CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_015953	Streptomyces sp. SirexAA-E, complete sequence	6 crisprs	DEDDh,WYL,cas4,csa3,cas3,DinG	0	2	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_015953_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_015953_1

1401276-1401391

Orphan

Consensus_repeat	Method
CTCAACACGACGCAGGAGGGCGGGCGATGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_015953_1

>merge|NC_015953|1|1401276-1401391|CRISPRCasFinder
CTCAACACGACGCAGGAGGGCGGGCGATGACGCGGTACGCCGTCTCCGGCCGGGGGTCCGGGGGTCGCCCCCCGGGCAAGCACAGTCTCAACACGACGCAGGAGGGCGGGCGATGA

>NC_015953|1|1|1401276-1401391|CRISPRCasFinder
CTCAACACGACGCAGGAGGGCGGGCGATGA	CGCGGTACGCCGTCTCCGGCCGGGGGTCCGGGGGTCGCCCCCCGGGCAAGCACAGT
CTCAACACGACGCAGGAGGGCGGGCGATGA

Protein	Signature genes	Signature genes Name	Protein_function
NC_015953.1\|WP_026359032.1\|1389182_1389929_+\|transglycosylase-SLT-domain-containing-protein	unknown	unknown	gnl\|CDD\|381605
NC_015953.1\|WP_014045142.1\|1390077_1392624_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|213180
NC_015953.1\|WP_014045155.1\|1404183_1404468_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	unknown	unknown	gnl\|CDD\|182475
NC_015953.1\|WP_078492596.1\|1405500_1406511_-\|GTP-3',8-cyclase-MoaA	unknown	unknown	gnl\|CDD\|234672
NC_015953.1\|WP_014045156.1\|1404644_1405052_+\|DUF3099-domain-containing-protein	unknown	unknown	gnl\|CDD\|378630
NC_015953.1\|WP_014045150.1\|1398036_1398804_-\|enoyl-ACP-reductase-FabI	unknown	unknown	gnl\|CDD\|236124
NC_015953.1\|WP_014045160.1\|1408271_1408637_-\|DUF485-domain-containing-protein	unknown	unknown	gnl\|CDD\|377315
NC_015953.1\|WP_014045143.1\|1392950_1394207_+\|phosphoserine-phosphatase-SerB	unknown	unknown	gnl\|CDD\|319803
NC_015953.1\|WP_026359030.1\|1397486_1397855_-\|hypothetical-protein	unknown	unknown	unknown
NC_015953.1\|WP_014045159.1\|1406640_1408275_-\|cation-acetate-symporter	unknown	unknown	gnl\|CDD\|271374
NC_015953.1\|WP_014045148.1\|1396800_1397475_+\|FadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225097
NC_015953.1\|WP_014045144.1\|1394277_1394802_-\|histidine-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|224973
NC_015953.1\|WP_014045145.1\|1394888_1395098_-\|hypothetical-protein	unknown	unknown	unknown
NC_015953.1\|WP_014045161.1\|1408944_1410474_+\|S8-family-serine-peptidase	unknown	unknown	gnl\|CDD\|173799
NC_015953.1\|WP_014045157.1\|1405269_1405518_+\|hypothetical-protein	unknown	unknown	unknown
NC_015953.1\|WP_014045163.1\|1411211_1412114_-\|sterol-desaturase-family-protein	unknown	unknown	gnl\|CDD\|225546
NC_015953.1\|WP_014045154.1\|1402835_1404104_+\|tyrosine--tRNA-ligase	unknown	unknown	gnl\|CDD\|235645
NC_015953.1\|WP_014045162.1\|1410531_1411215_-\|lysoplasmalogenase	unknown	unknown	gnl\|CDD\|377946
NC_015953.1\|WP_014045151.1\|1398809_1399529_-\|3-oxoacyl-[acyl-carrier-protein]-reductase	unknown	unknown	gnl\|CDD\|273824
NC_015953.1\|WP_026359031.1\|1395383_1396670_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340897

Protein	Function_ID	Function_description	E-value
NC_015953.1\|WP_026359032.1\|1389182_1389929_+\|transglycosylase-SLT-domain-containing-protein	gnl\|CDD\|381605	cd13402, LT_TF-like, lytic transglycosylase-like domain of tail fiber-like proteins and similar domains. These tail fiber-like proteins are multi-domain proteins that include a lytic transglycosylase (LT) domain. Members of the LT family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, and the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL). LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.	6.76286e-30
NC_015953.1\|WP_014045142.1\|1390077_1392624_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|213180	cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily. ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR). DR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. Compared to other members of the ABC transporter subfamilies, the ABCG transporter family is composed of proteins that have an ATP-binding cassette domain at the N-terminus and a TM (transmembrane) domain at the C-terminus.	1.12925e-71
NC_015953.1\|WP_014045155.1\|1404183_1404468_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	gnl\|CDD\|182475	PRK10457, PRK10457, hypothetical protein; Provisional.	1.21553e-06
NC_015953.1\|WP_078492596.1\|1405500_1406511_-\|GTP-3',8-cyclase-MoaA	gnl\|CDD\|234672	PRK00164, moaA, GTP 3',8-cyclase MoaA.	0
NC_015953.1\|WP_014045156.1\|1404644_1405052_+\|DUF3099-domain-containing-protein	gnl\|CDD\|378630	pfam11298, DUF3099, Protein of unknown function (DUF3099). Some members in this family of proteins are annotated as membrane proteins however this cannot be confirmed. Currently no function is known.	9.75656e-20
NC_015953.1\|WP_014045160.1\|1408271_1408637_-\|DUF485-domain-containing-protein	gnl\|CDD\|377315	pfam04341, DUF485, Protein of unknown function, DUF485. This family includes several putative integral membrane proteins.	5.69035e-31
NC_015953.1\|WP_014045143.1\|1392950_1394207_+\|phosphoserine-phosphatase-SerB	gnl\|CDD\|319803	cd07500, HAD_PSP, phosphoserine phosphatase (PSP), similar to Methanococcus Jannaschii PSP and Saccharomyces cerevisiae SER2p. This family includes Methanococcus jannaschii PSP, and Saccharomyces cerevisiae phosphoserine phosphatase SER2p, EC 3.1.3.3, which participates in a pathway whereby serine and glycine are synthesized from the glycolytic intermediate 3-phosphoglycerate; phosphoserine phosphatase catalyzes the hydrolysis of phospho-L-serine to L-serine and inorganic phosphate, the third reaction in this pathway. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	1.31107e-92
NC_015953.1\|WP_014045162.1\|1410531_1411215_-\|lysoplasmalogenase	gnl\|CDD\|377946	pfam07947, YhhN, YhhN family. The members of this family are similar to the hypothetical protein yhhN expressed by E. coli. Many are annotated as possible transmembrane proteins, and in fact they all have a high proportion of hydrophobic residues. A human member of this family, formerly known as TMEM86B, is a lysoplasmalogenase that catalyzes the hydrolysis of the vinyl ether bond of lysoplasmalogen. Putative conserved active site residues have been proposed for the YhhN family.	2.36537e-24
NC_015953.1\|WP_014045159.1\|1406640_1408275_-\|cation-acetate-symporter	gnl\|CDD\|271374	cd11480, SLC5sbd_u4, Uncharacterized bacterial solute carrier 5 subfamily; putative solute-binding domain. SLC5 (also called the sodium/glucose cotransporter family or solute sodium symporter family) is a family of proteins that co-transports Na+ with sugars, amino acids, inorganic ions or vitamins. Prokaryotic members of this family include Vibrio parahaemolyticus glucose/galactose (vSGLT), and Escherichia coli proline (PutP) and pantothenate (PutF) cotransporters. One member of the SLC5 family, human SGLT3, has been characterized as a glucose sensor and not a transporter. This subfamily belongs to the solute carrier 5 (SLC5) transporter family.	0
NC_015953.1\|WP_014045148.1\|1396800_1397475_+\|FadR-family-transcriptional-regulator	gnl\|CDD\|225097	COG2186, FadR, Transcriptional regulators [Transcription].	1.468e-48
NC_015953.1\|WP_014045144.1\|1394277_1394802_-\|histidine-phosphatase-family-protein	gnl\|CDD\|224973	COG2062, SixA, Phosphohistidine phosphatase SixA [Signal transduction mechanisms].	2.0672e-44
NC_015953.1\|WP_014045150.1\|1398036_1398804_-\|enoyl-ACP-reductase-FabI	gnl\|CDD\|236124	PRK07889, PRK07889, enoyl-[acyl-carrier-protein] reductase FabI.	1.44624e-172
NC_015953.1\|WP_014045161.1\|1408944_1410474_+\|S8-family-serine-peptidase	gnl\|CDD\|173799	cd07473, Peptidases_S8_Subtilisin_like, Peptidase S8 family domain in Subtilisin-like proteins. This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.	6.00285e-56
NC_015953.1\|WP_014045163.1\|1411211_1412114_-\|sterol-desaturase-family-protein	gnl\|CDD\|225546	COG3000, ERG3, Sterol desaturase [Lipid metabolism].	3.57365e-38
NC_015953.1\|WP_014045154.1\|1402835_1404104_+\|tyrosine--tRNA-ligase	gnl\|CDD\|235645	PRK05912, PRK05912, tyrosyl-tRNA synthetase; Validated.	0
NC_015953.1\|WP_014045151.1\|1398809_1399529_-\|3-oxoacyl-[acyl-carrier-protein]-reductase	gnl\|CDD\|273824	TIGR01830, 3-oxoacyl-_reductase_FabG, 3-oxoacyl-(acyl-carrier-protein) reductase. This model represents 3-oxoacyl-[ACP] reductase, also called 3-ketoacyl-acyl carrier protein reductase, an enzyme of fatty acid biosynthesis. [Fatty acid and phospholipid metabolism, Biosynthesis].	1.84575e-125
NC_015953.1\|WP_026359031.1\|1395383_1396670_-\|MFS-transporter	gnl\|CDD\|340897	cd17339, MFS_NIMT_CynX_like, 2-nitroimidazole and cyanate transporters and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Escherichia coli 2-nitroimidazole transporter (NIMT) and cyanate transport protein CynX, and similar proteins. NIMT, also called YeaN, confers resistance to 2-nitroimidazole, the antibacterial and antifungal antibiotic, by mediating the active efflux of this compound. CynX is part of an active transport system that transports exogenous cyanate into E. coli cells. The NIMT/CynX-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	5.21204e-127

>NC_015953.1|WP_014045151.1|1398809_1399529_-|3-oxoacyl-[acyl-carrier-protein]-reductase
MSRSVLVTGGNRGIGLAIARAFADNGDKVAITYRSGEPPQALTEAGVLAVRCDITDTEQVEQAYKEIEEKHGPVEVLVANAGITKDQLLMRMSEDDFTSVVDTNLTGTFRVVKRANRAMLRAKKGRVVLISSVVGLMGSAGQANYAASKAGLVGFARSLARELGSRNITFNVVAPGFVDTDMTQVLTDEQRKGIVSQVPLGRYAQPAEIAAAVRFLASDDASYITGAVIPVDGGLGMGH
>NC_015953.1|WP_014045150.1|1398036_1398804_-|enoyl-ACP-reductase-FabI
MSGILDGKRILITGVLMESSIAFHAAKVAQEQGAEVILTAFPRPTLTERIAKKLPKPAKVIELDVTNTEHLDRLAGLVRDELGSLDGVVHSIGFAPQDALGGNFLNTPFESVATAMHVSAFSLKSLAMACKPLMNDGGSIVGLTFDAQFAWPQYDWMGPAKAALEATSRYLARDLGKEDIRCNLISAGPIGSMAAKSIPGFGELADVWNHRSPLEWDMADPEPAGRGIVALLSDFFPKTTGEIIHVDGGVHMIGA
>NC_015953.1|WP_026359030.1|1397486_1397855_-|hypothetical-protein
MRSTRRRTWALVAAAVAVAGLLAPVAVSAASRAAGEGASSAPPSPEPSGAECRTTVDGSRVVAHCHNPYPATDLVQLHTECARWWDVDADAEAVAVQPGRTVRLEDRCWKEVGRAWVSHRVS
>NC_015953.1|WP_014045148.1|1396800_1397475_+|FadR-family-transcriptional-regulator
MTLTSPRRSALADQVIAQLRNQITSGEWPVGSRIPTEPELVEQLGVARNTVREAVRALAHNGLLDIRQGSGTYVVATSELAGVMHRRFADADPRHIAELRSTLESSAARLAALRRTDRDLRQLDTLMARREETWAAGDAEAFVAADATLHLAVVAASHNDVLTELYADLNDLLRDYLRGDVGTELRPQDHMDHARLVEAIRAGDAETAATEAAGHALNCLRDRV
>NC_015953.1|WP_026359031.1|1395383_1396670_-|MFS-transporter
MRHDESPTLNTASAPPTADGGGKAAPGPSPWLLRLVTVGLVLAAINLRPAITSLGPLLKEVRDGLHMSGSVAGVLTSVPPFCFALFGFMAPRLARRFGPGAVVCAGMVAIAAGLLIRPYIGSTAGFLAASALALMGIAVSNVLMPVIVKRWFPDRVGSMTGLYSMALALGTAFAAALTVPVTNALGGSWKPGLAVWAVPAVIAVVPWLALVRDRDGSTGQRRTRPTAGTSPEPAPALRITRSRTSWALACFFGLQATAAYITMGWIPQIFRDAGVSAGTAGVLLAVIMAMGVPLAFVIPRVAARLRTQGPIVLVLGGCGLLGYAGLYLAPAGGSWLWALLLGIANCAFPLALTMIGMRARSGAGVVRLSAFAQSTGYLLSIPGPLLVGVLYQHSGGWGLPLALMAGLLVPQTVAGVLAGRNRVIEDEC
>NC_015953.1|WP_014045145.1|1394888_1395098_-|hypothetical-protein
MTARTQTRTRRAAPDDAVEARLPWWAVVLPALAFAALLLLIAGPGQAEAATGDPAVGRLLGLMVGLLSR
>NC_015953.1|WP_014045144.1|1394277_1394802_-|histidine-phosphatase-family-protein
MSAETPRRIVLLRHAKAEWSQQSDHERPLAERGRKEAPVAGRRLADSGIDFDLALCSTATRTRETWKLAVHEFAQRPRTVYEERLYEASVGELIALFGEIPDDVRTVLVIGHNPGMHGVADVLAGQAEGDALTRMTRDGFSTAAYAVIDFQGPWKSLEPGVGKIAEYWAPNARA
>NC_015953.1|WP_014045143.1|1392950_1394207_+|phosphoserine-phosphatase-SerB
MSASEPPRSPRSPELPDSPQGTGTPTLLVKIFGKDRPGITAGLFDTLAAFSVDVVDIEQVVTRGRIVLCALVTDPAAGGATEGGLRSTVHSWAESLKLQAEIISGTGDNRPRGYGRSHVTVLGNPLTAESTAAIAARITSTGGNIDRIFRLAKYPVTAVEFAVSGTATEELRTALATEAADIGVDIAVVSAGLSRRAQRLVVMDVDSTLIQDEVIELFAAHAGCEDKVAEVTEQAMRGELDFEQSLHARVALLAGLDASVVDKVRAEVRLTPGARTLIRTLKRLGYQVGVVSGGFTQVTDDLKERLGLDFASANTLEVVDGKLTGRVVGDVVDRAGKARLLRSFAEQAGVPLAQTVAIGDGANDLDMLNTAGLGVAFNAKPVVRQAAHTAVNVPFLDTVLYLLGITREEVEAADGLVD
>NC_015953.1|WP_014045142.1|1390077_1392624_-|ATP-binding-cassette-domain-containing-protein
MGRGVPELVLEFNGRTWTLDPSRPYTLGRDPQGDLMADDARVSWRHATISWNGRSWSIEDHGSTNGTYVLGRRVQQTEIGPGVAVNLGNATDGPRLSFTAAAAGVHSGQPAAAQPGPAHPQQGAPVWPDPAHAQHPQQAAAQQQMHYAPPVPHQQGGPGPTPGAGAPGGASGAPPVYGDRSPTTFHQLDLGRVMRIGRALENELVVSDLQVSRLHAEFRATPDGRFEIRDLGSHNGTYVNGLPLSKSGSALIGPNDIVGVGHSTFRLVGDRLEEFVDTGEVSFSARHLTVTVDGGKNILKDVSFGVPEKSLVAVIGPSGSGKSTLLKALTGYRPANQGDVLYDNRNLYKQFAELRQRIGLVPQDDILHKELTVSKALGYAAKLRFPADTTEAERTARIHEVLAELKLDIHKDKKVTSLSGGQRKRVSVALELLTKPSLIFLDEPTSGLDPGMDRDVMQLLRGLADDGRTVLVVTHSVAELAICDKLLVMAPGGSVAYFGPPEEALNFFGYTSWADVFSAFENYRDYDWAGRWRGSQHYQMYAADIDAVAAQSVHMPPAQQMRPPKPQGWTAQLLTLMRRYISVIASDKGFLALMVILPAVLGLVSVVIPAEFGLAAPDVAGKRFNSKAGTILLILAVGMCFAGSANSVRELIKERVIYERERATGLSRSAYLTSKVIVLGVITALQGVIICGIGLSTRKLPEEGLFMSPAVEICLAIIALGFTSMMVGLMISALVKTAEKTMPLLVMFAIVQVVFTGVLFQLYGSPGLEQFAWLMPSRWAVAAAGATLDLAHLMPPWDTDNPTDLDPLWESSAGQWGMNIAVLLLMAVVLFAVVSRLLRRHEPEVMRK
>NC_015953.1|WP_026359032.1|1389182_1389929_+|transglycosylase-SLT-domain-containing-protein
MSISRITSRSRRLNKAQKLSVAGVSTLAAAAVAFSLVPDDASATTEPQAVSGAPVAFAGKGQTDSVQASIIEQHSTAEQLVKAADAAKAKAAAAEKKAADQAEAKAKAVAEAKSKAAAKAKADAQKRSSSTSSRAADRKPVYADNLDGWIREALSIMHEKKIPGTYEGLHRNIMRESSGNPRAINNWDINAINGIPSKGLLQVIKPTFDFYHVAGTKKDQYDPVANITAAANYAADKYGSIDNVDSAY
>NC_015953.1|WP_014045154.1|1402835_1404104_+|tyrosine--tRNA-ligase
MTDIVDELKWRGLFAQSTDEDALRKALADGPVTFYCGFDPTAASLHVGHLVQVLTMRRLQLAGLRPLALVGGATGQIGDPRPTAERTLNDPETIAAWVDRLRGQIEPFLTFEGPNAATMVNNLDWTAGLSAIEFLRDIGKHFRVNKMLTKDSVARRLESQEGISYTEFSYQLLQGMDFLELYRRHGCTLQQGGSDQWGNLTAGIDLIHRLEPGAQVHALATPLMVKADGTKFGKSESGAVWLDPEMTTPYAFYQFWLNVDDRDISTYMRILSFKSREELQELEQLTQERPQARSAQRALAEELTTLVHGGAQCAAVIAASKALFGQGDLAELDEPTLGAALSEVPHARVTELGPVVDLLVEVGLSASKSAARRTVKEGGAYVNNAKVTDGEAAPAREELLHGRWLVLRRGKKNLAAVEVTAG
>NC_015953.1|WP_014045155.1|1404183_1404468_-|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein
MGWLWAIIVGLVLGVIARGILPGKQNIPLWLTVVFGILGSILGNAVAGWLGVADTKGIDWTRHVLQLIGAIVIVAVGDMLWQAIRGRRGDRQRT
>NC_015953.1|WP_014045156.1|1404644_1405052_+|DUF3099-domain-containing-protein
MAGGAIWWWDMMRNQRGALVFRITGARQSLADDVRGRQRRYIISMSVRTVSVVLAATLWNVERHVAVVALALGVLLPYVAVVIANAGRENAPGLPSTFVPAPMRPALGAASGTEPAGPVPDSGGAGSAGGAPGPE
>NC_015953.1|WP_014045157.1|1405269_1405518_+|hypothetical-protein
MNFPDTPAESAAGAPVCSAKGCRADAVWVLAWNNPKLHTPERRKTWLACDEHREHLSSFLGVRGFLKDVVPLAEWESSASDR
>NC_015953.1|WP_078492596.1|1405500_1406511_-|GTP-3',8-cyclase-MoaA
MTGEGAHVLIDTYGRVATDLRVSLTDRCNLRCTYCMPEEGLQWLAKPDLLTDEEIVRLVRVAVTSLGITEVRFTGGEPLLRPGLVSVVERCAALEPRPRMSLTTNGIGLKRTAAALKTAGLDRVNVSLDTLRPDVFKTLTRRDRHKDVLDGLRAARDAGLTPVKVNSVLMPGLNDDEAPELLAWAVDHGYELRFIEQMPLDAQHGWKRDGMITAGDILASLRTRFTLTAEDEDERGSAPAERWTVDGGPHRVGVIASVTRPFCQACDRTRLTADGQVRTCLFAQEETDLRGALRSGAPDEEIARIWKLAMWGKKAGSGLDDPAFLQPDRPMSAIGG
>NC_015953.1|WP_014045159.1|1406640_1408275_-|cation-acetate-symporter
MSAAAHSSSLVLAASSTTEHRPLIISLFAVFVAATLAITVWAGRQTKSASDFYAGGRQFTAFQNGLAVSGDYMSAASFLGIAGAIALFGYDGFLYSIGFLVAWLVALLLVAEPLRNSGRYTMGDVLAYRMRQRPVRTAAGVSTIVVSIFYLLAQMAGAGVLVALLLGITGDTGKILIVALVGVLMILYVTIGGMKGTTWVQMVKAVLLIAGALLMTFMVLWKFDFNVSDLLGTAAEKSGHGKAFLEPGLKYGATGVSKLDFISLGIALVLGTAGLPHILIRFYTVPTAKAARKSVNWAIGIIGAFYLMTIALGFGAAALIGPDEIKAKNPAGNAAAPQLAEYLGGVGTTGGAVLLAVISAVAFATILAVVAGLTLASSSSFAHDIYANVIRRGKATEKEEMRAARWATVAIGIVSIALGAMARDLNVAGLVALAFAVAASANLPTILYSLFWKRFTTQGALWSIYGGLASSVVLVLFSPVVSGKASSMFPDVDFAWFPLENPGLISIPLGFLLGWIGSVVSKEEPDTDKYAELEVKSLTGTGAH
>NC_015953.1|WP_014045160.1|1408271_1408637_-|DUF485-domain-containing-protein
MATDAPPPQGSTDNSPAQPTTEVFVETQKSAEFAELRRAHRSFAFPLTVGFIAWYLLYVLLSSYAGDFMGTTVFANFNVAFVFGLAQFATTFLIAWFYSRHAATKIDPKAEAIKSRLEADA
>NC_015953.1|WP_014045161.1|1408944_1410474_+|S8-family-serine-peptidase
MAHLASRRTRALTLPVGLALTASLGFLPGTASAAPGKAPAATVRTDGPKLSYVVNTRVGLGTVKQVKQAIAKAGGTVVTSYDRIGVIVVHSQNPDFGPAIRKSWGVQSAGATRTNPIVPQATKDIGVAQPLTAAQAEAASAKATAGQDELEPLQWDLPAIKADKAHQKSLGSSRVTVGVIDTGVDDTHPDLAPNFDRKASVNCVSGAPDTTDGAWRPAANESDHGTHVAGTIAAAKNGTGVTGVAPGVKVSGIKVSNPDGFFYTEAVVCGFVWAAEHGVDVTNNSYYTDPWLFNCKNDPDQGALVEAVTRATRYAEGRGVVNVAAAGNSDHDLALHAIEDTTSPNDSTTVTRTVDPRLCPDIPTMLPGVVTVSATGAKGLKSSYSNYGLGVIDVAAPGGDSTVYQTPEAPATSGLILSTLPGGKFGYKAGTSMASPHVAGVAALIRSSHPYASPAVVKALLTHQADATACGAPYDIDGDGTVDAVCQGGKSYNGFYGAGVVDALDAVRR
>NC_015953.1|WP_014045162.1|1410531_1411215_-|lysoplasmalogenase
MSPRPRAPRLVRPLLVAFLAATAVDLAGLLAGSHTAHLVAKPLLMPLLAAYAAARGGPRLLVAALLCGWGGDVLLMPGADAAFLAGMGLFAAGHVCYLRLFGRARASLPAGLGYAAALAVLLVLLWSDLPGGMRIPLTCYSLLLTTMAWRAGALGRWAGAGGALFLLSDALIATSIAAWPRLPAHDFWVMLTYAAAQYLLTAGVLGSRDGASPAVTGADRTGGGVRV
>NC_015953.1|WP_014045163.1|1411211_1412114_-|sterol-desaturase-family-protein
MEPNLPDVVLWSIPAFVLLTVLEMVSYRLHPDDEAAGYEAKDAATSVTMGLGSLVFDLLWKIPVVAIYTALYELTPLRVPVLWWTVLLMLFAQDFFYYWSHRGHHVVRILWACHVVHHSSRNFNLTTALRQPWTSLTSWPFYLPLIALGVHPAALAFCSSANLVYQFWVHTERVGKLPRPFEYVLNTPSHHRVHHASQGGYLDRNFGGILIVWDRLFGSFAAEAERPVYGLTKNISTYNPLRVATHEYAAIARDVRAAGSWSERAGRVFRGPGWQPARTVAPAAPAPREASVRPAAEQAR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_015953_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_015953_2

2124444-2124548

Orphan

Consensus_repeat	Method
TGCTCTGCCAATTGAGCTACAGGGGAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_015953_2

>merge|NC_015953|2|2124444-2124548|CRISPRCasFinder
TGCTCTGCCAATTGAGCTACAGGGGATCGCGCTCCCCCGACTGGACTCGAACCAGTAACCTGCCGGTTAACAGCCGGCTGCTCTGCCAATTGAGCTACAGGGGAT

>NC_015953|2|2|2124444-2124548|CRISPRCasFinder
TGCTCTGCCAATTGAGCTACAGGGGAT	CGCGCTCCCCCGACTGGACTCGAACCAGTAACCTGCCGGTTAACAGCCGGC
TGCTCTGCCAATTGAGCTACAGGGGAT

Protein	Signature genes	Signature genes Name	Protein_function
NC_015953.1\|WP_014045798.1\|2113294_2113867_+\|hypothetical-protein	unknown	unknown	unknown
NC_015953.1\|WP_014045806.1\|2122697_2123963_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340863
NC_015953.1\|WP_014045804.1\|2119853_2121185_+\|acetyl-CoA-carboxylase	unknown	unknown	gnl\|CDD\|223848
NC_015953.1\|WP_014045816.1\|2137666_2138005_-\|divalent-cation-tolerance-protein-CutA	unknown	unknown	gnl\|CDD\|376987
NC_015953.1\|WP_014045814.1\|2135031_2136375_-\|deoxyguanosinetriphosphate-triphosphohydrolase	unknown	unknown	gnl\|CDD\|235098
NC_015953.1\|WP_014045813.1\|2133631_2134891_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|170080
NC_015953.1\|WP_014045815.1\|2136853_2137591_+\|YdcF-family-protein	unknown	unknown	gnl\|CDD\|225500
NC_015953.1\|WP_019992665.1\|2125158_2126604_+\|sugar-kinase	unknown	unknown	gnl\|CDD\|198375
NC_015953.1\|WP_014045799.1\|2113997_2115035_+\|rod-shape-determining-protein	unknown	unknown	gnl\|CDD\|336482
NC_015953.1\|WP_014045803.1\|2118376_2119834_+\|acyl-CoA-synthetase	unknown	unknown	gnl\|CDD\|236096
NC_015953.1\|WP_014045801.1\|2116538_2116970_-\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224439
NC_015953.1\|WP_014045805.1\|2121251_2122361_-\|LLM-class-flavin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|274652
NC_015953.1\|WP_014045812.1\|2131618_2133526_-\|DNA-primase	unknown	unknown	gnl\|CDD\|235551
NC_015953.1\|WP_014045810.1\|2128444_2130364_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NC_015953.1\|WP_014045800.1\|2115052_2116561_+\|GAF-domain-containing-protein	unknown	unknown	gnl\|CDD\|225113
NC_015953.1\|WP_014045802.1\|2117130_2118342_+\|NarK/NasA-family-nitrate-transporter	unknown	unknown	gnl\|CDD\|225133
NC_015953.1\|WP_014045807.1\|2124729_2125041_+\|hypothetical-protein	unknown	unknown	unknown
NC_015953.1\|WP_014045811.1\|2130395_2131463_-\|RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|235640
NC_015953.1\|WP_014045797.1\|2112484_2112961_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236090
NC_015953.1\|WP_014045809.1\|2126711_2128445_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055

Protein	Function_ID	Function_description	E-value
NC_015953.1\|WP_014045806.1\|2122697_2123963_-\|MFS-transporter	gnl\|CDD\|340863	cd06173, MFS_MefA_like, Macrolide efflux protein A and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Streptococcus pyogenes macrolide efflux protein A (MefA) and similar transporters, many of which remain uncharacterized. Some members may be multidrug resistance (MDR) transporters, which are drug/H+ antiporters (DHAs) that mediate the efflux of a variety of drugs and toxic compounds, conferring resistance to these compounds. MefA confers resistance to 14-membered macrolides including erythromycin and to 15-membered macrolides. It functions as an efflux pump to regulate intracellular macrolide levels. The MefA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.7219e-71
NC_015953.1\|WP_014045804.1\|2119853_2121185_+\|acetyl-CoA-carboxylase	gnl\|CDD\|223848	COG0777, AccD, Acetyl-CoA carboxylase beta subunit [Lipid metabolism].	5.97237e-50
NC_015953.1\|WP_014045816.1\|2137666_2138005_-\|divalent-cation-tolerance-protein-CutA	gnl\|CDD\|376987	pfam03091, CutA1, CutA1 divalent ion tolerance protein. Several gene loci with a possible involvement in cellular tolerance to copper have been identified. One such locus in eubacteria and archaebacteria, cutA, is thought to be involved in cellular tolerance to a wide variety of divalent cations other than copper. The cutA locus consists of two operons, of one and two genes. The CutA1 protein is a cytoplasmic protein, encoded by the single-gene operon and has been linked to divalent cation tolerance. It has no recognized structural motifs. This family also contains putative proteins from eukaryotes (human and Drosophila).	1.92601e-45
NC_015953.1\|WP_014045814.1\|2135031_2136375_-\|deoxyguanosinetriphosphate-triphosphohydrolase	gnl\|CDD\|235098	PRK03007, PRK03007, deoxyguanosinetriphosphate triphosphohydrolase-like protein; Provisional.	0
NC_015953.1\|WP_014045813.1\|2133631_2134891_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|170080	PRK09754, PRK09754, phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional.	6.22404e-69
NC_015953.1\|WP_014045815.1\|2136853_2137591_+\|YdcF-family-protein	gnl\|CDD\|225500	COG2949, SanA, Uncharacterized membrane protein [Function unknown].	2.1854e-62
NC_015953.1\|WP_014045799.1\|2113997_2115035_+\|rod-shape-determining-protein	gnl\|CDD\|336482	pfam06723, MreB_Mbl, MreB/Mbl protein. This family consists of bacterial MreB and Mbl proteins as well as two related archaeal sequences. MreB is known to be a rod shape-determining protein in bacteria and goes to make up the bacterial cytoskeleton. Genes coding for MreB/Mbl are only found in elongated bacteria, not in coccoid forms. It has been speculated that constituents of the eukaryotic cytoskeleton (tubulin, actin) may have evolved from prokaryotic precursor proteins closely related to today's bacterial proteins FtsZ and MreB/Mbl.	1.13865e-136
NC_015953.1\|WP_014045803.1\|2118376_2119834_+\|acyl-CoA-synthetase	gnl\|CDD\|236096	PRK07787, PRK07787, acyl-CoA synthetase; Validated.	0
NC_015953.1\|WP_014045801.1\|2116538_2116970_-\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|224439	COG1522, Lrp, Transcriptional regulators [Transcription].	1.53888e-32
NC_015953.1\|WP_014045805.1\|2121251_2122361_-\|LLM-class-flavin-dependent-oxidoreductase	gnl\|CDD\|274652	TIGR03565, alk_sulf_monoox, alkanesulfonate monooxygenase, FMNH(2)-dependent. Members of this protein family are monooxygenases that catalyze desulfonation of aliphatic sulfonates such as methane sulfonate. This enzyme uses reduced FMN, although various others members of the same luciferase-like monooxygenase family (pfam00296) are F420-dependent enzymes. [Central intermediary metabolism, Sulfur metabolism].	3.01067e-143
NC_015953.1\|WP_014045812.1\|2131618_2133526_-\|DNA-primase	gnl\|CDD\|235551	PRK05667, dnaG, DNA primase; Validated.	0
NC_015953.1\|WP_014045810.1\|2128444_2130364_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	0
NC_015953.1\|WP_014045800.1\|2115052_2116561_+\|GAF-domain-containing-protein	gnl\|CDD\|225113	COG2203, FhlA, FOG: GAF domain [Signal transduction mechanisms].	5.55604e-17
NC_015953.1\|WP_014045802.1\|2117130_2118342_+\|NarK/NasA-family-nitrate-transporter	gnl\|CDD\|225133	COG2223, NarK, Nitrate/nitrite transporter [Inorganic ion transport and metabolism].	1.3915e-80
NC_015953.1\|WP_019992665.1\|2125158_2126604_+\|sugar-kinase	gnl\|CDD\|198375	cd07809, FGGY_D-XK_1, D-xylulose kinases, subgroup 1; members of the FGGY family of carbohydrate kinases. This subgroup is composed of D-xylulose kinases (XK, also known as xylulokinase; EC 2.7.1.17) from bacteria and eukaryota. They share high sequence similarity with Escherichia coli xylulokinase (EcXK), which catalyzes the rate-limiting step in the ATP-dependent phosphorylation of D-xylulose to produce D-xylulose 5-phosphate (X5P) and ADP. Some uncharacterized sequences are also included in this subfamily. EcXK exists as a dimer. Each monomer consists of two large domains separated by an open cleft that forms an active site. This model includes both the N-terminal domain, which adopts a ribonuclease H-like fold, and the structurally related C-terminal domain. The presence of Mg2+ or Mn2+ might be required for catalytic activity. Members of this subgroup belong to the FGGY family of carbohydrate kinases.	1.94403e-120
NC_015953.1\|WP_014045811.1\|2130395_2131463_-\|RNA-polymerase-sigma-factor	gnl\|CDD\|235640	PRK05901, PRK05901, RNA polymerase sigma factor; Provisional.	7.49209e-159
NC_015953.1\|WP_014045797.1\|2112484_2112961_-\|hypothetical-protein	gnl\|CDD\|236090	PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated.	6.29206e-07
NC_015953.1\|WP_014045809.1\|2126711_2128445_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	5.33884e-164

>NC_015953.1|WP_014045806.1|2122697_2123963_-|MFS-transporter
MTETAETRVSRTRILADLTPLRTSPDYRRLWFGNTVSWIGQGMTALAVSLQVYDITGSAFSVGLIGLCSFVPLVLLGLYSGAIADTVDRRKLGLYSAAGSFVLSIALAAVAFAGIEHVGFLYAVVALQGVCFALNSPARSSMIARLLPAEQLPAANALNAMTSTTGGLVGPMLGGLIVGWWGYRSAYTVDAITFTASLYAMWRLPSMLPDRKTGKGAERASVMDGLRFLGTRPNLRMTFFSDLCAMVLAQPRALFPVVAVLWFGGDAKTTGLLVAAPALGALLGSVFSGWLGRIRRHGLAVLIAVCCWGAAVAVFGLTRQLWPGLALLAVAGCADSISMVFRNTMLQAAAPDEMRGRLQGVFIVVVAGGPRLGDLMAGSVADLASPAVAVTGGGIACVVIVCLLGLRWRGFARYDARDPQP
>NC_015953.1|WP_014045805.1|2121251_2122361_-|LLM-class-flavin-dependent-oxidoreductase
MSDTRPPFLLHWFLPTGGDGRDPGGVTAVQGRTGAATRRPADIGYLSQVARAAEQAGFHSLLTPVGLGCVDPWILTAALTQHTDRIGFLVAFRAGFASPTLLAQQADAFRRFAGGRLRLNVVTGGDPVEQRAYGDELAHDARYARTDEVMAVLRDLLEGKRVDHDGEHLRIEGAQLTDPALQHPVPLYFGGASPAAESVAARRADVQLLWGEPPAALADRVGRLRTRAPALRYGLRLHVISRDTSAEAWAEADRILAGIDPEAVRASQERFARMDSTGQARMAALHGGSTDAAKLQVAPNLWAGIGLVREGAGTALVGSHDEVAERLHAYHRLGIDEFILSGYPHLEEAYRVGEEVAPRLRALVAKDGE
>NC_015953.1|WP_014045804.1|2119853_2121185_+|acetyl-CoA-carboxylase
MPARDAIAAVTDAFTEHRPPGAPEAGDGPLGWDGYGASRERAAARTGEAESVLYGTGRVGGLDCVLVAFEFGFLGGSLGRRSGDRLEAAYTLAAERRLPLVSLVATGGSRMQEGMIALIQLQRVAGASARLRAAGLPQIAVLRDPATGGGWATLGAGADVVLALPGAQIGFAGSRVRPAGADPFAYTAEGQLAAGQVDAVVAPEELGRTLGRWLAALTVTGPARPAPVPDALSATGLPESGWDAVERARAAGRPRAGAYLDAYFDDRLELRGDRCGGVDPGMLCGVGLRAGQPVAYAAQCGTATLPAGYRTAARVIRLADRLGLPVLTLIDTPGAANDAEAERTGAGAAIAEVFGAVASARVPVTSLVIGEGGSGGALALAAPGNTHVTADSYFSVIAPELAAAILKRGPQDVRTTAGQLRLRPQDLVELGVARSVVGPSPGP
>NC_015953.1|WP_014045803.1|2118376_2119834_+|acyl-CoA-synthetase
MTSLLPALHETSDRTDSPEAVRFGEHTLTYAELAGASAALAARIAGAGRVAVWATPTAGTVVAVVAALRAGVPAVPLNPRTGARELAHILADSSPSLVLAGAGEELPAALDGVERLDVDTAARAWGTGFAEPPAESPALVVYTSGTTGPPKGAVLPRRAIAASLDALQDAWRWTGDDVLVHALPLFHVHGLVLGILGPLRRGGSVRHLGRFSPEGVARELLSGATMLFGVPTMYHRLAGALDGPDGAGELRKALAGARLLVSGSAALPVHDHERIAAATGRRVVERYGMTETLMNTGVRADGVPRAGTVGPPLAGVELRLVEEDGGVLEGAGALGEIQVRGPNLFTGYLNRPDATAAAFTEDGFFRTGDMATLDPDGYVRIVGRKATDLIKSGGYKIGAGEIENALLEHPGVREAAVTGEPDPDLGERIVAWVVPADAGSPPGERELADHVAGLLAPHKRPRVVRLLDALPRNDLGKIMKRALGV
>NC_015953.1|WP_014045802.1|2117130_2118342_+|NarK/NasA-family-nitrate-transporter
MHTASEQTPAPGGTPPSAAYRNLVMATVGFALTFWAWNLVSPLSGDFKDRLGLSSFQQSLLVAVPVLVGSLGRIPAGALTDRFGARLMFPAVSALTIVPVLLLIPAKNSFGAMLAVGFLLGLGGTTFAIGIPLVNSWFPPAKRGLALGVFGMGMGGVALSGYFTPRIAKHGQDLPFWIVAAALVVYSLLAAVLITDRPDRKVPTQSLAHRLGQAGRLRVTWELSALYAIGFGGIVAFGVYLPTYLKTWYAMSPTEAGTKAAGFALVTVIFRPIGGWLSDRMHPALVTAAALLLAALTAIVQAFDPPLNPLGTIALLCMAAGLGTASGSVFALVSQVTPQAQVGSVTGIVGAMGGLGGFVPPLVMGAIYSAKDSYSIGFMLLSDLALAGCVYAFGRMRTVRGEG
>NC_015953.1|WP_014045801.1|2116538_2116970_-|Lrp/AsnC-family-transcriptional-regulator
MDRLDREILAILQEDARISYRDLGVRVGLSANAAGDRVRRMRQEGVIRGFTAVIDPAADTRTGLVVFIDVSLRLDTTDEQFERAVLTLPGITEVVHVTGGHDYLVRATAADTGPLDALLRRLKKDAGVAHSTTRIALRAAPAR
>NC_015953.1|WP_014045800.1|2115052_2116561_+|GAF-domain-containing-protein
MAARGLDLRTILQHIVDTATALAGARHGALTLLDRDLRRVTDLFTSGLTEAERRELAELPETHAGVVGALADDPRPLRLHDLTADPRSCGVPAGHPRMRTFAGAPVQVRDEVLGSLCVTGKRAGGDFTDTDLALLRLLASQAGAAIGGAHLYEAARQRAHWIEGAAAVTRALLRGTGTTDALMTVAERARVLAGAAAGVVLQPTADGGMEIVAASTRDDPAGLVGTVIEPGAPVLVQLLGGEGVFLDDSATDPRMTTHVRSRFGPSMMLPLQSGGRLIGTLALPRRRGERLYTEAERQLASQFASQAALAMVMADAQKYREQLAVYEDRDRIARDLHDLVVQRLFATEMMLESTRRKDSSGDGATADLLTRAVDELDSTIQEVRTAIFALQQPPADAPATFRGRVLRETGGAAGVLGFQPSVHFTGAVDALVPDHLAEQLLAVLRGALATAHRRAEVSAVEVEVDATARLPDGRDAVRLVVADDGRTESGARSPTVIWQAPL
>NC_015953.1|WP_014045799.1|2113997_2115035_+|rod-shape-determining-protein
MTVSLDQLRRCHLAVDLGAARTRVYIKGLGLVVDEPSVAAVNTRTGSLIAVGTLAEQMTGRTPGYIRVARPVSGGTVVDIDMAQRMLRHLLGEKLRRQLRRKPRLRAAACTPHESDPLAQRATVETLVGLGARRVELVDTLIAAAVGCGMPVEQPTATMIMVCGAATTQIAVLSLGSIVTAVRIPIGGEAIDHAVIQYLRQHHQLMLPSQSVRPLQLALSGGGLTPGGPAVTDIHGRDVATGLARTVQVDTAAVRQAIHAPLTAVLDGLGKVLRDCPPDLVADIADSGITMVGGSALLPGLDEMLRDATGVPVHIAERPDVCAVLGLGAMLDGKIQPLVLNPLAG
>NC_015953.1|WP_014045798.1|2113294_2113867_+|hypothetical-protein
MTAPAPFGPLEFQLVLLRRMADHQPDLVEDARHELSATLAEMREANRRWQAMARAPRGRGALRRYRSVLGEPESSVRRAVGDLECDALLWRLPLWPDLRFEVMAGPGGAVWNEWLVRAPGAPAPDLRTAGDLLPWSCTVDEVARAFAPARPMEGSAPTRWALAFTDPSDHRPWIAEFTWGLLQRLLPGRV
>NC_015953.1|WP_014045797.1|2112484_2112961_-|hypothetical-protein
MLLAAAGVVLALGALSLAELATEAGHEDGAADYVTDATGPTTGAEPGPSTSPGPAGPGPVDQPTTAPATASRSGGPSATASPTPTEPEPSGSASSKAASDPADTSPSATPGPDDSGTPAEPTGPAPSDSPTRPDPPEEEPTPTPSPTETCTHWLWFCT
>NC_015953.1|WP_014045807.1|2124729_2125041_+|hypothetical-protein
MRYRLTFIAGVALGYVLGTRAGRERYEQLRKGAQRLSENPAVRNAAESAAQGGRDFAGKAYHSVSEKVGDRVPASVSGRVRSLRERSGHNGHGAGDDWGTTNT
>NC_015953.1|WP_019992665.1|2125158_2126604_+|sugar-kinase
MGIVAGLDSSSAFTHIVVCDTDTGAVLRQGYAAHPVEAKASEVDPQAWLLSLGEAASGGLLEGVEAIGVSAQQHGLVPLDHQGNLVRPALLGNDRRAQAAAADLVDGLGGRQAWAEAVGSVPQATQPVAKLRWLARTEPDHAQRVAAVMQPHDWLVWQLLGRPARRTTDRGAASGTGYWSAGSGSYRPDLVELALGHQAALPEVLGPADASGTTPEGLLISAGTGETMAAAFGLGVAVGDAVVSLGASGSVMAVHHEALADPHGMITSFADATGMHLPVVHTSNAVRALRGTAEMLGLDGLEELSELALKSTPGASGLVLLPYLEGERTPHLPHTAGTLSGLRRESMKPEHLARAAFEGMLCSLTDALDVLRGRGVEVRRVFLLGAAAELPAVQALAPAVFGTQVVVPQPEQYAALGAARQAAWALGVSRGTLDARTPPAWRGAAAQVLEPGEELPVGRAVRQQYGATRDQVHPGAFGDAV
>NC_015953.1|WP_014045809.1|2126711_2128445_+|ABC-transporter-ATP-binding-protein
MLIKLLRTYLGPYRRPILLLVALQFLQTCASLYLPSLNADIIDNGVVQGDTGYILEFGGVMIAVSVVQVLCNVGAVYFGARTASALGRDVRASVFSRVQSFSAREVGRFGAPSLITRTTNDVQQIQMLVLMSFTLMVSAPIMCVGGIVMALGQDVKLSAVLLAVVPVLGIAVSLIVKRMRPLFRTMQTRLDTVNRVLREQITGNRVIRAFVRDDYEEKRFGGANTELTAVALSTGRLMALMFPTVMTVVNVSSVAVVWFGAHRIDSGGMEIGALTAFIAYLMQIVMSVMMATFMFMMVPRAEVCAERIQEVLETESSVVPPKDPVTELRTHGHLEIRGAEFRYPGAEEPVLRSVDLVARPGETTAVIGSTGSGKSTLLGLVPRLFDATGGDVLVGGRDVRTLDPALLARSVSLVPQKPYLFSGTVATNLRYGNPDATDEELWHALEVAQAKEFVERLEHGLDAPIAQGGTNVSGGQRQRLAIARTLVQRPEIYLFDDSFSALDYATDAALRSALSRETAGATVVIVAQRVSTIRDADRILVLDEGRVVGAGSHHELMDGNETYREIVLSQLTEAEAA
>NC_015953.1|WP_014045810.1|2128444_2130364_+|ABC-transporter-ATP-binding-protein
MAGPGGRMMGPTERSADFKGSGKRLLGRFSKERSSLYLMLGAGTLSVALSVVGPKILGIATDLIFAGIVGRQMPEGTSKDQAIDGLRERGDDGLADMLSGVDFVPGDGIDFHAVGNVLLATLAVYVGAGLLMLVSSRVSIRIINRVVFQLREDLQSKLARLPLSYFDRQKRGEVLSRATNDIDNISQTLQQTMGQLVNSLLTIVGVLIMMFWISPLLALVALITIPLSALVAARVGKRSQPQFVAQWQVTGKLNAHIEEMYTGHALVKVFGRQEESARDFAEQNDALYRAGFKAQFNSGIMQPLMMFVSNLNYVLVAVVGGLRVASGALSIGDVQAFIQYSRQFSMPLTQVASMANLLQSGVASAERVFELLDAEEQGPDPVEAERPKELRGSVVLEKVSFRYDPEKPLIEDLSLRVEPGQTVAIVGPTGAGKTTLVNLLMRFYEVTGGRITLDGVDVSKMSRDGLRSGIGMVLQDTWLFGGTIAENIAYGASREVSREEVEEAAKAAHADRFVRTLPEGYDTVLDDEGSGVSAGEKQLITIARAFLSDPVILVLDEATSSVDTRTEVLIQKAMARLAHGRTSFVIAHRLSTIRDADVILVMEDGSIVEQGTHAELLAATGAYARLYAAQFAEAPAAVD
>NC_015953.1|WP_014045811.1|2130395_2131463_-|RNA-polymerase-sigma-factor
MQTRTVTTTTTPAPAVPAQNRASRHPETPGVPEPVLEEPADVPEPTGRPETGGPSSDLFRQYLREIGRIPLLGAADEVELARRVEAGLFAEERLAATPGPDTRLAQDLGRLVVQGRMAERRLIEANLRLVVSVAKRYAGRGLTMLDLVQEGNLGLIRAVEKFDYTRGYKFSTYATWWIRQAMSRALADQARTIRVPVHVVELINRVVRVQRRLLQERGHEPSAEEVAAQLDLTPERVETILRLAQEPVSLHAPVGEEDDVAFGDLIEDGDAPSPVESAAFLLLREHLEAVLSTLGERERKVVQLRYGLDDGRPRTLEEIGRLFGVTRERIRQIESKTLARLRDHAFADQLRGYLD
>NC_015953.1|WP_014045812.1|2131618_2133526_-|DNA-primase
MAGRINDDDVKAVRDAVPIDAVVSEYLQLRNAGGGNLKGLCPFHDEKSPSFQVSPSKGLFHCFGCQEGGDTIAFVMKIDHLTFSETVERLAGQAGITLRYEEGGYNPSHQRGERIRLVEAHKIAADFYREQLNGAEAEIGRRFLAERGFDQDAAAHFGVGYSPAGWDHLTRYLRGKGFSDRELISSGLSQDGRRGPIDRFRGRLMWPISDTSGDTVGFGARKLRDDDNGPKYLNTPETAIYKKSQVLYGIDLAKKDIAKASRAVVVEGYTDVMACHLAGVTTAIATCGTSFGNDHIKILRRLLMDNGSARVIFTFDGDAAGQKAALRAFEDDQKFAAETYIAIAPDNMDPCDLRLAKGDDAVRDLVEPRTPLFEFALRQIVGRYDLETPAGRAAALDEAAPVVARIKNSSSQHEVAVQLAGLLGILDTQFVVKRVGQLARWARDRGERGPAPGGPSRGGSGQHQASAPRPPSGPALNLRSPAHRTERELLKLALQKPALVAPAFDAYGEDEFTAPPYAAVRRCIAEAGGAEQGLAETRDYLAAVLDAAPDDTVRNLVTELAVEVFHGKSIDETYAGMQLVQVRLRAVDRRIHDVQGSLARLGHNVAPDHLAAAQNEVWVLQQYAESLRSHGAAAL
>NC_015953.1|WP_014045813.1|2133631_2134891_-|FAD-dependent-oxidoreductase
MVDANRTFVIVGGGLAGAKAAETLRSEGFTGRVILIGDERDHPYERPPLSKGYLAGKDERDSAFVHEPAWYARADIELHLGQVVTSVDRAGRSVQLGDNTVVHYDKLLLATGAEPRRLDIPGTDLVGVHHLRRLAHADRLRNVLSALGRDNGHLVIAGGGWIGLEVAAAARGYGAEVTVVEPSPTPLHHVIGPELGQIFTDLHTAHGVRFHFGAHLTEITGQDGLVLAARTDTGDEHPAHDVLAAIGAAPRTALAEAAGLDMAAPEHGGGVAVDASLRTSDPHIFAAGDLASVEHPLFGTRLRVEHWANALNGGPAAARAMLGQEVTYDRVPYFFSDQYDLGLEYSGWAPPGSYDQVVIRGDAGKREFIAFWLKDRRVLAGMNVNVWDVTDGIQQLVRSRREIDPHALGDPSVPLDSLV
>NC_015953.1|WP_014045814.1|2135031_2136375_-|deoxyguanosinetriphosphate-triphosphohydrolase
MDGTYDTRDIKEHDATEHGATPYRAGDTERWDTEAEKQPGRTAFQRDRARVLHSAALRRLAGKTQVVTPGTRGTAWDASPRTRLTHSLECAQVGRELGAALGCDPDLVETACLSHDMGHPPFGHNGEQALNDFASDCGGFEGNAQSLRLLTRLEPKRFVRDTRSGELVSVGLNLTRAALDAATKYPWPRGAHPRDPDSSKFGVYEDDLPVFEWVRANAPADRTCFEAQVMDWSDDVAYSVHDFEDGLHAGHIDPALLLAEAEREEIWGVAVGRYVPADTDPQELADALDRLLAQEWWPHRYDGSAVAQARLKDATSQLIGRFCKAAEDATHQAYGPGPLTRYGAELVVPVRVRDECAVLKAVADRYVMQRAEQEVLRADQRIVIAELAAALTARAPDGLEPQFRALFTAAPDDRARKRVLVDQIAALTDASARTLHRTLTGTRQTGT
>NC_015953.1|WP_014045815.1|2136853_2137591_+|YdcF-family-protein
MRLGTWGRPAALGRPGPVRLRLPRTRRGRRRLVRALMVACTAALLPATWLHTTADARVRGTADAPARQVAVVFGAGLWQGRPSPYLAHRLDAAAELYRSGKVKVLLVTGDNSRVEYDEPDAMRTYLTAHGVPDGRIVSDYAGFDTWDSCVRAKKIFGVDRAVLVSQGFHIRRAVALCRSAGIDAYGVGVDAVHDATWYYGGAREVFAAGKALLDVVFEPDPRFLGPRETGVTEALSADPAEVDAG
>NC_015953.1|WP_014045816.1|2137666_2138005_-|divalent-cation-tolerance-protein-CutA
MTEPAWLTVLTTTDSEDKAQELARGAVEARLAACAQISGPVTSVYRWQGALETAQEWQVLLKTTALRYDELEAHLLVAHDYDTPEVIATPVVRGSTRYLSWVAAETAPPAAL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_015953_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_015953_3

2643030-2643116

Orphan

Consensus_repeat	Method
GGGCGCGCCCGCCCGCGTACGGGCAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_015953_3

>merge|NC_015953|3|2643030-2643116|CRISPRCasFinder
GGGCGCGCCCGCCCGCGTACGGGCACACCTGCTTCGACTCCGCGAGGAGGGTCGCCCTGTCGGGCGTGCCCGCCCGCGTACGGGCAC

>NC_015953|3|3|2643030-2643116|CRISPRCasFinder
GGGCGCGCCCGCCCGCGTACGGGCAC	ACCTGCTTCGACTCCGCGAGGAGGGTCGCCCTGTC
GGGCGTGCCCGCCCGCGTACGGGCAC

Protein	Signature genes	Signature genes Name	Protein_function
NC_015953.1\|WP_014046235.1\|2640522_2641095_-\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380054
NC_015953.1\|WP_014046231.1\|2636469_2637405_-\|Ku-protein	unknown	unknown	gnl\|CDD\|238408
NC_015953.1\|WP_014046236.1\|2641091_2642564_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341047
NC_015953.1\|WP_014046245.1\|2652215_2652536_-\|multidrug-efflux-SMR-transporter	unknown	unknown	gnl\|CDD\|224987
NC_015953.1\|WP_014046247.1\|2653200_2653539_-\|DUF3618-domain-containing-protein	unknown	unknown	gnl\|CDD\|378834
NC_015953.1\|WP_019993615.1\|2646038_2646710_-\|DUF1707-domain-containing-protein	unknown	unknown	gnl\|CDD\|377959
NC_015953.1\|WP_014046230.1\|2635359_2636322_+\|ATP-dependent-DNA-ligase	unknown	unknown	gnl\|CDD\|236599
NC_015953.1\|WP_014046246.1\|2652739_2653078_-\|co-chaperone-GroES	unknown	unknown	gnl\|CDD\|197951
NC_015953.1\|WP_014046243.1\|2648674_2649475_-\|ABC-2-family-transporter-protein	unknown	unknown	gnl\|CDD\|226953
NC_015953.1\|WP_026359203.1\|2647785_2648640_-\|ABC-2-family-transporter-protein	unknown	unknown	gnl\|CDD\|253605
NC_015953.1\|WP_014046228.1\|2632745_2633588_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|375319
NC_015953.1\|WP_014046233.1\|2638804_2639647_+\|class-II-fructose-bisphosphate-aldolase	unknown	unknown	gnl\|CDD\|376459
NC_015953.1\|WP_014046234.1\|2639673_2640453_+\|DeoR/GlpR-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268
NC_015953.1\|WP_014046239.1\|2644762_2646013_+\|SGNH/GDSL-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|238868
NC_015953.1\|WP_014046232.1\|2637780_2638656_+\|excalibur-calcium-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|377566
NC_015953.1\|WP_014046241.1\|2646792_2647776_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|213234
NC_015953.1\|WP_014046244.1\|2649629_2652173_+\|transglycosylase-domain-containing-protein	unknown	unknown	gnl\|CDD\|223815
NC_015953.1\|WP_014046229.1\|2633626_2634388_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187620
NC_015953.1\|WP_014046238.1\|2643141_2644620_-\|DUF445-domain-containing-protein	unknown	unknown	gnl\|CDD\|377281
NC_015953.1\|WP_014046237.1\|2642715_2643018_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|366874

Protein	Function_ID	Function_description	E-value
NC_015953.1\|WP_014046235.1\|2640522_2641095_-\|TetR-family-transcriptional-regulator	gnl\|CDD\|380054	pfam17920, TetR_C_16, Tetracyclin repressor-like, C-terminal domain. TetR family regulators are involved in the transcriptional control of multidrug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity. The TetR proteins identified in overm ultiple genera of bacteria and archaea share a common helix-turn-helix (HTH) structure in their DNA-binding domain. However, TetR proteins can work in different ways: they can bind a target operator directly to exert their effect (e.g. TetR binds Tet(A) gene to repress it in the absence of tetracycline), or they can be involved in complex regulatory cascades in which the TetR protein can either be modulated by another regulator or TetR can trigger the cellular response. This entry represents the C-terminal domain found in a number of different TetR transcription regulator proteins found in Actinobacteria. TetR regulates the expression of the membrane-associated tetracycline resistance protein, TetA, which exports the tetracycline antibiotic out of the cell before it can attach to the ribosomes and inhibit protein synthesis. TetR blocks transcription from the genes encoding both TetA and TetR in the absence of antibiotic. The C-terminal domain is multi-helical and is interlocked in the homodimer with the helix-turn-helix (HTH) DNA-binding domain.	2.55917e-19
NC_015953.1\|WP_014046231.1\|2636469_2637405_-\|Ku-protein	gnl\|CDD\|238408	cd00789, KU_like, Ku-core domain, Ku-like subfamily; composed of prokaryotic homologs of the eukaryotic DNA binding protein Ku. The alignment includes the core domain shared by the prokaryotic YkoV-like proteins and the eukaryotic Ku70 and Ku80. The prokaryotic Ku homologs are predicted to form homodimers. It is proposed that the Ku homologs are functionally associated with ATP-dependent DNA ligase and the eukaryotic-type primase, probably as components of a double-strand break repair system.	8.04663e-105
NC_015953.1\|WP_014046236.1\|2641091_2642564_-\|MFS-transporter	gnl\|CDD\|341047	cd17504, MFS_MMR_MDR_like, Methylenomycin A resistance protein (also called MMR peptide)-like multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of putative multidrug resistance (MDR) transporters including Chlamydia trachomatis antiseptic resistance protein QacA_2, and Serratia sp. DD3 Bmr3. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	5.95333e-44
NC_015953.1\|WP_014046245.1\|2652215_2652536_-\|multidrug-efflux-SMR-transporter	gnl\|CDD\|224987	COG2076, EmrE, Membrane transporters of cations and cationic drugs [Inorganic ion transport and metabolism].	1.46962e-28
NC_015953.1\|WP_014046247.1\|2653200_2653539_-\|DUF3618-domain-containing-protein	gnl\|CDD\|378834	pfam12277, DUF3618, Protein of unknown function (DUF3618). This domain family is found in bacteria, and is approximately 50 amino acids in length.	1.03931e-08
NC_015953.1\|WP_019993615.1\|2646038_2646710_-\|DUF1707-domain-containing-protein	gnl\|CDD\|377959	pfam08044, DUF1707, Domain of unknown function (DUF1707). This domain is found in a variety of Actinomycetales proteins. All of the proteins containing this domain are hypothetical and probably membrane bound or associated. Currently, it is unclear to the function of this domain.	6.96148e-22
NC_015953.1\|WP_014046230.1\|2635359_2636322_+\|ATP-dependent-DNA-ligase	gnl\|CDD\|236599	PRK09632, PRK09632, ATP-dependent DNA ligase; Reviewed.	1.93978e-98
NC_015953.1\|WP_014046246.1\|2652739_2653078_-\|co-chaperone-GroES	gnl\|CDD\|197951	smart00883, Cpn10, Chaperonin 10 Kd subunit. The chaperonins are 'helper' molecules required for correct folding and subsequent assembly of some proteins. These are required for normal cell growth, and are stress-induced, acting to stabilise or protect disassembled polypeptides under heat-shock conditions. Type I chaperonins present in eubacteria, mitochondria and chloroplasts require the concerted action of 2 proteins, chaperonin 60 (cpn60) and chaperonin 10 (cpn10). The 10 kDa chaperonin (cpn10 - or groES in bacteria) exists as a ring-shaped oligomer of between six to eight identical subunits, while the 60 kDa chaperonin (cpn60 - or groEL in bacteria) forms a structure comprising 2 stacked rings, each ring containing 7 identical subunits. These ring structures assemble by self-stimulation in the presence of Mg2+-ATP. The central cavity of the cylindrical cpn60 tetradecamer provides as isolated environment for protein folding whilst cpn-10 binds to cpn-60 and synchronizes the release of the folded protein in an Mg2+-ATP dependent manner. The binding of cpn10 to cpn60 inhibits the weak ATPase activity of cpn60.	3.7715e-26
NC_015953.1\|WP_014046243.1\|2648674_2649475_-\|ABC-2-family-transporter-protein	gnl\|CDD\|226953	COG4587, COG4587, ABC-type uncharacterized transport system, permease component [General function prediction only].	4.43326e-30
NC_015953.1\|WP_026359203.1\|2647785_2648640_-\|ABC-2-family-transporter-protein	gnl\|CDD\|253605	pfam06182, ABC2_membrane_6, ABC-2 family transporter protein. This family acts as the transmembrane domain (TMD) of ABC transporters. The family includes proteins responsible for the transport of herbicides.	5.29926e-60
NC_015953.1\|WP_014046228.1\|2632745_2633588_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|375319	pfam17765, MLTR_LBD, MmyB-like transcription regulator ligand binding domain. This domain is found in a family of actinobacterial transcription factors. The structure shows it has a PAS domain like fold and it is bound to Myristic acid.	3.11679e-38
NC_015953.1\|WP_014046233.1\|2638804_2639647_+\|class-II-fructose-bisphosphate-aldolase	gnl\|CDD\|376459	pfam01116, F_bP_aldolase, Fructose-bisphosphate aldolase class-II.	6.67395e-104
NC_015953.1\|WP_014046234.1\|2639673_2640453_+\|DeoR/GlpR-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	2.55477e-59
NC_015953.1\|WP_014046239.1\|2644762_2646013_+\|SGNH/GDSL-hydrolase-family-protein	gnl\|CDD\|238868	cd01830, XynE_like, SGNH_hydrolase subfamily, similar to the putative arylesterase/acylhydrolase from the rumen anaerobe Prevotella bryantii XynE. The P. bryantii XynE gene is located in a xylanase gene cluster. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.	1.43295e-73
NC_015953.1\|WP_014046232.1\|2637780_2638656_+\|excalibur-calcium-binding-domain-containing-protein	gnl\|CDD\|377566	pfam05901, Excalibur, Excalibur calcium-binding domain. Extracellular Ca2+-dependent nuclease YokF from Bacillus subtilis and several other surface-exposed proteins from diverse bacteria are encoded in the genomes in two paralogous forms that differ by a ~45 amino acid fragment, which comprises a novel conserved domain. Sequence analysis of this domain revealed a conserved DxDxDGxxCE motif, which is strikingly similar to the Ca2+-binding loop of the calmodulin-like EF-hand domains, suggesting an evolutionary relationship between them. Functions of many of the other proteins in which the novel domain, named Excalibur (extracellular calcium-binding region), is found, as well as a structural model of its conserved motif are consistent with the notion that the Excalibur domain binds calcium. This domain is but one more example of the diversity of structural contexts surrounding the EF-hand-like calcium-binding loop in bacteria. This loop is thus more widespread than hitherto recognized and the evolution of EF-hand-like domains is probably more complex than previously appreciated.	1.40211e-16
NC_015953.1\|WP_014046241.1\|2646792_2647776_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|213234	cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA. NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake. NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the proton-motive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunorubicin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single integral membrane protein.	1.18589e-130
NC_015953.1\|WP_014046244.1\|2649629_2652173_+\|transglycosylase-domain-containing-protein	gnl\|CDD\|223815	COG0744, MrcB, Membrane carboxypeptidase (penicillin-binding protein) [Cell envelope biogenesis, outer membrane].	1.2491e-150
NC_015953.1\|WP_014046229.1\|2633626_2634388_-\|SDR-family-oxidoreductase	gnl\|CDD\|187620	cd05362, THN_reductase-like_SDR_c, tetrahydroxynaphthalene/trihydroxynaphthalene reductase-like, classical (c) SDRs. 1,3,6,8-tetrahydroxynaphthalene reductase (4HNR) of Magnaporthe grisea and the related 1,3,8-trihydroxynaphthalene reductase (3HNR) are typical members of the SDR family containing the canonical glycine rich NAD(P)-binding site and active site tetrad, and function in fungal melanin biosynthesis. This subgroup also includes an SDR from Norway spruce that may function to protect against both biotic and abitoic stress. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.65512e-67
NC_015953.1\|WP_014046238.1\|2643141_2644620_-\|DUF445-domain-containing-protein	gnl\|CDD\|377281	pfam04286, DUF445, Protein of unknown function (DUF445). Predicted to be a membrane protein.	1.4308e-134
NC_015953.1\|WP_014046237.1\|2642715_2643018_+\|hypothetical-protein	gnl\|CDD\|366874	pfam02009, RIFIN, Rifin. Plasmodium falciparum is the causative agent of deadly malaria disease. It encodes repetitive interspersed families of polypeptides (RIFINs), which are expressed on the surface of infected erythrocytes. All RIFIN sequences contain the PEXEL motif (a pentameric sequence RxLxE/Q/D, known as the Plasmodium export element) required for correct export and surface expression or host-targeting (HT) signal which plays a central role in the export of proteins into the host cell. It has been reported that PEXEL is preferably located 15-20 amino acids downstream of an N-terminal hydrophobic signal sequence. The RIFIN protein family can be divided into A and B types based on the presence or absence of a 25 amino acid motif located approximately 66 amino acids downstream of the PEXEL motif, with A- and B-types serving different roles in distinct parasite stages. The specific type B RIFIN variant (PF13_0006) is expressed on the surface of free merozoites, internally in developing gametocytes and on the surface of gametes at the point of emerging from activated, mature stage V gametocytes. While type A RIFIN are expressed on the infected erythrocyte surface, potentially contributing to the antigenic variation capacity of the parasite.	0.00423465

>NC_015953.1|WP_014046237.1|2642715_2643018_+|hypothetical-protein
MAKVPAAAVAASGLVGGYGIARWTKKRPLGGVALAAAGSVAAYEWNRQAGTRAAVGLTAAYVAAFAGSHPLAKKVGAWPAVFAVAGGVAAASWAVTRRGA
>NC_015953.1|WP_014046236.1|2641091_2642564_-|MFS-transporter
MTASAPAAAPAHPRFALGVLAFCGVVVAIMQTLVVPLLPHIPELTGATPAAASWLVTVTLLTGAVFTPVLGRVGDMYGKRRVLLVSLGLLVAGSVLCAISSHIGVLIAGRALQGAAIAVVPLGISILRDELPPERVLSAVALMSSSMGIGAAVGLPIAAVVIQNFEWHTMFWVSGAIGLLDIVLVLRCVPESPLRTRGRFDAPGALGLTAALVCLLLAVTQGGGWGWTSPLTLGLLVASVAIALVWGAYELRVRTPMVDLRVSARPAVLLTNVAALLIGFAFYANSLVTAQMVQEPRSTGYGLGASLVVSGLCLLPGGVTMVLLSPVSARISAKHGPKTSLGLAAGVIAVGYGVRFFTSHSLWLIIAGATVVAAGTAIAYSALPALVMRGVPAGETGAANGLNTLMRSVGQAFCSATVAAVLADMTFVAGGRTAPTLGAYQLVFVIAAVAAVLALVVTLCMPRGRADTGTVEAARENTGRTRAVPIQESA
>NC_015953.1|WP_014046235.1|2640522_2641095_-|TetR-family-transcriptional-regulator
MTARATAAATPAEATTGKDAILRAARRAFTQRPYAEVTIRGIAADAGVSASLVVKHFGRKEELFNTVADFGPAAEELFDAPLDRLGRHMVLTLVRRRREQQADPLLRVVFSLGNHDERSLLRDRFHEQVTGRLASLLPGPEADLRAELIAGQLIGLGATLGLHREGAGALATAEHLADLYAPAVQRLVTD
>NC_015953.1|WP_014046234.1|2639673_2640453_+|DeoR/GlpR-transcriptional-regulator
MGAHTRRTRLLEILGDEGRLDVLDAAGRLGCSTATVRRDPDELARQNLLTRTRGGAVVSRVAYDLPLRCKAGRKADEKRRIARAVADLIPSGCMVGLNGGTTTSEVARELAVRPEPAAGGHALTVVTNAVDIAAEPAIRPQVKTVVNGGVARLRSYELFGPLVDAVLRTLALDCAVLGVDAFHPRFGAATHDESEAGVGRSLAECADTVVVVADAAELGRRAFAQVCETAAVSILVTDREAPDEAVEEFTALGIDVRRV
>NC_015953.1|WP_014046233.1|2638804_2639647_+|class-II-fructose-bisphosphate-aldolase
MPLISTGALAHEARSAATGLGAFNVVQIEHAQAIVGGAEAAGLPVILQISENTARYHGSLEPIGLATLALARAADVPVAVHLDHAESAGLVRQAVDLGFTSVMFDASTLPYEENVAATRAITEYCHGHDVCVEAELGEIGGKDGAHAPGVRTDPEEARAFVDATRVDALAVAVGSSHAMLTRDAALDFALISRLRDAVAVPLVLHGSSGVGDTGLAGAVAAGMTKVNISTHLNKLFTGAVRAHLEAHPRVADPRAYLGPARDAVAAEVTRLLGILARPGR
>NC_015953.1|WP_014046232.1|2637780_2638656_+|excalibur-calcium-binding-domain-containing-protein
MRSTITNGPLRMSAGAAVLALVLAGCGGGRAGQDAKTVADTSPTASASPTGGRELALTDDTAGADAGEEVTVDALANDTVTRQDGTDAPLLSTFGPARLTLTVDGEPRYGTVTVDGTSLTYTAKAGHTGEDEFTYRVAVKDETALDAVAHVRITVTEPTPSPTPTPTPKPKPKPTPAQKTKAPAEPSVYYENCDAARAAGAAPVHRGDPGYAAHLDRDNDGVGCEPYGSSGSSGGSSGGSSSTGGSSGGGGGSTYYANCTAVRAAGAAPIHRGDPGYASHLDRDGDGVACE
>NC_015953.1|WP_014046231.1|2636469_2637405_-|Ku-protein
MPRPLWTGAISFGLVTIPIKVVSATENHSISFHQYHLEDMGRVRTRKVCELDGEVLSQDEIGKGYEVAKDRTVPVTDEELDRMPLPTAKAIEIVAFVDAGSVDPVRISDSYYLAVDGQVAAKPYTLLRKALERSDKVAVAKFAWHNRERLGLLRVRDNALVLHAMRWPDEIRSPESLAPRDVELEEGEIERAVQLTDSMALDGISGFKDRYREALEELIAAKSEGKELPEPREGEEEEPGKVMDLMAALNASVEAARESRGEEGEGGHATVHEMKSGTRGRAAKKTAKTAKSASAAKKPAKKAAARKRTAS
>NC_015953.1|WP_014046230.1|2635359_2636322_+|ATP-dependent-DNA-ligase
MSTLPRFAPMLATPGPLPSAAVDDQWAYEVKQDGQRALVYLPGDGSMELRARSGTVITAAYPDLAGLGAALGGVPAVLDGEIVALDSQGRSDFERLQSRMGLSGSPAKAARAAERVPAQLVLFDALFLRDASLVSLGYRERRAALEGLGLDGPRWSTPSVVVGHGRQALDMTREAGLEGVLAKRLNSVYEPGVRSRSWIKIRHALTADVVVGGWVPGRGRLGGLPGALLVGERHEGGLRYAGSVGTGWSDAERHRLAELLRVAAIDTCPFDVAPRVAGARWVLPRLVGEVRYSTRTRAGRLRQPSWHRLRPDLAPDDLET
>NC_015953.1|WP_014046229.1|2633626_2634388_-|SDR-family-oxidoreductase
MNQYTIALVTGGNRGLGRATALALAGQGTDVILTYRSNEEEAAAVVDAVAALGRKAVALRLDTTALDAFPDFATAVREALRDTWDRDTFDFLVNNAGSSVFTPVGGTTVEAFDLLGNVHFKGVVFLTQELLPLLADGGRIVNLSTGLARFYGEGYAIYASFKSAVETYTRYLAQELGGRGISVNAVAPGPVATDFAGGVLRDNEQVRAHLAEQTALGRVGEPEDIGGVIAALLAPGTRWITGQRIEASGGSRL
>NC_015953.1|WP_014046228.1|2632745_2633588_-|helix-turn-helix-domain-containing-protein
MDRAQLADFLRTRREALQPEDVGLPRGARRRTQGLRREEVAALGGMSPDYYARIEQQRGPMPSEPMLAALARGLHLTLDERDHLFRMAGHNTPSRRPSTDHVSPGVMRVLDRLQDTPAQIVNSLAETLVQTPLAVALLGDETDFTGLDRSLVYRWFTHPYARRIYPEADHARHSRILTSELRTAYSRQGADSRAGRIVDALLERSEEFTELWSAHEIGVRREGDRKRISHPELGVLDLQCQSLYDADQSQALLVFTATPGTDSHEKLHLLAAVGARDPRR
>NC_015953.1|WP_014046238.1|2643141_2644620_-|DUF445-domain-containing-protein
MEQDAGQGAGPGSEGRGPDGEDPGRPGPPGADAVPKGPADGGPSGAPGGGDTGSGRPGAAGSGRTRVPGGLGGFAYTAADEEKRRGVRRMKTTATGLLLLVALVYVLATWAKNTGVGGWPGYVAAAAEAGMVGALADWFAVTALFRRPLGLPIPHTAIIPTKKDQLGASLGSFVGENFLSGEVVRDRIHALGVGSRLGGWLAEPEHADRVTAELATALRGALTVLRDSDVQAVVGEAITRRADAAEVGPGMGKMLEKVVSDGGHRRVVDLVCARAHDWLVLHGDSVMDAVQGGAPGWTPRFVDKRVGERVYKELLRFVTEMRDMPGHPARGSIDTFLTDFAADLQTDTETRARVERLKSEILGRGEVQDVIASAWSSVRTMIIAAAEDERSELRLRARASLMSLGRRLATDERLQAKLEGWLEDAAVYVVTTYRTEITSLISDTVAGWDADQTSKKIEAHIGRDLQFIRINGTVVGALAGLVIYSVSRALGG
>NC_015953.1|WP_014046239.1|2644762_2646013_+|SGNH/GDSL-hydrolase-family-protein
MSRRQGHALLIALVAGTAALAAVLALGTSLVSSTRRAPLAEAQAQPAARHPAAPAHSSGSWVVTWTGAPAAPEPDTADGYPGRTFRNTVHTSIGGDAARITLSNLFGTTPLVIDQATVATRPVTFAGRGTVTVAAGGQVVSDPVTVPVAPDADLLVTLRTPYGGQPVTQHPNAHQTSYLADGRRTWATTAWRYLTAVDVRTDTASGAIVVLGDSLTAGANSSTDTNSRWPDVLSDRLRHRYGIANQGIAGNRVLRDSTSRTGAGGMSGLHRFDRDVLSVAGARTVIVALGINDVQQAPQETDPQRIVAALRTLTERAHARGLRVVGATLTPFRGYPTWTPARNDVRLAVNAQIRAGRVFDDFVDFDRAVRDPYAPDRILPAYDAGDRLHFNDTGYRVLGRLVDPATVTGASTADAL
>NC_015953.1|WP_019993615.1|2646038_2646710_-|DUF1707-domain-containing-protein
MRASDAERERVAETLREAVAEGRLEMDEFEQRLDATYKARTHGELEPLISDLPVPGGAVAPVAGRVPAAAGRAVAPMDWAGRIGGPATSTGGFAFWGGFSRKGRWTVGRIFTAFAMWGGGEIDLREARFEDREVVVRCFAIMGGIQVKVSPDVQLHVNGVGVMGGFDEQSKDADFGDPAPDAPRVRVTGFALMGGVGVDRKWSKAQRQRLKEAERPRLERWDD
>NC_015953.1|WP_014046241.1|2646792_2647776_-|ATP-binding-cassette-domain-containing-protein
MDSDFIELDGVEKVFDVRRRTGFLRRERREVRAVDGISFRVPRGEMVGYIGPNGAGKSTTIKMLTGILTPSGGRLRVAGIDPSRERTKLAHRIGVVFGQRTTLWWDLPLRDSYRLMHRMYRIPDSRFRENLDRCVELLDLAELLDVPVRQLSLGQRMRGDIAAALLHDPEVLYLDEPTIGLDVISKAKVRGFLRELNAERSTTVLLTTHDLTDIEQLCDRVMVIDHGRLVYDGALAGLHEVGESERTLVVDLEREMPPIELASDLAVRVVRVEGPRQWLAFPASASAAPLVARLAAEHPLVDLSVREPDIEAVIAKMYAADPSRQAV
>NC_015953.1|WP_026359203.1|2647785_2648640_-|ABC-2-family-transporter-protein
MADPGAWREDAFAGRSRLLEGVRAYGLIVAMWMRSTMAYRASFVMTTVGNFVATAFDFVTIMLMFTHVDALGGYTLPEIALLYGASATAFGLSDLLLGSVERLGRRVRDGTLDTLLVRPVPVLAQVAADRFALRRLGRITQGLLVLGYALVTLDIAWTPLKVVMLPLMVLSGAAVFGAVFVAGAAFQFFAQDASEVQNAFTYGGTTVLQYPPSIFAKELVRGVTFVVPLAFVSWLPALYVLGRDYPLGLPGWVAFLPPVVAALCWALASLAWRTGLRAYRSTGS
>NC_015953.1|WP_014046243.1|2648674_2649475_-|ABC-2-family-transporter-protein
MRLYAVVAAGGFRRHATYRAATAAGVFTNTVFGFIVAYTYMALWDVRPRLGGYDVSEAVTYVWLGQALLMTCAMMGGGFEDELSERIRTGDIAVDLYRPADLQLWWLAGDLGRAAFHLLGRGIVPMVLGALAFDLALPRSPWTWAAFLVSVSLGVVVSFGLRYLVALSAFWLMDGAGAMQMAMLAGLFFSGMLLPLTLFPGLLGEVARALPWSSLLQVPADVFLGKRTGWGLVQAYAFQAGWAVALLLAGRLLQSVATRRVVVQGG
>NC_015953.1|WP_014046244.1|2649629_2652173_+|transglycosylase-domain-containing-protein
MSHEPPQNSGDPGQQGNGGWSPRDPSAAEPAPKNPDATDGADAPDTPGALDAPDDAPDTPDADARATSQASEASQGPEASQASQGPEASEASQEADGAPGGKKRAARRKRTGWRRAVPTWRMALGGVLLLALLLVGGFLVGYQLVDIPAANAAATAQSNVYLYADGKKVIARDGEINREKVPLDRIPRNIRHAVLAAEDRDFYSEDAIDVKATLRAGWKTLTGGGRQGGSTITQQYVKNYYLGQEQTVVRKAKEFFISIKLDREQSKDEILEGYLNTSYFGRNAYGIQAASHAYYGKDVEDLKIGEGAYLASLLNAPSNYDVVVHPENKKAALARWNYVLDGMVKEGWLSRSDRKAMTFPVPVKAEPPTALSGQRGYIVQAVEDYLTSNKIIDADTLATGGYRIVTTLRKDKQDALVEAVQDNVLSKTSDERDADRNVRAGGASVDPADGHVVALYGGVDYTRQYVNNATRRDYQVGSTFKPFVLAAALAHGSKTQGGRAITPNTRYDGTNERTVQSSTGSTGYSPANEDDVDYGSITVREATDKSVNAVYAQMAQDVGPERVRDTAVALGIPKTTPDLTATPSIALGPATASVLDMASAYATLADHGRQRPHSLVVKISKNGTDLALPTHKARQVISREAADTTTSVLLSVVEGGTATAAQSAGRPAAGKTGTAEEDRAAWFAGYTPDLATVIAVMGQDPDTGIQKPLYGALGLPRMNGGGAPAQTWGAYTRAALEGSDAQDFELEADEGPEEPEQDEDTEESDPSKRPRDTEEAGGRDSASPGATSPRDRTGAKPSGTAAPADPPRTPRDDAPAGGATASPAAKQPPENTPAKPAAATPEGTPGP
>NC_015953.1|WP_014046245.1|2652215_2652536_-|multidrug-efflux-SMR-transporter
MAWVLLVVAGLLEVGWSIGMKYTEGFTRLWPSVFTGLGIVASMMLLSQAAKTLPIGTAYGVWVGIGAAGAAVLGMVVLNEPVTAARIFFVCLLLVAVVGLKATSGH
>NC_015953.1|WP_014046246.1|2652739_2653078_-|co-chaperone-GroES
MSENTDDKLPIRMLHDRVLVRSDSPEGERRSGGGILIPATAAVGRRLAWAEVVAVGQNVRTVEPGDRVLYDPEDRAEVEVRGTAYVLMRERDLHAVAADRFEGSVDSTGLYL
>NC_015953.1|WP_014046247.1|2653200_2653539_-|DUF3618-domain-containing-protein
MSDTRTPAQIEADIISRRAQLAVVLDEIGVRVHPKTIMGDAKAKVASTVDRTAGRAYVAVNRSVSGVKAQFVAEDGSPRLDRVIPAALLVAGAVTLLTVSSRSSGSSRRKKR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_015953_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_015953_4

5579782-5579858

Orphan

Consensus_repeat	Method
CCCGGACGTGCTGCCGGTCACCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_015953_4

>merge|NC_015953|4|5579782-5579858|CRISPRCasFinder
CCCGGACGTGCTGCCGGTCACCCAGCCCTGATCCCGCACGAGCCGGCCCTGCCTCCCGGACGTGCTGCCGGTCATCC

>NC_015953|4|4|5579782-5579858|CRISPRCasFinder
CCCGGACGTGCTGCCGGTCACCC	AGCCCTGATCCCGCACGAGCCGGCCCTGCCT
CCCGGACGTGCTGCCGGTCATCC

Protein	Signature genes	Signature genes Name	Protein_function
NC_015953.1\|WP_014048791.1\|5583365_5584505_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237030
NC_015953.1\|WP_014048782.1\|5572902_5573607_+\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NC_015953.1\|WP_014048797.1\|5589826_5590480_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NC_015953.1\|WP_014048793.1\|5585818_5587063_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340863
NC_015953.1\|WP_014048795.1\|5588395_5589196_+\|inositol-monophosphatase	unknown	unknown	gnl\|CDD\|238817
NC_015953.1\|WP_014048790.1\|5581814_5582870_-\|DUF3071-domain-containing-protein	unknown	unknown	gnl\|CDD\|378619
NC_015953.1\|WP_014048777.1\|5564859_5565987_+\|GTP-binding-protein	unknown	unknown	gnl\|CDD\|223597
NC_015953.1\|WP_014048781.1\|5571875_5572667_+\|M23-family-metallopeptidase	unknown	unknown	gnl\|CDD\|366703
NC_015953.1\|WP_014048780.1\|5570124_5571507_+\|insulinase-family-protein	unknown	unknown	gnl\|CDD\|223685
NC_015953.1\|WP_014048792.1\|5584539_5585859_-\|FAD-binding-protein	unknown	unknown	gnl\|CDD\|281959
NC_015953.1\|WP_014048796.1\|5589294_5589468_-\|hypothetical-protein	unknown	unknown	unknown
NC_015953.1\|WP_019993298.1\|5580916_5581744_+\|sulfurtransferase	unknown	unknown	gnl\|CDD\|225450
NC_015953.1\|WP_014048783.1\|5573788_5574070_-\|HPr-family-phosphocarrier-protein	unknown	unknown	gnl\|CDD\|273389
NC_015953.1\|WP_014048786.1\|5577924_5579112_+\|alkaline-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|366747
NC_015953.1\|WP_014048785.1\|5577328_5577925_+\|hypothetical-protein	unknown	unknown	unknown
NC_015953.1\|WP_014048794.1\|5587188_5588316_+\|ferrochelatase	unknown	unknown	gnl\|CDD\|234585
NC_015953.1\|WP_014048778.1\|5566016_5568473_-\|DNA-topoisomerase-IV-subunit-A	unknown	unknown	gnl\|CDD\|235503
NC_015953.1\|WP_014048784.1\|5574286_5577256_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|131764
NC_015953.1\|WP_014048779.1\|5568718_5570098_+\|insulinase-family-protein	unknown	unknown	gnl\|CDD\|223685
NC_015953.1\|WP_014048788.1\|5579875_5580652_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319911

Protein	Function_ID	Function_description	E-value
NC_015953.1\|WP_014048791.1\|5583365_5584505_+\|hypothetical-protein	gnl\|CDD\|237030	PRK12270, kgd, multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.	0.000170714
NC_015953.1\|WP_014048782.1\|5572902_5573607_+\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	3.51353e-39
NC_015953.1\|WP_014048797.1\|5589826_5590480_+\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	8.62206e-71
NC_015953.1\|WP_014048793.1\|5585818_5587063_-\|MFS-transporter	gnl\|CDD\|340863	cd06173, MFS_MefA_like, Macrolide efflux protein A and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Streptococcus pyogenes macrolide efflux protein A (MefA) and similar transporters, many of which remain uncharacterized. Some members may be multidrug resistance (MDR) transporters, which are drug/H+ antiporters (DHAs) that mediate the efflux of a variety of drugs and toxic compounds, conferring resistance to these compounds. MefA confers resistance to 14-membered macrolides including erythromycin and to 15-membered macrolides. It functions as an efflux pump to regulate intracellular macrolide levels. The MefA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.44298e-20
NC_015953.1\|WP_014048795.1\|5588395_5589196_+\|inositol-monophosphatase	gnl\|CDD\|238817	cd01639, IMPase, IMPase, inositol monophosphatase and related domains. A family of Mg++ dependent phosphatases, inhibited by lithium, many of which may act on inositol monophosphate substrate. They dephosphorylate inositol phosphate to generate inositol, which may be recycled into inositol lipids; in eukaryotes IMPase plays a vital role in intracellular signaling. IMPase is one of the proposed targets of Li+ therapy in manic-depressive illness. This family contains some bacterial members of the inositol monophosphatase family classified as SuhB-like. E. coli SuhB has been suggested to participate in posstranscriptional control of gene expression, and its inositol monophosphatase activity doesn't appear to be sufficient for its cellular function. It has been proposed, that SuhB plays a role in the biosynthesis of phosphatidylinositol in mycobacteria.	1.03768e-99
NC_015953.1\|WP_014048790.1\|5581814_5582870_-\|DUF3071-domain-containing-protein	gnl\|CDD\|378619	pfam11268, DUF3071, Protein of unknown function (DUF3071). Some members in this family of proteins are annotated as DNA-binding proteins however this cannot be confirmed. Currently no function is known.	1.04981e-60
NC_015953.1\|WP_014048777.1\|5564859_5565987_+\|GTP-binding-protein	gnl\|CDD\|223597	COG0523, COG0523, Putative GTPases (G3E family) [General function prediction only].	3.23771e-69
NC_015953.1\|WP_014048781.1\|5571875_5572667_+\|M23-family-metallopeptidase	gnl\|CDD\|366703	pfam01551, Peptidase_M23, Peptidase family M23. Members of this family are zinc metallopeptidases with a range of specificities. The peptidase family M23 is included in this family, these are Gly-Gly endopeptidases. Peptidase family M23 are also endopeptidases. This family also includes some bacterial lipoproteins for which no proteolytic activity has been demonstrated. This family also includes leukocyte cell-derived chemotaxin 2 (LECT2) proteins. LECT2 is a liver-specific protein which is thought to be linked to hepatocyte growth although the exact function of this protein is unknown.	7.06344e-40
NC_015953.1\|WP_014048780.1\|5570124_5571507_+\|insulinase-family-protein	gnl\|CDD\|223685	COG0612, PqqL, Predicted Zn-dependent peptidases [General function prediction only].	9.15703e-57
NC_015953.1\|WP_014048792.1\|5584539_5585859_-\|FAD-binding-protein	gnl\|CDD\|281959	pfam04030, ALO, D-arabinono-1,4-lactone oxidase. This domain is specific to D-arabinono-1,4-lactone oxidase EC:1.1.3.-, which is involved in the final step of the D-erythroascorbic acid biosynthesis pathway.	4.37315e-115
NC_015953.1\|WP_014048779.1\|5568718_5570098_+\|insulinase-family-protein	gnl\|CDD\|223685	COG0612, PqqL, Predicted Zn-dependent peptidases [General function prediction only].	5.25083e-80
NC_015953.1\|WP_014048783.1\|5573788_5574070_-\|HPr-family-phosphocarrier-protein	gnl\|CDD\|273389	TIGR01003, Phosphocarrier_protein_HPr, Phosphotransferase System HPr (HPr) Family. The HPr family are bacterial proteins (or domains of proteins) which function in phosphoryl transfer system (PTS) systems. They include energy-coupling components which catalyze sugar uptake via a group translocation mechanism. The functions of most of these proteins are not known, but they presumably function in PTS-related regulatory capacities. All seed members are stand-alone HPr proteins, although the model also recognizes HPr domains of PTS fusion proteins. This family includes the related NPr protein. [Signal transduction, PTS].	3.63841e-23
NC_015953.1\|WP_014048786.1\|5577924_5579112_+\|alkaline-phosphatase-family-protein	gnl\|CDD\|366747	pfam01663, Phosphodiest, Type I phosphodiesterase / nucleotide pyrophosphatase. This family consists of phosphodiesterases, including human plasma-cell membrane glycoprotein PC-1 / alkaline phosphodiesterase i / nucleotide pyrophosphatase (nppase). These enzymes catalyze the cleavage of phosphodiester and phosphosulfate bonds in NAD, deoxynucleotides and nucleotide sugars. Also in this family is ATX an autotaxin, tumor cell motility-stimulating protein which exhibits type I phosphodiesterases activity. The alignment encompasses the active site. Also present with in this family is 60-kDa Ca2+-ATPase form F. odoratum.	1.72373e-42
NC_015953.1\|WP_014048794.1\|5587188_5588316_+\|ferrochelatase	gnl\|CDD\|234585	PRK00035, hemH, ferrochelatase; Reviewed.	6.7737e-135
NC_015953.1\|WP_014048778.1\|5566016_5568473_-\|DNA-topoisomerase-IV-subunit-A	gnl\|CDD\|235503	PRK05561, PRK05561, DNA topoisomerase 4 subunit A.	0
NC_015953.1\|WP_014048784.1\|5574286_5577256_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|131764	TIGR02717, Uncharacterized_protein_MJ0590, acetyl coenzyme A synthetase (ADP forming), alpha domain. Although technically reversible, it is believed that this group of ADP-dependent acetyl-CoA synthetases (ACS) act in the direction of acetate and ATP production in the organisms in which it has been characterized. In most species this protein exists as a fused alpha-beta domain polypeptide. In Pyrococcus and related species, however the domains exist as separate polypeptides. This model represents the alpha (N-terminal) domain. In Pyrococcus and related species there appears to have been the development of a paralogous family such that four other proteins are close relatives. In reference, one of these (along with its beta-domain partner) was characterized as ACS-II showing specificity for phenylacetyl-CoA. This model has been constructed to exclude these non-ACS-I paralogs. This may result in new, authentic ACS-I sequences falling below the trusted cutoff.	3.00421e-105
NC_015953.1\|WP_019993298.1\|5580916_5581744_+\|sulfurtransferase	gnl\|CDD\|225450	COG2897, SseA, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism].	1.41596e-86
NC_015953.1\|WP_014048788.1\|5579875_5580652_-\|VOC-family-protein	gnl\|CDD\|319911	cd07247, SgaA_N_like, N-terminal domain of Streptomyces griseus SgaA and similar domains. SgaA suppresses the growth disturbances caused by high osmolarity and a high concentration of A-factor, a microbial hormone, during the early growth phase in Streptomyces griseus. A-factor (2-isocapryloyl-3R-hydroxymethyl-gamma-butyrolactone) controls morphological differentiation and secondary metabolism in Streptomyces griseus. It is a chemical signaling molecule that at a very low concentration acts as a switch for yellow pigment production, aerial mycelium formation, streptomycin production, and streptomycin resistance. The structure and amino acid sequence of SgaA are closely related to a group of antibiotics resistance proteins, including bleomycin resistance protein, mitomycin resistance protein, and fosfomycin resistance proteins. SgaA might also function as a streptomycin resistance protein.	2.24012e-29

>NC_015953.1|WP_014048786.1|5577924_5579112_+|alkaline-phosphatase-family-protein
MAQPAWQEPVPLALDSAPVPEYGGGSLADLLPTLAAGQDVPGFDAVIPELTPADRNCVFLIDGLGWEQIKAHPDEAPFLHSLLPTSRGGTGRPLTAGFPSTTATSLASVGTGRPPGEHGLNGYTARNPETGALMNQLRWKPWTEPRVWQPYPTVFQLAHEAGVRTAQVSAPTFEQTPLTKVALSGGSFLGRLSGEERMDLAAERLAAGDRSLVYTYYSEVDGKGHRFGVDSDAWRGQLMYVDGLARRLAEQLPPRSALYITADHGMIDIPFDEQSRIDFDEDWELSAGVALLGGEGRARHVYAVPGAEADVLAVWREVLGEQFWVASRDEAVSAGWFGPHIDARVHGRIGDVVAAAHDDVVITASVNEPHESAMAGMHGSLTPVELLVPLLEVRS
>NC_015953.1|WP_014048785.1|5577328_5577925_+|hypothetical-protein
MAKTGTTTQGLRAAIERSGYYPALVAEAVEAAVGGEPVASYLVHQETTFDSNEVRRHVTVLVLTDTRFIVSHTDEQAADTSSPTPYATTSTESVKLDRISSVVVSRVVANPEKYVPGTLPREVVLTIGWGAVSRIDLEPAACGDPNCEADHGYTGNTTADDLSLRVSEAGDGPDAVRQTLAFAQSLSEATAATAATGR
>NC_015953.1|WP_014048784.1|5574286_5577256_+|GNAT-family-N-acetyltransferase
MEPTPEQSPHHAYPDHWEADVVLRDGGTARIRPITTDDAERLVHFYEQVSDESKYYRFFAPYPRLSAKDVHRFTHHDYVDRVGLAVTIGGEFIATVRYDRINAQGRPASAPADEAEVAFLVQDAHQGRGVASALLEHIAAVARERGIRRFAAEVLPANNKMIKVFRDAGYTQQRSFEDGSVHLTLDLEPTAESLAVQRAREQRAEARSVQRLLAPGSVAVVGTGRAPGGVGRTVLRNLLGSGFTGRAYAVNRSFAPDLATLDGVPAHRSVGEIGERVDLAVVAVPAERVPEAVADCGEHGVRGLVVLSAGYAERGAEGRERQRELVRQARSYGMRIIGPNAFGVINTAGPVRLNASLAPESPAAGRIGLFTQSGAIGIAVLSGLHRRGAGLSTFISAGNRADLSGNDFLQYWFEDQATDVALLYLESFGNPRKFHRLARRTAAVKPVVVVKGARHSGSAPPGHAVPVSRIPDATVSALMRQAGVIRVDTVTEMVDVGLLLADQPLPDGPRVAILGNSESLGLLTFDACLAEGLRPRPPRDLTTEAEPQDFRDALAEALADTTCDAVIVTAIPWVGENGEAHTGDGEVLATALREAAATGPAKPVAVVHVEMGGLAQALAAATSTAAPPRSEDPSAPVPAGHARTRPQGAHAPSGHPTSARQGTGGVRGDGAVPPRSPGAPGSTPGGPAAPHDAPGAKAGRIPAYPAAERAVRALSEAVKYAQWRRQAAAPGKVPEFLDETIDEHAAAARIDALLGPGSDPRGRPLTQEEAADLLGLYGITVRPGLPAPDVEAAVAAAARLGYPVALKTTAPHLRHRPDLGGVRLDLAGERALRRAYGELTDLLGTPAELRPVVQAMAPRGVDTVVRASIDAAAGAVLSFGLAGAPSELLGDTAHRLVPATDRDAAELIRSIRAAPLLFGWRGSAPADTPALEELVLRVSRLVDDHPEVVSVVLEPVVVATHGLTVLGASIRLAPPPARNDLGPRRLPSY
>NC_015953.1|WP_014048783.1|5573788_5574070_-|HPr-family-phosphocarrier-protein
MAERRVNVGWAEGLHARPASIFVRAATASGVPVTIAKADGNPVNAASMLAVLGLGAQGGEEIVLASDADDSEAALDRLAKLVAEGLEELPETV
>NC_015953.1|WP_014048782.1|5572902_5573607_+|GntR-family-transcriptional-regulator
MRIPAHSVCTAIRDDIVSGVFARGSRLTEEVLARRYGVSRVPVREALRTLESEGFVVTRRHAGACVAEPTDQEAADLLEIRTLLEPLGAARAAQRRTEAHLKVLRGLVRLGQERVRRGEGEDLRSLGGWFHETLAQASGSPALIALLTQLRHKIAWMYTVEQSALPADSWAEHGALVDAVARGDAERARALAAQHAERAAAAHRPRRPERPASVPGPPRVRASQQAVNTAGVRH
>NC_015953.1|WP_014048781.1|5571875_5572667_+|M23-family-metallopeptidase
MAFTRATGKHRAPNRLTRRSAQVAGIAALATAGVIGATASPALAADSAATVETVGLTQVTAIGSSLAAQIEAQAQAQRHQADLAAKAKAEAEAKAKAKAEAKRKAEARAEETRKAEARAARAAERARLNSFRLPVAGSYVTTAYKSGGSLWSSGSHSGVDFRAASGSSVVAVGAGTVVEAGWGGAYGNNIVLRMTDGTYTQYGHLSSIGVQVGQRVSSGQQIGLSGSTGNSTGPHLHFEARTTPQYGSDMDPVAYLRSHGVRL
>NC_015953.1|WP_014048780.1|5570124_5571507_+|insulinase-family-protein
MEYHPQPTAGEARPWAFPAPERGALPNGLTVLRCHRPGQQVVAVEIFLQAPLDAEPEGLDGVATIMARALSEGTDKHSAEEFAAELERCGATLDAHADHPGVRVSLEVPVSRLAKALGLVAEALRAPAFAEDEIERLVGNRLDEIPHEQANPARRAAKQLSKELFPATARMSRPRQGTEETVRRIDAPAVRAFYDAHVRPSTATAVVVGDLTGVDLDALLADTVGDWSGNTAPARPVPPITADDTGRVVVVDRPGAVQTQLLIGRIGADRHDSVWPAQVLGTYCLGGTLTSRLDRVLREEKGYTYGVRAFGQVLRSTAPGSSSGTTGAAMLAISGSVDTESTGPALEDLWKVLRTLAAEGLTDAERETAVQNLVGVAPLKFETAASVAATLADQVEQHLPDDYQAHLYARLAETGTVEATAAVVNAFPVDRLVTVLVGDASRIAEPVRALGIGEVTVVSG
>NC_015953.1|WP_014048779.1|5568718_5570098_+|insulinase-family-protein
MPMGHTATAQAGSGGLTATEHRLANGLRVVLSEDHLTPVAAVCLWYDVGSRHEVKGRTGLAHLFEHLMFQGSGQVKGNGHFELVQGAGGSLNGTTSFERTNYFETMPTHQLELALWLEADRMGSLLAALDEESMENQRDVVKNERRQRYDNVPYGTAFEKLTALAYPEGHPYHHTPIGSMADLDAATLEDARAFFRTYYAPNNAVLSVVGDIDPEQTLAWIEKYFGSIPSHDGKQPPRDGTLPGIIGEQLREVVHEEVPARALMAAYRLPHDGTRECDAADLALTVLGGGESSRLHNRLVRRDRTAVAAGFGLLRLAGAPSLGWLDVKTSGGVEVPRIEAAVDEELARFAAEGPTPEEMERAQAQLEREWLDRLGTVAGRADELCRYAVLFGDPQLALTAVGRVLDVTADEVREAAQAHLRPDNRAVLVYEPVEPADETEDSGDAAQAAGTDAHEGADK
>NC_015953.1|WP_014048778.1|5566016_5568473_-|DNA-topoisomerase-IV-subunit-A
MARRSTKTPPPDDFEEKILDIDVVDEMQGSFLEYAYSVIYSRALPDARDGMKPVHRRIVSQMNEMGLRPDRGYVKCARVVGEVMGKLHPHGDASIYDALVRMAQPFSMRLPLVDGHGNFGSLGNDDPPAAMRYTECRMADATSLMTESIDEDTVDYQSNYDGQEREPVVLPAAYPNLLVNGASGIAVGMATNMPPHNLGEVIAAARHLIRHPNADLDALMRFVPGPDLPTGGRIVGLGGIKDAYASGRGTFKIRATVAIESVTARRKGLVVTELPFSVGPEKVIAKIKDLVGAKKLQGIADVKDLTDREHGLRLVIEVKNGFVPEAVLEQLYKLTPMEESFGINNVALVDGQPLTLGLKELLEVYLDHRFEVVRRRSEFRRTKRRDRLHLVEGLLVALLDIDEVIRLIRDSDNSAQAKERLMERFSLSEIQTQYILDTPLRRLTRFDRIELESERDRLNDEIAALTAILESDAELRKLVSSELAAVAKKFGTDRRTVLLESAGSQVASVPLEVADDPCRVLLSSTGLLARTANADPIVVAEDTKRTKHDVIVSAVPATARGDVGAVTSTGRLLRLSVIDLPQLPDTHTAPTLSGGAQISEFLTLETGEELICLSTLEEESPGLAIGTLQGVVKRVVPDYPPNKDEWEIISLKDGDRIVGATQLLTGEEDLVFITSDAQLLRYPAAQVRPQGRAAGGMTGIKLGADAAVLSFTAVDPAADAVVFTVAGSHGTLDDSERTWKLTPFDQYPRKGRATGGVRCQRFLKGEDVLVFAWAGGVPARAAQRNGTPAQLPAPDPRRDGSGTPMTSQVAVVAGPLPL
>NC_015953.1|WP_014048777.1|5564859_5565987_+|GTP-binding-protein
MTPTHAPQIPVVVLAGFLGSGKTTLLNHLLRNRAGNRIGVIVNDFGAIEIDAMTVAGQVGSTVSLGDGCLCCAVDAGELDVYLATLTKPAARLDVIVIEASGLAEPQELVRMLLASDNPRVRYGGLVEVVDAAEFLETRERHPEMDRHLTVADLVVLNKTDRVPEARLDAVREAVASTGSGAAVIGAVHGRIDPGLLFDPVLRQEEDDHARQLTFEDLLREADQEADGDHADHLHAAYESVSFTSDVPMDPRRFMAFLDSRPPGLYRIKGFADFGAGDRGNAYALHAVGGFLRFVPRPWVRDEARRTQLVLIGSGIDGDALHKELADCRTEPGRGPTGRPQSGRSGTGEAPQDAIDELERSMWGVLRYVRQPDED
>NC_015953.1|WP_014048788.1|5579875_5580652_-|VOC-family-protein
MTEAAARRAPGAPCWVSLIVHGLSATEEFYGRLFGWEFRPGPEELGPYVRALLHGKEVAGIGQLPPGRHLPIAWTTYLASEDADATAEAIRSCGGTVAVGPIDAGRAGRLAIASDPGGAVFGVWQPGEHLGTALAGTPGTPVWNELVTRETSSVAKFYQAVFGFDTEAVVSADFDYQTLSLAGRPVAALHGVGHGLPRDRGPHWMTYFEVADTDEAAARVVELGGQVIQPPREASGGRLATVADPEGAVFTIQRTSEH
>NC_015953.1|WP_019993298.1|5580916_5581744_+|sulfurtransferase
MKPIITVSEYMSEATGARPPVPLDVRWQLGGPHGRADYDAGHIPGAVFVDLDAELAGPPGRGGRHPLPDLEVFAAAMRRAGVSRDTPVVVYDGGQGWAAARAWWLLRWAGHPDVRVLDGGLAAWTGDLSTKTPEPDAGDFRPEPGGLPLLGADGAAALAESGLLLDARAAERYRGDVEPIDRVGGHIPGALSAPTAENVAEDGRFLPAGTLASRFAALGAAPGTEVGVYCGSGVSGAHEVLALEIAGHRAALYAGSWSEWSADESRPVATGPDPR
>NC_015953.1|WP_014048790.1|5581814_5582870_-|DUF3071-domain-containing-protein
MPELRVVAVSNDGTRLVLKAADSTEYTLPIDERLRAAVRNDRARLGQIEIEVESHLRPRDIQARIRAGASAEEVAQFAGIPVDRVRRFEGPVLAERAFMAERARKTPVRRPGENTGPQLGEAVQERLLLRGADRETVQWDSWRRDDGTWEVLLVYRVAGEPHSASWTYDPPRRLVQAVDDEARSLIGETDEVAAPEPSFPFVPRIARLPRDRPLDRALDRQIERPAPPAPEPEERLSGVSADERDSLTSLLEAVPSFRGDMVVPERPSQPEPPAIEPAAEEPEADEPPAAAAGAGSAYADVLMPRAVAGHRDRLTGTTDRQAEADGVRPGRRAAVPSWDEIVFGTRRKKQD
>NC_015953.1|WP_014048791.1|5583365_5584505_+|hypothetical-protein
MVQKPQNDAERKERRIDLSVPQVAGSALAAVAAAVMASQLGVYGTIAGAGVMSVVATSGGPVFQHFFRRTGEQIREVTVHVKHPGGRQVTVRTRDTVPAARRPAGDATAEEPATRPDPGHPQPVNDDPERTRLLGVPDPERTRLLGTVDAERTQMLGAVDPEETRKLGAVDPERTQMFGAVGREGTRPVMNDPERTQLFGQAETSDDAYSEARTHGTTARGWKRSALAAVAVFTVAMGGITAFEVASGNDLSGGGGTTVGSVVRGGHGPATTDPAPTTSTDPQRSGGTEDGEPGDGSASAPATDPGQDRSSEPGTGGDPSSPARPEPTPSATGGSTAPAPTGSTAPENTTPAAPEPTATGDADAPVGENGATGGPDTGR
>NC_015953.1|WP_014048792.1|5584539_5585859_-|FAD-binding-protein
MTETYATATSTWRNWAGNVTARPVRAVSPASVAELAEVLRRASEDGLRVKPAGTGHSFTAAAATDGVLIRPDLLTGIREIDRAAMTVTVEAGTPLKRLNTALAREGLSLTNMGDIMDQTVAGATSTGTHGTGRDSASIAAQIRALELVTADGTVLRCSPDEHADVFAAARIGLGALGVVTAITFAVEPVFLLTAREEPMSFDRVTADFDQLVAENEHFEFYWFPHTGNCNTKRNNRSAGPAAPPGRISGWVEDELLSNGIFQVACSVGRALPGTIPAIAGISSRALSARSYTDIPYKVFTSPRRVRFVEMEYAVPREAAVEALREVRAMVDRSPLRISFPVEVRTAPGDDIALSTASGRESAYIAVHMYRGTPYQAYFTAVERIMTGFGGRPHWGKIHTRDAAYLSEAYPRFGEFTAVRDRLDPDRLFGNDYLRRVLGD
>NC_015953.1|WP_014048793.1|5585818_5587063_-|MFS-transporter
MPSPYRAVFTAPGTRAFSAAGFLGRMPLSMMGIGVVTMVSQITGRYGLAGALSATLAMAAAVMGPQVSRLVDRYGQRRVLRPVTLVAAAAVAGLLVCAQQGLPEWTLFVFAVGAGCVPSMGSMVRARWAEIYRGTGRQLHTAYAWESIVDEVCFIVGPIVSIGLSTAWFPEAGPLLAAVFLVIGVFWLTSQRATEPRPLPEEHHTAGSALRSRGLQVLVVTFVATGAIFGAVDVVTVAFAEERGHKAAASLVLAVYALGSCLAGAVFGVLHLKGKPSSRWLLGVCAMAVSMIPLQLAGSLPFLAVALFVAGLAIAPTMVTTMALVEQHVPRTQLTEGMTWTSTGLAVGVALGSSAAGWVVDASGARAGYVVPAVAGALAAAVAFLGYRRLVEPAPTGGRGEDDRDLRNCDEHVA
>NC_015953.1|WP_014048794.1|5587188_5588316_+|ferrochelatase
MSDLRDPAPYDALLLLSFGGPEGPDDVVPFLANVTRGRGIPEERLKEVGKHYFLFGGVSPINAQNRDLLEALRKDFAGHGLDLPVYWGNRNWAPYLTDTLREMVTDGRRRIAVLATSAYASYSGCRQYRENLAESLAELEAEGLPVPRVDKLRHYFNHPGFVRPMADGVLASLADLPDEARAGAHLAFTTHSIPTSAADTSGPAETHGDGGSYVAEHLDVARVIVDAVREETGITHPWELVYQSRSGAPHIPWLEPDICDHLETLHGEGAPAVVMVPIGFVSDHMEVLYDLDTEATAKAAELGLPVRRSATVGADPRFAAAVRELVLERAAAEQERPVRRCALGELGPSHDLCPVGCCPARAPKPAAAGADSPYA
>NC_015953.1|WP_014048795.1|5588395_5589196_+|inositol-monophosphatase
MTDPFLTELLDLALEAARRAGALLRDGRPADLGVAATKSSPIDVVTEMDIGAEKLITGFLSDRRPTDGFLGEEGASSEGTSGIRWVIDPLDGTVNYLYGLPTWAVSIAAERDGERVVGVVEAPMRRETFHAVLGSGAHLNGEALHCRPTAPLDQALVSTGFNYVTEVRAHQAEVAQRLIPRLRDIRRGGSAAVDLCDVAAGRLDGYFERGLHPWDLAAGDLIAREAGALTGGRPGLRPDRDLTVAATPGVFEPLQALLEELGAWHD
>NC_015953.1|WP_014048796.1|5589294_5589468_-|hypothetical-protein
MDAFTAGLLQRIKTTESDLTRARETGDDFLADVEQSELDDLRRLAAEHGVEIGATSV
>NC_015953.1|WP_014048797.1|5589826_5590480_+|response-regulator-transcription-factor
MRVLVVEDEQLLADAVATGLRREAMAVDVVYDGAAALERVGVNDYDVVVLDRDLPLVHGDDVCRRIVELGMPTRVLMLTASADVSDRVEGLELGADDYLPKPFAFSELTARVRALGRRTTAALPPVLERAGIRLDPNRREVFRGDQEVQLAPKEFAVLEVLMRSEGAVVSAEQLLEKAWDENTDPFTNVVRVTVMTLRRKLGEPPVIVTVPGSGYRI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_015953_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_015953_5

6224028-6224468

Orphan

Consensus_repeat	Method
GNNGTCGTAGGTGTAGGTGGNNNT	CRT

6 spacers

The CRISPR arrays of NC_015953_5

>merge|NC_015953|5|6224028-6224468|CRT
CTCGTCGTAGGTGAACGTCGATGTCCCGGCGGGAGTGGTGCGGGTCTTGAGGTTGCCGTCGGCGTCGTAGGTGAAGGCGGCGGTGACCGAGCCGGCCTTCTGGGTCTTGATGCGGTCGCGGTTGTCGTAGGTGTAGGTGGTGGTAACACCGCGGCCGTCGGTCATACTTTCCTGGCGGCCGAGGTCGTCGTAGGTGTAGGTGATGGGCTTGAGCGGGCTGGGCGGGGTGACCTTGGTCAGGTTGCCCTTGTCGTCGTAGGTGTAGCTGGTCTTTTTCTCCCGCGGATCGGTGGCGGTGCAGCGTTGGCCGGGCAGGCCGCCGCAGTCCATCTCACCCGTCTTGGGGTTGTAGGTGTAGGTCCACTTCGCGGCGGTGCCGCCGGAGGTGGAGTCGGTGGAGGTGAGCAGGTTGCCCGAGGTGTCGTAGGCGTTGGTGGTCTT

>NC_015953|5|1|6224028-6224468|CRT
CTCGTCGTAGGTGAACGTCGATGT	CCCGGCGGGAGTGGTGCGGGTCTTGAGGTTGCCGTC
GGCGTCGTAGGTGAAGGCGGCGGT	GACCGAGCCGGCCTTCTGGGTCTTGATGCGGTCGCG
GTTGTCGTAGGTGTAGGTGGTGGT	AACACCGCGGCCGTCGGTCATACTTTCCTGGCGGCCGAG
GTCGTCGTAGGTGTAGGTGATGGG	CTTGAGCGGGCTGGGCGGGGTGACCTTGGTCAGGTTGCCCTT
GTCGTCGTAGGTGTAGCTGGTCTT	TTTCTCCCGCGGATCGGTGGCGGTGCAGCGTTGGCCGGGCAGGCCGCCGCAGTCCATCTCACCCGTCTT
GGGGTTGTAGGTGTAGGTCCACTT	CGCGGCGGTGCCGCCGGAGGTGGAGTCGGTGGAGGTGAGCAGGTTGCCCGA
GGTGTCGTAGGCGTTGGTGGTCTT

Protein	Signature genes	Signature genes Name	Protein_function
NC_015953.1\|WP_014049265.1\|6217060_6217693_-\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380065
NC_015953.1\|WP_014049266.1\|6217753_6218626_+\|ketopantoate-reductase-family-protein	unknown	unknown	gnl\|CDD\|224805
NC_015953.1\|WP_014049275.1\|6232708_6233158_-\|HIT-family-protein	unknown	unknown	gnl\|CDD\|223611
NC_015953.1\|WP_014049278.1\|6236642_6237263_-\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|376808
NC_015953.1\|WP_078492667.1\|6234243_6234396_-\|hypothetical-protein	unknown	unknown	unknown
NC_015953.1\|WP_014049267.1\|6219566_6220157_-\|SMI1/KNR4-family-protein	unknown	unknown	gnl\|CDD\|378155
NC_015953.1\|WP_041676625.1\|6214545_6214893_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|340879
NC_015953.1\|WP_014049271.1\|6226003_6226525_-\|hypothetical-protein	unknown	unknown	unknown
NC_015953.1\|WP_014049264.1\|6216403_6216826_+\|RidA-family-protein	unknown	unknown	gnl\|CDD\|100004
NC_015953.1\|WP_014049263.1\|6215568_6216423_+\|fumarylacetoacetate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|376566
NC_015953.1\|WP_014049277.1\|6234678_6236568_+\|S9-family-peptidase	unknown	unknown	gnl\|CDD\|224423
NC_015953.1\|WP_019993084.1\|6214907_6215108_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187602
NC_015953.1\|WP_014049262.1\|6215104_6215572_+\|nuclear-transport-factor-2-family-protein	unknown	unknown	gnl\|CDD\|379639
NC_015953.1\|WP_014049272.1\|6228175_6229936_-\|CocE/NonD-family-hydrolase	unknown	unknown	gnl\|CDD\|273375
NC_015953.1\|WP_026359084.1\|6237353_6238193_-\|NAD(P)H-binding-protein	unknown	unknown	gnl\|CDD\|187578
NC_015953.1\|WP_014049273.1\|6230344_6231064_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|188483
NC_015953.1\|WP_014049261.1\|6214150_6214549_-\|hypothetical-protein	unknown	unknown	unknown
NC_015953.1\|WP_078492665.1\|6220552_6221065_-\|hydrolase	unknown	unknown	gnl\|CDD\|379504
NC_015953.1\|WP_014049274.1\|6231313_6232063_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NC_015953.1\|WP_078492666.1\|6233390_6234158_-\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853

Protein	Function_ID	Function_description	E-value
NC_015953.1\|WP_014049265.1\|6217060_6217693_-\|TetR-family-transcriptional-regulator	gnl\|CDD\|380065	pfam17939, TetR_C_30, Tetracyclin repressor-like, C-terminal domain. TetR family regulators are involved in the transcriptional control of multidrug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity. The TetR proteins identified in overm ultiple genera of bacteria and archaea share a common helix-turn-helix (HTH) structure in their DNA-binding domain. However, TetR proteins can work in different ways: they can bind a target operator directly to exert their effect (e.g. TetR binds Tet(A) gene to repress it in the absence of tetracycline), or they can be involved in complex regulatory cascades in which the TetR protein can either be modulated by another regulator or TetR can trigger the cellular response. TetR regulates the expression of the membrane-associated tetracycline resistance protein, TetA, which exports the tetracycline antibiotic out of the cell before it can attach to the ribosomes and inhibit protein synthesis. TetR blocks transcription from the genes encoding both TetA and TetR in the absence of antibiotic. The C-terminal domain is multi-helical and is interlocked in the homodimer with the helix-turn-helix (HTH) DNA-binding domain. This entry represents the C-terminal domain present in the Pseudomonas aeruginosa PsrA which regulates the fadBA5 beta-oxidation operon. Functional analysis of PsrA indicated its importance in regulating b-oxidative enzymes. It has also been suggested that PsrA, a member of the TetR family of repressors, could affect global gene expression including activation of rpoS.	3.11051e-17
NC_015953.1\|WP_014049266.1\|6217753_6218626_+\|ketopantoate-reductase-family-protein	gnl\|CDD\|224805	COG1893, ApbA, Ketopantoate reductase [Coenzyme metabolism].	5.7415e-33
NC_015953.1\|WP_014049275.1\|6232708_6233158_-\|HIT-family-protein	gnl\|CDD\|223611	COG0537, Hit, Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases [Nucleotide transport and metabolism / Carbohydrate transport and metabolism / General function prediction only].	1.99583e-32
NC_015953.1\|WP_014049264.1\|6216403_6216826_+\|RidA-family-protein	gnl\|CDD\|100004	cd00448, YjgF_YER057c_UK114_family, YjgF, YER057c, and UK114 belong to a large family of proteins present in bacteria, archaea, and eukaryotes with no definitive function. The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.	2.68046e-14
NC_015953.1\|WP_014049267.1\|6219566_6220157_-\|SMI1/KNR4-family-protein	gnl\|CDD\|378155	pfam09346, SMI1_KNR4, SMI1 / KNR4 family (SUKH-1). Proteins in this family are involved in the regulation of 1,3-beta-glucan synthase activity and cell-wall formation. Genome contextual information showed that SMI1 are primary immunity proteins in bacterial toxin systems.	0.00111174
NC_015953.1\|WP_014049273.1\|6230344_6231064_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|188483	TIGR03968, transcriptional_regulator_TetR_family, mycofactocin system transcriptional regulator. Members of this family are TetR family putative transcriptional regulators that occur in genome contexts near proteins of the mycofactocin system. These include the precursor peptide (TIGR03969), a radical SAM peptide maturase (TIGR03962), and a putative carrier protein (TIGR03967). [Regulatory functions, DNA interactions].	4.7771e-09
NC_015953.1\|WP_041676625.1\|6214545_6214893_-\|hypothetical-protein	gnl\|CDD\|340879	cd17321, MFS_MMR_MDR_like, Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of bacterial, fungal, and archaeal multidrug resistance (MDR) transporters including several proteins from Bacilli such as methylenomycin A resistance protein (also called MMR peptide), tetracycline resistance protein (TetB), and lincomycin resistance protein LmrB, as well as fungal proteins such as vacuolar basic amino acid transporters, which are involved in the transport into vacuoles of the basic amino acids histidine, lysine, and arginine in Saccharomyces cerevisiae, and aminotriazole/azole resistance proteins. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. For example, MMR confers resistance to the epoxide antibiotic methylenomycin while TetB resistance to tetracycline by an active tetracycline efflux. MMR-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.24231e-08
NC_015953.1\|WP_014049263.1\|6215568_6216423_+\|fumarylacetoacetate-hydrolase-family-protein	gnl\|CDD\|376566	pfam01557, FAA_hydrolase, Fumarylacetoacetate (FAA) hydrolase family. This family consists of fumarylacetoacetate (FAA) hydrolase, or fumarylacetoacetate hydrolase (FAH) and it also includes HHDD isomerase/OPET decarboxylase from E. coli strain W. FAA is the last enzyme in the tyrosine catabolic pathway, it hydrolyzes fumarylacetoacetate into fumarate and acetoacetate which then join the citric acid cycle. Mutations in FAA cause type I tyrosinemia in humans this is an inherited disorder mainly affecting the liver leading to liver cirrhosis, hepatocellular carcinoma, renal tubular damages and neurologic crises amongst other symptoms. The enzymatic defect causes the toxic accumulation of phenylalanine/tyrosine catabolites. The E. coli W enzyme HHDD isomerase/OPET decarboxylase contains two copies of this domain and functions in fourth and fifth steps of the homoprotocatechuate pathway; here it decarboxylates OPET to HHDD and isomerises this to OHED. The final products of this pathway are pyruvic acid and succinic semialdehyde. This family also includes various hydratases and 4-oxalocrotonate decarboxylases which are involved in the bacterial meta-cleavage pathways for degradation of aromatic compounds. 2-hydroxypentadienoic acid hydratase encoded by mhpD in E. coli is involved in the phenylpropionic acid pathway of E. coli and catalyzes the conversion of 2-hydroxy pentadienoate to 4-hydroxy-2-keto-pentanoate and uses a Mn2+ co-factor. OHED hydratase encoded by hpcG in E. coli is involved in the homoprotocatechuic acid (HPC) catabolism. XylI in P. putida is a 4-Oxalocrotonate decarboxylase.	1.35068e-88
NC_015953.1\|WP_014049277.1\|6234678_6236568_+\|S9-family-peptidase	gnl\|CDD\|224423	COG1506, DAP2, Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism].	3.0864e-82
NC_015953.1\|WP_019993084.1\|6214907_6215108_+\|SDR-family-oxidoreductase	gnl\|CDD\|187602	cd05344, BKR_like_SDR_like, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR)-like, SDR. This subgroup resembles the SDR family, but does not have a perfect match to the NAD-binding motif or the catalytic tetrad characteristic of the SDRs. It includes the SDRs, Q9HYA2 from Pseudomonas aeruginosa PAO1 and APE0912 from Aeropyrum pernix K1. BKR catalyzes the NADPH-dependent reduction of ACP in the first reductive step of de novo fatty acid synthesis (FAS). FAS consists of four elongation steps, which are repeated to extend the fatty acid chain through the addition of two-carbo units from malonyl acyl-carrier protein (ACP): condensation, reduction, dehydration, and a final reduction. Type II FAS, typical of plants and many bacteria, maintains these activities on discrete polypeptides, while type I FAS utilizes one or two multifunctional polypeptides. BKR resembles enoyl reductase, which catalyzes the second reduction step in FAS. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs.	3.35144e-17
NC_015953.1\|WP_014049262.1\|6215104_6215572_+\|nuclear-transport-factor-2-family-protein	gnl\|CDD\|379639	pfam14534, DUF4440, Domain of unknown function (DUF4440).	7.95678e-14
NC_015953.1\|WP_014049272.1\|6228175_6229936_-\|CocE/NonD-family-hydrolase	gnl\|CDD\|273375	TIGR00976, Hypothetical_protein_Rv1835c/MT1883/Mb1866c., putative hydrolase, CocE/NonD family. This model represents a protein subfamily that includes the cocaine esterase CocE, several glutaryl-7-ACA acylases, and the putative diester hydrolase NonD of Streptomyces griseus (all hydrolases). This family shows extensive, low-level similarity to a family of xaa-pro dipeptidyl-peptidases, and local similarity by PSI-BLAST to many other hydrolases. [Unknown function, Enzymes of unknown specificity].	2.97814e-101
NC_015953.1\|WP_026359084.1\|6237353_6238193_-\|NAD(P)H-binding-protein	gnl\|CDD\|187578	cd05269, TMR_SDR_a, triphenylmethane reductase (TMR)-like proteins, NMRa-like, atypical (a) SDRs. TMR is an atypical NADP-binding protein of the SDR family. It lacks the active site residues of the SDRs but has a glycine rich NAD(P)-binding motif that matches the extended SDRs. Proteins in this subgroup however, are more similar in length to the classical SDRs. TMR was identified as a reducer of triphenylmethane dyes, important environmental pollutants. This subgroup also includes Escherichia coli NADPH-dependent quinine oxidoreductase (QOR2), which catalyzes two-electron reduction of quinone; but is unlikely to play a major role in protecting against quinone cytotoxicity. Atypical SDRs are distinct from classical SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	2.15955e-53
NC_015953.1\|WP_014049278.1\|6236642_6237263_-\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|376808	pfam02525, Flavodoxin_2, Flavodoxin-like fold. This family consists of a domain with a flavodoxin-like fold. The family includes bacterial and eukaryotic NAD(P)H dehydrogenase (quinone) EC:1.6.99.2. These enzymes catalyze the NAD(P)H-dependent two-electron reductions of quinones and protect cells against damage by free radicals and reactive oxygen species. This enzyme uses a FAD co-factor. The equation for this reaction is:- NAD(P)H + acceptor <=> NAD(P)(+) + reduced acceptor. This enzyme is also involved in the bioactivation of prodrugs used in chemotherapy. The family also includes acyl carrier protein phosphodiesterase EC:3.1.4.14. This enzyme converts holo-ACP to apo-ACP by hydrolytic cleavage of the phosphopantetheine residue from ACP. This family is related to pfam03358 and pfam00258.	2.82164e-36
NC_015953.1\|WP_078492665.1\|6220552_6221065_-\|hydrolase	gnl\|CDD\|379504	pfam14206, Cys_rich_CPCC, Cysteine-rich CPCC. This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria, archaea, eukaryotes and viruses. Proteins in this family are typically between 68 and 104 amino acids in length. There are six conserved cysteines and a conserved CPCC sequence motif.	6.62359e-38
NC_015953.1\|WP_014049274.1\|6231313_6232063_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	8.88027e-11
NC_015953.1\|WP_078492666.1\|6233390_6234158_-\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	1.05451e-10

>NC_015953.1|WP_078492665.1|6220552_6221065_-|hydrolase
MSDADGQMRAELAELEALEAAEAAGDSLVAPESTTAPPPGGWLPCPCCGHQMFGEMGSYDICSVCFWEEDLAQLRWPWSFGANAVCLVDAQRNYQRFGAMEERFLRHVRPPAQDEPLDPEWRPIDPSRDSFETPSSSGAWPEDLSALYWWRPTFWRRDEQPTAPPAPIQE
>NC_015953.1|WP_014049267.1|6219566_6220157_-|SMI1/KNR4-family-protein
MMTGMNTEACDPAELAALREIFASRSEALPPIGSDAVRSFEAEHGILLPEPYRTFVAEVCDGLRAGPPYYGLLPLTQTPDDWDSGGPERLLAEPFPLTAAWLWEAEGDEAALSEQEFEDRTAPVYDHGSLLLGTDGCGMYWHLIVTGPQRGHVWLIDENCAIPFGTRPGTCLMPGTPGFSGWVTRWAQGRSWFADA
>NC_015953.1|WP_014049266.1|6217753_6218626_+|ketopantoate-reductase-family-protein
MKLLVYGAGICGSLLAAHLHEAGLDVSLLARGRRLASLRRHGVQLAEEDSPAVRRVRVPVVEHPAGGYDLAAVTVRTHQVDAALKSLADFEGDVLFLHNWAAGAQPLEEAIGRGRVLLGFPPVGGTTDGDVVRYRASNFVTSRVPMPIGEPDGRTTPRLERIVRTFRAADVNARIEPRMDAWLKTHAAFSEPLGRAAYTAGGPAALAEDPDAVRGMLHLMRQNLAAMPTPPVPRTFGALQTLPQGLLVALLRRFLRSRTATRSGLSDTSPATAAELDLLAEQLRTTAQAR
>NC_015953.1|WP_014049265.1|6217060_6217693_-|TetR-family-transcriptional-regulator
MALPDTRTKVLDAAERLFAENGYRGTSVRAITNLAGANLAAVAYHFGSKAELMAAVARRVIEPINKAQHARLDEILSRTADPGVADLVEAFVGPLFDEMPADDAGGARTSRLIMTILSDPAEEARSWTGPDEAAVRERFLSAFARALPGVAPQELWFRLRGTLAVTAVDRVEVHNQPTPSCSAATGGEAKRWAITFLTAAMSAPATETVR
>NC_015953.1|WP_014049264.1|6216403_6216826_+|RidA-family-protein
MSSPHPDRVPGRVSVYLPSFGHANPVPAASRIGPFLASGALTGRDPATGEMPEDLRAQCANVFAHVRALMAAVDGATDDILKMTFRLARYRDRGPLNREWTTMSPDPAHRPARQVVAARLDGGALVHCDLMAILGDPRGL
>NC_015953.1|WP_014049263.1|6215568_6216423_+|fumarylacetoacetate-hydrolase-family-protein
MKIARFRVAEGPVRLGRVDGDRVTDISGVPGVGTSLRAILPVLGTLREAVLAAEGPSLPLDAVVLEAPVDDPQKYLGIGMNYREHAEEARQAGVPVPTSQMWFNKQVSCIVGPHDAIHEPTVSDELDYEVELGVVIGRRCRHVAAEDARSVIAGYLVANDVSVRDWLAKRSPTFTLGKSFDTHGPIGPWLTTDDEIADPHALRMRLSVNGEVRQDSSTNDMIYDIYEQIAYLSQVMTLMPGDILATGTPAGIGAPIGRFLRTGDVVRAEIEGLGVIENHVVAAP
>NC_015953.1|WP_014049262.1|6215104_6215572_+|nuclear-transport-factor-2-family-protein
MSTVVNADAATRAELTALDERRRAALVAVDLPALDAMFDDSLVHVHAPGLTHSKAQLLEHVATRRAYLDSTRGELSIRLVGDVAVMTGRLTNRLRSPEGGERVLGGVVTQVLRRCDDGEWRFLSFQMTPDGEHVWPAMPSELEAQDETTGKDGQR
>NC_015953.1|WP_019993084.1|6214907_6215108_+|SDR-family-oxidoreductase
MARRMMAAEGIDRDEARRRIASTVAARRLGRPEEFGDACAFLCSAQAGYISGQNLQLDGGSYRGVL
>NC_015953.1|WP_041676625.1|6214545_6214893_-|hypothetical-protein
MCRSAPGAGLVFTLSEYFGLVHHDSTFDIAIRLIPLNGFTVLLGPLVGRLMVRTTPGLVLIAGLVTGGIGALLVTTFDASTGVACSAAVIGILGIGIALATAASPWPRPPSPPSP
>NC_015953.1|WP_014049261.1|6214150_6214549_-|hypothetical-protein
MNSLPPRLAPTAGAASSALRQIGSALGPAVFGVLLTNRTLSTLPGHLAASDLGTADRGQVLGMVSDAGIQAGAFLRLSTGPTTAEAQSVYGASFTDALRTCALVGGIGMLAAAVALATIGVRKTAHNAAAGS
>NC_015953.1|WP_014049271.1|6226003_6226525_-|hypothetical-protein
MTVAATVAGATLSLLGTGVASAATGPGATPQQQAANAAVGAAGTEAGNPLSAVATAAGVCADAAQIGTTEYIYRGTETIASVKQFYSPSCDKNYGYVWAWKSFLDQNINFNLTVGVWAYERNSLVGQRTVFNTHAQEFWSNAADTADECTSADGTINIPADPHPLSTRTSKRC
>NC_015953.1|WP_014049272.1|6228175_6229936_-|CocE/NonD-family-hydrolase
MRKRSAATATALITACAVTGALTGAAVATPGRTTDGDRAGKTAVATATHSVTHEKNDRVPEGARWTQHYFPSSDDSGTELHADVLLPEGLPEGAKVPVIMSAGAYFGHSGEMEVEEEHAGPSGRFQDLLEGTDLFDKGYAFVMVDTRGFGGSTGCLDLGGAGDQADVKAAIDWSSKQPWSTGAVGMYGKSFDAYTGLLGNNAKHDALKAVVAQEPIWDLYQQLHSNGVPRPNSVQMPTSYNRIAGLAQLPDEDKRYRTNAAYETKHPECLALNSYGPSIGDPDDQYWKDRSPARHAKNTDTPLLFTQGTAETNTLPVGMEEFLDNHRGPQRAWIGPWDHVRGNERTSDGKFAMGRATWFKETLSFYDEHLKGIAPKVRFPNFVVQDNLGDWRAEKSWPTPNLSANLHLGNGSYVDSGAGSQPAPPEGEVGRAAGSFFVWSGPLETATRVTGTPRVSMTARGEGNVMVKLYDVDADGNAVAFDERVSRLDQDQLDIELKSTDWTLRAGHRLAVEIGSVRSGDWLDTPSKHKIRINDTRLQLPLGDPAEDTATGGDQAPWIDIFTQINSAQLKPGPATFTVPNASTQR
>NC_015953.1|WP_014049273.1|6230344_6231064_+|TetR-family-transcriptional-regulator
MTDDEASTRRGRGGMSEQRRHRVRLEISREAARLFWAQGVDGTSGDQIAEAVGLSTRTIWRHFRSKESCAEPIIAQSVEWELATLRSWPPHRSLEEHFATEAKRLASEIGTQGQADAGLGVKMMRLADTEPALRTAWLMACDQVEHELAAVIATRLGLEHDDLQVRLHAAAASAALRILNEYVGAGLLDGTDPRKLGDENFAFIADAVRTATGGAVGDPVDIAEVPAESGEGTADRLAF
>NC_015953.1|WP_014049274.1|6231313_6232063_+|class-I-SAM-dependent-methyltransferase
MLQSEIWDDRAAQSYDTPGTGMFAPEVLGPTVDRLAELTEGGRALEFAIGTGRVALPLAERGVPVSGIELSKPMVDQLRTQADEAAIPVVVGDMAAARVPGEFQLVYLVYNGISVLLTQAEQVACFRNAALHLAPGGRFVIELWVPELRKLPPGQQGVVFGSAPGYIGLDTYDVLRQQVVSHHFGFDAEGGREASLFRSPHRYIWPAELDLMAELAGMTLESRHADWTGAEFTAESRSHVSVYRTVGPL
>NC_015953.1|WP_014049275.1|6232708_6233158_-|HIT-family-protein
MTTVFSRIITGELPGLFVWQDPEIVAFLSIAPLRPGHTLVVPRREVDRWTDIDGALLARSFEVAQAVGQGVQRAWNAPRAGLVVAGFEVPHLHIHVAPVWDMTDFDFSKAKQEKDQSALTGAAAKLRGALLELGYEQARDSAPECERSR
>NC_015953.1|WP_078492666.1|6233390_6234158_-|IS3-family-transposase
MTVPVRDVELNEQITEVHARSRGTYGVPRGHAVLTREGAGCGRRRVVRLTRAAGLQGCRAGTVDDGKRLRSPTSGLLCAPTSLPGTSSSTAPGSTPAGAATSHTSRPARAGSVWPRSSASPPGAWPAGTTADHLRTDLVADALASAGRQRRPARPAIFHSDRGSHFADLAAATPCFQKRRATCREIPNWIWRRHCSLVPGSAKPLTPGPGSLHAVDRRVRSRPPGPVRRTGLRAAQIGRALGWMNLVEQPGSRRP
>NC_015953.1|WP_078492667.1|6234243_6234396_-|hypothetical-protein
MVGLCRRGARSVRQVAQDFELTETAVRDWVKQAGADAAGATGRPAVNSRS
>NC_015953.1|WP_014049277.1|6234678_6236568_+|S9-family-peptidase
MALPKIISVEDLFAPPRRSRASISPDGTKVAYLAPWRTHLNLWVGSVDAPEEARRVTSEDRNLLSYHWTGNPRWLLYTRDQGGDENSRLYRVDLEAPDAAATDLTPFPGARITDLRLPATRPGKAVFSSNSRNPAVFDLFELDIATGDLRMLAENTGGAATTLFYGGGGDPLISEVTEQGDLRLSRRDESTRTLCHLAQFEGADYPLGVYPLEATADGGGVLFGSYRGSDRLRLVRLDTATGEETEIDSHPHYDLDSRARVFPALPSPLIFSRRTGQLIGVRYLGERLVIHALDPHFAEVLGNLTKLSDGDLADISSDETEQRWVVSFTHDRDPGAAYFYDHSSGESHLLFRPRGHLDPEQLAPMKPVTITSRDGLALPSHLTLPLGTEPHRLPLALLVHGGPWDRDSWGFNPLVQLLANRGYAVLQVNFRSSTGYGKSFMKAGIGELAGKMHDDLIDGVDWAVGQGYADPDRVAILGGSYGGYAALVGVTFTPDVFAAAVDIFGVSDLANFLRNQPEFVRPALAANWFRWVGDPADPHQEADMLARSPISRVDQVRTPLLIAQGANDARVGQAESDNMVQALRARGTLVEYILMGDEGHSIENPENLIAVYRAVERFLGEHLGPGRDG
>NC_015953.1|WP_014049278.1|6236642_6237263_-|NAD(P)H-dependent-oxidoreductase
MSTDDIPRTLVVIAHPDPGSLTHHVSERLGAALRPGEVEVADLHQEGFDPRFTPADRRAYHEGGGPPPDVVREQQRLDRATDLVLVFPVYWWSVPALLKGWIDRVFVSGWAFESSPAAGVLPKLQRLTTHLLPIAGADAGAYERHGYETALRTQLTHGLVDYVGSRRGATAFVHDSEQLSSEATGTTVDRAVHTVAAAVRAPASRS
>NC_015953.1|WP_026359084.1|6237353_6238193_-|NAD(P)H-binding-protein
MNAQTFLVIGATGRTGRRVAARLRLRGVPVRAASRSSAVHFDWSQPAGWDPVLRGVDAAYVVPPPVPGPVHAFAARAAAAGVRRLVLLSGRGADDWGGSRFGKNMLSAEEAVRGAPLEWTVLRASNFAQNFSEDVFHAPLLAGELALPAGDVPEPFVDVEDIADAAVAALTERDRHAGQVYELSGPRPVRFAEAVELIARASDRPLTYRRITRDAYAAALVGRGVDRHEADEVAEMFALLASGSVAGTTGDLATVLGGAPRTFEEYVVRAAAAGVWDPR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_015953_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_015953_6

6255419-6255509

Orphan

Consensus_repeat	Method
CGTCCTCCCCGCCGACGCGGGGGTGTTCCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_015953_6

>merge|NC_015953|6|6255419-6255509|CRISPRCasFinder
CGTCCTCCCCGCCGACGCGGGGGTGTTCCGTTCGTGCGGGCGATCCACCGGGAGTTCGAGGCGTCCTCCCCGCCGACGCGGGGGTGTTCCG

>NC_015953|6|5|6255419-6255509|CRISPRCasFinder
CGTCCTCCCCGCCGACGCGGGGGTGTTCCG	TTCGTGCGGGCGATCCACCGGGAGTTCGAGG
CGTCCTCCCCGCCGACGCGGGGGTGTTCCG

Protein	Signature genes	Signature genes Name	Protein_function
NC_015953.1\|WP_014049286.1\|6248187_6249003_+\|SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|252734
NC_015953.1\|WP_093565535.1\|6252962_6253798_+\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|379129
NC_015953.1\|WP_014049299.1\|6262230_6262692_+\|hypothetical-protein	unknown	unknown	unknown
NC_015953.1\|WP_019993057.1\|6263551_6264463_+\|glutamate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270408
NC_015953.1\|WP_014049298.1\|6261233_6262013_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187605
NC_015953.1\|WP_014049292.1\|6255642_6255951_+\|hypothetical-protein	unknown	unknown	unknown
NC_015953.1\|WP_014049293.1\|6256004_6256910_-\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|379129
NC_015953.1\|WP_014049291.1\|6254931_6255279_-\|hypothetical-protein	unknown	unknown	unknown
NC_015953.1\|WP_014049290.1\|6254525_6254843_-\|hypothetical-protein	unknown	unknown	unknown
NC_015953.1\|WP_014049287.1\|6250045_6250486_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NC_015953.1\|WP_014049289.1\|6253818_6254418_-\|YdcF-family-protein	unknown	unknown	gnl\|CDD\|99750
NC_015953.1\|WP_019993067.1\|6249085_6249259_+\|IS3-family-transposase	unknown	unknown	unknown
NC_015953.1\|WP_014049294.1\|6257233_6258418_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271189
NC_015953.1\|WP_014049297.1\|6260433_6261213_+\|exodeoxyribonuclease-III	unknown	unknown	gnl\|CDD\|197320
NC_015953.1\|WP_014049295.1\|6258448_6259723_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|131480
NC_015953.1\|WP_014049288.1\|6250567_6251458_+\|NmrA/HSCARG-family-protein	unknown	unknown	gnl\|CDD\|187561
NC_015953.1\|WP_014049284.1\|6242354_6243269_+\|transposase-family-protein	unknown	unknown	gnl\|CDD\|372577
NC_015953.1\|WP_014049285.1\|6243547_6244225_-\|DUF3159-domain-containing-protein	unknown	unknown	gnl\|CDD\|371490
NC_015953.1\|WP_014049300.1\|6262793_6263537_+\|amino-acid-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224051
NC_015953.1\|WP_014049296.1\|6259735_6260383_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|316044

Protein	Function_ID	Function_description	E-value
NC_015953.1\|WP_014049286.1\|6248187_6249003_+\|SAM-dependent-methyltransferase	gnl\|CDD\|252734	pfam04672, Methyltransf_19, S-adenosyl methyltransferase. This family contains a SAM (S-adenosyl methyltransferase) domain, with a central beta sheet with 3 alpha-helices on both sides. Crystal packing analysis of the structure Structure 3giw suggests that a monomer is the solution state oligomeric form. An unidentified ligand (UNL, cyan) was found at the putative active site surrounded by the residues His57, His170, Phe171, Tyr216 and Met22. The UNL is likely to be a phenylalanine or phenylalanine-like molecule. (details derived from TOPSAN).	7.12725e-116
NC_015953.1\|WP_093565535.1\|6252962_6253798_+\|IS5-family-transposase	gnl\|CDD\|379129	pfam13340, DUF4096, Putative transposase of IS4/5 family (DUF4096).	7.25773e-23
NC_015953.1\|WP_014049300.1\|6262793_6263537_+\|amino-acid-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	5.97652e-153
NC_015953.1\|WP_014049298.1\|6261233_6262013_-\|SDR-family-oxidoreductase	gnl\|CDD\|187605	cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogenase (Ga5DH)-like, classical (c) SDRs. Ga5DH catalyzes the NADP-dependent conversion of carbon source D-gluconate and 5-keto-D-gluconate. This SDR subgroup has a classical Gly-rich NAD(P)-binding motif and a conserved active site tetrad pattern. However, it has been proposed that Arg104 (Streptococcus suis Ga5DH numbering), as well as an active site Ca2+, play a critical role in catalysis. In addition to Ga5DHs this subgroup contains Erwinia chrysanthemi KduD which is involved in pectin degradation, and is a putative 2,5-diketo-3-deoxygluconate dehydrogenase. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107,15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.54995e-75
NC_015953.1\|WP_014049293.1\|6256004_6256910_-\|IS5-family-transposase	gnl\|CDD\|379129	pfam13340, DUF4096, Putative transposase of IS4/5 family (DUF4096).	9.0244e-28
NC_015953.1\|WP_014049287.1\|6250045_6250486_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	5.73601e-16
NC_015953.1\|WP_014049285.1\|6243547_6244225_-\|DUF3159-domain-containing-protein	gnl\|CDD\|371490	pfam11361, DUF3159, Protein of unknown function (DUF3159). Some members in this family of proteins with unknown function are annotated as membrane proteins however this cannot be confirmed. Currently this family of proteins has no known function.	1.67177e-57
NC_015953.1\|WP_014049289.1\|6253818_6254418_-\|YdcF-family-protein	gnl\|CDD\|99750	cd06259, YdcF-like, YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been idenitified. The family also includes Escherichia coli sanA and Salmonella typhimurium sfiX, which are involved in vancomycin resistance; sfiX may also be involved in murein synthesis.	9.31268e-15
NC_015953.1\|WP_014049294.1\|6257233_6258418_+\|site-specific-integrase	gnl\|CDD\|271189	cd01189, INT_ICEBs1_C_like, C-terminal catalytic domain of integrases from bacterial phages and conjugate transposons. This family of tyrosine based site-specific integrases is has origins in bacterial phages and conjugate transposons. One member is the integrase from Bacillus subtilis conjugative transposon ICEBs1. ICEBs1 can be excised and transfered to various recipients in response to DNA damage or high concentrations of potential mating partners. The family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	4.07853e-33
NC_015953.1\|WP_014049297.1\|6260433_6261213_+\|exodeoxyribonuclease-III	gnl\|CDD\|197320	cd09086, ExoIII-like_AP-endo, Escherichia coli exonuclease III (ExoIII) and Neisseria meningitides NExo-like subfamily of the ExoIII family purinic/apyrimidinic (AP) endonucleases. This subfamily includes Escherichia coli ExoIII, Neisseria meningitides NExo,and related proteins. These are ExoIII family AP endonucleases and they belong to the large EEP (exonuclease/endonuclease/phosphatase) superfamily that contains functionally diverse enzymes that share a common catalytic mechanism of cleaving phosphodiester bonds. AP endonucleases participate in the DNA base excision repair (BER) pathway. AP sites are one of the most common lesions in cellular DNA. During BER, the damaged DNA is first recognized by DNA glycosylase. AP endonucleases then catalyze the hydrolytic cleavage of the phosphodiester bond 5' to the AP site, and this is followed by the coordinated actions of DNA polymerase, deoxyribose phosphatase, and DNA ligase. If left unrepaired, AP sites block DNA replication, and have both mutagenic and cytotoxic effects. AP endonucleases can carry out a variety of excision and incision reactions on DNA, including 3'-5' exonuclease, 3'-deoxyribose phosphodiesterase, 3'-phosphatase, and occasionally, nonspecific DNase activities. Different AP endonuclease enzymes catalyze the different reactions with different efficiencies. Many organisms have two AP endonucleases, usually one is the dominant AP endonuclease, the other has weak AP endonuclease activity. For example, Neisseria meningitides Nape and NExo, and exonuclease III (ExoIII) and endonuclease IV (EndoIV) in Escherichia coli. NExo and ExoIII are found in this subfamily. NExo is the non-dominant AP endonuclease. It exhibits strong 3'-5' exonuclease and 3'-deoxyribose phosphodiesterase activities. Escherichia coli ExoIII is an active AP endonuclease, and in addition, it exhibits double strand (ds)-specific 3'-5' exonuclease, exonucleolytic RNase H, 3'-phosphomonoesterase and 3'-phosphodiesterase activities, all catalyzed by a single active site. Class II AP endonucleases have been classified into two families, designated ExoIII and EndoIV, based on their homology to the Escherichia coli enzymes ExoIII and endonuclease IV (EndoIV). This subfamily belongs to the ExoIII family; the EndoIV family belongs to a different superfamily.	4.68258e-114
NC_015953.1\|WP_014049295.1\|6258448_6259723_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|131480	TIGR02427, b-ketoadipate_enol-lactone_hydrolase, 3-oxoadipate enol-lactonase. Members of this family are 3-oxoadipate enol-lactonase. Note that the substrate is known as 3-oxoadipate enol-lactone, 2-oxo-2,3-dihydrofuran-5-acetate, 4,5-Dihydro-5-oxofuran-2-acetate, and 5-oxo-4,5-dihydrofuran-2-acetate. The enzyme the catalyzes the fourth step in the protocatechuate degradation to beta-ketoadipate and then to succinyl-CoA and acetyl-CoA. 4-hydroxybenzoate, 3-hydroxybenzoate, and vanillate all can be converted in one step to protocatechuate. This enzyme also acts in catechol degradation. In genomes that catabolize both catechol and protocatechuate, two forms of this enzyme may be found. All members of the seed alignment for this model were chosen from within protocatechuate degradation operons of at least three genes of the pathway, from genomes with the complete pathway through beta-ketoadipate. [Energy metabolism, Other].	4.62272e-79
NC_015953.1\|WP_014049288.1\|6250567_6251458_+\|NmrA/HSCARG-family-protein	gnl\|CDD\|187561	cd05251, NmrA_like_SDR_a, NmrA (a transcriptional regulator) and HSCARG (an NADPH sensor) like proteins, atypical (a) SDRs. NmrA and HSCARG like proteins. NmrA is a negative transcriptional regulator of various fungi, involved in the post-translational modulation of the GATA-type transcription factor AreA. NmrA lacks the canonical GXXGXXG NAD-binding motif and has altered residues at the catalytic triad, including a Met instead of the critical Tyr residue. NmrA may bind nucleotides but appears to lack any dehydrogenase activity. HSCARG has been identified as a putative NADP-sensing molecule, and redistributes and restructures in response to NADPH/NADP ratios. Like NmrA, it lacks most of the active site residues of the SDR family, but has an NAD(P)-binding motif similar to the extended SDR family, GXXGXXG. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Atypical SDRs are distinct from classical SDRs. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	4.85504e-80
NC_015953.1\|WP_014049284.1\|6242354_6243269_+\|transposase-family-protein	gnl\|CDD\|372577	pfam13359, DDE_Tnp_4, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	3.60313e-17
NC_015953.1\|WP_014049296.1\|6259735_6260383_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|316044	pfam13483, Lactamase_B_3, Beta-lactamase superfamily domain. This family is part of the beta-lactamase superfamily and is related to pfam00753.	8.45583e-27
NC_015953.1\|WP_019993057.1\|6263551_6264463_+\|glutamate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270408	cd13690, PBP2_GluB, Substrate binding domain of ABC glutamate transporter; the type 2 periplasmic binding protein fold. This group includes periplasmic glutamate-binding domain GluB from Corynebacterium efficiens and its related proteins. The GluB domain belongs to the type 2 periplasmic binding protein fold superfamily (PBP2), whose many members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.49792e-92

>NC_015953.1|WP_014049291.1|6254931_6255279_-|hypothetical-protein
MSYDLAVWDGERPLNDDAAGSAFDEMYERYLESEDVAVPPFPRIKAYVNALIERYPEDDRDSPWASPPVIDEASGPIVYLLMSYSRAEEVSEYAASLAREYELICFDPQGETLRS
>NC_015953.1|WP_014049290.1|6254525_6254843_-|hypothetical-protein
MFTGGTARLLVRNDGEAALELTVEPWADAYQLLPGQTCVVVTHSPTEDGSWSGTLRRDEPFQVDHRRDSVTVWANGNCFHLSDMAGGAIDAADWQCPAQSGVPEK
>NC_015953.1|WP_014049289.1|6253818_6254418_-|YdcF-family-protein
MRRRTGLAIAGVAALAWGEWLNWHWSRALVGSSEGTSAAVVVLGYRNPQGTANLINRWRVRAGIRSIAADGAHETCVNFSGGATGSGATEAQLMAGYAKSVLAFDGTVLLEDQSATTWENITNVIPLLEDVDRIKIASQPAHALKDRAYLRRQRPDLAEKLVRADDYRTGEWMVVKPLLALYGLWTLRGLKAEERKISL
>NC_015953.1|WP_093565535.1|6252962_6253798_+|IS5-family-transposase
MIWGCGVARSKPWEVDDELWAVIEPLLPKVERRARHPGRKRHPDRLVFQGILFVLHSGIAWEHLPQELGFGSGMTCWRRLAEWTEAAVWPRLHEVLLAKLRSANALDFSRPAVDGSHIRALKGGPKTGRSPVDRGRTGSKHHLITDATGIPLAATLTGGNRNDVTQLIPLLQAVPPVRGKRGRPRRRPDVVLGDRGYDHDKYRRLVWDLGVKPLIARRGIEHGSGLGAQRWVVERAFAHLHWFRRLRIRWEIRDDIHEAFLTLGCSIICWRRLKNHQA
>NC_015953.1|WP_014049288.1|6250567_6251458_+|NmrA/HSCARG-family-protein
MSTQRTGTIAVFGATGQQGGAVVDALLDHKARVRALVRNPQSDRAQALAARGVELAAIRADDPASLAAALATVEGFYFMTPEANSLEEVEAEIRVGTALVDAASETGVPYVVFNSVFGADRESGVPHHDSKHWIEEHLRKSGLRATMVRATAFMENFASVMAPSLEHGEIVLRLPLPQDVALKMISVRDIGRVAAALLLDIAQAPGGVVELIGDELTGPQIAETFGARAGLPARYETLPLSVLPNDLDKAMFRQFAKAEENPSDLAVVRSIEPATLDLAEWIRATGWTAPANVAGA
>NC_015953.1|WP_014049287.1|6250045_6250486_+|MarR-family-transcriptional-regulator
MDYGDKLFWLSVVIQRKYAQICAEFDLTPSQATLLCAVRNEPRQMADLAASLGMTKNSLSQLVDRTARRELVGRASSAQDRRIVMLSATPTGKVLGEAVYAEVAKRLPEIARNLDADDQRDFERVATAIVDTSDLSSPTSNQPITP
>NC_015953.1|WP_019993067.1|6249085_6249259_+|IS3-family-transposase
MKQHEIDAGARPGTTTEESAQLKALKKENAEPKRANDILKAEASFFTAELDRPHTRS
>NC_015953.1|WP_014049286.1|6248187_6249003_+|SAM-dependent-methyltransferase
MFPNGSFEQGKPHPARVYDSLLGGKDNYPVDQAVAEGIAQRWPEIQRSAQQNRAWMARAVRHMVQEGGVTQFLDIGTGIPTRPNLHEIAQGMVPSARIVYVDNDPVVLRHAEALLTPISPEGRSTYLQADLRDPRAVLESPEVTETLDMTRPVGLVLAAILHFLDDDEDPAGVLRVLVDALPVGSYVALSHACGDADPVRAAEASAFYRQNKVSKPVVLRTQKQIEEFFTGLELLEPGVVTVDRWRPDASVSEGPDDMGFRGGLGLKHGIA
>NC_015953.1|WP_014049285.1|6243547_6244225_-|DUF3159-domain-containing-protein
MQSTSPQKAATVMQAADQGKKKTALEQVGGTKGVIYSALPALVFVVANNVGGLKVGILAALLVAGGIAVQRLVRKESIQPALGGVFGVTVAAGISWYTGSAKDFFLIGIWASLVGAVAFVLSVVLRWPLAGLIWNSTTGKGIVWRADRRSRIYYDIATLVLAAIFSARFAVQQYLYQADEVGSLGFAKIAMGYPLLAVGILAVAWAARASDKRLKAVGLLPAKRT
>NC_015953.1|WP_014049284.1|6242354_6243269_+|transposase-family-protein
MLSRTVLAHQVFTGVSRGHLASLVAELAGPWQAVVEGRRHEARGGARKREAGAGARHRLVFVDRLVATLIHLRHDLPHAASGLLFGVDRSTITRAISEIRGLLAERGCAVPDRPGLRLRTLADVFAYAQAEGIELRLDATEVQVRRPPAGRGGRRAFVSGKKEQNTMKATVVADHQGRTLWTDALRPGRMHDATAARNEGIGPCFRHFRDVEVLLDDGYLGLRRDHPGQAVTPPRKGNKISPPEVLEARLRARHRHSSKRITVEHALADHKRWKQLVRWTHRRETLPVTYRAIAGLVSDRNTTG
>NC_015953.1|WP_014049292.1|6255642_6255951_+|hypothetical-protein
MGKQDGPGRELNAYEKVLAEDRRVMREMFRVSVGGAHAGLVITVFIVVLFAAIGGTVWALIVGGAVAFWFTVALFAVVGGGRRGWAAVKRAYLVSFGWAGWL
>NC_015953.1|WP_014049293.1|6256004_6256910_-|IS5-family-transposase
MGRGDLTDEQWAVLEPLLPKGTKAGRPPVWPRRQLIDGIRFRVRTGVPWRDMPVEYGPWGRVYDLFRRWQRNGTWALAPDVGHTRHWILTRLQSLADAKVAITWDLSVDSTVCRAHQHAAGARKQGDLQKEPPGGVFTEPGDHGLGRSRGGFTTKLHLAVEQGQKPMSIVITAGQRGDSPQFEPVLEKIRVPRIGPGRPRVRPNRVRADKAYASRRNRAYLRRRGIRCTIPDKADQARNRRKLGARGGRPPRFDPVDYRERHAVECGINRLKRHRAVATRFDKLAVRFEATVLVAAIGEWL
>NC_015953.1|WP_014049294.1|6257233_6258418_+|site-specific-integrase
MPEPKKIVLASGKIRYRAVIGIGKHENGKRRQLTITKDTAKEVKAEISRIENEQNTGSFVPPHLITVNQWIDQWLEKKAEDLEETTVYNYRTTLDRVRGKLGNIKLQELTEEDVEAWMLWSLKFGRVRGDKAGTPLGVTSVDMSLARLKDVLNRAVTKRLVQVNVASEISIPRKARKVERKTKGKLEPWNVKEVHAFVQGIAGDRLYAPLLLSLMGLRPAEVCGLRWADIDLADDTLIVANTRTMMGNKTVIEKDTKSMAGERVLPLPAPVKEALKKFKALQAAEKLALGTGYADVGYMCVNVTGEVHTTKQLRTRAYKLMADIGLRQVRLYDARASCFTYLANNGVPDHLLARWAGHTNVKTTKRWYVKPDVEDLRGAATTWGGLHSAQEGGV
>NC_015953.1|WP_014049295.1|6258448_6259723_+|alpha/beta-fold-hydrolase
MSETDNMTVKYQVDGPEDAPVLVLGPSLGTTWHMWDRQMPELSKHWRVFRYDLPGHGGAPARPAASVTDLADRLLATLDSLGVQRFGYAGCSIGAAVGADLALRHPHRVASLALVASSPRFGTADEFRQRGVVVRTNGLEPIARTSPERWFTPGFAAAQPAIVEWAVQMVRTTDPGCYISFCEALAAFDIRAQLPRIGVPTLVLVGAEDKVTGPAEARTLVAGIPDARLALVPGASHLAPVEQPGAVTDLLLMHFSSSWQDTLASFPVPPAPAAPFTPVTPVAEIAPAALPDSVPAGRNERYDLGMKVRREVLGDAHVDAATAASDDFTDDFQDLVTRYAWGEIWSREGLDRRSRSCVALTAVVCSGHLESLGRHVRAALRNGLTPAEIKEVLLQTAVYCGVPAADSAFAVAQSVIREETTPPA
>NC_015953.1|WP_014049296.1|6259735_6260383_+|MBL-fold-metallo-hydrolase
MNASPLTLTKKTHSCVRVERDGQTLVIDPGGFSEDDAAVGADAILVTHEHPDHFDEARLRAGLEADPAAEIWTLRSVAEQLSAAFPGRVHTVGHGDTFSVAGFDVQVHGELHAVIHPDIPRITNIGFLVDGSLFHPGDALTVPDHPVDTLMLPVMAPWNKISEVIDYVREVKPRRAIDVHDALLTDLARPVYDNQIGALGGADHGRLAPGDATRL
>NC_015953.1|WP_014049297.1|6260433_6261213_+|exodeoxyribonuclease-III
MRIATWNVNSITARLPRLLAWLESSGTDVLCLQETKCTLEQFPAEALREAGYESAVNATGRWNGVGLLSRVGLTDVVTGLPDGPEYEGVQEPRAVSAACGPVRVWSVYVPNGREVAHDHYAYKLRWLEALRKAVAADAAGPVPFAVLGDFNIAPTDDDVWDPSLFEGATHVTPAERDALAALRAGGLSDVVPRPLKYDHPYTYWDYRQLGFPKNRGMRIDLVYGNAPFAAAVQDSYVDREERKGKGASDHAPVVVDLDV
>NC_015953.1|WP_014049298.1|6261233_6262013_-|SDR-family-oxidoreductase
MTSQSYLSELFSLDGRVAVVTGGSSGIGRAITEALARAGASVVVVARREAELTRTVDELTAQGCRAAWVSADLATAEGVRTAGEQAAAAFGEPDILVNSAGVNLRPPMGELDEDVWDTTMAVNLKAPHLLGRRFGPGMAERGFGRIIHITSQQAHRAFVQSGAYGVSKGGLESLARSQAEAWSPYGVTCNTLVPGFVMTPLNARISGDPEKVAALAARTMTGRNGLPEDFAGAAVFLASRASAYVTGQSVFVDGGFSVH
>NC_015953.1|WP_014049299.1|6262230_6262692_+|hypothetical-protein
MYIPFLDNWRKRQGGTRGGALAAAVETDPEGVAELFAECELLRARAKQSGLRLDDTPASLSALDQIPPRWRDDPDELPWLGNDAGLYLGTVLVRTVPGAAWDILASGQPVVRLASGREIDVVTAGLDWAMTGSPELSEMYAESAESGPGAKSR
>NC_015953.1|WP_014049300.1|6262793_6263537_+|amino-acid-ABC-transporter-ATP-binding-protein
MAVDPLIELRDVNKYFGKLHVLQDINLTVGRGEVVVVIGPSGSGKSTLCRTINRLETIESGHIFIDGEPLPEEGKGLAQLRAEVGMVFQSFNLFAHKTVLANVSLAQLKVRGRKKDQADRRSRELLERVGLAEQADKFPAQLSGGQQQRVAIARALAMDPKALLFDEPTSALDPEMINEVLEVMRQLAREGMTMVVVTHEMGFARSAANRVVFMADGRIVEDRTPEDFFTAPESDRAKDFLSKILKH
>NC_015953.1|WP_019993057.1|6263551_6264463_+|glutamate-ABC-transporter-substrate-binding-protein
MRTKNIAAVLAGLLLAALAAGCGREGSPPVKGPRTDRLPTYRADTGFQLPKSPTWRKAHRRGYLVVGAKEDQPYLGEKDPASGVYSGFDIEIARMMAASLGFEPKKIRFRTIASANRETALQNGQIDYYVGTYTINDMRKKIVGFAGPYYMAGQGLLVRTDENDIHGPQDLAGKTVCSAAGSTPYQRIAADYPKAKLVAYDTYSICVDNLLTFQVDAVTTDDAILLGFAAKAPDEMKVVGKPFSEEPYGIGVPRSDNALRLALDDALEANEKNGNWKKAFEATLGLSGVPAPKPPPIDRYPAN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_015953_6	6.1\|6255449\|31\|NC_015953\|CRISPRCasFinder	6255449-6255479	31	MK838108	Aeromonas phage LAh2, complete genome	37716-37746	6	0.806
NC_015953_6	6.1\|6255449\|31\|NC_015953\|CRISPRCasFinder	6255449-6255479	31	MK838111	Aeromonas phage LAh5, complete genome	37693-37723	6	0.806
NC_015953_6	6.1\|6255449\|31\|NC_015953\|CRISPRCasFinder	6255449-6255479	31	MK838109	Aeromonas phage LAh3, complete genome	37710-37740	6	0.806
NC_015953_6	6.1\|6255449\|31\|NC_015953\|CRISPRCasFinder	6255449-6255479	31	MK838107	Aeromonas phage LAh1, complete genome	37710-37740	6	0.806
NC_015953_6	6.1\|6255449\|31\|NC_015953\|CRISPRCasFinder	6255449-6255479	31	MK838110	Aeromonas phage LAh4, complete genome	37710-37740	6	0.806
NC_015953_4	4.1\|5579805\|31\|NC_015953\|CRISPRCasFinder	5579805-5579835	31	NC_009959	Dinoroseobacter shibae DFL 12 = DSM 16493 plasmid pDSHI05, complete sequence	56223-56253	7	0.774
NC_015953_6	6.1\|6255449\|31\|NC_015953\|CRISPRCasFinder	6255449-6255479	31	NC_047866	Aeromonas phage Ahp1, complete genome	17584-17614	7	0.774
NC_015953_6	6.1\|6255449\|31\|NC_015953\|CRISPRCasFinder	6255449-6255479	31	CP000619	Burkholderia vietnamiensis G4 plasmid pBVIE03, complete sequence	4034-4064	7	0.774
NC_015953_4	4.1\|5579805\|31\|NC_015953\|CRISPRCasFinder	5579805-5579835	31	NZ_CP053984	Achromobacter pestifer strain FDAARGOS_790 plasmid unnamed, complete sequence	61608-61638	8	0.742
NC_015953_4	4.1\|5579805\|31\|NC_015953\|CRISPRCasFinder	5579805-5579835	31	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	1782000-1782030	9	0.71
NC_015953_4	4.1\|5579805\|31\|NC_015953\|CRISPRCasFinder	5579805-5579835	31	MN586028	Gordonia phage MelBins, complete genome	55933-55963	9	0.71
NC_015953_6	6.1\|6255449\|31\|NC_015953\|CRISPRCasFinder	6255449-6255479	31	NZ_CP024582	Roseomonas sp. FDAARGOS_362 plasmid unnamed1, complete sequence	373202-373232	9	0.71
NC_015953_6	6.1\|6255449\|31\|NC_015953\|CRISPRCasFinder	6255449-6255479	31	NZ_CP025188	Roseomonas mucosa strain AD2 plasmid p1-AD2, complete sequence	54065-54095	9	0.71

1. spacer 6.1|6255449|31|NC_015953|CRISPRCasFinder matches to MK838108 (Aeromonas phage LAh2, complete genome) position: , mismatch: 6, identity: 0.806

ttcgtgcgggcgatccaccgggagttcgagg	CRISPR spacer
cgcaagcgggcgaaccaccgggagttcaagg	Protospacer
. *. ******** *************.***

2. spacer 6.1|6255449|31|NC_015953|CRISPRCasFinder matches to MK838111 (Aeromonas phage LAh5, complete genome) position: , mismatch: 6, identity: 0.806

ttcgtgcgggcgatccaccgggagttcgagg	CRISPR spacer
cgcaagcgggcgaaccaccgggagttcaagg	Protospacer
. *. ******** *************.***

3. spacer 6.1|6255449|31|NC_015953|CRISPRCasFinder matches to MK838109 (Aeromonas phage LAh3, complete genome) position: , mismatch: 6, identity: 0.806

ttcgtgcgggcgatccaccgggagttcgagg	CRISPR spacer
cgcaagcgggcgaaccaccgggagttcaagg	Protospacer
. *. ******** *************.***

4. spacer 6.1|6255449|31|NC_015953|CRISPRCasFinder matches to MK838107 (Aeromonas phage LAh1, complete genome) position: , mismatch: 6, identity: 0.806

ttcgtgcgggcgatccaccgggagttcgagg	CRISPR spacer
cgcaagcgggcgaaccaccgggagttcaagg	Protospacer
. *. ******** *************.***

5. spacer 6.1|6255449|31|NC_015953|CRISPRCasFinder matches to MK838110 (Aeromonas phage LAh4, complete genome) position: , mismatch: 6, identity: 0.806

ttcgtgcgggcgatccaccgggagttcgagg	CRISPR spacer
cgcaagcgggcgaaccaccgggagttcaagg	Protospacer
. *. ******** *************.***

6. spacer 4.1|5579805|31|NC_015953|CRISPRCasFinder matches to NC_009959 (Dinoroseobacter shibae DFL 12 = DSM 16493 plasmid pDSHI05, complete sequence) position: , mismatch: 7, identity: 0.774

agccctgatcccgcacgagccggccctgcct	CRISPR spacer
tgggctgatcacggacgagccggccctggcg	Protospacer
 *  ****** ** ************** *

7. spacer 6.1|6255449|31|NC_015953|CRISPRCasFinder matches to NC_047866 (Aeromonas phage Ahp1, complete genome) position: , mismatch: 7, identity: 0.774

ttcgtgcgggcgatccaccgggagttcgagg	CRISPR spacer
cgccgccgggcgaaccaccgggagttcaagg	Protospacer
. *   ******* *************.***

8. spacer 6.1|6255449|31|NC_015953|CRISPRCasFinder matches to CP000619 (Burkholderia vietnamiensis G4 plasmid pBVIE03, complete sequence) position: , mismatch: 7, identity: 0.774

ttcgtgcgggcgatccaccgggagttcgagg	CRISPR spacer
gtctcgcgggcgctccacggggagttcgacc	Protospacer
 ** .******* ***** **********

9. spacer 4.1|5579805|31|NC_015953|CRISPRCasFinder matches to NZ_CP053984 (Achromobacter pestifer strain FDAARGOS_790 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

agccctgatcccgcacgagccggccctgcct	CRISPR spacer
ccgcctgatcccgcccgagccggacctggtg	Protospacer
   *********** ******** **** .

10. spacer 4.1|5579805|31|NC_015953|CRISPRCasFinder matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.71

agccctgatcccgcacgagccggccctgcct	CRISPR spacer
cgtgatgatcccgcgcgatccggccctgtgg	Protospacer
 *.  *********.*** *********.

11. spacer 4.1|5579805|31|NC_015953|CRISPRCasFinder matches to MN586028 (Gordonia phage MelBins, complete genome) position: , mismatch: 9, identity: 0.71

agccctgatcccgcacgagccggccctgcct	CRISPR spacer
cgaggacatcccgcccgagccggccccgccg	Protospacer
 *     ******* ***********.***

12. spacer 6.1|6255449|31|NC_015953|CRISPRCasFinder matches to NZ_CP024582 (Roseomonas sp. FDAARGOS_362 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.71

ttcgtgcgggcgatccaccgggagttcgagg	CRISPR spacer
gagatgggggcgatccaccgggatttcggcc	Protospacer
   .** **************** ****.

13. spacer 6.1|6255449|31|NC_015953|CRISPRCasFinder matches to NZ_CP025188 (Roseomonas mucosa strain AD2 plasmid p1-AD2, complete sequence) position: , mismatch: 9, identity: 0.71

ttcgtgcgggcgatccaccgggagttcgagg	CRISPR spacer
gagatgggggcgatccaccgggatttcggcc	Protospacer
   .** **************** ****.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3191124 : 3263637

Streptomyces_phage(13.33%)

protease,integrase,holin,transposase,tRNA

attL 3232125:3232167|attR 3250037:3250079

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014046701.1\|3191124_3192306_+\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-22	34.0
WP_014046702.1\|3192306_3193428_-	esterase	NA	NA	NA	NA
WP_014046703.1\|3193601_3195404_+	DUF2156 domain-containing protein	NA	NA	NA	NA
WP_026359246.1\|3195662_3196460_+	dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	1.7e-21	32.2
WP_014046705.1\|3196456_3196942_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_014046706.1\|3197134_3197494_+	dihydroneopterin aldolase	NA	NA	NA	NA
WP_014046707.1\|3197490_3198102_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_014046708.1\|3198215_3198698_+	DUF3180 domain-containing protein	NA	NA	NA	NA
WP_014046709.1\|3198754_3199360_-	GTP cyclohydrolase I FolE	E7DN69	Pneumococcus_phage	3.0e-42	51.7
WP_014046710.1\|3199545_3201603_-\|protease	ATP-dependent zinc metalloprotease FtsH	G8DDJ2	Micromonas_pusilla_virus	3.5e-106	44.8
WP_014046711.1\|3201821_3202361_-	hypoxanthine phosphoribosyltransferase	A0A1V0SEQ1	Hokovirus	6.7e-09	30.1
WP_014046712.1\|3202458_3203538_-\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_014046713.1\|3203728_3204874_-\|protease	zinc-dependent metalloprotease	NA	NA	NA	NA
WP_026359245.1\|3204922_3206407_-	D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase	NA	NA	NA	NA
WP_014046715.1\|3206493_3206985_+	inorganic diphosphatase	A0A2H4J8U1	uncultured_Caudovirales_phage	2.9e-27	43.9
WP_019993785.1\|3207179_3208889_+	threonine/serine exporter family protein	NA	NA	NA	NA
WP_014046717.1\|3208959_3210258_-	VTT domain-containing protein	NA	NA	NA	NA
WP_014046719.1\|3210575_3211199_+	NAD(P)H:quinone oxidoreductase type IV	NA	NA	NA	NA
WP_014046720.1\|3211211_3212633_+	glutamate decarboxylase	NA	NA	NA	NA
WP_014046721.1\|3212642_3213452_-	ABC transporter permease	NA	NA	NA	NA
WP_014046722.1\|3213448_3214411_-	daunorubicin resistance protein DrrA family ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	2.3e-20	29.5
WP_014046723.1\|3214506_3215148_-	PadR family transcriptional regulator	NA	NA	NA	NA
WP_014046724.1\|3215280_3216735_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_050986366.1\|3216789_3217671_-	helix-turn-helix domain-containing protein	A0A1J0MCL6	Streptomyces_phage	6.2e-36	37.9
WP_019993782.1\|3218012_3218579_+	ATP-binding protein	NA	NA	NA	NA
WP_014046727.1\|3218603_3218846_-	DUF397 domain-containing protein	NA	NA	NA	NA
WP_014046728.1\|3219112_3221206_-	FUSC family protein	NA	NA	NA	NA
WP_014046729.1\|3221315_3222494_-	DUF2786 domain-containing protein	NA	NA	NA	NA
WP_141714519.1\|3222522_3222717_-	hypothetical protein	NA	NA	NA	NA
WP_014046730.1\|3222721_3224428_+	bifunctional 3'-5' exonuclease/DNA polymerase	NA	NA	NA	NA
WP_014046731.1\|3224503_3225379_-	dioxygenase	NA	NA	NA	NA
WP_026359243.1\|3225479_3226841_-\|protease	alpha-lytic protease prodomain-containing protein	NA	NA	NA	NA
WP_014046733.1\|3227065_3228118_+	DUF2804 domain-containing protein	NA	NA	NA	NA
WP_014046734.1\|3228155_3228842_+	phosphotransferase	NA	NA	NA	NA
WP_014046735.1\|3229460_3230756_+	family 16 glycosylhydrolase	M1HKY4	Acanthocystis_turfacea_Chlorella_virus	5.7e-30	36.2
WP_014046736.1\|3230789_3231998_+	glycosyl hydrolase	NA	NA	NA	NA
3232125:3232167	attL	NA	NA	NA	NA
WP_014046737.1\|3232507_3235969_-	DEAD/DEAH box helicase family protein	Q6NDX2	Leptospira_phage	1.8e-14	26.6
WP_014046738.1\|3236025_3237204_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_014046739.1\|3237200_3238724_-	SAM-dependent DNA methyltransferase	A0A1W6JNK1	Staphylococcus_phage	1.7e-17	27.5
WP_019993779.1\|3238842_3239298_-	NUDIX hydrolase	NA	NA	NA	NA
WP_014046741.1\|3239335_3240556_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_014046742.1\|3240746_3241640_+	aminoglycoside phosphotransferase family protein	NA	NA	NA	NA
WP_014046743.1\|3242690_3243365_+	hypothetical protein	NA	NA	NA	NA
WP_014046744.1\|3243407_3245117_-	relaxase/mobilization nuclease domain-containing protein	NA	NA	NA	NA
WP_014046745.1\|3245113_3245674_-	plasmid mobilization relaxosome protein MobC	NA	NA	NA	NA
WP_014046747.1\|3248248_3249910_+\|integrase	site-specific integrase	A0A1S5S7K9	Streptococcus_phage	3.1e-20	33.5
WP_014046749.1\|3250844_3251546_-	hypothetical protein	NA	NA	NA	NA
3250037:3250079	attR	NA	NA	NA	NA
WP_014046750.1\|3251837_3252773_+	hypothetical protein	NA	NA	NA	NA
WP_014046751.1\|3252870_3253617_-	site-specific DNA-methyltransferase	A0A2P1CGF5	Mycobacterium_phage	8.5e-63	53.2
WP_014046752.1\|3254196_3255342_+	C40 family peptidase	A0A2L1IVP0	Streptomyces_phage	1.2e-28	49.4
WP_014046753.1\|3255428_3255737_+	membrane protein	NA	NA	NA	NA
WP_014046754.1\|3255736_3256426_+	hypothetical protein	NA	NA	NA	NA
WP_014046755.1\|3256454_3257858_+	ATP-binding protein	NA	NA	NA	NA
WP_014046756.1\|3257999_3259466_+	hypothetical protein	NA	NA	NA	NA
WP_014046757.1\|3259501_3259954_+	hypothetical protein	NA	NA	NA	NA
WP_014046758.1\|3259979_3261548_+	ATP-binding protein	NA	NA	NA	NA
WP_019993773.1\|3261616_3261823_-	hypothetical protein	NA	NA	NA	NA
WP_014046760.1\|3261997_3262696_+	hypothetical protein	NA	NA	NA	NA
WP_093565262.1\|3262727_3263637_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	1.7e-12	37.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_015953

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection