CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_014921	Mycoplasma fermentans M64, complete sequence	1 crisprs	NA	0	1	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_014921_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014921_1

615585-615686

Orphan

Consensus_repeat	Method
TTTGACACTTTTGTAAAAGTTTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_014921_1

>merge|NC_014921|1|615585-615686|CRISPRCasFinder
TTTGACACTTTTGTAAAAGTTTCTTCCTACATATATTTTACATTATTATGTAACAAAAAAGAAGATTATAAAATTAATTTTTTACACTTTTGTAAAAGTTTC

>NC_014921|1|1|615585-615686|CRISPRCasFinder
TTTGACACTTTTGTAAAAGTTTC	TTCCTACATATATTTTACATTATTATGTAACAAAAAAGAAGATTATAAAATTAATT
TTTTACACTTTTGTAAAAGTTTC

Protein	Signature genes	Signature genes Name	Protein_function
NC_014921.1\|WP_013526914.1\|610626_611796_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|349992
NC_014921.1\|WP_013526911.1\|607678_609022_-\|hypothetical-protein	unknown	unknown	unknown
NC_014921.1\|WP_013526930.1\|625985_626840_+\|repb	unknown	unknown	gnl\|CDD\|238484
NC_014921.1\|WP_013526922.1\|618914_619259_-\|hypothetical-protein	unknown	unknown	unknown
NC_014921.1\|WP_013526910.1\|607101_607404_-\|hypothetical-protein	unknown	unknown	unknown
NC_014921.1\|WP_013526923.1\|619631_620267_-\|GIY-YIG-nuclease-family-protein	unknown	unknown	gnl\|CDD\|214947
NC_014921.1\|WP_013526924.1\|620750_621785_+\|restriction-endonuclease-subunit-S	unknown	unknown	gnl\|CDD\|341163
NC_014921.1\|WP_013526917.1\|612443_614276_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NC_014921.1\|WP_013526908.1\|604859_605057_-\|hypothetical-protein	unknown	unknown	unknown
NC_014921.1\|WP_013526918.1\|614312_615563_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|224292
NC_014921.1\|WP_049764035.1\|611799_612444_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NC_014921.1\|WP_013526928.1\|624561_624873_+\|restriction-endonuclease-subunit-S	unknown	unknown	gnl\|CDD\|341133
NC_014921.1\|WP_013354684.1\|606510_607092_-\|DNA-integrity-scanning-protein-DisA-nucleotide-binding-domain-protein	unknown	unknown	gnl\|CDD\|376789
NC_014921.1\|WP_013526909.1\|605066_606509_-\|magnesium-transporter	unknown	unknown	gnl\|CDD\|225148
NC_014921.1\|WP_041594315.1\|622638_623439_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271191
NC_014921.1\|WP_013526919.1\|615885_616686_-\|Cof-type-HAD-IIB-family-hydrolase	unknown	unknown	gnl\|CDD\|369792
NC_014921.1\|WP_013526920.1\|616860_617535_-\|hypothetical-protein	unknown	unknown	unknown
NC_014921.1\|WP_158304008.1\|621995_622499_-\|restriction-endonuclease-subunit-S	unknown	unknown	gnl\|CDD\|341141
NC_014921.1\|WP_013526912.1\|609132_610329_-\|putative-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|225420
NC_014921.1\|WP_013526921.1\|617577_618735_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_014921.1\|WP_013526914.1\|610626_611796_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|349992	cd18548, ABC_6TM_Tm287_like, Six-transmembrane helical domain Tm287 of a heterodimeric ABC transporter Tm287/288 from Thermotoga maritima and similar proteins. This group represents the six-transmembrane helical domain (Tm287) of a heterodimeric ABC transporter Tm287/288 from Thermotoga maritima and similar proteins. This TMD possesses the ATP-binding cassette (ABC) exporter fold, which is characterized by 6 TM helices per subunit (domain), or a total of 12 TM helices for the complete transporter. The ABC exporters are found in both prokaryotes and eukaryotes, where they mediate the cellular secretion of toxic compounds, a various type of lipids and polypeptides. ABC transporters typically consist of two transmembrane domains (TMDs) and two nucleotide-binding domains (NBDs). The sequences and structures of the TMDs are quite varied between the different type of transporters, suggesting significant structural diversity of the translocated substrates, while NBDs are conserved among all ABC transporters. The two NBDs together bind and hydrolyze ATP, thereby providing the driving force for transport, while the TMDs participate in substrate recognition and translocation across the lipid membrane by alternating between inward- and outward-facing conformations. Moreover, some ABC genes are organized as half-transporters, which must form either homodimers or heterodimers to form a functional transporter. The ABC exporters play a role in multidrug resistance to antibiotics and anticancer agents, and mutations in these proteins have been shown to cause severe human diseases such as cystic fibrosis.	1.61348e-45
NC_014921.1\|WP_013526930.1\|625985_626840_+\|repb	gnl\|CDD\|238484	cd00984, DnaB_C, DnaB helicase C terminal domain. The hexameric helicase DnaB unwinds the DNA duplex at the chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This C-terminal domain contains an ATP-binding site and is therefore probably the site of ATP hydrolysis.	3.84516e-54
NC_014921.1\|WP_013526923.1\|619631_620267_-\|GIY-YIG-nuclease-family-protein	gnl\|CDD\|214947	smart00974, T5orf172, This entry represents the putative helicase A859L.	3.27418e-12
NC_014921.1\|WP_013526924.1\|620750_621785_+\|restriction-endonuclease-subunit-S	gnl\|CDD\|341163	cd17274, RMtype1_S_Eco540ANI-TRD1-CR1_like, Type I restriction-modification system specificity (S) subunit Target Recognition Domain-ConseRved domain (TRD-CR), similar to S.Eco540ANI TRD1-CR1, S.Eco2747AII TRD1-CR1, S.Eco540AI TRD1-CR1, S.Eco2747II TRD1-CR1, and S.Eco540I TRD1-CR1. Escherichia coli ST540AN S subunit (S.Eco540ANI ), Escherichia coli ST540A S subunit (S.Eco540AI), and Escherichia coli ST540 S subunit (S.Eco540I) recognize 5'... GAANNNNNNRTCG ... 3'. Escherichia coli ST2747A S subunit (S.Eco2747AII) and Escherichia coli ST2747 S subunit (S.Eco2747II) recognize 5'... GAANNNNNNNTAAA ... 3'. The restriction-modification (RM) system S subunit consists of two variable target recognition domains (TRD1 and 2) and two conserved regions (CR1 and CR2) which separate the TRDs. The TRDs each bind to different specific sequences in the DNA. RM systems protect a bacterial cell against invasion of foreign DNA by endonucleolytic cleavage of DNA that lacks a site specific modification. The host genome is protected from cleavage by methylation of specific nucleotides in the target sites. In type I systems, both restriction and modification activities are present in one enzyme complex composed of one DNA specificity (S) subunit (this family), two modification (M) subunits and two restriction (R) subunits. This model contains both TRD1-CR1 and TRD2-CR2. It may also include TRD-CR-like sequence-recognition domains of various type II restriction enzymes and methyltransferases and type I DNA methyltransferases.	2.46558e-13
NC_014921.1\|WP_013526917.1\|612443_614276_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	3.32948e-132
NC_014921.1\|WP_013526918.1\|614312_615563_-\|ATP-binding-protein	gnl\|CDD\|224292	COG1373, COG1373, Predicted ATPase (AAA+ superfamily) [General function prediction only].	1.34595e-54
NC_014921.1\|WP_049764035.1\|611799_612444_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	2.67255e-63
NC_014921.1\|WP_013526928.1\|624561_624873_+\|restriction-endonuclease-subunit-S	gnl\|CDD\|341133	cd17244, RMtype1_S_Apa101655I-TRD2-CR2_like, Type I restriction-modification system specificity (S) subunit Target Recognition Domain-ConseRved domain (TRD-CR), similar to Acetobacter pasteurianus S subunit (S.Apa101655I) TRD2-CR2. The S. Apa101655I S subunit recognizes 5'... TTAGNNNNNNTTC... 3'. The restriction-modification (RM) system S subunit consists of two variable target recognition domains (TRD1 and 2) and two conserved regions (CR1 and CR2) which separate the TRDs. The TRDs each bind to different specific sequences in the DNA. RM systems protect a bacterial cell against invasion of foreign DNA by endonucleolytic cleavage of DNA that lacks a site specific modification. The host genome is protected from cleavage by methylation of specific nucleotides in the target sites. In type I systems, both restriction and modification activities are present in one enzyme complex composed of one DNA specificity (S) subunit (this family), two modification (M) subunits and two restriction (R) subunits. This model contains both TRD1-CR1 and TRD2-CR2. It may also include TRD-CR-like sequence-recognition domains of various type II restriction enzymes and methyltransferases and type I DNA methyltransferases.	8.43563e-22
NC_014921.1\|WP_013354684.1\|606510_607092_-\|DNA-integrity-scanning-protein-DisA-nucleotide-binding-domain-protein	gnl\|CDD\|376789	pfam02457, DisA_N, DisA bacterial checkpoint controller nucleotide-binding. The DisA protein is a bacterial checkpoint protein that dimerizes into an octameric complex. The protein consists of three distinct domains. This domain is the first and is a globular, nucleotide-binding region; the next 146-289 residues constitute the DisA-linker family, pfam10635, that consists of an elongated bundle of three alpha helices (alpha-6, alpha-10, and alpha-11), one side of which carries an additional three helices (alpha7-9), which thus forms a spine like-linker between domains 1 and 3. The C-terminal residues, of domain 3, are represented by family HHH, pfam00633, the specific DNA-binding domain. The octameric complex thus has structurally linked nucleotide-binding and DNA-binding HhH domains and the nucleotide-binding domains are bound to a cyclic di-adenosine phosphate such that DisA is a specific di-adenylate cyclase. The di-adenylate cyclase activity is strongly suppressed by binding to branched DNA, but not to duplex or single-stranded DNA, suggesting a role for DisA as a monitor of the presence of stalled replication forks or recombination intermediates via DNA structure-modulated c-di-AMP synthesis.	3.9092e-50
NC_014921.1\|WP_013526909.1\|605066_606509_-\|magnesium-transporter	gnl\|CDD\|225148	COG2239, MgtE, Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism].	1.86073e-108
NC_014921.1\|WP_041594315.1\|622638_623439_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271191	cd01191, INT_C_like_2, Uncharacterized site-specific tyrosine recombinase, C-terminal catalytic domain. Tyrosine recombinase (integrase) belongs to a DNA breaking-rejoining enzyme superfamily. The catalytic domain contains six conserved active site residues. The recombination reaction involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	1.83931e-110
NC_014921.1\|WP_013526919.1\|615885_616686_-\|Cof-type-HAD-IIB-family-hydrolase	gnl\|CDD\|369792	pfam08282, Hydrolase_3, haloacid dehalogenase-like hydrolase. This family contains haloacid dehalogenase-like hydrolase enzymes.	5.29614e-47
NC_014921.1\|WP_013526912.1\|609132_610329_-\|putative-DNA-binding-domain-containing-protein	gnl\|CDD\|225420	COG2865, COG2865, Predicted transcriptional regulator containing an HTH domain and an uncharacterized domain shared with the mammalian protein Schlafen [Transcription].	1.99783e-21
NC_014921.1\|WP_158304008.1\|621995_622499_-\|restriction-endonuclease-subunit-S	gnl\|CDD\|341141	cd17252, RMtype1_S_EcoKI-TRD1-CR1_like, Type I restriction-modification system specificity (S) subunit Target Recognition Domain-ConseRved domain (TRD-CR), similar to S.EcoKI TRD1-CR1, S.StySPI TRD1-CR1, S.Ara36733II TRD1-CR1, and S.Eco3722I TRD1-CR1. Escherichia coli str. K-12 substr. MG1655 S subunit (S.EcoKI) and Escherichia coli NCM3722 S subunit (S.Eco3722I) recognize 5'... AACNNNNNNGTGC ... 3', Salmonella enterica subsp. enterica serovar Potsdam S subunit (S.StySPI) recognizes 5'... AACNNNNNNGTRC ... 3', and Actinomyces radicidentis S subunit (S.Ara36733II) recognizes 5'... CATCNNNNNNCTC ... 3'. The restriction-modification (RM) system S subunit consists of two variable target recognition domains (TRD1 and 2) and two conserved regions (CR1 and CR2) which separate the TRDs. The TRDs each bind to different specific sequences in the DNA. For example, S.EcoKI-TRD1 and S.StySPI-TRD1 recognize AAC/GTT, S.EcoKI-TRD2 recognizes GCAC/GTGC, and S.StySPI-TRD2 recognizes GYAC/GTRC. RM systems protect a bacterial cell against invasion of foreign DNA by endonucleolytic cleavage of DNA that lacks a site specific modification. The host genome is protected from cleavage by methylation of specific nucleotides in the target sites. In type I systems, both restriction and modification activities are present in one enzyme complex composed of one DNA specificity (S) subunit (this family), two modification (M) subunits and two restriction (R) subunits. This model contains both TRD1-CR1 and TRD2-CR2. It also includes TRD-CR-like sequence-recognition domains of various type II restriction enzymes and methyltransferases such as Treponema pedis T A4 putative Type IIG restriction enzyme/N6-adenine DNA methyltransferase RM.TpeTA4ORF2695P. It may also include type I DNA methyltransferases.	1.32728e-44

>NC_014921.1|WP_013526918.1|614312_615563_-|ATP-binding-protein
MVIKRDIYLEKLKEMIDIPLIKIISGLRRSGKSFLLFNLFKEYLINELKVDQNHIIEINLENQENHSYCDPNNFLEFIKSKIKDRKKYFLLIDEVQLLKDFVPVLNQLNNNQQLNVFVTGSNSKFLINDVVTEFRGRSISLHVFPLSFYEIASHKEFKNLDELWKSYLIYGGLPLIQNMKEANIKTNYLVNEFKRTYLIDIVEKNKIEDIDNLDDIINILASNIGSYTNPYKLSLTFKSIKKTNISDATIRKYIENLKNAFIINEVKKYDIKGKKYINASYKYYFEDIGLRNAKINFAQNEENHLMENIIYNELLLRGYNVNVGIVEIRPNANQKVQLEVDFIAQKGNQKVYIQSCLNMYDQNKEIQEKRPFKNINDNFKKIIITKDDPIFDTDTNGYKIYGIKQFLLDLDILNKN
>NC_014921.1|WP_013526917.1|612443_614276_+|ABC-transporter-ATP-binding-protein
MPRFSNLRFRQKGEKKISFKIFFKFLSNFQISKSVWIFTVLFGLLVASLTNIASWLMGFITDKFLDPKTFNLANFKMKDYIVFVVMLALVYVFIKIFEISQRVIVSKLSARLGRNLRLQCYQKIQQMEMSFYEEEQTGDLMSALTNDIQNITEAIWDILISVISIIFEFSFITIMMFIYVPLLAAIILAIVPINASVIFLIIRSNQKFYIQQQERLGEFNGYLEEIMDAFPLVNLHQQKENVAKEFDKYSRALIKPDASATTRMNIVFPWFHFSKTINLIIVIAASAAFVYYKVPTGGIKPLSAGVVMSFTLYLFRISDNISLLLEVINGIQHGLGSIVRINKILALVPQFDEVKLNELDYKTGKIEFKNVSFAYASKPDKLVLKNISFTIEKGKSLALVGHTGCGKTTIAKLLSKFYVPTSGDILIDGQSILKTKSKSWRNYIDTILQETYIFNDTVKNNLTVVNPNISDKDFNDIVEKTSVAEFINLMPEKFDTVLKSNGANLSEGQKQLIAISRSLIASKPISILDEATSNIDTITELKVQHAMKYLMKDRSMLIIAHRLSTIKNVDEILVINEGEIIERGNHDQLMKQNGHYKKIYSLGLNDTKID
>NC_014921.1|WP_049764035.1|611799_612444_+|ABC-transporter-ATP-binding-protein
MGIIGKTGSGKSTLVKLLTHEYLLDKKDGEIIIDSHNINEIDTNNFYEKVTQVYQKPMIISGSIKENITFSNHELSEQEIEKAINISCANFIKELDDKYEARVDQRGKNFSGGQRQRVAIAQALIKKPQILILDDSTSALDNETDLRVRQNIKENLKDSTLIVISQRINSIKDSNQIFVLDKGQIVASGKNSQLLNTSSIYKDIWQSQEQKVGE
>NC_014921.1|WP_013526914.1|610626_611796_+|ABC-transporter-ATP-binding-protein
MLKIFKYMPARIKFFAFLSAFFAILQPFLSMLNPTITKQLITLIAKVQNGTSMNEVSLLFWNITTSGTSQSMIYLIIMAIGFAFLLMIVAFLSAFFAARTCIYGTYYLRKNLFEHLLTLSRSNLEKYSVGSLITRFSNDLNKIKDGIFVVVRGLVVSPFFVVWGLVFTTTTNVYLSIAIYIIIPFLVGAAVFAIFKLFPYYRKENWILDQLNELSKEDINAIALIKSYNLEEPRYEKYFNKNQEWFTIYRKNVVFGSFAWPIINGFVLFGNVAIFALVAYLIGSKGDDNVAKLIGDVSQFTANLSMISMGVFNTLFTINRLFRSSVSAKRYIELMNSKSEIPFVVSDKKVTSGAIEFKNVNFAYPIYKKGKLVDTKEALKNINLKIEAG
>NC_014921.1|WP_013526912.1|609132_610329_-|putative-DNA-binding-domain-containing-protein
MLNKRGTGTIYFSLKDDHTIVDLDICNKSMRDISQAISNNVKPEIMPRISIEFIDNQNVIKVEAEGEQKPYSAYDKYYIRIGEEDKKLNRDKLVDFVQKSVFKINICEIENKDQDLTFNSFLLYANIKNLTVNKDTFEKNFDLKTKNNKYNLMSYLLSNNNDISIKVNTFKDNDKSVLLKRNEYGNKCLFYAIESILNYVGSINDTYVDLSTATRSKQKLFDFECFREAWLNACIHNHWDEKYPPQVNIFKDYIQIESNGGISRNMTKEEFFKGVSRPVNEKLQKIFMQLDLVEQTGYGVPLIVKKYDEEAFEIDENTIWVKIPFNRKEFKRINKNENKKDLNDNQIKVIKTIEKESNITINQLSSALSLSEGYIKKIINQLKNKNLIERNCSRKNGN
>NC_014921.1|WP_013526911.1|607678_609022_-|hypothetical-protein
MKNLSEINTKYILISLILSLILSLIIIITRYILTIIFTLKKDSKIHINYNLFFKIYIFLLLVSNLLIFSVLIWNVFIYLNDIFLRTIAILILSVLLILNLVFWIIKFSFLKQDNQLYLESKNNLENNELTIKIADNKNNCNWKIWKTLKSAYTSFQKKNFFIFKEFPRIILDISIVKKILVENKNNLFIIFQWKNEHFNIKLQNKFKIIDFIRNSCEDIEFFSFFDAYCEKNDESNIDLHEILGAKYNKKIWFWTKINNIEKTKLKLTFYYLDSFWNFALFLLPIILALFLNNEIPVLKTFNKWVILFWITFVYLTVSFVRIFFKKDLYLNERKKEKLKIDPFYEKNHFYANSYLIEKLSNFKNNFIYTISIVIKENSEENQLYIKNIKKQIDEINKKLFDSEKTYFKFFYLKTIFVKAKKHFKLFTKKITNKRNLKLKKLNIVNEK
>NC_014921.1|WP_013526910.1|607101_607404_-|hypothetical-protein
MAIIDRDLATCAERIQKRRELLLKLYNENQAELANPALIEDEKPITGECQEFMCLVNKHEKEDPRVRKQKIILKVLGASLSVLIILLCTLLAVLISRVYA
>NC_014921.1|WP_013354684.1|606510_607092_-|DNA-integrity-scanning-protein-DisA-nucleotide-binding-domain-protein
MCLESKIGFYVIVALLVTLILISIMPLIVNAIKNKMARSHFQKLGQSSQIRLINQLREAVEYLSKNKIGALITIENNDNIDNLRTDGVILNANISSSLLISIFNKYSPLHDGAVIIRDNKIYYASTFYKITRKSIDNQYGARHRAAMGISELCDATTIIVSEETGDVKFVKNGTFYNIRLEQFQEQLVKYLKD
>NC_014921.1|WP_013526909.1|605066_606509_-|magnesium-transporter
MSESQEISLQNELHEIIKTKNVTKAREFIDNNPMADVANLLNELQLEEQLTFLPLLKTSEAAELFSYLDEEVQANLAQSFTEDWGMKLLQELQSDELADVLEELPSNVTSKILAYTPQEKRAELNKLLSYEDDEVGSIMSIDISSIGNSYTCEQALHKIRRDYHKKNAELVHYYYVVNETNKLIGALTLEEIVFADPNAKIDDIYNPVTYVSAHDKTEVAAQVFSEHDMSVLPVVNHEKRLVGMITSDDVIDVIKEEATEDLYKMAGISSHEVNESEYLKTPWYKIIKSRILWLILLLLFATVTQIIVYFGTWTIAKKIKDVAEISLATISFAALIPVINNATSNSGIQANISVNRALALKEIEPGEYGKVIWKETLIGFVTGLILAVINFARLGIYFAATRDLMSTNKMIYWAIIIGSSIALWLALTISKLLGAAFPIIWAKIKKDPSSISASLINTFTDIISSLLIFGFAFAFLMVLI
>NC_014921.1|WP_013526908.1|604859_605057_-|hypothetical-protein
MIIHATNCQCPACMLKIASEQINNSDNTTKTWAIVLITLAVIILISITIYLAIKLKKDKLKKITN
>NC_014921.1|WP_013526919.1|615885_616686_-|Cof-type-HAD-IIB-family-hydrolase
MKKEIQAYFIDLDGTLLDLPEGEETLSSANVKAVVKLNKTKPVIISTGRSNSEFVLSLVKLLKCPYAICQNGALIVDKKNKVLARYEMEQNQVDEIVKLLKEEEMFFIFNGENKIYCNYESSAYMRPWTAKLEKLKYSDLGQKTNVTKILTFGKDEIATKNFKNFLAKKYPSLAFHIVSKGYSIEITHKNATKGKGAAFVCDLLKIDPKNAAHIGDSGNDLNALPEIGTFIAMENAMDEVKEVAHYIGPSFENSGIAKLFKDLKEI
>NC_014921.1|WP_013526920.1|616860_617535_-|hypothetical-protein
MYSFVKNKSLIKNIESFGSTLIKDLIKRINKQKYIRVQKELFGSGSEELIVQNDKGVIIIDYNLIVYAFFEGNSLYDCKKIREFVKKNFDESLTQLGCEISKDHSLSLTAENLTIDDYKDTPFIINLNIVFEFGPEYWIQLAHFKKSDAKKERWFWYNVPNTNSLMKRVEECKECDLWKDVQNIYLEKMNDFSKIFNRNADWFYCYAAAITEVENKNSDYDGED
>NC_014921.1|WP_013526921.1|617577_618735_-|hypothetical-protein
MKLDITITQMQFNEYLYDYSQDQEKKIRLDDWTAFDEYYYELLKKYIKEKVTNTNEKIRIYFLPRYDNKYYAFRLKYESEKEAEKELGKEEWFRNLMWLEDNQFSFWIWHVDYYLFFAKGLNNATNLEAFKIWFNNANKYEKNKNSKDNNEDSEAIDYLIKHSFYKFIQSLQDSIAKALNDKLNKVDILVFKNKYVDYQDTENYNFETVSNNSFQKLAKEKYNEFLAKFQDLKINKIFVKDLQPFYSSNDSETIKLLEFYIYLYKALYCTLSNFISLAYSKEDALNKCINIKDYCHEYWNEQFVPCFIFNNPKFELFSDIYTSITKVLPYLNKTKEISDSKTSDLVNSFKVESYYVLGLTIALLSYLKFLTICQVNKVIKKEKEI
>NC_014921.1|WP_013526922.1|618914_619259_-|hypothetical-protein
MNNEFTNFIFKEKIITNLYDNDNKLTKELKNKNIWDILNYKMFKNVNIDFLPYYIVDGQGYKSLIRKYQVITSSKNAKFEIVYGYLLLVASINLILLDYLNQNSINNSAFEYEV
>NC_014921.1|WP_013526923.1|619631_620267_-|GIY-YIG-nuclease-family-protein
MPEKGYVYVLTNPSFRDDWVKIGKSSRMPEVRGRELYNTAVPLPYEIYATLQTEKYNEVEKMIHKSIDRISKLRINKNREFFNIPPEKAYDILLDIKELLGNEAKLELMGDNVEVHTKEKTKRGEPFDFYSRGLKDGDVVSFIENSNIKAIVESNKTVYFENQSWSLSGLTREIYTRKGKVNSSGAYQGPKYFQFNGKRLTELPIIEECQS
>NC_014921.1|WP_013526924.1|620750_621785_+|restriction-endonuclease-subunit-S
MQKTLKCAIINNELNGSLFSTGFYGFKSIYNKIKYLKLFIESPYYQILKDSFCSGVTQKSINDEKLLNILIAIPPINEQEKIINKLISLDKFMKKYLEKENQLFKLDSEIKDKLQKSILQYAIQGKLVKQDPNDEPASKLLEAIQIEKNKLIKEGKIKKDKHESFIFQGEDKNYYEKIGSKVINITNEIPFEIPKNWVIVKISNISFRIDKKNIIIKTKQILSTGKYPIITQGQKFIEGYTNNVNNIFKVKEPIIIFGDHTKTTKFVDFNFVPGGDGTVFLKPLKINPLFFYYLVNYLSKKIRNRGYARHYILLKKEIIPIPNINEQNQIVSKIKKVFYFINCL
>NC_014921.1|WP_158304008.1|621995_622499_-|restriction-endonuclease-subunit-S
MVKIISGISYDKNDILTKMDKNYIRIIRSGNIQNSRLILFDDDIFLPVFYKNNIKMLHYNDIVIMASTGSKNLIGKPAFVEEQLDNVYIGAFLRIIRPNINNIFDYLKLIFMSEYYRSEIRKNVNGTNINNVNSNILLNMLIPIPSIKNERKISKKIYQVLNILTLM
>NC_014921.1|WP_041594315.1|622638_623439_-|tyrosine-type-recombinase/integrase
MILLFEDFLVKQNLTKNTINAYKSAIKLFNLKYEEINKKNLLLFKTYLIENYKPNSVNLKIQALNRYLEFIKKDTLKLKFIKVQQKTFIDNVISDADYVFLKRKLKKESLDWYFVVRFLAATGARVSELIKIKVEHVKLGYIDIYSKGGKARRIYIPLKLKKEAIIWLENKCLNSGYIFLNRFGKAITTRGISQQLKKYALKFGINPKVVYPHSFRHRFAKNFLEKYNDISFLADLMGHESIETTRIYLRKTSNEQQEIVDKIITW
>NC_014921.1|WP_013526928.1|624561_624873_+|restriction-endonuclease-subunit-S
MSKKGTLLLSFKLTIGKTSIINQDSVHNEAIVSINFYKDNNITKMFLLIFLGLLINNCEKINAIKGKTLNKEKLQKMLIPIPPIKNQNNILLITNKIIDLFKF
>NC_014921.1|WP_013526930.1|625985_626840_+|repb
MLLTTKQLQEFYKIEMENIAKNKSLLTNFNIIDNYANGLKPKQLYFLAARPGVGKTSFALNIIFNALENLKEDECIVLFSLEMDSIEIYSKLLALANSCSLKEVETNSKKIDFEDLNKKNLFIFDRYRNNFNNEKLSEVTPDIIYKSLNSIGLKIKAVFIDYFQLLDNQKYSSEREKLSQCSKQLKELSKIFNCNFFVLSQLSREYEKKTNNEPSFSDLKGTGSIEQDADLIMFLYNSSNNFNVGTLIPNKKTILNLSIAKNRNGELVKTNIDFIPHLAKFIES

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_014921_1	1.1\|615608\|56\|NC_014921\|CRISPRCasFinder	615608-615663	56	NZ_LR214999	Mycoplasma conjunctivae strain NCTC10147 plasmid 3	100527-100582	0	1.0
NC_014921_1	1.1\|615608\|56\|NC_014921\|CRISPRCasFinder	615608-615663	56	LR214965	Mycoplasma fermentans strain NCTC10117 genome assembly, plasmid: 11	90119-90174	0	1.0

1. spacer 1.1|615608|56|NC_014921|CRISPRCasFinder matches to NZ_LR214999 (Mycoplasma conjunctivae strain NCTC10147 plasmid 3) position: , mismatch: 0, identity: 1.0

ttcctacatatattttacattattatgtaacaaaaaagaagattataaaattaatt	CRISPR spacer
ttcctacatatattttacattattatgtaacaaaaaagaagattataaaattaatt	Protospacer
********************************************************

2. spacer 1.1|615608|56|NC_014921|CRISPRCasFinder matches to LR214965 (Mycoplasma fermentans strain NCTC10117 genome assembly, plasmid: 11) position: , mismatch: 0, identity: 1.0

ttcctacatatattttacattattatgtaacaaaaaagaagattataaaattaatt	CRISPR spacer
ttcctacatatattttacattattatgtaacaaaaaagaagattataaaattaatt	Protospacer
********************************************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

121409 : 129654

Acanthamoeba_polyphaga_mimivirus(16.67%)

tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013354365.1\|121409_123167_+	molecular chaperone DnaK	A0A0G2YAL1	Acanthamoeba_polyphaga_mimivirus	2.7e-123	44.9
WP_013354366.1\|123355_124570_+	replication-associated recombination protein A	A0A127AWE7	Bacillus_phage	3.3e-64	36.0
WP_013526674.1\|124571_125534_+\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	2.8e-26	37.0
WP_013526675.1\|125523_126195_+	uracil-DNA glycosylase	A0A172DS90	Canid_alphaherpesvirus	1.2e-26	35.6
WP_013526676.1\|126196_128383_+\|tRNA	phenylalanine--tRNA ligase subunit beta	A0A1L3IZU3	BeAn_58058_virus	1.8e-15	41.7
WP_013354370.1\|128391_129654_+	serine hydroxymethyltransferase	A0A240F2Y9	Aeromonas_phage	3.2e-94	50.0

DBSCAN-SWA_2

348401 : 404866

Bacillus_phage(28.57%)

tRNA,transposase,integrase

attL 377193:377211|attR 395032:395050

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013526785.1\|348401_349253_+\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_013354547.1\|349255_350098_+	HAD family phosphatase	NA	NA	NA	NA
WP_013354548.1\|350117_350990_+	riboflavin kinase	NA	NA	NA	NA
WP_013526786.1\|351099_352080_+	nucleotidyltransferase	NA	NA	NA	NA
WP_013526787.1\|352165_354709_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	4.0e-11	43.3
WP_013354550.1\|354945_355161_-	hypothetical protein	NA	NA	NA	NA
WP_013354551.1\|355257_355998_+	hypothetical protein	NA	NA	NA	NA
WP_013354552.1\|356001_356424_-	hypothetical protein	NA	NA	NA	NA
WP_013526789.1\|356732_358928_+	P80 family lipoprotein	NA	NA	NA	NA
WP_013354554.1\|359016_360195_+	thermonuclease family protein	NA	NA	NA	NA
WP_013354555.1\|360238_362335_+	ATP-binding cassette domain-containing protein	Q6GZ03	Mycoplasma_phage	1.6e-18	32.7
WP_013354556.1\|362318_363422_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_013354557.1\|363336_364320_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_013526791.1\|364331_364610_+	hypothetical protein	NA	NA	NA	NA
WP_013354558.1\|364618_366115_+	hypothetical protein	NA	NA	NA	NA
WP_013354559.1\|366195_367503_-	DNA recombination protein RmuC	NA	NA	NA	NA
WP_013354560.1\|367682_368207_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_013354561.1\|368250_368790_+	DJ-1/PfpI family protein	NA	NA	NA	NA
WP_013354562.1\|368831_370361_-	hypothetical protein	NA	NA	NA	NA
WP_013354563.1\|370395_373176_-	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	1.8e-105	32.0
WP_013526792.1\|373452_374352_+	hypothetical protein	NA	NA	NA	NA
WP_013526793.1\|374544_375141_+	30S ribosomal protein S4	NA	NA	NA	NA
WP_013354566.1\|375160_375400_+	50S ribosomal protein L31	NA	NA	NA	NA
WP_013354567.1\|375586_376609_+	heat-inducible transcriptional repressor HrcA	NA	NA	NA	NA
WP_013354568.1\|376608_377862_+	nucleotide exchange factor GrpE	NA	NA	NA	NA
377193:377211	attL	NA	NA	NA	NA
WP_013354569.1\|378030_378450_+	MscL family protein	NA	NA	NA	NA
WP_081439131.1\|378562_378670_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_049764032.1\|378757_379096_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	A0A1B1P773	Bacillus_phage	1.5e-11	37.1
WP_129622089.1\|379174_379318_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_013354570.1\|379441_379684_+	hypothetical protein	NA	NA	NA	NA
WP_041593976.1\|379984_380581_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	2.9e-13	37.6
WP_013526795.1\|380582_380771_+	50S ribosomal protein L35	NA	NA	NA	NA
WP_013354572.1\|380815_381166_+	50S ribosomal protein L20	NA	NA	NA	NA
WP_013526797.1\|381742_382843_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	9.1e-29	45.1
WP_013526801.1\|387076_388075_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_013354588.1\|388373_392210_+	hypothetical protein	NA	NA	NA	NA
WP_081451052.1\|392697_396033_-	hypothetical protein	NA	NA	NA	NA
395032:395050	attR	NA	NA	NA	NA
WP_013526804.1\|396075_397638_-	hypothetical protein	NA	NA	NA	NA
WP_013526805.1\|397770_402363_-	hypothetical protein	NA	NA	NA	NA
WP_013354585.1\|402627_402960_-	hypothetical protein	NA	NA	NA	NA
WP_013354584.1\|403423_403654_-	hypothetical protein	NA	NA	NA	NA
WP_049764027.1\|404029_404866_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	3.6e-46	43.0

DBSCAN-SWA_3

625985 : 640258

Mycoplasma_phage(100.0%)

integrase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013526930.1\|625985_626840_+	repb	O80239	Mycoplasma_phage	3.6e-33	35.4
WP_013526931.1\|626848_627010_+	hypothetical protein	NA	NA	NA	NA
WP_013526932.1\|627002_627164_+	hypothetical protein	A4D0G2	Mycoplasma_phage	1.5e-17	98.1
WP_013526935.1\|628099_628414_+	hypothetical protein	Q5QGL9	Mycoplasma_phage	2.1e-55	99.0
WP_013526936.1\|628401_630084_+	hypothetical protein	Q5QGL8	Mycoplasma_phage	0.0e+00	99.8
WP_013526937.1\|630064_631222_+	hypothetical protein	Q5QGL7	Mycoplasma_phage	1.8e-221	100.0
WP_015510650.1\|631223_633071_+	hypothetical protein	Q5QGL6	Mycoplasma_phage	0.0e+00	100.0
WP_013526939.1\|633112_633643_+	hypothetical protein	Q5QGL5	Mycoplasma_phage	1.5e-74	100.0
WP_013526940.1\|633655_634648_+	hypothetical protein	Q5QGL4	Mycoplasma_phage	5.3e-185	100.0
WP_013526941.1\|634650_636066_+	hypothetical protein	Q5QGL3	Mycoplasma_phage	1.1e-271	100.0
WP_013526942.1\|636082_637468_+	chaperonin	Q5QGL2	Mycoplasma_phage	5.7e-262	100.0
WP_013526945.1\|637761_638409_+	hypothetical protein	Q5QGL0	Mycoplasma_phage	1.2e-68	100.0
WP_013526946.1\|638468_639560_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_158304009.1\|639610_639778_-	hypothetical protein	NA	NA	NA	NA
WP_013526947.1\|639796_640258_-	hypothetical protein	Q5QGK8	Mycoplasma_phage	5.4e-84	100.0

DBSCAN-SWA_4

965865 : 989875