|WP_101494908.1\|515213_515633_-\|CoA-binding-protein	gnl\|CDD\|224745	COG1832, COG1832, Predicted CoA-binding protein [General function prediction only].	7.73677e-50
NC_018649.1\|WP_014960326.1\|517786_518959_+\|aminotransferase-class-V-fold-PLP-dependent-enzyme	gnl\|CDD\|224029	COG1104, NifS, Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism].	5.19493e-96
NC_018649.1\|WP_014959795.1\|527149_528208_+\|IS110-family-transposase	gnl\|CDD\|226077	COG3547, COG3547, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	5.54869e-41
NC_018649.1\|WP_014959793.1\|528603_529821_+\|IS256-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	4.28586e-145
NC_018649.1\|WP_014960318.1\|513005_513929_-\|NAD(P)-dependent-oxidoreductase	gnl\|CDD\|224995	COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism].	2.58536e-75
NC_018649.1\|WP_014960336.1\|532215_533646_+\|type-IV-secretion-system-DNA-binding-domain-containing-protein	gnl\|CDD\|313610	pfam10412, TrwB_AAD_bind, Type IV secretion-system coupling protein DNA-binding domain. The plasmid conjugative coupling protein TrwB forms hexamers from six structurally very similar protomers. This hexamer contains a central channel running from the cytosolic pole (made up by the AADs) to the membrane pole ending at the transmembrane pore shaped by 12 transmembrane helices, rendering an overall mushroom-like structure. The TrwB_AAD (all-alpha domain) domain appears to be the DNA-binding domain of the structure. TrwB, a basic integral inner-membrane nucleoside-triphosphate-binding protein, is the structural prototype for the type IV secretion system coupling proteins, a family of proteins essential for macromolecular transport between cells and export.	5.55791e-109
NC_018649.1\|WP_014960327.1\|518997_519897_+\|complex-I-NDUFA9-subunit-family-protein	gnl\|CDD\|187579	cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, subunit 9, 39 kDa, (NDUFA9) -like, atypical (a) SDRs. This subgroup of extended SDR-like proteins are atypical SDRs. They have a glycine-rich NAD(P)-binding motif similar to the typical SDRs, GXXGXXG, and have the YXXXK active site motif (though not the other residues of the SDR tetrad). Members identified include NDUFA9 (mitochondrial) and putative nucleoside-diphosphate-sugar epimerase. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	6.97242e-71
NC_018649.1\|WP_014960338.1\|533911_534403_+\|relaxase-domain-containing-protein	gnl\|CDD\|378042	pfam08751, TrwC, TrwC relaxase. Relaxases are DNA strand transferases which function during the conjugative cell to cell DNA transfer. TrwC binds to the origin of transfer (oriT) and melts the double helix.	1.7393e-35
NC_018649.1\|WP_014960075.1\|529977_531123_+\|IS110-family-transposase	gnl\|CDD\|226077	COG3547, COG3547, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	5.93423e-27
NC_018649.1\|WP_038504635.1\|514620_514866_-\|Dyp-type-peroxidase	gnl\|CDD\|225393	COG2837, COG2837, Predicted iron-dependent peroxidase [Inorganic ion transport and metabolism].	5.54924e-05
NC_018649.1\|WP_014960325.1\|517200_517794_+\|DUF3501-family-protein	gnl\|CDD\|378790	pfam12007, DUF3501, Protein of unknown function (DUF3501). This family of proteins is functionally uncharacterized. This protein is found in bacteria and archaea. Proteins in this family are about 200 amino acids in length. The structure of protein BPSS1837 from B. pseudomallei has been solved. This protein contains two domains, domain I (1:31, 46:81) is a helical domain, domain II (32:45,82-193) is a mainly beta protein with a beta barrel. According to crystal contacts the proteins probably functions as a dimer. The gene neighborhood analysis suggests that this protein may be functionally related to rubrerythrin and ferredoxin. The wedge surface between the two domains might be functionally important. The fold of this protein could best be described as a circularly permuted C2-like fold (details derived from TOPSAN).	6.80374e-77
NC_018649.1\|WP_187288715.1\|521552_524522_+\|toprim-domain-containing-protein	gnl\|CDD\|372578	pfam13362, Toprim_3, Toprim domain. The toprim domain is found in a wide variety of enzymes involved in nucleic acid manipulation.	2.4546e-06
NC_018649.1\|WP_179110183.1\|513925_514501_-\|redoxin-domain-containing-protein	gnl\|CDD\|239315	cd03017, PRX_BCP, Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides. The protein was named BCP based on its electrophoretic mobility before its function was known. BCP shows substrate selectivity toward fatty acid hydroperoxides rather than hydrogen peroxide or alkyl hydroperoxides. BCP contains the peroxidatic cysteine but appears not to possess a resolving cysteine (some sequences, not all, contain a second cysteine but its role is still unknown). Unlike other PRXs, BCP exists as a monomer. The plant homolog of BCP is PRX Q, which is expressed only in leaves and is cellularly localized in the chloroplasts and the guard cells of stomata. Also included in this subfamily is the fungal nuclear protein, Dot5p (for disrupter of telomere silencing protein 5), which functions as an alkyl-hydroperoxide reductase during post-diauxic growth.	1.63027e-60
NC_018649.1\|WP_038504638.1\|515853_517116_+\|hypothetical-protein	gnl\|CDD\|236869	PRK11168, glpC, anaerobic glycerol-3-phosphate dehydrogenase subunit C.	1.78283e-59

>NC_018649.1|WP_038504639.1|520034_520247_+|hypothetical-protein
MRAVGNRFLPADRIVPIDTIPHIFICVREKMGNQGECMPDSVPETSFRRFSRYAARSVPRIRREEEASRP
>NC_018649.1|WP_014960327.1|518997_519897_+|complex-I-NDUFA9-subunit-family-protein
MKIAMTGGTGFIGQAFLSAWSRQAPPSEVRLVSRHPPRAPLPSFARWYPGNVTDRGSLAPVFDGVDMVLHLTGILAETKSQSYEAIHVDGTRNVLDASKAGRVSRIIYLSAIGASRTARSRYHRTKAEAEDLLKNSGMDVTIFRPSVVFGKDDKFLNLFAGMGKTLHVLPLIGDGQSRVHPVWVNDLVESVLESMKQPETVGRTYQMGGCRIYTYHELMETLKRSLHFRAIVLPQPETLLRVVAGMQEALLPVPFLTREMVTMALEDNVADPNDLVVSFGKSPYPVEAYLEGEFSSKKE
>NC_018649.1|WP_014960326.1|517786_518959_+|aminotransferase-class-V-fold-PLP-dependent-enzyme
MNEVFRASLDCDNQMPLRPGVLEALTRSLEEGGNPMSRSGRGLRARQRLEDARDMLSEILGAHRSEVWFVSCGSEANTWALERTVMRGGLPPRAVFVSPLEHVSVLSAANARSRREGMPVLSLPLAPSGKVQVDALRTLFPEPPFLVSVQWANPEVGLIQPIEEIGRIVQEKGGTFHVDFIAAESFVPVRFRDLPVDLLTVSSARWGGPPGIAALLLKRGGRILPLIEGGGQEDGRRGGTQPDFLAAGWESALRHWKENREEEMARLTGLTRDLSRWVVRELKDVRIAGERGERIPGVLNILVHGIDGQAALSLLDAKGVEVGTGSSCSRDSLKVSHVLSALGYPAVESQGSVVLSMGWSTTDREVLLFREVFGGVLDRLRSLAPALKSS
>NC_018649.1|WP_014960325.1|517200_517794_+|DUF3501-family-protein
MREIRVTDLLDNTTYEQRRGDFRSRIIALKKDRGMNLGPILRLVFENRDTLLFQIQEMLLVERTTDPEKRAEEVEIYRTMLPTRSTLSATLMIEITEEGRIRETLDTLQGLDRGPYLHLAFGGERVTAQFEPDRSTDEKLSSVHYLTFPFTEKQRSGFLGLPEGERVMLLSDHPRYSAMTILSPGAIRSLQGDLSDE
>NC_018649.1|WP_038504638.1|515853_517116_+|hypothetical-protein
MPEENLSDPLDKKWLRVADICNGCRRCFHLCPSFDTLFGLLDRPDVDGDPFRLEPDALARTEDGCNYCKLCYNHCPYCPPHAYQLDFPDLMIRSRVRRKKMSGFSRSDRLLARTDWTGKMGTRFAGTVNAAIRNPLLRHIGRLVAGIDERAPILPFAHETFLERLGKRHRSPKRAPEGSPTKVALFVTCLGNYQMPDIPESVLRILEHHSIPVVVPGALCCGMPYLDAGDLEGFRLQAARVRDLYLPLVREGYQIVVPVPTCQLTLRKEFLQYGREEGVPEDFQELSEHSWDFFQFLEKLRAEGRFRTDFKSSPGPLSYHVACHLRDQNIGTPVREILGQIPGTTIRSVEQCSGHGGTWGMKPPHYPLARKKAEKTASVLQENGPGTWASDCPLAGKALEAASGNPVEHPAVLLRKAYGL
>NC_018649.1|WP_101494908.1|515213_515633_-|CoA-binding-protein
MVPSDETIATLIRESKTIAVVGISDKLGRPSLTVSSYLQDHGYSVLPVNPVLESVGHVKCHPSLEALPETPDMVVVFRKPADVPGVVREAANRGIRRIWIQEGIRSPEGYRLAEEHQMQIVMDRCIMKEIMRLGKGTGH
>NC_018649.1|WP_038504635.1|514620_514866_-|Dyp-type-peroxidase
MALLDREEGLAGSRIMAVQRWEHDLTHFRSRSPEEQDTLLGRDRTTNEERPEAPSSAYIREAPGRTFPRQRTCFADRLGPG
>NC_018649.1|WP_179110183.1|513925_514501_-|redoxin-domain-containing-protein
MRRLTRFNRTGRVLFFLALVLPVCLVLSEERSPAASPVPETGISAPSFSGTDQNGIVHRLSDYRGKWLVLYFFPKADTPGCTTEACSFRDSLLKLKALGARVVGVSMDDRSDQKHFARKYHLPFPLLADPTGTIARAYGAAGGFLNLDHRYTFLINPSGILVKRYLDVDPDHHARQIRDDLRALGAKEATS
>NC_018649.1|WP_014960318.1|513005_513929_-|NAD(P)-dependent-oxidoreductase
MSGHSAERSPYKEAVWIGTGNMGLPMAKNLLRSGIRLGVHNRTPQRLAPLLKAGAHAIADLRGSLSGTPLVFTMLADDAAVKETVLKEGGLLDSLPQGGVHVSMGTLSPGFVLELSKTHTERGQILVSAPVFGRPDRAEAGTLTIVAAGPQKTLESLLPLLEHLGSPVFCVGEDPSLANHIKVLGNFTLAGLLETLAESLSLARRVGVSPEQLVEILDTALYRSPVFRNYGQLMAREDFQPAGFRMRLGLKDVRLVQKEADRVDVALPLADLLHAGFLAGIHRGMEDWDWSALGQVRAEDAGAARKK
>NC_018649.1|WP_014960317.1|512067_512997_+|hypothetical-protein
MERVSQTRMTKKGIVRNAIPLLFLLGSVLLSGKPLLAAPGGSSGPEEGPGTIHDLSRWVLPRQTTGWVGVQGRERDRPLTVTPGNRFLSILHDHAAWYASSRRAVGLSPVQRRKINRLLADTRNRLVRLDGKDLALVQLFEAGAVAPRVDVSRLGQLNEKIGAVEGEEAQVFVTALSRFQSILLPLQRREGEEASRNVLPDMSVDLSGAVFFADRILSIRWNRLENSLEQSGKKPDDAYARAFQTGRKKIWSLGIRKTVGDKEAMDLLMKPWVDLPGLSKLEKKNGPVEASFWKEFLHTLGTLNPPSGS
>NC_018649.1|WP_187288715.1|521552_524522_+|toprim-domain-containing-protein
MDTETGRWTDFAGGEKGNFASLAAKIGISTDTPVFFERDPRAARREKARLVAMLRIADRIWKDATSITPESPSALYLRRRGIPEETIIRLSETEIVREARHGDDFALVTRMYDGIEPDADFAGIHRIFIDKTGAPVEVDGARKMMLGGSGWTVIPGSGEKIVAVGEGLETCLSAWSALDRRPGLIVSYVAGNLEKTQLSDTHRSAQVLILADRDLSRGIEKQGWRQGRGQEAAGTLAKTLVNRGFSVSVALPPGPGKQDWNDIPTDDAASLLKAALETTVGAEILPIGQVEASGQPWTPVTFYSKDQAQERLKEIYETPGKHLVAITTGVGKTKIWADSLTRETPTLTVFPDLDKARDFAKESGAKVYFGRSEQEGPGQCLKYPDLQDLGEKRRSIMAHECQTCPHGLSAQSQRGSETARETAEIAGLDLRVIQPCDWIFQISEIALEPHVACTEAALQGKPDHLLFCENPLAISKKERRLKRKIVFDDCFVPMDEIKSGISLEDVAIWLQQIDKEREKKTSTWLEKIETALRSFPSIIQYGMSRRVMLSSIRPPDGFQDWSEFAAFINDGKDSEKVLDGLSPERVTVVGGRRLVPLRALLDLARAVNSGTVYAENGLLHGTFDSLSAQLLREKGRDVVILDATPTPERIKAVREAKGQVHELFVQQPRLHVTQFTGRLHGRSSLSSITSEIRHARRMIEEAKIRGYSPSEIAFLTHLPLAEKLRQDRAFYGVDIGHFGRDQRSHNAWKGKKLLISFGIPLRPDLRTVYQHCTGQYWTGDREFMSTHIPHRIGDQVAQLSGCKLPVSEEIRDWERTLATAEIVQAIGRLRAVHAESDVEAWVVTSYPLAPAFGLQIDEIRREGGRTAGEYQDARWADTVSRFDEARGQGAESFRQINTILKKLGKLGISSASYQKLRSRIESFDMSMDGIDAEELESSIRALLNCENPVVEAKNLLKMENPRTEWVIAALTVIDVIESETQSQSLPKTG
>NC_018649.1|WP_014960330.1|524710_524971_-|hypothetical-protein
MAKKMGRPRKTISANEKLEKGEAVKAHAERMKAEGYVFRGTWIKKDVWEEILRAAEADGITSGEVIERAVSRCKNNPISRNTPPES
>NC_018649.1|WP_014960331.1|525242_525980_+|hypothetical-protein
MAKFRENLLLHYHLIRWTTALVVVFCVYSSVYYAIVGRDHGPQKLRTAAQVGRSDDSLYQMSVFTPIVRAGRLEKPLYNGVAQAKTADGLYKRFDYLVLSSKKSVRFGSSVDGQCLILSGTQDGGYTIFPLSYFYSDDGIRYPRRGWSTGPTDIKIVGKKQTGMPSPAPHFSFLKAGVSLQKVRQVLGTPAIISLSGSWRQGSDQGGCERQVFSLKTRTETYYFSDSPRVVLSFDGAGIFTKQIE
>NC_018649.1|WP_014960334.1|526735_526924_+|hypothetical-protein
MADILHKTERKMTTIDVGIDELEMRAQRELMALNLENARVYFDLIEELKMGSFSIKKVSGRG
>NC_018649.1|WP_014959795.1|527149_528208_+|IS110-family-transposase
MKVTTLGIDIAKTVFHLIGLDARGHEVLNKKVSRSHLTKTIQNLPPCRIAMESCGSANYWGREFEKMGHAIVLIPPQYVKPFVRTNKNDANDARAICEAALRPSIPTVPVKTEDAQDIQSLHRSRQLLIGFRTATINHIRGILLEYGIVLGQSPKKVGGELERLVNDPECGLSPSLRETLRVIGAELAGLESKLEDFDTWIENLAKRHPVCKRLMTVPGVGVLTATVLVALVGDPFRFRNGRHFAAYLGLVPKQHSSGGKNVLLGISKRGDTYLRTLLIHGGRAMVRSVMKIAAAGKEPAGRNTWILSLYERRGYNRTAVAVANKNARVLWALLTKEDAVYSPAGPALRKTA
>NC_018649.1|WP_014959793.1|528603_529821_+|IS256-family-transposase
MAELNLTLNPDLLPNLLTEGGDGLKKLVESVLNQVLEAQMTEHLGADRHERTEERAGYRNGVRERTLTTRVGTVILRVPQTRDGSFSTDLFKRYQRSEQALVLSMMEMVVQGVSTRKVANITEELCGTRFSKSTVSQLSTGLSARVQAWKNRKLSSPYPFVLIDALVIRVRKNESVSPMAALIATGITAEGQREILGLTLGDSENEASWDDMLRDLKHRGLSGVDLIVSDDHKGLKNAAWKHFQGVRWQRCQVHFLRNILGHAPASQRGPLAQALSRLFRSETMEEARMVRNEILRTFEKKAPKAMECLEEGFDETLNILTFPKKYRVRLRSTNSQERLNEEIRRRERVIRIFPNEESAIRLIGALLSEFHEQWSTGKKYLDMTEYHEWKKQESFKTSSTLAIVE
>NC_018649.1|WP_014960075.1|529977_531123_+|IS110-family-transposase
MKQYTKFVGLDVHKKTIAVAVADSKTPEVRYYGEIPNTIEALRRLIHKLSEEGAELHFVYEAGPCGYGVHRRLQAEGHRCQVVAPSLIPKKAGDRVKTDRRDAQALARLHRVGELTPVWVPGSEQEAMRDLSRLREDLKMEERHLKQRLLAFFLRHEVVLPEDKTRWGGPFMTWLENKTFENAVSQIVFQTYLESLKDVIGRGAGVVKEIETVLESYSLAPVVRSLMALRGVDLITAFTITAEVGDMTRFGTAAQFMAYLGLTPCESSSGENVRRGGVTKTGNGHVRRVLVESAWHAQRTPRISKALKERMKDQTPEVRKIAWEGQRRLFHRFHHLTAKGKRSTVAVTALARELAGFVWAIGCQVMGRPVALPKETMGETA
>NC_018649.1|WP_148274270.1|531875_532223_+|hypothetical-protein
MQIRITDAVEKDLQKVAVSEGKTVSELVREILENFLSGDDRKISGSDAEILDLVQKNFRYQRTLAKLILDIDLRTYAMRSGLTVADKMQLDAEIQKRKKVFVEKLEKIAEGGGDV
>NC_018649.1|WP_014960336.1|532215_533646_+|type-IV-secretion-system-DNA-binding-domain-containing-protein
MYDIFVIAVIVALIILAIDKFSSKKEESPLMRGEHIRGASIVTGSRSRDDMEITIGGIPISDESASKHIGFAGSTGSGKSTALREVLCTLSERVRERGDRVVCVDNRGEFMSVFGSKEDTILNPFDGRSVLWNPFSEVRDEQSDFRMLSRSLYPQKQSSQPEWDDFAKGLFANVLMKVSRTKPDPAEVLRLITLSEREEIEGFLEGTSSSISSSQENSKMFASIRSTLAQALDAWYSLPVDGSFSLRRWVHEGEGFLWLPYRPAQRASLQYLISGWIDLLINEILALDEDRSRKIWLICDELTAIGQIPSLIDALTLGRKPGLSVLMCFQSIAQLNDVYGKERAQTVISNARTKLVLAQGSHLDAQFWSDEIGKREYKEDEFSESSNSGSSMGQGHSRSAGSSDSVSHRVKQDHLVLPSELVDLPDNSGFLRVAGAGGITPVSLQRIDLPRVMSPFVPIDDSPEPEPVSVVDKTGS
>NC_018649.1|WP_014960338.1|533911_534403_+|relaxase-domain-containing-protein
MALGRNISPGQGAKYYRKDDYYIEKEGGEEHKLEWGGKLARDLGLQGKVDAETWEKALQGHFPGGVEIQGGSMVDPKTGERCHRAGTDFEFSAPKSVSIQALVFGDERLLQAHKEAAAEAMAFLEEQVGARRGHAGKTWETTGQALTAYSRSCWTPILPHDGQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_018649_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_018649_2

707186-707292

Orphan

Consensus_repeat	Method
AGAGTCCGGAGACGGTCCCGGTCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_018649_2

>merge|NC_018649|2|707186-707292|CRISPRCasFinder
AGAGTCCGGAGACGGTCCCGGTCGCCAGGCACAGGATTCCCAGGATTGTCAGGACGATTCCCCAACCCGAAGGAGAGTCGTGAAGAGTCCGGAGACGGTCCCGTTCG

>NC_018649|2|2|707186-707292|CRISPRCasFinder
AGAGTCCGGAGACGGTCCCGGTCG	CCAGGCACAGGATTCCCAGGATTGTCAGGACGATTCCCCAACCCGAAGGAGAGTCGTGA
AGAGTCCGGAGACGGTCCCGTTCG

Protein	Signature genes	Signature genes Name	Protein_function
NC_018649.1\|WP_148274274.1\|715137_715677_+\|hypothetical-protein	unknown	unknown	unknown
NC_018649.1\|WP_014960508.1\|692700_694530_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NC_018649.1\|WP_143461184.1\|694526_695432_-\|hypothetical-protein	unknown	unknown	unknown
NC_018649.1\|WP_014960524.1\|711343_712333_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133028
NC_018649.1\|WP_143461183.1\|700502_702482_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|366154
NC_018649.1\|WP_014960515.1\|702385_704431_-\|DUF4091-domain-containing-protein	unknown	unknown	gnl\|CDD\|379121
NC_018649.1\|WP_014960530.1\|718369_720331_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340836
NC_018649.1\|WP_014960526.1\|713816_715079_+\|hypothetical-protein	unknown	unknown	unknown
NC_018649.1\|WP_014960521.1\|708884_710999_-\|signal-transduction-histidine-kinase	unknown	unknown	gnl\|CDD\|274349
NC_018649.1\|WP_014960529.1\|717252_718377_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340836
NC_018649.1\|WP_014960531.1\|720327_721512_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340837
NC_018649.1\|WP_014960525.1\|712450_713461_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|132997
NC_018649.1\|WP_014960516.1\|704501_705917_-\|PEP-CTERM-box-response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225114
NC_018649.1\|WP_014960510.1\|695615_696962_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|274425
NC_018649.1\|WP_014960519.1\|707433_708357_-\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	unknown	unknown	gnl\|CDD\|224131
NC_018649.1\|WP_101494886.1\|705913_706627_-\|EpsI-family-protein	unknown	unknown	gnl\|CDD\|378781
NC_018649.1\|WP_014960513.1\|699259_700372_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|132997
NC_018649.1\|WP_077303689.1\|698156_699212_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|132997
NC_018649.1\|WP_014960511.1\|697012_698104_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|366154
NC_018649.1\|WP_014960528.1\|715744_717256_+\|O-antigen-ligase-family-protein	unknown	unknown	gnl\|CDD\|377422

Protein	Function_ID	Function_description	E-value
NC_018649.1\|WP_014960508.1\|692700_694530_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	2.39589e-106
NC_018649.1\|WP_014960524.1\|711343_712333_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133028	cd04185, GT_2_like_b, Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	1.21709e-81
NC_018649.1\|WP_143461183.1\|700502_702482_-\|glycosyltransferase	gnl\|CDD\|366154	pfam00535, Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.	4.27371e-11
NC_018649.1\|WP_014960515.1\|702385_704431_-\|DUF4091-domain-containing-protein	gnl\|CDD\|379121	pfam13320, DUF4091, Domain of unknown function (DUF4091). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, archaea and eukaryotes, and is approximately 70 amino acids in length. There is a single completely conserved residue G that may be functionally important.	1.46851e-13
NC_018649.1\|WP_014960530.1\|718369_720331_+\|glycosyltransferase	gnl\|CDD\|340836	cd03807, GT4_WbnK-like, Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.	1.27867e-87
NC_018649.1\|WP_014960521.1\|708884_710999_-\|signal-transduction-histidine-kinase	gnl\|CDD\|274349	TIGR02916, sensor_histidine_kinase, putative PEP-CTERM system histidine kinase. Members of this protein family have a novel N-terminal domain, a single predicted membrane-spanning helix, and a predicted cystosolic histidine kinase domain. We designate this protein PrsK, and its companion DNA-binding response regulator protein (TIGR02915) PrsR. These predicted signal-transducing proteins appear to enable enhancer-dependent transcriptional activation. The prsK gene is often associated with exopolysaccharide biosynthesis genes. [Protein fate, Protein and peptide secretion and trafficking, Signal transduction, Two-component systems].	8.13202e-73
NC_018649.1\|WP_014960529.1\|717252_718377_+\|glycosyltransferase	gnl\|CDD\|340836	cd03807, GT4_WbnK-like, Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.	1.21478e-88
NC_018649.1\|WP_014960531.1\|720327_721512_+\|glycosyltransferase	gnl\|CDD\|340837	cd03808, GT4_CapM-like, capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.	9.7096e-72
NC_018649.1\|WP_014960525.1\|712450_713461_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|132997	cd00761, Glyco_tranf_GTA_type, Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.	1.50706e-27
NC_018649.1\|WP_014960516.1\|704501_705917_-\|PEP-CTERM-box-response-regulator-transcription-factor	gnl\|CDD\|225114	COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms].	6.684e-168
NC_018649.1\|WP_014960510.1\|695615_696962_-\|glycosyltransferase	gnl\|CDD\|274425	TIGR03087, stp1, sugar transferase, PEP-CTERM/EpsH1 system associated. Members of this family include a match to the pfam00534 Glycosyl transferases group 1 domain. Nearly all are found in species that encode the PEP-CTERM/exosortase system predicted to act in protein sorting in a number of Gram-negative bacteria. In particular, these transferases are found proximal to a particular variant of exosortase, EpsH1, which appears to travel with a conserved group of genes summarized by Genome Property GenProp0652. The nature of the sugar transferase reaction catalyzed by members of this clade is unknown and may conceivably be variable with respect to substrate by species, but we hypothesize a conserved substrate.	2.40613e-30
NC_018649.1\|WP_014960519.1\|707433_708357_-\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	gnl\|CDD\|224131	COG1210, GalU, UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane].	2.808e-159
NC_018649.1\|WP_101494886.1\|705913_706627_-\|EpsI-family-protein	gnl\|CDD\|378781	pfam11984, DUF3485, Protein of unknown function (DUF3485). This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 223 to 526 amino acids in length. This protein is found associated with pfam09721.	4.53205e-60
NC_018649.1\|WP_014960513.1\|699259_700372_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|132997	cd00761, Glyco_tranf_GTA_type, Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.	2.24801e-26
NC_018649.1\|WP_077303689.1\|698156_699212_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|132997	cd00761, Glyco_tranf_GTA_type, Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.	1.02116e-31
NC_018649.1\|WP_014960511.1\|697012_698104_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|366154	pfam00535, Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.	6.36366e-27
NC_018649.1\|WP_014960528.1\|715744_717256_+\|O-antigen-ligase-family-protein	gnl\|CDD\|377422	pfam04932, Wzy_C, O-Antigen ligase. This group of bacterial proteins is involved in the synthesis of O-antigen, a lipopolysaccharide found in the outer membrane in gram-negative bacteria. This family includes O-antigen ligases such as E. coli RfaL.	1.401e-14

>NC_018649.1|WP_101494886.1|705913_706627_-|EpsI-family-protein
MSPRLRNMLLSSALMLAAVVLVGRLDSEGAIPSHLPLASFPDRIGNWTGVRLPMDKKTRSLLNADGYASVLYTDRPGDPGLLFFSVYYDRQTAEKNIHSPANCLPSSGWAILSHKIVSLPVNGRGLPPVDVNYNVIQKGLEKQLVLYWYQERGHLFANEYRGRIYLIEDALLLHRTDGALVRVSMPVRGSVGQTFRKEVRFLRNLSPLLDRYIPGSSRPVEMAARSGQSDLAGGSHP
>NC_018649.1|WP_014960516.1|704501_705917_-|PEP-CTERM-box-response-regulator-transcription-factor
MTHETPEALSFQPSILIVDDDPVVLKQMTWLFKGEYPVLTADSASSAIEIFVREKPPVAILDLSLGKDSGQDGIDLLRFFAEADPHFHGIILSGSIDRPRALEAVRLGAYDLLDKSVDPEELKRVVGRACNRALLSRTPARPKELSPSAEESNPFPGIVTKNPGMKEMLRILQKISATDVSVLITGESGTGKELFARAIHERSPRKNGPFVAINCGAIPESLLESELFGHEKGAFTGATESRAGKFEAAHHGTLFLDEVAELQIELQVKLLRVLQDKIVERVGSRNGKQLDVRIIAATNQPLNELMARGRFREDLYYRLSVMSFHLPPLRDRGEDVLLLAQHFLEKFRTEYNKPQVIDFNRECLDVIRKHDWPGNIRELENRIQRAVIIASGKWVTREDLDIGLDSRKHGESTLSMNLTGAREEAEKRMLVEAFEQARGNISHVARMIGTSRPTVHALIKKHGLSPKEFKE
>NC_018649.1|WP_014960515.1|702385_704431_-|DUF4091-domain-containing-protein
MPLFKNKLTWFLLGMASGILAVAAGGFLVLSSPTLRTHLKNTVKKLMKVHQTVAAIKTLEAKSKDLLHPGLVIPDNFLHYPFPGSRVEKNGDLTTWIAPLSDRIQLQDVPPSSLIGKPGSSSAIHLIGLRGEVLSFQLVLRSSRKIPDLHAELSTASDPKAFSCITTHRFLEHYEHFTASDVKYGPIHPHDIPDPLIPFRDPYTPGRIIVADIPVTPDANQPVWIDVAYAKNCSPGTYTGVLTVRSGAQILRKTPVNFEVLAPVLPEHAPISRWMELYVSRFYGGLVKGGLPTSDLEFQRMYRRAFVLGHAYGFSTNDSGGIHPDIRWDWRTGTPTSVDWSGYDQLYGPMLSGELTGSPPNTWSLPIGTWSLGIGMWGGFAVLGGHPSPVSDWKGVPDIATQNLAKLIVQHWKEKGWPIDKTFAYIADEPVHKLYYYADTYKLIAKNADSLHKGSPHIHVMVTDVPYITYKNQVGHNKLIMVGKVNIWAGASAQFIPSRMQERQKEGDHVWFYQAGGPPFIGQNDLYSLGPGFRMWFWTAWKYHVNGVFYWADTFWNDNKPNMNPYVNQGLGDGTIMYPGTELHFIGYPDIHGPIPSIRMAQWRRGYEDYRYLTYLKQMHKEKEADRIVDKLVIHALDDGGYLPYWRSPLWQKPGDWSHNPQDWHRERIKMAREIAAIPEN
>NC_018649.1|WP_143461183.1|700502_702482_-|glycosyltransferase
MAETGRLEPQSSGLAQGADQDGAGDCRDSGKLIMTERSLFSQKDPFTKLDKHSPQEICLQNFLYDFASMGIDSLWGHSSHPIKRSEEKILTLSKLKNSTAILSFDGLANLFPIDYFRLHTTLSGVSLKTHLSADNARIKIVNISRHNTRTILFDERISRFSGEFSSDCLNISKLDGSLHLEIEYKGEMEVNQTAWVSRSSRPIPSSSILLSITAFNRDEFVLPLLESLCGYPPLLALNLQILVVDNGGSLFQDKLPNDPRIRLIKQTNLGCTSGVMRALTIARDLKTDFMVIADDDIILPPEMLYRLLIFQVLSNKNLSVGAGMLTLQSPNILWEKGSLVLNQGLNSLKPLHKRTNLETQKDLTSLFHVDQLDYTALWLMSSPTQKLSFLPAFFIYYEDILQGLFLKKNGVPIVVPPHIFLWHATLEKRGAFWKRYLWVRNDLATRFLNPEKLNPLMVVFSFLKLIANLLASYDYKLAEFHLQAFSEAITDASWTIDPLGEKKKTDILIQHAPAQTDLSSRLPPDFLTQKRSSLGQKILKRLGNIVTLGNYLNPFSKSVRSDGKLPFRFHGDYESWGWFGYNTLAVVDKKGSGYLCKRSVKEAVKFIFPCIYLSFRFLITQRTMSKRYKEHSQRYENAWREAFLKLDKKVWTTPQNLGQ
>NC_018649.1|WP_014960513.1|699259_700372_-|glycosyltransferase-family-2-protein
MDTPVISVVITMYREGELLGETVDSILDQTFQDFEIVLVNNNADPLTLTVANRYCETHPEKIRIVHEPIQGVSAAKNRGIIESHGTYIALHDGDDLSHPERLSIQLETFLQNPEASFICSWFDRVGPDGKQTIKKDIADATPYFWFRTEQIIKKLYPDRTTKNPGSPLDFSLISTTFFKKQTAIDVGLFDNRFNPRWFEDFEFLTRLYETGEVVKISKSLLRYRMHTPERAAILRKQMNWLAIIRHLDLFYTILWERYQNKTQDAPEIFRELRAFWLTYVSGFFLEQEKGRTLGKMALKRALTENIQDPYIWKLWGKSFLPQALYPKLFWFDELNPNPLPEGANEDLVRGLFTPSPPTEAAAMNGVCRGS
>NC_018649.1|WP_077303689.1|698156_699212_-|glycosyltransferase-family-2-protein
MSLPEVSVIIPMYREGPLISETIESILSQTFTDYEIILVDNNADPETRGFAEEFVKKHPDKIRLTKETTQGIASAKNKGFQESRGRFIVFHDGDDLSHSHRLATQHSFLERHPELTFIGSWHDLISHDNHLIKKNISETLPSFWAETEKIFNQHFQEAFLRPKTRPIKFPLISTCFLRREAVRASGGHDERLNPRWFEENEFLLKVFDQGDAGVIPEALLSYRKHSPEGNRIMKDQMNWIRKTRHLNTFFNILKERYADRPGTEKLLNRLRSHFLRYTSQFFLQHKDGAPLGRIGLKRAIESSPADELSRKLLMKSYFPKALYPKLFWFDHWMTEPLPTEVNESFIRSLFA
>NC_018649.1|WP_014960511.1|697012_698104_-|glycosyltransferase-family-2-protein
MKPIISVVLPFYREGQLLAPAIDSVLSQTFQGWELVLVDNNASKETRHTARRYADSYPEKIRLIHEPEQGVISARNTGILQSQGEFIALSDGDDLLKPERLKRQYEVLSSRPDLAMVACHYDLLSYDGQTVLEENCPGFTHGSQNILEWKSYLKALFQPLHLNHMESFDLFGSPFLFFRKDVAIKAGLLDKRFNPRDLEDFEFCMRMFELGGFYLIPESLQFYRAENADTRRNKHKDKHTKMTLDKLQVFFTVLWERYGRDYPENHPVFRSLLAFHLNNFGCYLMRFSKGKGIGASWIRRAVFLRPGDLRYWKSYTKTFLPHRTHPRYFDFPEERQEELEFDRTFANRFLSEKSYRTGSVEFT
>NC_018649.1|WP_014960510.1|695615_696962_-|glycosyltransferase
MAKHQKSFSEKSLQKRLEAHKRVNKIPFIPWKLKRVFHHLLFPPHTEILSQPSSIRPILFIAPNIPYPDRGGTDYRLFHILKGTLKAGYLISFFSLYERDLLAGRIEKTSAFLQYENSLKELPLCHLFYGIRAFRTFLKNNPGAFSAIFIAWPKTVQATLPTIKRYDPSVPVIYDMCDYHARRLKREGELHSDPTILERAKKFKAIESEAARLTTLTLAISAEEKETFLSDNPSVNIDVLGNFFDFRETSVPGPEERAGILFIGSFVHAPNTDGVLWFLREIYPLIKQKHPSVPFHIVGIDPPPEILGFAHKDPEIVVHGWVPDLSRLFRSSRVFVAPLRYGAGIKGKVGLAMSRGLPVVTTSVGAEGMELTSGMNCEITDAPEEFAKQTIRLLSDQDHWLRLSGQGQHHALRHSSTDDLPEKMRQIFESVGAFSHLRTQRSARPDLP
>NC_018649.1|WP_143461184.1|694526_695432_-|hypothetical-protein
MKKDTNYVSAVQKKVTQSLLPGQVLVFFFLTAFCTAPSFASMGDFFGAGDTFGTGNTFGWGVTLGQENAIGNGNVFGSFISTGSGNQFGSENHLGTNITIGNSDKFGSENRFGTLLYIGSGDLFGSRDSLRENITVMNQDTFGSNDHLGYDIYIGYGDSFGSHEHFGNNITFGNGDSFSGTIRKTRGFTGLNDLYIPSGSVIGPDVHFGNDIYFGNDVTFGPGDTFGNYLYFGNGDHFNKMGMDVSPAPEPGTLSLYALGLLGFLAISGARIRKAKDPVQKDRVKGSVFSFPGSEYGETSG
>NC_018649.1|WP_014960508.1|692700_694530_-|ABC-transporter-ATP-binding-protein
MTSLRQAYALLSPSHRRGLLVLATLMLLSAIFEMAGIASIMPFMSMVADPGIVDHNHWLSLTYHRFGFDSPRSFMIFLGFVVLGVLFLSNLIAALTVWSILRFSFTAGRDLAQKMFSVYLNHPYVFFLNRNSSELVQNTLFEMGRTVNNVLIPLLTILARSTIALSILILLFSVNPSLALVAGTLLGGAYGLVYFGVRKTLARSGQEISRENARRTQVAYETFGGIKDIKILGREKTFFDLFQKPVERYALLQAQTQMISLLPRYALETMAFGGIIGIVLYLLSTGENLSTTLPLISLYALAGYRLMPALQQIFANWSTVRFNISAVERISRDIEALPENAQKQEVPPPATRRLSLQTAIELDRVTFHYPGREEAVLDDLSLVIPARTSIGLVGSTGSGKTTTLDILLGLLEPTGGSLKIDGQPVNRTNVRQWQATIGYVPQQIMLLDDTVLKNIAFGIPEQEIDRDKVVQAATLAHLHDFVTSDLREGYDTPIGERGVRLSGGQRQRIGIARALYHEPSVLVLDEATSALDNITENVIMEALNTLARDKTVIMVAHRLTTVRECDTIVVLDRGRVVDSGTYDALLERNDFFRMLAPDPSPESRAVEAE
>NC_018649.1|WP_014960519.1|707433_708357_-|UTP--glucose-1-phosphate-uridylyltransferase-GalU
MQKVRKAVFPLAGHGTRFLPMTKSSPKEMLPIIDKPVVQYVVEEAVESGIRQIVMVTGRGKRAIEDHFDISYELEDVLRKKNKLDILAELQRIASLSEITYIRQKEALGLGHAVLCSEMVVGNEPFAVALGDEILYGPKSGLAQLLEVYEELQAPVIGLQRVPRSEVSHYGIVDGTPVRDGLFRVDRLVEKPKTQDAPSDYAIIGRYILTPDVYGILGTQKPGVGGEIQLTDALNTLARQRPVYAMEIQGDRFDTGDKMGFLKATVHFALKRGDLSEEFRLFLEGVLTQGQLNPEPETPGETVYANR
>NC_018649.1|WP_014960521.1|708884_710999_-|signal-transduction-histidine-kinase
MKLHTILPAFSLLLTVLAVGLTSIVRRWSASTLVALLVLLCALVGGLADFAALRIHNLPHLELAFRVAFAGECLAAAAVLLFSVLYSRVQPASRFFEMGIPLTIAGLGFVFFVTSLFLDNHLFRLLPLPQTRSVLLISEPGLSAVSLFLIGTLLFSLYQMSRTYLAAGTMERWNIKYPLIGVSLWSFSLILVHANQLVNSGFDRSFLLLEHIGILSMDVLFLYAFLVQKTEEVALSLTRSTVNRSVLILLGGAGLLVLGGIGTTLGTLGPVWGKLSSSLTLFLGLGAFVVVFSSERLRRELESFLGVHVYSNRYDYRNAWMTLTRALSDSGRPGDIIPTLMETTREMTLSPSLSFATITESNEPVLHLQETLGWKADRNNRKQTIDPGWIPLLNRGVPLHSSDKPDTLQPGNEKPLFFDTLFKSLNASWIVPLLYQDRLLGLLGLNIKTRGALTVREDRLFLQALGAQWSSLLANASLSREMAGKREAEFLSSLRAFTFHDLKNAGVALKLLVHNAQKNIDSPEFQQELLFCLQNISEQIDSSMSQLLSPFQQEYSKTLDFDPVILIQNTVRSLNWDNLPGLAVKLSLSETPHVTGNPRVLETTLRNLLINAREALLDTGEILIETRTESDRLILVVSDNGPGMSREFIETRLFRPFQTTKKKGTGLGLFSCKLLIEQSGGTIDVHSREGEGTEFRITLPYAST
>NC_018649.1|WP_014960524.1|711343_712333_+|glycosyltransferase-family-2-protein
MDGTRVARNTEKVFVVLVTYNRKDLLLECLDGLLRQTRPIDGLVLIDNASTDGTADALYAQKFLPEVPPLNARSVWEFRRESFREGEMTFVYLRLPVNEGGSGGFHEGVKKALEFDCDWLWMMDDDVEPDEGCLQGQLAFSEISKCIHPRKYFQDGLAHEWEGYISAVTGRRVFQPDISFRKGFSFCTINTGCFEGMLIHRSVVEKIGLPDKRFFLGGDDSVYGFLAHYHTPVLYLRDPRINKKKIYQVENNPIGDRSIYYGMRNTFLMQRYLNEKMERYRLIRSFFILVRFVDYALNILQNRPEKFRGYRVLMRAFRDGLTGNFGKGL
>NC_018649.1|WP_014960525.1|712450_713461_-|glycosyltransferase-family-2-protein
MNGTAIETNKKQSSTAPSGWKPVEQGRYLFTVFTSAYNREKKIPRVYESMKSQTFRDFEWLIVDDGSVDNTRELVEKWQKEADFPIRYFWKENGGHHSAFNLGVQKAQGTLFLQLDSDDACFPNALEVFANTWNNLPAPKEQYAGITGLCVDQDGALIGDLYPRDIMDSTSLEMHYRFHVKGEKWGFTRTDLLRSHPFPIVEGVKWFPPNVVWYAIGRKYKTRYINQKLRTYFMETAQKSDQAAYFPVKKVAPGISYLHRTVLNEDIDKFSYSPKDFLRFAVHYGRFSLHAGRSFGTQYRELNNGLARTLWFLGLPLGMGLYIKDQSKVRKQAQKS
>NC_018649.1|WP_014960526.1|713816_715079_+|hypothetical-protein
MFVFSWKRVFLFPHRCRLANAMIRSAFLSGVALGLLLPVLFTGGIAYGGPIYGPSPNGSVPGGQVPGGDVNAPDVPSGLVPSLNGPGFNAPNNGSPSSGNSGQTGSPTGNLNPMNPNGPPGGSNNPNNPSNQGQPASSAPTFMNSAMPNSSNPFLPNNISPGLLSAPLENAYLQDGVPQLAAPMMSAVYRPFGMTFFQPNPFQVTPQGAVTLTGMYGEDSNIAYTTNQPSWGSFFSITPAVYYSNFDDYGYISLMGSASYYQYNAGNIPPYLDGTAGISAGTYLGDRVFVGVQDMGFVGFSPGMNGSPLAFFTGINPYYGNMSDAEVGFALTPKVTFVQSASDMYFDDSGFGAGIYNIQSLMDTLNYKDALNFLSLSYIYQQGIISLFPGFISDGLMGSAMRMVSPTTSFGGGECFLLSV
>NC_018649.1|WP_148274274.1|715137_715677_+|hypothetical-protein
MYSYYGILTHQLTRSLSVALQGGWNAVSFYSGETFQAPLIDLNIAYTGPRLGLGLNAGEYMENMSSYGVEMGPEKTKNVLGYATYSISPKTSVFSSAGYSIYDFLDPYSFSNSFFQTLQPNLSYSGSYLYLADGINYTPATWVNTSLIYNLVDFSTSIPNTSIVENMFMAMVTFVWNFN
>NC_018649.1|WP_014960528.1|715744_717256_+|O-antigen-ligase-family-protein
MGNVYPGTGGSLAVSERPVPEGMDFSLPKVPWGYYAAAVVLGFDAFFSVGIPRLILLPLSAVLFLSLALKSAGTPMPAMMALIVYIPYAKAIAGNMGGFLPGLNYTTALMVIVIIGMYSRVQGTHVEPALPLEATFRRLVLLFCVFGAISVIHTDLVFAQWSVFKSIVDYKRWIDPFLVFFLFSYLVRTQKEAKTLIYLMAVSMVVVGIGSLYQHHVISGRSHRVRLKGIAGQANQMGAFYANYMFLILGFVWMKGLTFLKKSLFALGFWGCLLGLFATESRGDFLALVMGMLLFLFLRKKVLFFVAIAGIIFVSVNIQFLPSGLRNRIQHTVTHRDPYGFSGSSGQLDASARTRLALWQGAANMIMSHPLMGVGYKMFPEYIYQYVPHNEETDRLPLRHRDGHNAYLMIGAEMGVPALLLFLLLLLYMFRIMWRAYRASPDRYWKTVSVCGLCAVTSLVLTNLFGSRVISLVLAGYLWALLAILLKVPKWAEEGDPEEEVAP
>NC_018649.1|WP_014960529.1|717252_718377_+|glycosyltransferase
MIPVLYLIEHLRQGGSERYVAELVRSAREMGVEPHVGCFAEGGIFYDEIRRVGIPLQAYPLDSLYHPSVLRTIRSLSAYIRKHRIRIVHSFQPNANVLGTVVGRLSGTKVVISRRNLGDFGGLGSPRLAWLQKAITNRLSHRVLANSRAVREAAIRGEGFPPEKVVLIYNGLDTERFRPVPDPASRRRELGIPEKGFVFGIASGFRPVKGVDVVIRAFAKARPLCPDSVLVLAGDGLGREQLENLVRELGLEEGVIFLGVRSDMEIIYPAFDAFVLTSHSEGFSNAILEAMGTGLPVVASRVGGNIEMVEDGVRGYLVPPGDPETLSDRLCRLYADPVLTHAMGKEARAWVERTNARDVIVRRFGELYRGVLDE
>NC_018649.1|WP_014960530.1|718369_720331_+|glycosyltransferase
MNEKVLSNGRPLTVCHLFPSLPLHGAENHFLKLCRNLDPDVVRTSIVVMVERGELAPDFEALGIPVTLIPKRSRYDLTVVPRLRAFLKAGQYDIIHTHLFTANFWGRLAAFGLSPVLVSSAHNVVPKERPTLVRVENFLDRFQSRWTDAIFCVTGQVLQSMKSDAGLPRHKLVAIENGLPFPEAAERRIKEARRRLGLPVDRRILAVIGRFSTQKNHTGFLEAFAKVRTKHPGLLVLFIGEGELEGAIREQVAALDLGEAVRFLGQRRDVPALLEALDLLVVPSLWEGLPNVMLEAMAANVPVVATAVGGIPDVLTDGVNGVVCQTSPESLSEAMDRALSRPDEMSRMADAASALIRDRYDIRNTARRYTGFYRNLDRQKRFSRGMRDVLRTGTGRLMSRPGKGRTGTLRVLMYHRIADDPGEDILAVTPFSFFEQMRWLKEEGFPVLPVADALKRLSEENLPEGAVCITFDDGYRDNFTEAFPVLSRFGFSAMVFPVTGFVLGEGEHPRYRQSPVPVPYLTVDQVRQMKAAGIEFGCHTHMHALLPEVSDNQAKDELCQAKKLLEDWIAAPVEVFAYPNGAFRKGHFPLLEQLGFRAAFSVMPGVNRRETDRWILRRTEVSGRDSLRDFMHKMRGGLDLWQGLYQSVKGFYR
>NC_018649.1|WP_014960531.1|720327_721512_+|glycosyltransferase
MNEHPFKILYLMTDPFGMGGVQSDLKALGPYFVSRGHEVVVACPSGDQVDVLTRGGVTHIPFSVHFRTPGQFGDQARKLRSLIERVQPTVLAPQSIRASWICHAAAKNLPLARVTTIHNIHSNMNALWAGVILNRASHLVIFESDHEHRRITRLGLSRRKTRVIPSGIDTETFYPDPEARQKMRAALPDLGPDDVVFGCVARLSEEKAHDNLLASYAVVRKSYPKTRLVLVGDGPLRGEIESRARELGIAPFVHFAGQQRNVREWLNLFDVFVLASTRESLPRAAREAMACGLPVIATRVGATREAVRDGENGFLVPPAQVDSFARAMIHLLFDPDLRVRMGRESRRMIDARFSQSTWLADNESVYKVAGSLAGRFSSREIGPRLLDPAVTPCS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_018649_1	1.1\|521178\|30\|NC_018649\|CRISPRCasFinder	521178-521207	30	MT740307	Pseudomonas phage phiK7A1, complete genome	16503-16532	7	0.767
NC_018649_1	1.1\|521178\|30\|NC_018649\|CRISPRCasFinder	521178-521207	30	MK448495	Streptococcus satellite phage Javan434, complete genome	3286-3315	8	0.733

1. spacer 1.1|521178|30|NC_018649|CRISPRCasFinder matches to MT740307 (Pseudomonas phage phiK7A1, complete genome) position: , mismatch: 7, identity: 0.767

actgttttgacgatttccatcagttggtca	CRISPR spacer
agttgcttgatgatttcaatcagttggtcg	Protospacer
* *  .****.****** ***********.

2. spacer 1.1|521178|30|NC_018649|CRISPRCasFinder matches to MK448495 (Streptococcus satellite phage Javan434, complete genome) position: , mismatch: 8, identity: 0.733

actgttttgacgatttccatcagttggtca	CRISPR spacer
aagtttttgaagatttccagcagttggcat	Protospacer
*   ****** ******** *******.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2650 : 15498

Bacillus_virus(28.57%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014959781.1\|2650_5107_+	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	1.4e-13	46.0
WP_014959782.1\|5162_7613_+	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	2.3e-101	34.0
WP_041772002.1\|7593_8409_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_014959785.1\|8454_9093_+	radical SAM protein	S4TZT1	uncultured_phage	6.4e-27	38.2
WP_014959786.1\|9095_9821_+	7-cyano-7-deazaguanine synthase QueC	A0A1B0Z0B4	Vibrio_phage	2.7e-21	32.0
WP_050995624.1\|9936_11538_+	leucyl aminopeptidase	Q6GYZ8	Mycoplasma_phage	1.7e-44	35.6
WP_014959788.1\|11600_12092_+	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	1.9e-26	42.4
WP_041772005.1\|14301_15498_-\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	1.3e-73	43.1

DBSCAN-SWA_2

262500 : 316732

Brevibacillus_phage(10.0%)

transposase,integrase,tRNA,protease

attL 276381:276395|attR 284261:284275

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014960050.1\|262500_263898_+\|tRNA	methylenetetrahydrofolate--tRNA-(uracil(54)- C(5))-methyltransferase (FADH(2)-oxidizing) TrmFO	NA	NA	NA	NA
WP_014960051.1\|263887_264856_+\|integrase	tyrosine-type recombinase/integrase	A0A0K2CP59	Brevibacillus_phage	5.9e-24	28.9
WP_014960052.1\|264839_265436_+\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_014960053.1\|265432_266767_+\|protease	ATP-dependent protease ATPase subunit HslU	A0A2H5BJT2	Erwinia_phage	1.5e-38	29.4
WP_101494950.1\|266823_267693_+	acetylglutamate kinase	NA	NA	NA	NA
WP_077305151.1\|267975_268617_+	dUTP diphosphatase	Q2NP83	Xanthomonas_phage	1.0e-35	50.0
WP_014960057.1\|268644_270108_-	TolC family protein	NA	NA	NA	NA
WP_014960058.1\|270100_271231_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_101494951.1\|271223_274403_-	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	1.5e-60	22.0
WP_014960060.1\|274588_275434_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	5.0e-51	48.2
WP_014960061.1\|275426_276287_-	pantoate--beta-alanine ligase	NA	NA	NA	NA
WP_041772394.1\|276371_277187_+	carbon-nitrogen hydrolase	M1I5T1	Acanthocystis_turfacea_Chlorella_virus	8.0e-14	29.3
276381:276395	attL	NA	NA	NA	NA
WP_014960063.1\|277259_277547_+	metal/formaldehyde-sensitive transcriptional repressor	NA	NA	NA	NA
WP_014960065.1\|278167_278695_+	hypothetical protein	NA	NA	NA	NA
WP_014960068.1\|279866_280970_+	hypothetical protein	NA	NA	NA	NA
WP_014960069.1\|281109_281601_+	hypothetical protein	NA	NA	NA	NA
WP_014960070.1\|281971_282856_-\|integrase	site-specific integrase	B5WZU7	Pseudomonas_phage	1.0e-59	48.7
WP_014960071.1\|283025_283343_-	nucleotidyltransferase domain-containing protein	NA	NA	NA	NA
WP_041772034.1\|283320_283731_-	nucleotidyltransferase substrate binding protein	NA	NA	NA	NA
WP_050995505.1\|283945_284929_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
284261:284275	attR	NA	NA	NA	NA
WP_050995505.1\|285153_286137_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_050995505.1\|286361_287345_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_014960075.1\|287945_289091_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_014959795.1\|290866_291925_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_041772035.1\|292099_292492_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_014960079.1\|292466_292787_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_041772400.1\|293070_294792_-\|transposase	IS1634 family transposase	NA	NA	NA	NA
WP_143461138.1\|295260_295401_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_041772403.1\|296938_298435_+	hypothetical protein	NA	NA	NA	NA
WP_014960086.1\|298642_299410_-	hypothetical protein	NA	NA	NA	NA
WP_014960087.1\|299658_300237_+	hypothetical protein	NA	NA	NA	NA
WP_014960088.1\|300264_301527_-	MFS transporter	NA	NA	NA	NA
WP_101494852.1\|301905_302565_+	oxidoreductase	NA	NA	NA	NA
WP_014960090.1\|302873_303305_-	putative toxin-antitoxin system toxin component, PIN family	NA	NA	NA	NA
WP_014960091.1\|303311_303605_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_014960092.1\|303769_304099_+	hypothetical protein	NA	NA	NA	NA
WP_014960093.1\|304159_304537_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_038506638.1\|304533_304731_-	type II toxin-antitoxin system VapB family antitoxin	NA	NA	NA	NA
WP_014960095.1\|304960_305896_-	radical SAM protein	NA	NA	NA	NA
WP_014960096.1\|305883_306870_-	thiamine biosynthesis protein	NA	NA	NA	NA
WP_014960097.1\|306866_307181_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_041772038.1\|309848_310058_+	type II toxin-antitoxin system prevent-host-death family antitoxin	NA	NA	NA	NA
WP_014960102.1\|310057_310342_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_148274342.1\|310474_311377_-	hypothetical protein	NA	NA	NA	NA
WP_014960104.1\|311394_312228_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A1V0SCZ1	Indivirus	5.3e-13	26.9
WP_014960105.1\|312375_313101_+	hypothetical protein	NA	NA	NA	NA
WP_014960106.1\|313107_314106_-	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	1.7e-10	26.1
WP_014960107.1\|314092_314719_-	crossover junction resolvasome subunit RuvA	NA	NA	NA	NA
WP_014960108.1\|314715_315249_-	crossover junction endodeoxyribonuclease RuvC	NA	NA	NA	NA
WP_014960109.1\|315229_316732_-\|protease	DegQ family serine endoprotease	A0A1B1IT49	uncultured_Mediterranean_phage	2.7e-31	30.4

DBSCAN-SWA_3

527149 : 580185

Acidithiobacillus_phage(20.0%)

transposase,integrase

attL 520946:520966|attR 547264:547284

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
520946:520966	attL	NA	NA	NA	NA
WP_014959795.1\|527149_528208_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_014959793.1\|528603_529821_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	3.3e-112	55.6
WP_014960075.1\|529977_531123_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_148274270.1\|531875_532223_+	hypothetical protein	NA	NA	NA	NA
WP_014960336.1\|532215_533646_+	type IV secretion system DNA-binding domain-containing protein	NA	NA	NA	NA
WP_014960338.1\|533911_534403_+	relaxase domain-containing protein	NA	NA	NA	NA
WP_014960259.1\|534618_536175_+\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	7.9e-111	44.9
WP_014960260.1\|536168_536900_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	2.4e-57	48.8
WP_081579018.1\|537040_539368_+	AAA family ATPase	NA	NA	NA	NA
WP_041772068.1\|539424_539628_+	hypothetical protein	NA	NA	NA	NA
WP_014960341.1\|539641_539980_+	hypothetical protein	NA	NA	NA	NA
WP_041772069.1\|539963_540179_+	hypothetical protein	NA	NA	NA	NA
WP_041772070.1\|540348_541080_+	hypothetical protein	NA	NA	NA	NA
WP_148274271.1\|541104_541734_+	hypothetical protein	NA	NA	NA	NA
WP_014960344.1\|541744_542074_+	hypothetical protein	NA	NA	NA	NA
WP_148274272.1\|542120_542450_+	hypothetical protein	NA	NA	NA	NA
WP_014960346.1\|542655_542898_+	hypothetical protein	NA	NA	NA	NA
WP_041772073.1\|542990_543521_+	hypothetical protein	NA	NA	NA	NA
WP_014960347.1\|543535_543781_+	hypothetical protein	NA	NA	NA	NA
WP_014960348.1\|543777_544020_+	hypothetical protein	NA	NA	NA	NA
WP_187288716.1\|544102_545068_+	AAA family ATPase	A0A2P0VN73	Tetraselmis_virus	2.7e-08	25.6
WP_014960350.1\|545060_545699_-	YqhA family protein	NA	NA	NA	NA
WP_014960351.1\|545688_545847_-	hypothetical protein	NA	NA	NA	NA
WP_041772074.1\|545984_546191_-	hypothetical protein	NA	NA	NA	NA
WP_014960353.1\|546187_547207_-\|integrase	site-specific integrase	W6MYA3	Pseudomonas_phage	1.7e-66	42.9
WP_014960354.1\|547436_547649_-	CbtB-domain containing protein	NA	NA	NA	NA
547264:547284	attR	NA	NA	NA	NA
WP_038506735.1\|547725_548022_-	glutaredoxin	NA	NA	NA	NA
WP_014960356.1\|548310_549663_+	CbbQ/NirQ/NorQ C-terminal domain-containing protein	NA	NA	NA	NA
WP_014960357.1\|549666_551319_+	hypothetical protein	NA	NA	NA	NA
WP_014960358.1\|551365_551986_+	hypothetical protein	NA	NA	NA	NA
WP_014960359.1\|551977_552592_-	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_014960360.1\|552998_555107_+	bifunctional diguanylate cyclase/phosphodiesterase	A0A127AWB9	Bacillus_phage	6.4e-15	31.4
WP_023525849.1\|555371_555992_+	hypothetical protein	NA	NA	NA	NA
WP_014960362.1\|556109_556298_+	YqaE/Pmp3 family membrane protein	NA	NA	NA	NA
WP_014960364.1\|556566_557496_+	hypothetical protein	NA	NA	NA	NA
WP_014960365.1\|557552_558200_+	hypothetical protein	NA	NA	NA	NA
WP_179108891.1\|558910_559705_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_014960367.1\|560305_560632_+	hypothetical protein	NA	NA	NA	NA
WP_041772078.1\|560631_563985_+	toprim domain-containing protein	A0A088C3Q3	Shewanella_sp._phage	1.2e-18	26.2
WP_014960370.1\|564203_564617_+	hypothetical protein	NA	NA	NA	NA
WP_014960371.1\|564629_565304_+	hypothetical protein	NA	NA	NA	NA
WP_014960372.1\|565358_566027_+	hypothetical protein	NA	NA	NA	NA
WP_179108892.1\|566023_566194_+	hypothetical protein	NA	NA	NA	NA
WP_014960374.1\|566488_569386_+	relaxase domain-containing protein	V5UQN3	Mycobacterium_phage	1.7e-13	23.2
WP_014960375.1\|569559_569691_+	ORF6N domain-containing protein	NA	NA	NA	NA
WP_014960377.1\|570364_570769_-	hypothetical protein	NA	NA	NA	NA
WP_101494909.1\|570888_571242_-	hypothetical protein	NA	NA	NA	NA
WP_014960379.1\|571268_571649_-	copper-binding protein	NA	NA	NA	NA
WP_179108894.1\|571645_574834_-	CusA/CzcA family heavy metal efflux RND transporter	S5VTK5	Leptospira_phage	6.9e-61	21.9
WP_014960381.1\|574842_576099_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_014960382.1\|576088_577516_-	TolC family protein	NA	NA	NA	NA
WP_143461203.1\|577999_578215_+	hypothetical protein	NA	NA	NA	NA
WP_179108893.1\|578542_578818_+	hypothetical protein	NA	NA	NA	NA
WP_014960386.1\|578874_580185_+\|transposase	ISL3 family transposase	A0A2D1GQC1	Lysinibacillus_phage	8.5e-82	39.2

DBSCAN-SWA_4

622469 : 640682

Pseudomonas_phage(15.38%)

integrase,terminase

attL 636154:636169|attR 650094:650109

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014960441.1\|622469_623726_-\|terminase	PBSX family phage terminase large subunit	A0A2H4J196	uncultured_Caudovirales_phage	3.4e-112	51.3
WP_014960442.1\|623709_624252_-\|terminase	terminase small subunit	H2BD75	Pseudomonas_phage	2.6e-13	33.6
WP_014960443.1\|624248_624458_-	hypothetical protein	NA	NA	NA	NA
WP_014960444.1\|624468_625773_-	AAA family ATPase	U5PWH9	Acinetobacter_phage	3.7e-29	30.0
WP_014960445.1\|626025_627972_-	PriCT-2 domain-containing protein	M4QC51	Vibrio_phage	2.2e-25	34.5
WP_014960446.1\|627968_628376_-	RusA family crossover junction endodeoxyribonuclease	F8TV31	EBPR_siphovirus	2.9e-17	41.3
WP_014960447.1\|628372_628612_-	hypothetical protein	NA	NA	NA	NA
WP_014960448.1\|628679_628964_+	hypothetical protein	NA	NA	NA	NA
WP_081579079.1\|629078_629255_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_187288717.1\|629318_630014_+	LexA family transcriptional regulator	A0A1B0T6H5	Thiobacimonas_phage	9.2e-19	36.6
WP_041772093.1\|630051_630567_+	hypothetical protein	NA	NA	NA	NA
WP_014960450.1\|630629_630917_+	hypothetical protein	NA	NA	NA	NA
WP_148274273.1\|631066_631333_+	hypothetical protein	NA	NA	NA	NA
WP_014960451.1\|631575_631854_+	hypothetical protein	NA	NA	NA	NA
WP_179110176.1\|631853_631994_+	hypothetical protein	NA	NA	NA	NA
WP_041772096.1\|632005_632197_+	hypothetical protein	NA	NA	NA	NA
WP_014960452.1\|632190_632592_+	hypothetical protein	NA	NA	NA	NA
WP_014960453.1\|632588_633269_+	ATP-binding protein	A0A0R6PKU1	Moraxella_phage	2.5e-61	53.5
WP_014960454.1\|633265_633763_+	DUF669 domain-containing protein	A0A088FAP5	Vibrio_phage	8.6e-27	44.2
WP_087586898.1\|633780_634329_+	HNH endonuclease	J7I0T2	Pseudomonas_phage	9.5e-11	42.7
WP_014960456.1\|634492_635155_+	hypothetical protein	A0A2I2L6K5	Escherichia_phage	6.2e-41	40.8
WP_179110175.1\|635127_636765_+	DEAD/DEAH box helicase family protein	A0A1J0GWD7	Alteromonas_phage	3.4e-112	40.5
636154:636169	attL	NA	NA	NA	NA
WP_014960458.1\|636727_637234_+	hypothetical protein	NA	NA	NA	NA
WP_014960459.1\|637220_637718_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_041772098.1\|637714_638371_+	HNH endonuclease	M1PKJ5	Streptococcus_phage	1.8e-16	35.4
WP_014960462.1\|638354_638591_+	hypothetical protein	NA	NA	NA	NA
WP_041772099.1\|638587_638794_+	hypothetical protein	NA	NA	NA	NA
WP_041772100.1\|638790_639021_+	hypothetical protein	NA	NA	NA	NA
WP_014960463.1\|639017_639434_+	hypothetical protein	NA	NA	NA	NA
WP_014960464.1\|639659_640682_+\|integrase	site-specific integrase	Q7Y5X7	Haemophilus_phage	3.0e-82	46.3
650094:650109	attR	NA	NA	NA	NA

DBSCAN-SWA_5

818116 : 824726

Acinetobacter_phage(16.67%)

integrase

attL 812323:812337|attR 826269:826283

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
812323:812337	attL	NA	NA	NA	NA
WP_014960623.1\|818116_818320_-	type II toxin-antitoxin system HicB family antitoxin	A0A0D4DCG1	Acinetobacter_phage	2.2e-05	47.9
WP_014960624.1\|818333_819518_-\|integrase	site-specific integrase	A0A221SAN4	Ralstonia_phage	8.8e-38	31.0
WP_014960626.1\|820236_821394_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	2.6e-119	57.0
WP_014960627.1\|821470_822727_+	adenosylhomocysteinase	S4W1G4	Pandoravirus	9.0e-65	36.0
WP_014960628.1\|822730_822961_+	sulfur carrier protein ThiS	NA	NA	NA	NA
WP_101494882.1\|822896_823877_+	cysteine synthase A	A0A1W6JIM2	Lactococcus_phage	1.5e-70	50.7
WP_014960630.1\|823913_824726_+	molybdopterin-synthase adenylyltransferase MoeB	A0A1V0SAV8	Catovirus	3.3e-12	26.3
826269:826283	attR	NA	NA	NA	NA

DBSCAN-SWA_6

1228591 : 1238275

Staphylococcus_phage(28.57%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014961032.1\|1228591_1230064_+\|tRNA	cysteine--tRNA ligase	A0A0G2Y344	Acanthamoeba_polyphaga_mimivirus	3.9e-43	32.4
WP_041772140.1\|1230078_1230795_+	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	NA	NA	NA	NA
WP_179110116.1\|1230937_1231576_+	redoxin domain-containing protein	A0A1J0GW78	Streptomyces_phage	3.7e-06	35.8
WP_014961035.1\|1231572_1233351_+	NAD+ synthase	A0A2L0UZF5	Agrobacterium_phage	8.0e-75	30.7
WP_014961036.1\|1233402_1234605_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	9.1e-99	47.1
WP_143461499.1\|1234629_1235109_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	3.8e-16	34.8
WP_014961038.1\|1235105_1235612_+	transcription antitermination factor NusB	NA	NA	NA	NA
WP_014961039.1\|1235608_1236109_+	hypothetical protein	NA	NA	NA	NA
WP_014961040.1\|1236195_1237509_+	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	8.6e-18	33.0
WP_143461497.1\|1237474_1238275_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3HI61	Synechococcus_phage	3.1e-42	39.2

DBSCAN-SWA_7

1542930 : 1591965

Escherichia_phage(20.0%)

transposase,integrase,tRNA,protease

attL 1567105:1567120|attR 1592502:1592517

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014961328.1\|1542930_1543494_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_014961329.1\|1543512_1544136_-	50S ribosomal protein L25	NA	NA	NA	NA
WP_014961330.1\|1544198_1545143_-	ribose-phosphate pyrophosphokinase	A0A1V0SHF7	Hokovirus	2.7e-45	35.4
WP_014961331.1\|1545291_1546173_-	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
WP_023525312.1\|1546169_1547558_-	DUF512 domain-containing protein	NA	NA	NA	NA
WP_143461514.1\|1547571_1548108_-	CDP-alcohol phosphatidyltransferase family protein	NA	NA	NA	NA
WP_148274311.1\|1548122_1549370_-	hypothetical protein	NA	NA	NA	NA
WP_014961335.1\|1549518_1550172_+	hypothetical protein	NA	NA	NA	NA
WP_014961336.1\|1550168_1551449_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	8.1e-130	56.9
WP_014961337.1\|1551475_1552087_-	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	1.6e-54	56.8
WP_148274312.1\|1552111_1553527_-	hypothetical protein	NA	NA	NA	NA
WP_014961339.1\|1553712_1554957_-	FAD-dependent monooxygenase	NA	NA	NA	NA
WP_014961340.1\|1554953_1556702_-	hypothetical protein	NA	NA	NA	NA
WP_014961341.1\|1556712_1558200_-	glucose-6-phosphate dehydrogenase	E3SKF6	Synechococcus_phage	2.6e-79	35.8
WP_014961342.1\|1558296_1561230_-	bifunctional transaldolase/phosoglucose isomerase	NA	NA	NA	NA
WP_014961343.1\|1561288_1563322_-	transketolase	NA	NA	NA	NA
WP_014961344.1\|1563358_1564189_-	6-phosphogluconolactonase	NA	NA	NA	NA
WP_014961345.1\|1564326_1565361_-	glucokinase	NA	NA	NA	NA
WP_099590563.1\|1565915_1566482_-	hypothetical protein	NA	NA	NA	NA
WP_014959795.1\|1566698_1567757_+\|transposase	IS110 family transposase	NA	NA	NA	NA
1567105:1567120	attL	NA	NA	NA	NA
WP_014959793.1\|1568152_1569370_+\|transposase	IS256 family transposase	A0A0K2CZ57	Paenibacillus_phage	3.3e-112	55.6
WP_014961348.1\|1569423_1570830_-	hypothetical protein	NA	NA	NA	NA
WP_041772164.1\|1570975_1571434_-	hypothetical protein	NA	NA	NA	NA
WP_041772165.1\|1571456_1571912_+	hypothetical protein	NA	NA	NA	NA
WP_041772167.1\|1572257_1572461_+	hypothetical protein	NA	NA	NA	NA
WP_014961350.1\|1572805_1573639_-	HDOD domain-containing protein	NA	NA	NA	NA
WP_014961351.1\|1573847_1574174_-	hypothetical protein	NA	NA	NA	NA
WP_014961352.1\|1574650_1575679_+	adenosyl-hopene transferase HpnH	NA	NA	NA	NA
WP_014961353.1\|1575761_1576763_+	zinc-dependent alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_014961354.1\|1576788_1577472_+	metallophosphoesterase	Q71TJ1	Escherichia_phage	3.3e-13	31.7
WP_014961355.1\|1577485_1578874_-	protoporphyrinogen oxidase	NA	NA	NA	NA
WP_036083671.1\|1579082_1579319_+	hypothetical protein	NA	NA	NA	NA
WP_143468997.1\|1579390_1579942_+	DMT family transporter	NA	NA	NA	NA
WP_014961359.1\|1579938_1581651_+	chloride channel protein	NA	NA	NA	NA
WP_041772168.1\|1581892_1582969_+\|integrase	site-specific integrase	W6MYA3	Pseudomonas_phage	5.5e-63	42.0
WP_050995547.1\|1583181_1583757_+	hypothetical protein	NA	NA	NA	NA
WP_014961362.1\|1583747_1584689_+	hypothetical protein	NA	NA	NA	NA
WP_014961363.1\|1584861_1585263_+	hypothetical protein	NA	NA	NA	NA
WP_014961364.1\|1585720_1586452_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	1.2e-58	48.4
WP_014961366.1\|1587626_1589237_+\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	9.5e-51	32.7
WP_014961367.1\|1589227_1589971_+	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	1.3e-23	31.1
WP_014961369.1\|1590818_1590971_-	hypothetical protein	NA	NA	NA	NA
WP_014961371.1\|1591407_1591965_-\|transposase	IS21 family transposase	NA	NA	NA	NA
1592502:1592517	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_018649

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection