CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NC_017484	Lactococcus lactis subsp. lactis CV56 plasmid pCV56C, complete sequence	0 crisprs	NA	0	0
NC_017488	Lactococcus lactis subsp. lactis CV56 plasmid pCV56E, complete sequence	1 crisprs	NA	1	0
NC_017485	Lactococcus lactis subsp. lactis CV56 plasmid pCV56D, complete sequence	0 crisprs	NA	0	0
NC_017487	Lactococcus lactis subsp. lactis CV56 plasmid pCV56B, complete sequence	0 crisprs	NA	0	0
NC_017486	Lactococcus lactis subsp. lactis CV56, complete sequence	1 crisprs	cas3,DEDDh,csa3,DinG	0	9
NC_017483	Lactococcus lactis subsp. lactis CV56 plasmid pCV56A, complete sequence	0 crisprs	NA	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_017486_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_017486_1

1787844-1787938

Orphan

Consensus_repeat	Method
TTTATTACTGACAGACTTGTCAGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_017486_1

>merge|NC_017486|1|1787844-1787938|CRISPRCasFinder
TTTATTACTGACAGACTTGTCAGCTTTGCTGACAAATCCTTCATCCATTGATAAAAAGCTCAATTCAATCGCTTTTTACTGACAGACTTGTCAGC

>NC_017486|1|1|1787844-1787938|CRISPRCasFinder
TTTATTACTGACAGACTTGTCAGC	TTTGCTGACAAATCCTTCATCCATTGATAAAAAGCTCAATTCAATCG
CTTTTTACTGACAGACTTGTCAGC

Protein	Signature genes	Signature genes Name	Protein_function
NC_017486.1\|WP_014570698.1\|1790331_1791588_-\|Fe-S-cluster-assembly-protein-SufD	unknown	unknown	gnl\|CDD\|223791
NC_017486.1\|WP_004255181.1\|1791725_1792496_-\|Fe-S-cluster-assembly-ATPase-SufC	unknown	unknown	gnl\|CDD\|223473
NC_017486.1\|WP_004255158.1\|1795569_1796256_-\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836
NC_017486.1\|WP_004255218.1\|1782895_1784044_+\|acetyl-CoA-C-acyltransferase	unknown	unknown	gnl\|CDD\|273881
NC_017486.1\|WP_004255213.1\|1784646_1785402_+\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|187594
NC_017486.1\|WP_004255217.1\|1784040_1784391_+\|hypothetical-protein	unknown	unknown	unknown
NC_017486.1\|WP_003130548.1\|1796402_1797311_-\|diacylglycerol-kinase-family-lipid-kinase	unknown	unknown	gnl\|CDD\|224513
NC_017486.1\|WP_004255171.1\|1794835_1795570_-\|amino-acid-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224051
NC_017486.1\|WP_004255194.1\|1788630_1789113_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223659
NC_017486.1\|WP_004255177.1\|1792670_1794002_-\|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase	unknown	unknown	gnl\|CDD\|133463
NC_017486.1\|WP_004255207.1\|1786410_1787823_-\|Fe-S-cluster-assembly-protein-SufB	unknown	unknown	gnl\|CDD\|131035
NC_017486.1\|WP_004255221.1\|1781664_1782906_+\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|341288
NC_017486.1\|WP_010906134.1\|1779651_1779957_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226801
NC_017486.1\|WP_004255227.1\|1779973_1780945_-\|biotin--[acetyl-CoA-carboxylase]-ligase	unknown	unknown	gnl\|CDD\|237010
NC_017486.1\|WP_004255215.1\|1784365_1784659_+\|hypothetical-protein	unknown	unknown	unknown
NC_017486.1\|WP_004255197.1\|1788056_1788515_-\|SUF-system-NifU-family-Fe-S-cluster-assembly-protein	unknown	unknown	gnl\|CDD\|273918
NC_017486.1\|WP_004255173.1\|1794004_1794706_-\|adaptor-protein-MecA	unknown	unknown	gnl\|CDD\|227199
NC_017486.1\|WP_004255210.1\|1785424_1786270_+\|nitronate-monooxygenase	unknown	unknown	gnl\|CDD\|132195
NC_017486.1\|WP_004255224.1\|1780950_1781520_-\|biotin-transporter-BioY	unknown	unknown	gnl\|CDD\|224187
NC_017486.1\|WP_004255189.1\|1789114_1790332_-\|cysteine-desulfurase	unknown	unknown	gnl\|CDD\|131034

Protein	Function_ID	Function_description	E-value
NC_017486.1\|WP_014570698.1\|1790331_1791588_-\|Fe-S-cluster-assembly-protein-SufD	gnl\|CDD\|223791	COG0719, SufB, Cysteine desulfurase activator SufB [Posttranslational modification, protein turnover, chaperones].	5.11409e-131
NC_017486.1\|WP_004255181.1\|1791725_1792496_-\|Fe-S-cluster-assembly-ATPase-SufC	gnl\|CDD\|223473	COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones].	2.57723e-148
NC_017486.1\|WP_004255158.1\|1795569_1796256_-\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	4.09368e-76
NC_017486.1\|WP_004255218.1\|1782895_1784044_+\|acetyl-CoA-C-acyltransferase	gnl\|CDD\|273881	TIGR01930, 3-ketoacyl-CoA_thiolase, acetyl-CoA acetyltransferases. This model represents a large family of enzymes which catalyze the thiolysis of a linear fatty acid CoA (or acetoacetyl-CoA) using a second CoA molecule to produce acetyl-CoA and a CoA-ester product two carbons shorter (or, alternatively, the condensation of two molecules of acetyl-CoA to produce acetoacetyl-CoA and CoA). This enzyme is also known as "thiolase", "3-ketoacyl-CoA thiolase", "beta-ketothiolase" and "Fatty oxidation complex beta subunit". When catalyzing the degradative reaction on fatty acids the corresponding EC number is 2.3.1.16. The condensation reaction corresponds to 2.3.1.9. Note that the enzymes which catalyze the condensation are generally not involved in fatty acid biosynthesis, which is carried out by a decarboxylating condensation of acetyl and malonyl esters of acyl carrier proteins. Rather, this activity may produce acetoacetyl-CoA for pathways such as IPP biosynthesis in the absence of sufficient fatty acid oxidation. [Fatty acid and phospholipid metabolism, Other].	3.89269e-158
NC_017486.1\|WP_003130548.1\|1796402_1797311_-\|diacylglycerol-kinase-family-lipid-kinase	gnl\|CDD\|224513	COG1597, LCB5, Sphingosine kinase and enzymes related to eukaryotic diacylglycerol kinase [Lipid metabolism / General function prediction only].	2.39571e-70
NC_017486.1\|WP_004255171.1\|1794835_1795570_-\|amino-acid-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	1.02808e-157
NC_017486.1\|WP_004255194.1\|1788630_1789113_-\|hypothetical-protein	gnl\|CDD\|223659	COG0586, DedA, Uncharacterized membrane-associated protein [Function unknown].	5.11388e-22
NC_017486.1\|WP_004255177.1\|1792670_1794002_-\|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase	gnl\|CDD\|133463	cd06853, GT_WecA_like, This subfamily contains Escherichia coli WecA, Bacillus subtilis TagO and related proteins. WecA is an UDP-N-acetylglucosamine (GlcNAc):undecaprenyl-phosphate (Und-P) GlcNAc-1-phosphate transferase that catalyzes the formation of a phosphodiester bond between a membrane-associated undecaprenyl-phosphate molecule and N-acetylglucosamine 1-phosphate, which is usually donated by a soluble UDP-N-acetylglucosamine precursor. WecA participates in the biosynthesis of O antigen LPS in many enteric bacteria and is also involved in the biosynthesis of enterobacterial common antigen. A conserved short sequence motif and a conserved arginine at a cytosolic loop of this integral membrane protein were shown to be critical in recognition of substrate UDP-N-acetylglucosamine.	5.23235e-85
NC_017486.1\|WP_004255207.1\|1786410_1787823_-\|Fe-S-cluster-assembly-protein-SufB	gnl\|CDD\|131035	TIGR01980, UPF0051_protein_slr0074, FeS assembly protein SufB. This protein, SufB, forms a cytosolic complex SufBCD. This complex enhances the cysteine desulfurase of SufSE. The system, together with SufA, is believed to act in iron-sulfur cluster formation during oxidative stress. Note that SufC belongs to the family of ABC transporter ATP binding proteins, so this protein, encoded by an adjacent gene, has often been annotated as a transporter component. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	0
NC_017486.1\|WP_004255221.1\|1781664_1782906_+\|AMP-binding-protein	gnl\|CDD\|341288	cd17633, AFD_YhfT-like, fatty acid-CoA ligase VraA. This family of acyl-CoA ligases includes Bacillus subtilis YhfT, as well as long-chain fatty acid-CoA ligase VraA, all of which are as yet to be characterized. These proteins belong to the adenylate-forming enzymes which catalyze an ATP-dependent two-step reaction to first activate a carboxylate substrate as an adenylate and then transfer the carboxylate to the pantetheine group of either coenzyme A or an acyl-carrier protein. The active site of the domain is located at the interface of a large N-terminal subdomain and a smaller C-terminal subdomain	3.2301e-68
NC_017486.1\|WP_010906134.1\|1779651_1779957_-\|hypothetical-protein	gnl\|CDD\|226801	COG4357, COG4357, Zinc finger domain containing protein (CHY type) [Function unknown].	1.12966e-28
NC_017486.1\|WP_004255227.1\|1779973_1780945_-\|biotin--[acetyl-CoA-carboxylase]-ligase	gnl\|CDD\|237010	PRK11886, PRK11886, bifunctional biotin--[acetyl-CoA-carboxylase] ligase/biotin operon repressor BirA.	8.8094e-70
NC_017486.1\|WP_004255213.1\|1784646_1785402_+\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|187594	cd05333, BKR_SDR_c, beta-Keto acyl carrier protein reductase (BKR), involved in Type II FAS, classical (c) SDRs. This subgroup includes the Escherichai coli K12 BKR, FabG. BKR catalyzes the NADPH-dependent reduction of ACP in the first reductive step of de novo fatty acid synthesis (FAS). FAS consists of four elongation steps, which are repeated to extend the fatty acid chain through the addition of two-carbo units from malonyl acyl-carrier protein (ACP): condensation, reduction, dehydration, and a final reduction. Type II FAS, typical of plants and many bacteria, maintains these activities on discrete polypeptides, while type I FAS utilizes one or two multifunctional polypeptides. BKR resembles enoyl reductase, which catalyzes the second reduction step in FAS. SDRs are a functionally diverse family of oxidoreductases that have a single domain with structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet) NAD(P)(H) binding region and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H) binding pattern: TGxxxGxG in classical SDRs. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P) binding motif and an altered active site motif (YXXXN). Fungal type type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P) binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr-151 and Lys-155, and well as Asn-111 (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs.	7.26065e-73
NC_017486.1\|WP_004255197.1\|1788056_1788515_-\|SUF-system-NifU-family-Fe-S-cluster-assembly-protein	gnl\|CDD\|273918	TIGR01994, Iron-sulfur_cluster_assembly_scaffold_protein_IscU, SUF system FeS assembly protein, NifU family. Three iron-sulfur cluster assembly systems are known so far. ISC is broadly distributed while NIF tends to be associated with nitrogenase in nitrogen-fixing bacteria. The most recently described is SUF, believed to be important to maintain the function during aerobic stress of enzymes with labile Fe-S clusters. It is fairly widely distributed. This family represents one of two different proteins proposed to act as a scaffold on which the Fe-S cluster is built and from which it is transferred. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	9.34852e-67
NC_017486.1\|WP_004255173.1\|1794004_1794706_-\|adaptor-protein-MecA	gnl\|CDD\|227199	COG4862, MecA, Negative regulator of genetic competence, sporulation and motility [Posttranslational modification, protein turnover, chaperones / Signal transduction mechanisms / Cell motility and secretion].	3.81196e-86
NC_017486.1\|WP_004255210.1\|1785424_1786270_+\|nitronate-monooxygenase	gnl\|CDD\|132195	TIGR03151, enACPred_II, putative enoyl-[acyl-carrier-protein] reductase II. This oxidoreductase of the 2-nitropropane dioxygenase family (pfam03060) is commonly found in apparent operons with genes involved in fatty acid biosynthesis. Furthermore, this genomic context generally includes the fabG 3-oxoacyl-[ACP] reductase and lacks the fabI enoyl-[ACP] reductase.	2.65942e-83
NC_017486.1\|WP_004255224.1\|1780950_1781520_-\|biotin-transporter-BioY	gnl\|CDD\|224187	COG1268, BioY, Uncharacterized conserved protein [General function prediction only].	5.72661e-47
NC_017486.1\|WP_004255189.1\|1789114_1790332_-\|cysteine-desulfurase	gnl\|CDD\|131034	TIGR01979, Probable_cysteine_desulfurase, cysteine desulfurases, SufSfamily. This model represents a subfamily of NifS-related cysteine desulfurases involved in FeS cluster formation needed for nitrogen fixation among other vital functions. Many cysteine desulfurases are also active as selenocysteine lyase and/or cysteine sulfinate desulfinase. This subfamily is associated with the six-gene SUF system described in E. coli and Erwinia as an FeS cluster formation system during oxidative stress. The active site Cys is this subfamily resembles GHHC with one or both His conserved. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	0

>NC_017486.1|WP_004255207.1|1786410_1787823_-|Fe-S-cluster-assembly-protein-SufB
MTENSTQEVVKDLEEYKFGFHDNAELEFTTGLGLTEEVIREISETKNEPEWMLEFRLKSFEAFKKLDMPKWGPDLSGIDFNDIVYYQKPSAKAARSWEDVPQEIKDTFEKIGIPEAERSYLAGASAQYESEVVYHNMKDEFEKLGIIFTDTDSGLRDYPEIFKKYFSKLVPPTDNKLAALNSAVWSGGSFVYVPKGVKCEIPIQAYFRINNEKSGQFERTLIIVEEGASIQYVEGCTAPTYSASSLHAAVVEIFVEEGGYMRYSTIQNWSDNVYNLVTKRAAAEKNATVEWIDGNLGSKVSMKYPAVHLNGPGARGTMLSIAFAGANQNQDTGAKMIHNAPNTSSSIISKSIAKNGGAVNYRGQVTFGKNSKKSASHIECDTILMDDLSKSDTVPFNEIHNSQVALEHEAKVSKISEEQLYYLMSRGLTEKEATDMIVMGFIEPFTKELPMEYAVELNRLISYSMEGSIG
>NC_017486.1|WP_004255210.1|1785424_1786270_+|nitronate-monooxygenase
MTWYHELGIKYPLFQGGMAWASNAELVAAVSNNGALGIIGSGGRTANELRRMIRKTKTLTSQPFGVNLMLLDKNIKQLLEVICEEKISVVTTGAGSPKEIIDTIIANNIKLFPVVPNKEIALKMLNLPISGIIVEGNEAGGHVGSQNLASLLKEIAPICPLPLIAAGGIYDHHTASLANILGANGVQVGTAFLLEKECQISPIYQELICKGEENGTSLISDKNGHLTRLLNISSEYPLNKSLKAAVEKGDLINGAFMAGSSSAYLEKIEPVENIIQRIMKK
>NC_017486.1|WP_004255213.1|1784646_1785402_+|SDR-family-NAD(P)-dependent-oxidoreductase
MEAMNKRTILITGATRGIGWAIAQKAAQANHKVILTGRDPLSLKSRAEELKKKFPKTEIQAIPLDVSNRSSVANAAKLIKDIDILINNAGITADSTFKKMSPEIWDEVISVNLTGVFNSTHALLDKINQGGQIITLTSKSALFGNFGQANYAASKAGIIAFTKTLAKELQKSMIRVNSVSPAAVTDMTLPVLKSLKETYGQNIPDEWKMGSSSDVANFIINDLIESEMTGKIFSINGSEIGYWQEPTFHKL
>NC_017486.1|WP_004255215.1|1784365_1784659_+|hypothetical-protein
MKLYKKINKADLIDYLQSVKDTNSLHYGKNPIIPGNFLLFILEEMYQEFYSMPLSYLKANFCSPAYLNERFCFIFNQNAFQITDRNQTLILKGEWKQ
>NC_017486.1|WP_004255217.1|1784040_1784391_+|hypothetical-protein
MILIAQKSLPRHFKLEGQKNFLSLLPQLWQELEGIPYSLKNGENWLLSEEIIRYPSSNYSFDKLKLYLLSEHITRHSKKYIINLSLEITSNTKLLAQINLSLLSEDSWNEIIQKNQ
>NC_017486.1|WP_004255218.1|1782895_1784044_+|acetyl-CoA-C-acyltransferase
MSFKNPVGIIAANRLPIGKINGFYKKISPETLYQNLIKQQFNKNLLLKKADIDYIILGNVTNQGGNLARRCALKAGFSSQVPAFTIDQQCGSGLKAMISSANYIISGEASVICTGGVESTSQANIVLDSESYQPINRFKMAPEPYEDFDMGTIADMTALKYNIPRSVQDLYALNSHKKATQAIEGKLLENEVFPYQDEGFTISSDQTVRPKSSMEALSKLTPAFTTNGTATAGNSCPINDGASSIILSSTNNPFDFQGYYLGQTTIALSPSDFLLGPIKATEKLLQKFNLKLNDIEAIELNEAFASQAILFQNYFKLDDIKLNAYGGSLAFGHPYGATGGILISRLLNRLNQVQKPCLGIATLCVAGGMGISVLIGNQWYQK
>NC_017486.1|WP_004255221.1|1781664_1782906_+|AMP-binding-protein
MEKNKFNFSKLAALFTDYPALKIGEISYSYQQINDLIQRKLTDYSHSSKTVITLINDSPLNFIIDFLAIIESGNYPLVVDKSFKKKSFKFGLIPEDTLFLASTSGTTGPPKIYYRNWESWKMGFEVCDDLFHLSNSQALATTSPLTTSLGLHTLMCALYLGKTFLTITNPSQFINITENYALFTVPTYLLNNLNELFALTSPEIIFLGGGTLSPEAINKVRKKLPQTQMIEFYGSSETSFISWQAVNEGKKTSSVGKLFPHVELTLGPKYRLTVKSPYLFSGYLNQPYPQSWTTDDLGTLKNNHLYLFGRRSDIIEHGANKIFPEEIERMAKDLCEDCIAFGVFDERYSQKIALLLLKPIEKEKLIKILAQRLPKYKLPQIYLETPTLNFTKNQKISRKELEKEYFRGVYHEL
>NC_017486.1|WP_004255224.1|1780950_1781520_-|biotin-transporter-BioY
MTKNQKVKTLTYSAFMTAFIIILGFLPGIPIGFIPVPIILQNMGIMMAGGLLGPKYGTISVGAFLTLALIGLPVLTGGNGGAASFLGPSGGYRMAWLFTPFLIGFFLKKLQITASKNWIGELIIVLVFGVIFVDLVGAIWLSIQSNIPLITSLISNLVFIPGDCIKAILTVLIVRRLRKEGGFEMYFRK
>NC_017486.1|WP_004255227.1|1779973_1780945_-|biotin--[acetyl-CoA-carboxylase]-ligase
MRTTKQFVLLKLLQQKGNWVSGDELAEELKLSRESIWKAINTLKRKGNQIESRKNLGYKYVGNESLDEDTINFYSGMKFEDKIFVFDEVTSTQELAKQYLSSHEVKQPFIFVANNQTEGHGRRGRNFYSPSDTGLYFSLILPNPSHDILKIGLLTTSTAVAVVKVLEQFYKDKNFQLKWVNDIYLGTYKVGGIITEAALDLESSSAGNFIMGIGLNLSTKDFPADLSEKAQGINPEFKIDRNQLLAEMAKEVINNFANYRQPDLIDEYRKRSLLFGKNVTLKLGTKAVNGKVEGISDDGSLILKAKSGELQTFKSGEVVKVDW
>NC_017486.1|WP_010906134.1|1779651_1779957_-|hypothetical-protein
MREKIWGKVIDEEGRCTHYHQENDIVALKCSDCEKYFSCYHCHDELENHLFRATDKEDFPVLCGHCGKKLNFNDYSRGECIKCSSAFNPNCHRHWQVYFNE
>NC_017486.1|WP_004255197.1|1788056_1788515_-|SUF-system-NifU-family-Fe-S-cluster-assembly-protein
MALSKLDNLYRAVILDHSSNPRHAGELQTGCMVDLNNPTCGDVIRLTVEFENDVISNIAFSGHGCTISTASASMMTVAVLGKTKEEAKELATIFSAMVTGETDERQEKLGDAQFLAGVSKFPARVKCSTLAWNALKKAIDVGEAQETVIHGE
>NC_017486.1|WP_004255194.1|1788630_1789113_-|hypothetical-protein
MLNWVASLPLWLATTFLFVVVFFRAQCTFWLGKLSYHGILKTKWGKKLEKNSETSAGILAIQKMGWPIIPLSFLTVGFQTAVQFGAGLTNWSWYKYTLAAIPGYLAWGFIYASGGLSLFRSLVQGSIGLLILFIIIILAVVIAANLILRYIRKNGIKTDD
>NC_017486.1|WP_004255189.1|1789114_1790332_-|cysteine-desulfurase
MLEGIKKDFPVLNQIVNDEPLVYLDNAATTQKPLKVLAAIKDYYENDNANVHRGVHTLAERATEKYEAAREKVRQFINAKSTKEVLFTRGTTTSINWVAQFAGQILKTGDEIVISIMEHHSNIVPWQEVAKKTGAILKFVYLKDGQLDMDDLRKKITNQTKFVSIAHVSNVLGTINPVEEITKIAHEHGAYMAVDGAQSTPHMAIDLQKMDVDFFAFSGHKMMGPTGIGVLYGKEELLNQFEPVEFGGEMIDFVYESHSTWTELPWKFEAGTPNIAGAIALGAAIDYIQELGIDQIHQHEIELIDYLMPKLQEIEGLKIYGPKDNVKRGGLIAFNIEGLHPHDVATALDMEGVAVRAGHHCAQPLLNYLETPATARASFYLYNTKADCDKLVEALKKTKEFFNLD
>NC_017486.1|WP_014570698.1|1790331_1791588_-|Fe-S-cluster-assembly-protein-SufD
MNQEILNFSQMHAEPAWLSDLRQKAALEFENLELPNIERVKINRWGLDHLSISENEEIGSVPTFTEIPNHPLLVQVGSQTVMEQMTPNLAEQGVIFTDFNSALTEIPELLEENFGSVVPFNESRLTAANTVTFNSGLVLYVPDGVEVLEPIESILMQEGSSEVPFNKRILIIVGKNAKVDYLERLETTDEQSSKAKANIVVEVIAKAGAQVKFAAIDRLGENVTASVVRRGLIGDNATVDWSVGVMNDGNVVADFDSDLKGNGSHSQIKVIGISTGHQTQGIDTRVTNFGLNSVGHILQNGVILDKGTLTFNAIGHIIKGAKNADAQQSSHVLMLSDKGRGDANPILLIDENEVTAGHAASVGQVDEEDLFYLQSRGLDEETAKRLVIRGFLGSVVSEIPVKSVQAEFIETIERKLGM
>NC_017486.1|WP_004255181.1|1791725_1792496_-|Fe-S-cluster-assembly-ATPase-SufC
MATLEIKNLHVAIEDKEILKGVNLVINTNEIHAIMGPNGTGKSTLSAAIMGNPNYSVTQGEVLFDGQNVLEMSVDERARLGLFLAMQYPSEIPGITNAEFLRAAMNAKRAEDDKVSVMEFIKKLDKNMEVLSMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPTFAILDEIDSGLDIDALKVVAKGVNSMRGEKFGALIITHYQRLLDYITPDVVHIMMDGRVVKTGGAELAKRLETEGYVNIAEELGLEYKEEV
>NC_017486.1|WP_004255177.1|1792670_1794002_-|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase
MVDTLKEIPFALKFLIVIIITFGISVILTPIMTFVSKAIGAVDKPNERRVNKKPMPSAGGLVIFIAFAIATLFILPHIVHNQPPIHSQPPVHGASHQPIQLVSYFSYIWPFIVGAGIVVLTGLIDDIKEISPKMKLLGLTVAASFIWFFTNARFDNLKIPFGGPLLIFPAWLSFIFTVFWILAITNAINLIDGLDGLASGVSIISLTTMGIVSYFFLPSPNVFLPITIFIMVAAIMGFFPYNYHPAIIYLGDTGALFLGFIISVASLQGLKNATAVAVLTPLLILGVPITDTIMAMVRRKLNRQSIATADKRHLHHRLMALGFTHHGAVLVIYGIASIFAFISILLQFSSRIGGILLVIACLFGLEIFIELVGILGENRQPVLKALKFVGNSSYRDKVLHSDEDADIDENEEDIGNHSMIDEEIDEPTQEFPIQNYRRSRNKK
>NC_017486.1|WP_004255173.1|1794004_1794706_-|adaptor-protein-MecA
MKYEDINENTIKITLSFDDLTDYDIKLSDFFGNQEVIEQFFYELVDELGLENRFGNVGMLTFQIQPFPQGVHMIVHEEAMLGEGGEIPDDPEEFEELMTGFYNKLNEIGADMARERGITDFKPGLGLPGTKKDEAEQEPDFIYYSIRYEDIMSVLTGIKNVKFADEESEFYRYDGNFYLVVLDNQKEKGKMHVESTRSRMMEYGEATKMSREFLQEYGECLIATRALDVLRKI
>NC_017486.1|WP_004255171.1|1794835_1795570_-|amino-acid-ABC-transporter-ATP-binding-protein
MNEYLIEIKNLHKYFGKNEVLKGLDIQIKKGEVVVMIGPSGSGKSTFLRTMNLLEKPTDGQVYFEGVNIADKSVDVFKHREKMGMVFQQFNLFPNMTVLENLCLAPVKTGKMTKEEAKKTAEDLLQRVGLSDKAEAYPQALSGGQQQRVAIARALAMNPDVMLFDEPTSALDPEMVGEVLAVMQELAKEGMTMVVVTHEMGFAKTVADRVLFMADGTIVEQGKPAQVFDSPKEKRTQDFLAKVL
>NC_017486.1|WP_004255158.1|1795569_1796256_-|amino-acid-ABC-transporter-permease
MNFDFLPKYLPYFNDGMIVTILISAFVVLIGTLLGIVTALAKISKIAPLRWLANIYIEIFRGTPMLVQIMLGFGLMGSLSLPTFQVGILQQDLGRLIPGIIVISLNSGAYMAEIVRAGIEAVPLGQKEAAYSLGIRPRQAMATVILPQALRNILPAVGNEFVTIIKDSSLLYTIGVMEVFNGAQTVANLTYQTISPMLFVALYYFVVTFVVSRLLVLFEKKLGKGYAK
>NC_017486.1|WP_003130548.1|1796402_1797311_-|diacylglycerol-kinase-family-lipid-kinase
MTYYLLANPNSGAGKGARTLETLIPYLEKNNYEYRLFKTKAAGEEGALVRQILDLKNPDDHLVIIGGDGTISLVINELPEEEAFSYIPSGSGNDFARSLKLKLDPIESFEAARRGINHEIFIMNYQSKGLSGYALNNIGIGLDATIVKSANEGKLKQVLNKLKLGSFSYILTALHVLITKKPFPALIEVENQEISLENAFLMTFTKHPYFGGGVKISPEATNENADIHLVEYNKHHLLRTFSLIPSVLRGMHLKHPLFLHRVSPQFSVELAESQPVQIDGEIHELVAADRLSISTERRMIIY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

35509 : 49721

Lactococcus_phage(100.0%)

integrase,bacteriocin,terminase

attL 34901:34928|attR 49830:49857

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
34901:34928	attL	NA	NA	NA	NA
WP_010905041.1\|35509_35833_-	sigma-70 family RNA polymerase sigma factor	Q9AZI1	Lactococcus_phage	3.8e-52	100.0
WP_010905042.1\|35857_36268_-	RinA family protein	Q9AZI2	Lactococcus_phage	8.0e-71	100.0
WP_010905043.1\|36264_36708_-\|terminase	terminase small subunit	Q9AZI3	Lactococcus_phage	7.3e-62	100.0
WP_014570322.1\|36840_37422_-	hypothetical protein	Q9AZI4	Lactococcus_phage	9.8e-99	99.5
WP_010905045.1\|37657_39286_-	DNA primase	Q9AZI5	Lactococcus_phage	0.0e+00	100.0
WP_010905046.1\|39296_40091_-	bifunctional DNA primase/polymerase	Q9AZI6	Lactococcus_phage	5.4e-156	100.0
WP_010905047.1\|40094_40424_-	hypothetical protein	Q9AZI7	Lactococcus_phage	5.2e-57	100.0
WP_010905048.1\|40410_40605_-	hypothetical protein	Q9AZI8	Lactococcus_phage	2.3e-28	100.0
WP_014570323.1\|40852_41092_-	hypothetical protein	Q9AZJ0	Lactococcus_phage	4.7e-39	98.7
WP_010905051.1\|41134_41416_-	hypothetical protein	Q9AZJ1	Lactococcus_phage	8.5e-48	100.0
WP_010905052.1\|41412_41664_-	helix-turn-helix transcriptional regulator	Q9AZJ2	Lactococcus_phage	1.7e-39	100.0
WP_010905053.1\|41660_42182_-	hypothetical protein	Q9AZJ3	Lactococcus_phage	1.5e-93	100.0
WP_010905054.1\|42185_42380_-	DUF1655 domain-containing protein	Q9AZJ4	Lactococcus_phage	7.9e-29	100.0
WP_014570324.1\|42455_43196_-	Rha family transcriptional regulator	Q9AZJ5	Lactococcus_phage	9.2e-134	100.0
WP_015966790.1\|43224_43422_-	hypothetical protein	Q9AZJ6	Lactococcus_phage	1.3e-26	100.0
WP_003132198.1\|43682_44069_+	helix-turn-helix transcriptional regulator	Q9AZJ7	Lactococcus_phage	7.3e-66	100.0
WP_003132200.1\|44078_44633_+	hypothetical protein	Q9AZJ8	Lactococcus_phage	8.1e-111	100.0
WP_003132204.1\|44743_44974_+	hypothetical protein	Q9AZK0	Lactococcus_phage	3.7e-17	100.0
WP_003132205.1\|45046_45241_+	hypothetical protein	Q9AZK1	Lactococcus_phage	6.0e-29	100.0
WP_010905057.1\|45392_45635_+	hypothetical protein	Q9AZK2	Lactococcus_phage	4.6e-34	100.0
WP_010905058.1\|45770_45995_+	hypothetical protein	Q9AZK3	Lactococcus_phage	4.5e-36	100.0
WP_011834160.1\|46461_46788_+	hypothetical protein	NA	NA	NA	NA
WP_010905062.1\|47981_48287_+\|bacteriocin	bacteriocin immunity protein	Q9AZK7	Lactococcus_phage	8.3e-49	100.0
WP_014570326.1\|48536_49721_+\|integrase	site-specific integrase	Q9AZK8	Lactococcus_phage	5.6e-226	99.7
49830:49857	attR	NA	NA	NA	NA

DBSCAN-SWA_2

380470 : 392601

Streptococcus_phage(40.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003131595.1\|380470_380788_+	thioredoxin family protein	A0A0K2FIM3	Achromobacter_phage	4.5e-05	30.4
WP_003131594.1\|380873_381500_+\|tRNA	DUF4479 and tRNA-binding domain-containing protein	NA	NA	NA	NA
WP_014570381.1\|381662_383003_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_010905314.1\|383092_383482_+	single-stranded DNA-binding protein	A0A0K0MWE1	Streptococcus_phage	1.4e-24	45.0
WP_003131589.1\|383601_383886_+	co-chaperone GroES	A0A221S386	uncultured_virus	3.1e-13	44.1
WP_003131585.1\|383973_385602_+	chaperonin GroEL	A0A219YK78	uncultured_virus	4.9e-156	56.8
WP_003131583.1\|385647_386460_-	MBL fold metallo-hydrolase	A0A0C5AJ83	Bacteriophage	3.1e-34	38.1
WP_014570382.1\|386630_388073_-	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	1.4e-32	33.0
WP_003131580.1\|388065_388767_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.2e-42	39.7
WP_003131575.1\|388944_389580_+	dTMP kinase	M1PSC7	Streptococcus_phage	5.4e-74	65.0
WP_003131573.1\|389712_390573_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	5.0e-67	45.2
WP_003131572.1\|390624_391407_+	stage 0 sporulation family protein	NA	NA	NA	NA
WP_003131570.1\|391399_391726_+	DNA replication initiation control protein YabA	NA	NA	NA	NA
WP_003131568.1\|391725_392601_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	8.7e-99	65.4

DBSCAN-SWA_3

982758 : 996591

Enterococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003130964.1\|982758_983451_+	cell division ATP-binding protein FtsE	G9BWD6	Planktothrix_phage	2.7e-31	34.4
WP_014570517.1\|983443_984379_+	ABC transporter permease	NA	NA	NA	NA
WP_003130966.1\|984480_985458_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	2.4e-118	66.2
WP_003130967.1\|985807_987976_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	3.0e-257	61.1
WP_003130968.1\|988111_988534_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A142F1R4	Bacillus_phage	2.3e-12	37.3
WP_012897612.1\|988535_988754_-	redoxin NrdH	C3U2K9	Lactococcus_phage	7.6e-12	47.6
WP_003130972.1\|988927_989569_-	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_003130974.1\|989843_991778_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	5.4e-125	43.4
WP_003130975.1\|991982_992522_+	cysteine hydrolase family protein	NA	NA	NA	NA
WP_014570518.1\|992514_993348_+	3'-5' exonuclease	A0A0K2SUJ2	Clostridium_phage	3.1e-21	39.4
WP_003130977.1\|993344_993794_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_014570519.1\|994068_996591_+	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	4.3e-98	32.2

DBSCAN-SWA_4

1005204 : 1058916

Lactococcus_phage(81.67%)

portal,tail,transposase,terminase,holin,capsid,integrase

attL 1010814:1010830|attR 1056329:1056345

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014570522.1\|1005204_1006293_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	8.4e-51	38.8
WP_003130990.1\|1006292_1006943_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.2e-41	43.6
WP_003130992.1\|1006951_1008148_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	3.9e-110	50.8
WP_003130993.1\|1008175_1008640_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.8e-39	53.7
WP_014570523.1\|1008742_1009195_+	lipoprotein signal peptidase	NA	NA	NA	NA
WP_003130995.1\|1009255_1010161_+	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	5.4e-11	28.2
WP_003130996.1\|1010307_1010751_+	divergent PAP2 family protein	NA	NA	NA	NA
1010814:1010830	attL	NA	NA	NA	NA
WP_014570524.1\|1010890_1012522_+	glycosyltransferase family 39 protein	NA	NA	NA	NA
WP_014570525.1\|1012514_1013471_+	glycosyltransferase family 2 protein	I1TED8	Salmonella_phage	2.4e-49	37.5
WP_003131888.1\|1013596_1014283_+	response regulator transcription factor	W8CYM9	Bacillus_phage	5.5e-32	33.6
WP_003131889.1\|1014302_1014818_+	DUF2127 domain-containing protein	NA	NA	NA	NA
WP_003131891.1\|1014821_1016147_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	3.4e-22	27.5
WP_003131894.1\|1016153_1016810_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_010905678.1\|1016990_1018808_+	glutamine--fructose-6-phosphate transaminase (isomerizing)	M1HVL7	Paramecium_bursaria_Chlorella_virus	3.5e-94	37.0
WP_003131898.1\|1018938_1019619_+	DNA repair protein RadC	NA	NA	NA	NA
WP_014570526.1\|1019817_1020942_-\|integrase	site-specific integrase	A0A1B1IME4	Lactococcus_phage	1.2e-209	98.4
WP_014570527.1\|1021067_1021559_-	hypothetical protein	A0A1B1IMF9	Lactococcus_phage	2.3e-48	97.6
WP_003131902.1\|1021619_1022057_-	ImmA/IrrE family metallo-endopeptidase	A0A059NT76	Lactococcus_phage	2.6e-80	97.2
WP_043991139.1\|1022053_1022572_-	helix-turn-helix transcriptional regulator	A0A1B1IME5	Lactococcus_phage	4.2e-85	98.3
WP_003131906.1\|1022743_1022977_+	helix-turn-helix transcriptional regulator	Q9AZW2	Lactococcus_phage	2.1e-36	100.0
WP_003131909.1\|1022990_1023716_+	phage antirepressor Ant	A0A1P8BKW5	Lactococcus_phage	6.4e-132	99.2
WP_003131910.1\|1023728_1024064_+	DUF771 domain-containing protein	Q38331	Lactococcus_phage	1.3e-58	100.0
WP_003131911.1\|1024204_1024399_+	hypothetical protein	A0A1P8BKS3	Lactococcus_phage	3.9e-28	100.0
WP_014570528.1\|1024408_1024657_+	hypothetical protein	A0A1P8BKS9	Lactococcus_phage	1.2e-18	63.4
WP_014570529.1\|1024653_1024830_+	putative transcriptional regulator	Q38094	Lactococcus_phage	4.1e-24	94.8
WP_014570530.1\|1024932_1025739_+	PD-(D/E)XK nuclease-like domain-containing protein	A0A1B1IM00	Lactococcus_phage	3.6e-152	99.3
WP_014570531.1\|1025732_1026653_+	AAA family ATPase	Q8LTN3	Lactococcus_phage	1.3e-166	99.7
WP_014570532.1\|1026878_1027688_+	helix-turn-helix domain-containing protein	Q9MCG3	Lactococcus_phage	1.1e-132	95.9
WP_011676026.1\|1027668_1027890_+	hypothetical protein	Q94M91	Lactococcus_phage	1.9e-34	100.0
WP_002819817.1\|1027879_1028269_+	RusA family crossover junction endodeoxyribonuclease	R9QLL1	Lactococcus_phage	3.2e-69	100.0
WP_014570534.1\|1029079_1029319_+	DUF1031 family protein	Q9MC29	Lactococcus_phage	9.7e-37	97.5
WP_014570536.1\|1029644_1029920_+	hypothetical protein	A0A1B1IM11	Lactococcus_phage	3.6e-43	100.0
WP_014570537.1\|1029931_1030321_+	hypothetical protein	NA	NA	NA	NA
WP_148226676.1\|1030438_1031137_+	DUF1642 domain-containing protein	A0A1P8BKG5	Lactococcus_phage	4.2e-120	98.7
WP_014570540.1\|1031133_1031553_+	dUTP diphosphatase	A5GYP0	Lactococcus_phage	3.7e-71	97.8
WP_014570541.1\|1031554_1031887_+	hypothetical protein	NA	NA	NA	NA
WP_080554635.1\|1032017_1032206_+	hypothetical protein	A0A1P8BKA8	Lactococcus_phage	1.2e-21	91.9
WP_043991140.1\|1032202_1032457_+	hypothetical protein	Q9MBX4	Lactococcus_phage	2.0e-19	88.5
WP_014570542.1\|1032479_1032641_+	hypothetical protein	Q9MBW9	Lactococcus_phage	1.2e-25	100.0
WP_014570543.1\|1032633_1032996_+	hypothetical protein	Q9MBV6	Lactococcus_phage	1.8e-66	98.3
WP_014570544.1\|1032982_1033663_+	hypothetical protein	A0A172LN93	Lactococcus_phage	1.3e-126	97.8
WP_014570545.1\|1033740_1033983_+	hypothetical protein	Q9MCF5	Lactococcus_phage	4.9e-44	100.0
WP_043991142.1\|1034187_1034373_+	hypothetical protein	R9QMC5	Lactococcus_phage	3.1e-14	65.6
WP_014570547.1\|1034369_1034684_+	hypothetical protein	A0A1P8BL62	Lactococcus_phage	1.6e-23	95.7
WP_014570548.1\|1034817_1035060_+	hypothetical protein	A6MA87	Lactococcus_virus	2.5e-24	67.1
WP_014570549.1\|1035138_1035528_+	DUF722 domain-containing protein	A5GYP6	Lactococcus_phage	7.1e-69	99.2
WP_014570550.1\|1035699_1036173_+\|transposase	transposase	A5GYP7	Lactococcus_phage	1.6e-83	99.4
WP_124156151.1\|1036162_1037605_+\|terminase	phage terminase large subunit	A5GYP8	Lactococcus_phage	2.1e-283	100.0
WP_014570552.1\|1037617_1039147_+\|portal	phage portal protein	A0A1B1IM25	Lactococcus_phage	2.9e-291	99.6
WP_014570553.1\|1039139_1039970_+\|capsid	phage capsid protein	A0A1B1IM23	Lactococcus_phage	6.4e-152	98.9
WP_014570554.1\|1039985_1041050_+	DNA methyltransferase	A0A1B1IMM2	Lactococcus_phage	1.7e-157	91.0
WP_003131315.1\|1041064_1041982_+	hypothetical protein	A5GYL9	Lactococcus_phage	3.0e-166	100.0
WP_014570555.1\|1042010_1042247_+	Ig domain-containing protein	A5GYM0	Lactococcus_phage	4.2e-32	100.0
WP_014570556.1\|1042320_1042722_+	hypothetical protein	A5GYM1	Lactococcus_phage	6.8e-59	100.0
WP_014570557.1\|1042711_1043056_+	hypothetical protein	A5GYM2	Lactococcus_phage	3.1e-60	100.0
WP_003131320.1\|1043052_1043382_+	hypothetical protein	A5GYM3	Lactococcus_phage	4.4e-56	100.0
WP_014570558.1\|1043381_1043816_+	hypothetical protein	A5GYM4	Lactococcus_phage	2.5e-75	99.3
WP_014570559.1\|1043826_1044303_+	hypothetical protein	A5GYM5	Lactococcus_phage	3.0e-85	100.0
WP_003131323.1\|1044359_1044767_+	hypothetical protein	A0A1B1IMQ4	Lactococcus_phage	1.2e-66	100.0
WP_014570560.1\|1044782_1045490_+	hypothetical protein	A5GYM7	Lactococcus_phage	3.4e-122	97.9
WP_014570561.1\|1045479_1047693_+\|tail	phage tail tape measure protein	A5GYM8	Lactococcus_phage	3.9e-164	83.0
WP_014570562.1\|1047702_1049232_+\|tail	phage tail family protein	A5GYM9	Lactococcus_phage	5.1e-296	99.4
WP_014570563.1\|1049228_1053179_+	hypothetical protein	A5GYS8	Lactococcus_phage	0.0e+00	76.9
WP_014570564.1\|1053190_1053427_+	hypothetical protein	A5GYS9	Lactococcus_phage	2.6e-34	97.4
WP_003132818.1\|1053439_1053790_+	hypothetical protein	A5GYT0	Lactococcus_phage	2.6e-54	97.4
WP_014570565.1\|1053802_1054102_+\|holin	phage holin	Q9AZR2	Lactococcus_phage	2.2e-46	99.0
WP_014570566.1\|1054101_1054881_+	C40 family peptidase	Q38323	Lactococcus_phage	5.1e-127	99.2
WP_014570567.1\|1055563_1056214_-	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_003132739.1\|1056438_1056831_+	transcriptional regulator Spx	NA	NA	NA	NA
1056329:1056345	attR	NA	NA	NA	NA
WP_003132741.1\|1057008_1058916_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	2.1e-49	28.9

DBSCAN-SWA_5

1698179 : 1708038

Prochlorococcus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003130886.1\|1698179_1698941_-	phosphate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.5e-17	30.0
WP_003130885.1\|1699106_1699916_-	phosphate ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	7.0e-10	26.5
WP_003130884.1\|1699949_1700843_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_003130883.1\|1700842_1701766_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_003130881.1\|1701886_1702738_-	phosphate ABC transporter substrate-binding protein PstS family protein	E3SNT9	Prochlorococcus_phage	4.2e-05	27.3
WP_003130880.1\|1703084_1703981_-	phosphate ABC transporter substrate-binding protein	E3SM63	Prochlorococcus_phage	7.2e-08	32.4
WP_003130878.1\|1704258_1704726_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	2.7e-43	56.6
WP_031296345.1\|1704757_1705315_-	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_003130876.1\|1705419_1708038_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	7.1e-64	33.7

DBSCAN-SWA_6

1722461 : 1738763

Lactococcus_phage(92.31%)

integrase

attL 1721010:1721025|attR 1735018:1735033

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1721010:1721025	attL	NA	NA	NA	NA
WP_014570681.1\|1722461_1722662_-	cold-shock protein	Q9AZD3	Lactococcus_phage	1.4e-28	93.9
WP_003132877.1\|1723781_1724192_-	protein-export chaperone SecB	NA	NA	NA	NA
WP_014570682.1\|1724218_1724485_-	hypothetical protein	NA	NA	NA	NA
WP_003132879.1\|1724484_1725006_-	hypothetical protein	NA	NA	NA	NA
WP_003132880.1\|1725065_1725245_-	hypothetical protein	Q9AZG2	Lactococcus_phage	4.6e-23	98.3
WP_043991155.1\|1725402_1725675_+	hypothetical protein	NA	NA	NA	NA
WP_014570684.1\|1725739_1725937_-	hypothetical protein	Q9AZG4	Lactococcus_phage	4.1e-09	96.7
WP_003132811.1\|1726120_1726483_-	hypothetical protein	Q9AZG6	Lactococcus_phage	1.7e-56	99.2
WP_003132810.1\|1726500_1727073_-	hypothetical protein	Q9AZG7	Lactococcus_phage	7.9e-93	94.2
WP_003132808.1\|1727234_1727441_-	hypothetical protein	Q9AZG9	Lactococcus_phage	1.4e-31	97.1
WP_003132807.1\|1727459_1727642_-	hypothetical protein	Q9AZH0	Lactococcus_phage	5.3e-27	98.3
WP_003132806.1\|1728011_1729709_-	hypothetical protein	Q9AZH2	Lactococcus_phage	1.0e-244	95.7
WP_003132804.1\|1729718_1729988_-	hypothetical protein	Q9AZH3	Lactococcus_phage	2.0e-38	95.5
WP_162467663.1\|1729984_1730122_-	hypothetical protein	Q9AZH4	Lactococcus_phage	1.5e-13	86.7
WP_003132801.1\|1730389_1731082_-	Bro-N domain-containing protein	NA	NA	NA	NA
WP_003132799.1\|1731084_1731309_-	hypothetical protein	NA	NA	NA	NA
WP_014570685.1\|1731525_1731756_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_014570686.1\|1731913_1732591_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_014570687.1\|1732683_1733895_+\|integrase	site-specific integrase	Q9AZI0	Lactococcus_phage	4.4e-117	54.4
WP_012898318.1\|1734015_1734930_-	diacylglycerol kinase family lipid kinase	A0A1V0SBJ0	Catovirus	5.4e-11	24.1
WP_003132795.1\|1735086_1735599_-	HD domain-containing protein	NA	NA	NA	NA
1735018:1735033	attR	NA	NA	NA	NA
WP_010906113.1\|1735931_1736165_+	30S ribosomal protein S20	NA	NA	NA	NA
WP_003132792.1\|1736258_1738763_-	ATP-dependent RecD-like DNA helicase	A0A1W6JK95	Lactococcus_phage	7.8e-44	25.8

DBSCAN-SWA_7

1854767 : 1940850

109

Lactococcus_phage(77.27%)

portal,tail,head,tRNA,transposase,terminase,holin,integrase,capsid,plate

attL 1899564:1899586|attR 1937880:1937902

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003132359.1\|1854767_1856645_-\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG	NA	NA	NA	NA
WP_014570709.1\|1857017_1857593_-	hypothetical protein	NA	NA	NA	NA
WP_014570710.1\|1857725_1858094_-	DUF1033 family protein	NA	NA	NA	NA
WP_003132362.1\|1858209_1858611_-	Mini-ribonuclease 3	NA	NA	NA	NA
WP_010906168.1\|1858603_1859950_-\|tRNA	cysteine--tRNA ligase	A0A2K9V966	Bandra_megavirus	3.1e-47	29.5
WP_003132364.1\|1859962_1860556_-	DUF1211 domain-containing protein	NA	NA	NA	NA
WP_003132365.1\|1860569_1861169_-	serine O-acetyltransferase	NA	NA	NA	NA
WP_003132366.1\|1861275_1862046_-	hypothetical protein	NA	NA	NA	NA
WP_014570711.1\|1862254_1864576_-	polyribonucleotide nucleotidyltransferase	NA	NA	NA	NA
WP_014570712.1\|1864859_1866005_-	hypothetical protein	NA	NA	NA	NA
WP_003132369.1\|1866369_1867335_+	ribose-phosphate diphosphokinase	A0A2K9L2G2	Tupanvirus	2.3e-36	32.8
WP_003132370.1\|1867456_1867888_-	universal stress protein	NA	NA	NA	NA
WP_010906171.1\|1868127_1869255_+	cysteine desulfurase	H7BUW1	unidentified_phage	2.2e-30	36.0
WP_003132372.1\|1869278_1869623_+	DUF1831 domain-containing protein	NA	NA	NA	NA
WP_003132374.1\|1869712_1870900_-	elongation factor Tu	A0A076FFS6	Aureococcus_anophage	2.0e-34	29.4
WP_003132378.1\|1871142_1871325_+	hypothetical protein	NA	NA	NA	NA
WP_014570713.1\|1871383_1871500_+	DUF4044 domain-containing protein	NA	NA	NA	NA
WP_003132382.1\|1871557_1874356_-\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	3.6e-82	25.9
WP_003132384.1\|1874671_1875598_-	DivIVA domain-containing protein	NA	NA	NA	NA
WP_010906173.1\|1875654_1876446_-	RNA-binding protein	NA	NA	NA	NA
WP_010906174.1\|1876442_1876718_-	YggT family protein	NA	NA	NA	NA
WP_003132390.1\|1876717_1877308_-	cell division protein SepF	NA	NA	NA	NA
WP_003132391.1\|1877341_1878019_-	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_003132392.1\|1878022_1879276_-	cell division protein FtsZ	NA	NA	NA	NA
WP_003132393.1\|1879306_1880677_-	cell division protein FtsA	NA	NA	NA	NA
WP_010906175.1\|1880837_1881707_-	DegV family protein	A0A0N9SI50	Staphylococcus_phage	3.8e-14	35.3
WP_003132395.1\|1881819_1882548_-	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	A0A2D1A6G0	Rhodococcus_phage	1.2e-05	27.8
WP_010906176.1\|1882693_1883812_-	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_003132398.1\|1883942_1884788_-	aldo/keto reductase	A0A1V0SDE7	Indivirus	4.8e-30	32.9
WP_003132399.1\|1884799_1886128_-	MFS transporter	NA	NA	NA	NA
WP_003130410.1\|1886242_1887190_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	3.4e-32	33.0
WP_003130787.1\|1887373_1888252_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003130788.1\|1888267_1888672_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_032398888.1\|1888753_1890064_-	aminopeptidase C	R4TV59	Phaeocystis_globosa_virus	9.7e-62	31.5
WP_003130792.1\|1890192_1890786_-	bis(5'-nucleosyl)-tetraphosphatase (symmetrical) YqeK	NA	NA	NA	NA
WP_003130794.1\|1890843_1891524_-	5'-methylthioadenosine/adenosylhomocysteine nucleosidase	NA	NA	NA	NA
WP_003130796.1\|1891555_1891834_-	hypothetical protein	NA	NA	NA	NA
WP_003130797.1\|1891826_1892411_-	NUDIX hydrolase	NA	NA	NA	NA
WP_003130798.1\|1892515_1893892_-	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A0G2Y8M0	Acanthamoeba_polyphaga_mimivirus	7.1e-31	35.3
WP_012898440.1\|1894119_1894908_+	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	1.7e-32	33.6
WP_010906184.1\|1894986_1895256_-	30S ribosomal protein S15	NA	NA	NA	NA
WP_003130801.1\|1895437_1897321_-	Stk1 family PASTA domain-containing Ser/Thr kinase	A0A1V0SDC3	Indivirus	3.1e-21	31.6
WP_003130802.1\|1897320_1898097_-	Stp1/IreP family PP2C-type Ser/Thr phosphatase	NA	NA	NA	NA
WP_014570715.1\|1898177_1899452_-	16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB	NA	NA	NA	NA
1899564:1899586	attL	NA	NA	NA	NA
WP_014570716.1\|1900405_1901185_-	C40 family peptidase	Q9AZW7	Lactococcus_phage	8.7e-127	98.1
WP_014570717.1\|1901184_1901472_-\|holin	phage holin	Q9AZL0	Lactococcus_phage	2.8e-46	96.8
WP_014570718.1\|1901484_1901835_-	hypothetical protein	A5GYT0	Lactococcus_phage	1.7e-53	97.4
WP_043991163.1\|1901949_1902162_-	hypothetical protein	M1NSI3	Streptococcus_phage	5.8e-17	83.6
WP_014570720.1\|1902224_1904582_-\|plate	BppU family phage baseplate upper protein	A0A1P8BM97	Lactococcus_phage	5.2e-74	81.7
WP_014570721.1\|1904599_1907353_-	peptidoglycan DD-metalloendopeptidase family protein	A0A1P8BLR1	Lactococcus_phage	0.0e+00	95.8
WP_014570722.1\|1907352_1908114_-\|tail	phage tail family protein	Q9AYV7	Lactococcus_phage	3.3e-139	97.6
WP_014570723.1\|1908123_1910937_-\|tail	phage tail tape measure protein	Q9G097	Lactococcus_phage	5.2e-270	90.5
WP_014570724.1\|1910950_1911214_-	hypothetical protein	Q9AZ59	Lactococcus_phage	1.4e-41	97.7
WP_014570725.1\|1911309_1911645_-	hypothetical protein	Q77RZ7	Lactococcus_phage	4.2e-54	99.1
WP_014570726.1\|1911760_1912258_-\|tail	phage major tail protein, TP901-1 family	A0A1P8BM54	Lactococcus_phage	9.0e-85	97.6
WP_014570727.1\|1912268_1912664_-	hypothetical protein	A0A1P8BM84	Lactococcus_phage	5.1e-67	100.0
WP_014570728.1\|1912660_1912999_-	HK97 gp10 family phage protein	Q77K21	Lactococcus_phage	7.3e-54	97.3
WP_003131945.1\|1912995_1913307_-	hypothetical protein	Q8LTQ6	Lactococcus_phage	1.8e-54	98.1
WP_003131944.1\|1913303_1913636_-\|head,tail	phage head-tail connector protein	A0A1P8BMC5	Lactococcus_phage	7.1e-54	100.0
WP_014570729.1\|1913622_1913820_-	hypothetical protein	B5SP32	Lactococcus_phage	2.8e-29	100.0
WP_014570730.1\|1913819_1914641_-\|capsid	N4-gp56 family major capsid protein	B5SP31	Lactococcus_phage	1.5e-140	98.9
WP_014570731.1\|1914642_1915305_-	DUF4355 domain-containing protein	B5SP30	Lactococcus_phage	4.9e-78	100.0
WP_043991226.1\|1915419_1915629_-	hypothetical protein	A0A1P8BKS4	Lactococcus_phage	2.5e-28	95.5
WP_014570733.1\|1915670_1915898_-	hypothetical protein	A0A1P8BL44	Lactococcus_phage	7.3e-34	98.6
WP_014570734.1\|1915912_1916623_-	hypothetical protein	A0A1P8BL19	Lactococcus_phage	6.1e-127	97.9
WP_014570735.1\|1916662_1917607_-\|capsid	minor capsid protein	A0A1P8BM04	Lactococcus_phage	4.1e-171	96.5
WP_025016873.1\|1917610_1917799_-	hypothetical protein	A0A1P8BM11	Lactococcus_phage	1.1e-24	98.4
WP_014570736.1\|1917785_1919174_-\|portal	phage portal protein	A0A1P8BM37	Lactococcus_phage	2.2e-237	90.9
WP_014570737.1\|1919187_1920576_-\|terminase	phage terminase large subunit	Q8LTR4	Lactococcus_phage	9.1e-268	98.5
WP_003131930.1\|1920568_1920985_-	hypothetical protein	Q9AZ67	Lactococcus_phage	1.6e-58	87.7
WP_010905372.1\|1921340_1921763_-	RinA family protein	Q9AZM9	Lactococcus_phage	8.5e-52	100.0
WP_014570738.1\|1922439_1922625_-	hypothetical protein	R9QMC5	Lactococcus_phage	4.1e-27	100.0
WP_014570739.1\|1922632_1922836_-	hypothetical protein	NA	NA	NA	NA
WP_043991165.1\|1922958_1923135_-	DUF1660 domain-containing protein	A0A1P8BLJ5	Lactococcus_phage	1.5e-26	98.1
WP_010905362.1\|1923131_1923275_-	hypothetical protein	Q9AZN8	Lactococcus_phage	2.1e-18	100.0
WP_014570741.1\|1923352_1924033_-	hypothetical protein	A0A1P8BK99	Lactococcus_phage	1.5e-127	98.7
WP_014570742.1\|1924059_1924332_-	hypothetical protein	A0A1P8BKH9	Lactococcus_phage	1.8e-42	87.8
WP_003129863.1\|1924335_1924755_-	dUTP diphosphatase	A0A1P8BLJ0	Lactococcus_phage	3.9e-73	100.0
WP_143468752.1\|1924751_1925447_-	DUF1642 domain-containing protein	A0A1P8BKG5	Lactococcus_phage	2.4e-120	98.7
WP_043991166.1\|1925418_1925598_-	hypothetical protein	A0A1P8BKQ8	Lactococcus_phage	5.2e-27	100.0
WP_014570743.1\|1925594_1925795_-	DUF1125 domain-containing protein	Q9MC26	Lactococcus_phage	2.4e-28	98.5
WP_014570744.1\|1926303_1926543_-	DUF1031 family protein	A0A1P8BKN9	Lactococcus_phage	2.8e-36	96.2
WP_014570745.1\|1926535_1926730_-	hypothetical protein	Q9B005	Lactococcus_phage	1.6e-26	96.9
WP_014570746.1\|1926732_1927122_-	RusA family crossover junction endodeoxyribonuclease	Q9MC30	Lactococcus_phage	7.1e-69	100.0
WP_014570747.1\|1927111_1927276_-	hypothetical protein	A0A1P8BKY2	Lactococcus_phage	9.3e-23	98.1
WP_014570749.1\|1928183_1928990_-	phage replisome organizer N-terminal domain-containing protein	A0A1P8BL25	Lactococcus_phage	1.7e-56	98.1
WP_014570750.1\|1929114_1929540_-	single-stranded DNA-binding protein	Q9MC32	Lactococcus_phage	8.8e-73	96.5
WP_014570751.1\|1929532_1930291_-	hypothetical protein	Q0ILF6	Lactococcus_phage	3.1e-145	98.4
WP_014570752.1\|1930299_1930818_-	host-nuclease inhibitor Gam family protein	Q9XJE3	Lactococcus_phage	3.8e-86	97.1
WP_014570753.1\|1930917_1931145_-	hypothetical protein	A0A1P8BKS9	Lactococcus_phage	4.0e-32	96.0
WP_014570754.1\|1931146_1931347_-	helix-turn-helix transcriptional regulator	A0A1P8BL04	Lactococcus_phage	6.9e-12	97.1
WP_014570755.1\|1931497_1931776_+	DUF3892 domain-containing protein	NA	NA	NA	NA
WP_014570756.1\|1931805_1932000_-	hypothetical protein	A0A1P8BKZ2	Lactococcus_phage	7.4e-27	96.9
WP_014570757.1\|1932094_1932364_-	hypothetical protein	NA	NA	NA	NA
WP_014570758.1\|1932376_1933144_-	phage repressor protein/antirepressor Ant	A0A1B1IMQ3	Lactococcus_phage	4.0e-124	89.0
WP_014570759.1\|1933156_1933396_-	helix-turn-helix transcriptional regulator	Q38329	Lactococcus_phage	2.6e-34	96.2
WP_014570760.1\|1933501_1933759_+	hypothetical protein	A7TWL9	Staphylococcus_phage	1.1e-14	58.8
WP_014570761.1\|1933748_1933958_-	hypothetical protein	NA	NA	NA	NA
WP_014570762.1\|1934112_1934655_+	hypothetical protein	NA	NA	NA	NA
WP_014570763.1\|1934786_1934987_-	putative transcriptional regulator	A0A1P8BMC4	Lactococcus_phage	1.8e-23	96.4
WP_179917525.1\|1935255_1935825_+	helix-turn-helix domain-containing protein	Q38327	Lactococcus_phage	3.0e-60	84.2
WP_014570765.1\|1935830_1936265_+	zinc peptidase	NA	NA	NA	NA
WP_014570766.1\|1936278_1936614_+	hypothetical protein	NA	NA	NA	NA
WP_014570767.1\|1936829_1937861_+\|integrase	site-specific integrase	Q9AZK8	Lactococcus_phage	2.4e-71	44.5
WP_003131479.1\|1938160_1938667_-	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
1937880:1937902	attR	NA	NA	NA	NA
WP_012898445.1\|1938687_1938876_-	DUF2273 domain-containing protein	NA	NA	NA	NA
WP_031299493.1\|1938886_1939426_-	alkaline shock response membrane anchor protein AmaP	NA	NA	NA	NA
WP_003131476.1\|1939473_1939716_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_003131475.1\|1939890_1940850_-\|tRNA	methionyl-tRNA formyltransferase	NA	NA	NA	NA

DBSCAN-SWA_8

2145813 : 2187692

Lactococcus_phage(95.74%)

portal,tail,terminase,holin,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014570796.1\|2145813_2146593_-	C40 family peptidase	R9QNI8	Lactococcus_phage	2.2e-125	98.5
WP_014570797.1\|2146592_2146892_-\|holin	phage holin	A5GYT1	Lactococcus_phage	4.9e-46	98.0
WP_014570798.1\|2146904_2147255_-	hypothetical protein	A5GYT0	Lactococcus_phage	1.8e-55	100.0
WP_014570799.1\|2147267_2147504_-	hypothetical protein	A5GYN1	Lactococcus_phage	2.9e-33	94.9
WP_193363677.1\|2147515_2151601_-	hypothetical protein	A5GYS8	Lactococcus_phage	0.0e+00	65.8
WP_014570562.1\|2151579_2153109_-\|tail	phage tail family protein	A5GYM9	Lactococcus_phage	5.1e-296	99.4
WP_014570561.1\|2153118_2155332_-\|tail	phage tail tape measure protein	A5GYM8	Lactococcus_phage	3.9e-164	83.0
WP_014570560.1\|2155321_2156029_-	hypothetical protein	A5GYM7	Lactococcus_phage	3.4e-122	97.9
WP_003131323.1\|2156044_2156452_-	hypothetical protein	A0A1B1IMQ4	Lactococcus_phage	1.2e-66	100.0
WP_014570559.1\|2156508_2156985_-	hypothetical protein	A5GYM5	Lactococcus_phage	3.0e-85	100.0
WP_014570558.1\|2156995_2157430_-	hypothetical protein	A5GYM4	Lactococcus_phage	2.5e-75	99.3
WP_003131320.1\|2157429_2157759_-	hypothetical protein	A5GYM3	Lactococcus_phage	4.4e-56	100.0
WP_014570557.1\|2157755_2158100_-	hypothetical protein	A5GYM2	Lactococcus_phage	3.1e-60	100.0
WP_014570556.1\|2158089_2158491_-	hypothetical protein	A5GYM1	Lactococcus_phage	6.8e-59	100.0
WP_014570555.1\|2158564_2158801_-	Ig domain-containing protein	A5GYM0	Lactococcus_phage	4.2e-32	100.0
WP_003131315.1\|2158829_2159747_-	hypothetical protein	A5GYL9	Lactococcus_phage	3.0e-166	100.0
WP_014570554.1\|2159761_2160826_-	DNA methyltransferase	A0A1B1IMM2	Lactococcus_phage	1.7e-157	91.0
WP_014570553.1\|2160841_2161672_-\|capsid	phage capsid protein	A0A1B1IM23	Lactococcus_phage	6.4e-152	98.9
WP_014570552.1\|2161664_2163194_-\|portal	phage portal protein	A0A1B1IM25	Lactococcus_phage	2.9e-291	99.6
WP_124156151.1\|2163206_2164649_-\|terminase	phage terminase large subunit	A5GYP8	Lactococcus_phage	2.1e-283	100.0
WP_014570801.1\|2164638_2165136_-	hypothetical protein	A0A1L2JXT6	Streptococcus_phage	2.2e-67	81.2
WP_014570802.1\|2166798_2167221_-	DUF722 domain-containing protein	Q9AYX5	Lactococcus_phage	2.1e-74	99.3
WP_003131301.1\|2167298_2167460_-	hypothetical protein	NA	NA	NA	NA
WP_023349206.1\|2167588_2167783_-	DUF1660 domain-containing protein	A0A1P8BLJ5	Lactococcus_phage	1.1e-33	96.9
WP_014570803.1\|2167779_2167998_-	hypothetical protein	A5GYP3	Lactococcus_phage	4.9e-35	100.0
WP_014570804.1\|2168058_2168382_-	DUF1140 family protein	A0A126HA38	Lactococcus_phage	9.7e-48	91.6
WP_014570805.1\|2168384_2168756_-	hypothetical protein	Q9AZ74	Lactococcus_phage	7.0e-34	64.2
WP_014570806.1\|2168748_2168901_-	hypothetical protein	Q9MCF7	Lactococcus_phage	1.3e-23	98.0
WP_014570807.1\|2168932_2169184_-	hypothetical protein	A0A1P8BL80	Lactococcus_phage	3.8e-23	50.0
WP_043991176.1\|2169180_2169378_-	hypothetical protein	A0A1P8BKA8	Lactococcus_phage	2.0e-24	93.8
WP_148226678.1\|2169386_2169593_-	hypothetical protein	A0A1P8BKA8	Lactococcus_phage	2.2e-21	91.5
WP_003129863.1\|2169752_2170172_-	dUTP diphosphatase	A0A1P8BLJ0	Lactococcus_phage	3.9e-73	100.0
WP_148226676.1\|2170168_2170867_-	DUF1642 domain-containing protein	A0A1P8BKG5	Lactococcus_phage	4.2e-120	98.7
WP_014570537.1\|2170984_2171374_-	hypothetical protein	NA	NA	NA	NA
WP_014570536.1\|2171385_2171661_-	hypothetical protein	A0A1B1IM11	Lactococcus_phage	3.6e-43	100.0
WP_014570810.1\|2171983_2172394_-	hypothetical protein	A5GZ50	Lactococcus_phage	1.3e-76	100.0
WP_014570811.1\|2172406_2172649_-	L-rhamnose isomerase	A5GZ49	Lactococcus_phage	7.8e-42	100.0
WP_124156154.1\|2172641_2173526_-	phage replisome organizer N-terminal domain-containing protein	A5GZ47	Lactococcus_phage	2.7e-68	58.4
WP_014570813.1\|2173819_2174746_-	recombinase RecT	A0A1P8BKY8	Lactococcus_phage	1.2e-146	92.9
WP_014570814.1\|2174742_2175576_-	hypothetical protein	A0A1B1IMS5	Lactococcus_phage	7.9e-126	96.0
WP_014570815.1\|2175678_2175927_-	hypothetical protein	A0A1B1IM02	Lactococcus_phage	4.9e-31	90.2
WP_043991177.1\|2176059_2176242_-	hypothetical protein	A0A1B1ILZ8	Lactococcus_phage	3.1e-27	98.3
WP_014570818.1\|2176257_2176947_-	phage regulatory protein	A5GZ67	Lactococcus_phage	6.8e-123	99.6
WP_014570819.1\|2177005_2177239_-	transcriptional regulator	A5GZ66	Lactococcus_phage	5.0e-38	100.0
WP_031561101.1\|2177445_2177826_+	XRE family transcriptional regulator	A5GZ65	Lactococcus_phage	1.6e-65	100.0
WP_014570821.1\|2177836_2178421_+	hypothetical protein	A0A1B1ILZ7	Lactococcus_phage	6.6e-111	98.5
WP_014570822.1\|2178476_2179016_+	PH domain-containing protein	A5GZ63	Lactococcus_phage	2.2e-92	99.4
WP_014570823.1\|2179141_2180599_+	recombinase family protein	A0A1B1IM01	Lactococcus_phage	2.8e-275	99.4
WP_014570824.1\|2180749_2181823_-	type II secretion system F family protein	NA	NA	NA	NA
WP_003130596.1\|2181716_2182607_-	Flp pilus assembly complex ATPase component TadA	NA	NA	NA	NA
WP_014570825.1\|2182775_2187692_-	PolC-type DNA polymerase III	A0A0K2SUJ2	Clostridium_phage	1.1e-20	35.6

DBSCAN-SWA_9

2271947 : 2289229

Lactococcus_phage(85.71%)

protease,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003131963.1\|2271947_2272142_-	hypothetical protein	Q9AZK6	Lactococcus_phage	3.7e-10	62.3
WP_003131964.1\|2274009_2274267_-	hypothetical protein	NA	NA	NA	NA
WP_014570835.1\|2274555_2274750_-	hypothetical protein	Q9AZK1	Lactococcus_phage	2.5e-27	96.9
WP_014570836.1\|2274763_2275315_-	hypothetical protein	Q9AZJ8	Lactococcus_phage	1.4e-86	79.9
WP_014570837.1\|2275326_2275710_-	helix-turn-helix transcriptional regulator	Q9AZJ7	Lactococcus_phage	1.8e-45	70.1
WP_014570838.1\|2275967_2276165_+	hypothetical protein	Q9AZJ6	Lactococcus_phage	1.4e-20	81.2
WP_080554629.1\|2276168_2276414_+	hypothetical protein	NA	NA	NA	NA
WP_043991180.1\|2276598_2277417_-	TIGR02391 family protein	A0A059NT45	Lactococcus_phage	1.8e-82	57.1
WP_014570840.1\|2277494_2277680_+	helix-turn-helix transcriptional regulator	A0A1X9I6I3	Streptococcus_phage	2.4e-06	44.3
WP_011677056.1\|2277798_2277993_+	DUF1655 domain-containing protein	Q9AZF2	Lactococcus_phage	1.1e-27	95.3
WP_014570841.1\|2277997_2278423_+	hypothetical protein	Q9AZF1	Lactococcus_phage	3.5e-69	90.8
WP_014570842.1\|2278434_2278716_+	hypothetical protein	Q9AZJ1	Lactococcus_phage	1.5e-41	89.2
WP_014570843.1\|2278758_2278998_+	hypothetical protein	Q9AZJ0	Lactococcus_phage	8.8e-38	94.9
WP_014570844.1\|2279245_2279557_+	hypothetical protein	NA	NA	NA	NA
WP_014570845.1\|2279553_2279883_+	hypothetical protein	Q9AZI7	Lactococcus_phage	9.3e-54	93.6
WP_014570846.1\|2279886_2280681_+	bifunctional DNA primase/polymerase	Q9AZI6	Lactococcus_phage	1.4e-143	90.9
WP_014570847.1\|2280691_2282326_+	DNA primase	Q9AZI5	Lactococcus_phage	1.2e-290	91.0
WP_003131978.1\|2282535_2282718_+	hypothetical protein	Q9AZE3	Lactococcus_phage	7.9e-23	93.1
WP_014570848.1\|2282743_2283352_+	hypothetical protein	Q9AZE2	Lactococcus_phage	1.4e-84	87.1
WP_014570849.1\|2283360_2283951_+\|head,protease	HK97 family phage prohead protease	Q9AZE1	Lactococcus_phage	2.7e-104	96.4
WP_043991182.1\|2284164_2284494_+	hypothetical protein	Q9AZE0	Lactococcus_phage	3.3e-51	94.5
WP_043991183.1\|2284596_2284905_+	sigma-70 family RNA polymerase sigma factor	Q9AZD9	Lactococcus_phage	7.3e-45	92.2
WP_003131983.1\|2285633_2285834_+	hypothetical protein	NA	NA	NA	NA
WP_003131984.1\|2285892_2287233_-	type I glutamate--ammonia ligase	A0A2P1EM84	Moumouvirus	1.8e-10	23.7
WP_003131985.1\|2287294_2287660_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_003131986.1\|2287760_2288198_-	low molecular weight phosphotyrosine protein phosphatase	NA	NA	NA	NA
WP_014570850.1\|2288354_2288507_-	hypothetical protein	NA	NA	NA	NA
WP_003131990.1\|2288611_2289229_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	5.9e-09	28.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_017488

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_017488_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_017488_1

1138-1219

Orphan

Consensus_repeat	Method
AGTGGTGTGTAAGTGCGCATTGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_017488_1

>merge|NC_017488|1|1138-1219|CRISPRCasFinder
AGTGGTGTGTAAGTGCGCATTGTCATGAAAAAATGGCACGCAATTTCATCACTTTTTAAAGTGATGTGTAAGTGCGCATTGT

>NC_017488|1|1|1138-1219|CRISPRCasFinder
AGTGGTGTGTAAGTGCGCATTGT	CATGAAAAAATGGCACGCAATTTCATCACTTTTTAA
AGTGATGTGTAAGTGCGCATTGT

>NC_017488.1|WP_010892287.1|761_911_+|hypothetical-protein
MTNKEKELFAENEELKKEIKDLKERIERYREMEVELSTTIDLLRGGIIE
>NC_017488.1|WP_010892286.1|66_765_+|replication-protein
MAIKNTKARNFGFLLYPDSIPNDWKEKLESLGVSMAVSPLHDMDEKKDKDTWNSSDVIRNGKHYKKPHYHVIYIARNPVTIESVRNKIKRKLGNSSVAHVEILDYIKGSYEYLTHESKDAIAKNKHIYDKKDILNINDFDIDRYITLDESQKRELKNLLLDIVDDYNLVNTKDLMAFIRLRGAEFGILNTNDVKDIVSTNSSAFRLWFEGNYQCGYRASYAKVLDAETGEIK
>NC_017488.1|WP_010892285.1|2100_2262_+|hypothetical-protein
MVISESKKRVMISLTKEQDKKLTDMAKQKGFSKSAVAALAIEEYARKESEQKK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_017488_1	1.1\|1161\|36\|NC_017488\|CRISPRCasFinder	1161-1196	36	JQ807734	UNVERIFIED: Clostridium sp. MT351 plasmid, complete sequence	545-580	0	1.0
NC_017488_1	1.1\|1161\|36\|NC_017488\|CRISPRCasFinder	1161-1196	36	JQ807734	UNVERIFIED: Clostridium sp. MT351 plasmid, complete sequence	604-639	0	1.0
NC_017488_1	1.1\|1161\|36\|NC_017488\|CRISPRCasFinder	1161-1196	36	NC_002192	Lactococcus lactis plasmid pWV01, complete sequence	1906-1941	0	1.0
NC_017488_1	1.1\|1161\|36\|NC_017488\|CRISPRCasFinder	1161-1196	36	NC_002192	Lactococcus lactis plasmid pWV01, complete sequence	1965-2000	0	1.0
NC_017488_1	1.1\|1161\|36\|NC_017488\|CRISPRCasFinder	1161-1196	36	NZ_CP031542	Lactococcus lactis subsp. cremoris strain 3107 plasmid p3107D, complete sequence	1291-1326	0	1.0
NC_017488_1	1.1\|1161\|36\|NC_017488\|CRISPRCasFinder	1161-1196	36	NZ_CP031542	Lactococcus lactis subsp. cremoris strain 3107 plasmid p3107D, complete sequence	1350-1385	0	1.0
NC_017488_1	1.1\|1161\|36\|NC_017488\|CRISPRCasFinder	1161-1196	36	NZ_CP031542	Lactococcus lactis subsp. cremoris strain 3107 plasmid p3107D, complete sequence	1409-1444	0	1.0
NC_017488_1	1.1\|1161\|36\|NC_017488\|CRISPRCasFinder	1161-1196	36	NC_017488	Lactococcus lactis subsp. lactis CV56 plasmid pCV56E, complete sequence	1161-1196	0	1.0
NC_017488_1	1.1\|1161\|36\|NC_017488\|CRISPRCasFinder	1161-1196	36	NZ_CP016730	Lactococcus lactis subsp. cremoris strain JM4 plasmid pJM4B, complete sequence	993-1028	0	1.0
NC_017488_1	1.1\|1161\|36\|NC_017488\|CRISPRCasFinder	1161-1196	36	NZ_CP016730	Lactococcus lactis subsp. cremoris strain JM4 plasmid pJM4B, complete sequence	1052-1087	0	1.0
NC_017488_1	1.1\|1161\|36\|NC_017488\|CRISPRCasFinder	1161-1196	36	NZ_CP016730	Lactococcus lactis subsp. cremoris strain JM4 plasmid pJM4B, complete sequence	1111-1146	0	1.0
NC_017488_1	1.1\|1161\|36\|NC_017488\|CRISPRCasFinder	1161-1196	36	NZ_CP016720	Lactococcus lactis subsp. lactis strain UC11 plasmid pUC11A, complete sequence	22048-22083	2	0.944
NC_017488_1	1.1\|1161\|36\|NC_017488\|CRISPRCasFinder	1161-1196	36	NC_015900	Lactococcus lactis subsp. lactis bv. diacetylactis plasmid pVF18, complete sequence	4665-4700	2	0.944
NC_017488_1	1.1\|1161\|36\|NC_017488\|CRISPRCasFinder	1161-1196	36	NZ_CP016726	Lactococcus lactis subsp. lactis strain UC08 plasmid pUC08A, complete sequence	22046-22081	2	0.944
NC_017488_1	1.1\|1161\|36\|NC_017488\|CRISPRCasFinder	1161-1196	36	KU707950	Lactobacillus plantarum strain 1-3 plasmid pM411, complete sequence	1673-1708	2	0.944
NC_017488_1	1.1\|1161\|36\|NC_017488\|CRISPRCasFinder	1161-1196	36	NC_012562	Leuconostoc citreum strain C4 plasmid pCC3, complete sequence	2313-2348	8	0.778

1. spacer 1.1|1161|36|NC_017488|CRISPRCasFinder matches to JQ807734 (UNVERIFIED: Clostridium sp. MT351 plasmid, complete sequence) position: , mismatch: 0, identity: 1.0

catgaaaaaatggcacgcaatttcatcactttttaa	CRISPR spacer
catgaaaaaatggcacgcaatttcatcactttttaa	Protospacer
************************************

2. spacer 1.1|1161|36|NC_017488|CRISPRCasFinder matches to JQ807734 (UNVERIFIED: Clostridium sp. MT351 plasmid, complete sequence) position: , mismatch: 0, identity: 1.0

catgaaaaaatggcacgcaatttcatcactttttaa	CRISPR spacer
catgaaaaaatggcacgcaatttcatcactttttaa	Protospacer
************************************

3. spacer 1.1|1161|36|NC_017488|CRISPRCasFinder matches to NC_002192 (Lactococcus lactis plasmid pWV01, complete sequence) position: , mismatch: 0, identity: 1.0

catgaaaaaatggcacgcaatttcatcactttttaa	CRISPR spacer
catgaaaaaatggcacgcaatttcatcactttttaa	Protospacer
************************************

4. spacer 1.1|1161|36|NC_017488|CRISPRCasFinder matches to NC_002192 (Lactococcus lactis plasmid pWV01, complete sequence) position: , mismatch: 0, identity: 1.0

catgaaaaaatggcacgcaatttcatcactttttaa	CRISPR spacer
catgaaaaaatggcacgcaatttcatcactttttaa	Protospacer
************************************

5. spacer 1.1|1161|36|NC_017488|CRISPRCasFinder matches to NZ_CP031542 (Lactococcus lactis subsp. cremoris strain 3107 plasmid p3107D, complete sequence) position: , mismatch: 0, identity: 1.0

catgaaaaaatggcacgcaatttcatcactttttaa	CRISPR spacer
catgaaaaaatggcacgcaatttcatcactttttaa	Protospacer
************************************

6. spacer 1.1|1161|36|NC_017488|CRISPRCasFinder matches to NZ_CP031542 (Lactococcus lactis subsp. cremoris strain 3107 plasmid p3107D, complete sequence) position: , mismatch: 0, identity: 1.0

catgaaaaaatggcacgcaatttcatcactttttaa	CRISPR spacer
catgaaaaaatggcacgcaatttcatcactttttaa	Protospacer
************************************

7. spacer 1.1|1161|36|NC_017488|CRISPRCasFinder matches to NZ_CP031542 (Lactococcus lactis subsp. cremoris strain 3107 plasmid p3107D, complete sequence) position: , mismatch: 0, identity: 1.0

catgaaaaaatggcacgcaatttcatcactttttaa	CRISPR spacer
catgaaaaaatggcacgcaatttcatcactttttaa	Protospacer
************************************

8. spacer 1.1|1161|36|NC_017488|CRISPRCasFinder matches to NC_017488 (Lactococcus lactis subsp. lactis CV56 plasmid pCV56E, complete sequence) position: , mismatch: 0, identity: 1.0

catgaaaaaatggcacgcaatttcatcactttttaa	CRISPR spacer
catgaaaaaatggcacgcaatttcatcactttttaa	Protospacer
************************************

9. spacer 1.1|1161|36|NC_017488|CRISPRCasFinder matches to NZ_CP016730 (Lactococcus lactis subsp. cremoris strain JM4 plasmid pJM4B, complete sequence) position: , mismatch: 0, identity: 1.0

catgaaaaaatggcacgcaatttcatcactttttaa	CRISPR spacer
catgaaaaaatggcacgcaatttcatcactttttaa	Protospacer
************************************

10. spacer 1.1|1161|36|NC_017488|CRISPRCasFinder matches to NZ_CP016730 (Lactococcus lactis subsp. cremoris strain JM4 plasmid pJM4B, complete sequence) position: , mismatch: 0, identity: 1.0

catgaaaaaatggcacgcaatttcatcactttttaa	CRISPR spacer
catgaaaaaatggcacgcaatttcatcactttttaa	Protospacer
************************************

11. spacer 1.1|1161|36|NC_017488|CRISPRCasFinder matches to NZ_CP016730 (Lactococcus lactis subsp. cremoris strain JM4 plasmid pJM4B, complete sequence) position: , mismatch: 0, identity: 1.0

catgaaaaaatggcacgcaatttcatcactttttaa	CRISPR spacer
catgaaaaaatggcacgcaatttcatcactttttaa	Protospacer
************************************

12. spacer 1.1|1161|36|NC_017488|CRISPRCasFinder matches to NZ_CP016720 (Lactococcus lactis subsp. lactis strain UC11 plasmid pUC11A, complete sequence) position: , mismatch: 2, identity: 0.944

-catgaaaaaatggcacgcaatttcatcactttttaa	CRISPR spacer
tcatg-aaaaatggcatgcaatttcatcactttttaa	Protospacer
 **** **********.********************

13. spacer 1.1|1161|36|NC_017488|CRISPRCasFinder matches to NC_015900 (Lactococcus lactis subsp. lactis bv. diacetylactis plasmid pVF18, complete sequence) position: , mismatch: 2, identity: 0.944

-catgaaaaaatggcacgcaatttcatcactttttaa	CRISPR spacer
tcatg-aaaaatggcatgcaatttcatcactttttaa	Protospacer
 **** **********.********************

14. spacer 1.1|1161|36|NC_017488|CRISPRCasFinder matches to NZ_CP016726 (Lactococcus lactis subsp. lactis strain UC08 plasmid pUC08A, complete sequence) position: , mismatch: 2, identity: 0.944

-catgaaaaaatggcacgcaatttcatcactttttaa	CRISPR spacer
tcatg-aaaaatggcatgcaatttcatcactttttaa	Protospacer
 **** **********.********************

15. spacer 1.1|1161|36|NC_017488|CRISPRCasFinder matches to KU707950 (Lactobacillus plantarum strain 1-3 plasmid pM411, complete sequence) position: , mismatch: 2, identity: 0.944

-catgaaaaaatggcacgcaatttcatcactttttaa	CRISPR spacer
tcatg-aaaaatggcacgcaatttcatcgctttttaa	Protospacer
 **** **********************.********

16. spacer 1.1|1161|36|NC_017488|CRISPRCasFinder matches to NC_012562 (Leuconostoc citreum strain C4 plasmid pCC3, complete sequence) position: , mismatch: 8, identity: 0.778

catgaaaaaatggcacgcaatttcatcactttttaa	CRISPR spacer
ctgataaaattggcaagcaatttcatcactttgaaa	Protospacer
*  . **** ***** ****************  **

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_017486

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_017488

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection