CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_017267	Xanthomonas oryzae pv. oryzicola BLS256, complete sequence	1 crisprs	WYL,DEDDh,csa3,cas3,DinG	0	0	18	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_017267_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_017267_1

501473-501627

Orphan

Consensus_repeat	Method
CCCATGCACTTGGTAACGTGGTTGCCTGACATGACCAAGCAGTGAAATCGCAGAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_017267_1

>merge|NC_017267|1|501473-501627|CRISPRCasFinder
CCCATGCACTTGGTAACGTGGTTGCCTGACATGACCAAGCAGTGAAATCGCAGATGGATCACGTAACGATGCAGATCAGGTTGCAGCGCGTAGTCAAGCGCCCATGCACTTGGTAACGTGGTTGCCTGACATGACCAAGCAGTGAAATCGCAGAT

>NC_017267|1|1|501473-501627|CRISPRCasFinder
CCCATGCACTTGGTAACGTGGTTGCCTGACATGACCAAGCAGTGAAATCGCAGAT	GGATCACGTAACGATGCAGATCAGGTTGCAGCGCGTAGTCAAGCG
CCCATGCACTTGGTAACGTGGTTGCCTGACATGACCAAGCAGTGAAATCGCAGAT

Protein	Signature genes	Signature genes Name	Protein_function
NC_017267.2\|WP_014501670.1\|488011_488254_+\|hypothetical-protein	unknown	unknown	unknown
NC_017267.2\|WP_011260422.1\|504284_504638_-\|Na+/H+-antiporter-subunit-G	unknown	unknown	gnl\|CDD\|237169
NC_017267.2\|WP_014501681.1\|498857_499973_+\|4-hydroxyphenylpyruvate-dioxygenase	unknown	unknown	gnl\|CDD\|225726
NC_017267.2\|WP_014501691.1\|511292_512888_-\|M4-family-metallopeptidase	unknown	unknown	gnl\|CDD\|341060
NC_017267.2\|WP_014501677.1\|495780_497289_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|225646
NC_017267.2\|WP_014501678.1\|497300_497891_+\|thioredoxin-family-protein	unknown	unknown	gnl\|CDD\|379399
NC_017267.2\|WP_014501672.1\|489815_490199_-\|variant-SH3-domain-protein	unknown	unknown	gnl\|CDD\|369452
NC_017267.2\|WP_014501684.1\|504634_504919_-\|K+/H+-antiporter-subunit-F	unknown	unknown	gnl\|CDD\|180435
NC_017267.2\|WP_014501685.1\|504915_505422_-\|Na+/H+-antiporter-subunit-E	unknown	unknown	gnl\|CDD\|181598
NC_017267.2\|WP_014501676.1\|494444_495338_+\|tryptophan-2,3-dioxygenase	unknown	unknown	gnl\|CDD\|188272
NC_017267.2\|WP_019301451.1\|498246_498735_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224759
NC_017267.2\|WP_014501682.1\|501747_503073_+\|homogentisate-1,2-dioxygenase	unknown	unknown	gnl\|CDD\|235421
NC_017267.2\|WP_014501687.1\|506959_507334_-\|Na+/H+-antiporter-subunit-C	unknown	unknown	gnl\|CDD\|236377
NC_017267.2\|WP_014501690.1\|510707_511193_-\|DUF962-domain-containing-protein	unknown	unknown	gnl\|CDD\|226914
NC_017267.2\|WP_082350429.1\|503498_503888_-\|hypothetical-protein	unknown	unknown	unknown
NC_017267.2\|WP_014501688.1\|507333_510162_-\|monovalent-cation/H+-antiporter-subunit-A	unknown	unknown	gnl\|CDD\|237157
NC_017267.2\|WP_024712412.1\|491263_492352_-\|pyruvate-dehydrogenase-(acetyl-transferring)-E1-component-subunit-alpha	unknown	unknown	gnl\|CDD\|213783
NC_017267.2\|WP_014501673.1\|490200_491271_-\|alpha-ketoacid-dehydrogenase-subunit-beta	unknown	unknown	gnl\|CDD\|223101
NC_017267.2\|WP_014501686.1\|505418_506963_-\|monovalent-cation/H+-antiporter-subunit-D	unknown	unknown	gnl\|CDD\|237166
NC_017267.2\|WP_014501671.1\|488307_489819_-\|2-oxo-acid-dehydrogenase-subunit-E2	unknown	unknown	gnl\|CDD\|223582

Protein	Function_ID	Function_description	E-value
NC_017267.2\|WP_011260422.1\|504284_504638_-\|Na+/H+-antiporter-subunit-G	gnl\|CDD\|237169	PRK12674, PRK12674, putative monovalent cation/H+ antiporter subunit G; Reviewed.	5.65573e-32
NC_017267.2\|WP_014501681.1\|498857_499973_+\|4-hydroxyphenylpyruvate-dioxygenase	gnl\|CDD\|225726	COG3185, COG3185, 4-hydroxyphenylpyruvate dioxygenase and related hemolysins [Amino acid transport and metabolism / General function prediction only].	1.14394e-147
NC_017267.2\|WP_014501691.1\|511292_512888_-\|M4-family-metallopeptidase	gnl\|CDD\|341060	cd09597, M4_TLP, Peptidase M4 family including thermolysin, protealysin, aureolysin, and neutral protease. This peptidase M4 family includes several endopeptidases such as thermolysin (EC 3.4.24.27), aureolysin (the extracellular metalloproteinase from Staphylococcus aureus), neutral protease from Bacillus cereus, protealysin, and bacillolysin (EC 3.4.24.28). Typically, the M4 peptidases consist of a presequence (signal sequence), a propeptide sequence, and a peptidase unit. The presequence is cleaved off during export while the propeptide has inhibitory and chaperone functions and facilitates folding. The propeptide remains attached until the peptidase is secreted and can be safely activated. All peptidases in this family bind a single catalytic zinc ion which is tetrahedrally co-ordinated by three amino acid ligands and a water molecule that forms the nucleophile on activation during catalysis. The active site is found between two sub-domains; the N-terminal domain contains the HEXXH zinc-binding motif while the helical C-terminal domain, which is unique for the family, carries the third zinc ligand. These peptidases are secreted eubacterial endopeptidases from Gram-positive or Gram-negative sources that degrade extracellular proteins and peptides for bacterial nutrition. They are selectively inhibited by Steptomyces metalloproteinase inhibitor (SMPI) as well as by phosphoramidon from Streptomyces tanashiensis. A large number of these enzymes are implicated as key factors in the pathogenesis of various diseases, including gastritis, peptic ulcer, gastric carcinoma, cholera and several types of bacterial infections, and are therefore important drug targets. Some enzymes of the family can function at extremes of temperatures, while some function in organic solvents, thus rendering them novel targets for biotechnological applications. Thermolysin is widely used as a nonspecific protease to obtain fragments for peptide sequencing. It has also been used in production of the artificial sweetener aspartame.	9.7734e-109
NC_017267.2\|WP_014501677.1\|495780_497289_+\|MFS-transporter	gnl\|CDD\|225646	COG3104, PTR2, Dipeptide/tripeptide permease [Amino acid transport and metabolism].	2.93943e-137
NC_017267.2\|WP_014501678.1\|497300_497891_+\|thioredoxin-family-protein	gnl\|CDD\|379399	pfam13899, Thioredoxin_7, Thioredoxin-like. Thioredoxins are small enzymes that participate in redox reactions, via the reversible oxidation of an active centre disulfide bond.	0.000180899
NC_017267.2\|WP_014501672.1\|489815_490199_-\|variant-SH3-domain-protein	gnl\|CDD\|369452	pfam07653, SH3_2, Variant SH3 domain. SH3 (Src homology 3) domains are often indicative of a protein involved in signal transduction related to cytoskeletal organisation. First described in the Src cytoplasmic tyrosine kinase. The structure is a partly opened beta barrel.	1.06234e-06
NC_017267.2\|WP_014501684.1\|504634_504919_-\|K+/H+-antiporter-subunit-F	gnl\|CDD\|180435	PRK06161, PRK06161, putative monovalent cation/H+ antiporter subunit F; Reviewed.	2.98417e-34
NC_017267.2\|WP_014501685.1\|504915_505422_-\|Na+/H+-antiporter-subunit-E	gnl\|CDD\|181598	PRK08965, PRK08965, putative monovalent cation/H+ antiporter subunit E; Reviewed.	4.24879e-62
NC_017267.2\|WP_014501676.1\|494444_495338_+\|tryptophan-2,3-dioxygenase	gnl\|CDD\|188272	TIGR03036, trp_2_3_diox, tryptophan 2,3-dioxygenase. Members of this family are tryptophan 2,3-dioxygenase, as confirmed by several experimental characterizations, and by conserved operon structure for many of the other members. This enzyme represents the first of a two-step degradation to L-kynurenine, and a three-step pathway (via kynurenine) to anthranilate plus alanine. [Energy metabolism, Amino acids and amines].	3.81491e-127
NC_017267.2\|WP_019301451.1\|498246_498735_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|224759	COG1846, MarR, Transcriptional regulators [Transcription].	2.354e-19
NC_017267.2\|WP_014501682.1\|501747_503073_+\|homogentisate-1,2-dioxygenase	gnl\|CDD\|235421	PRK05341, PRK05341, homogentisate 1,2-dioxygenase; Provisional.	0
NC_017267.2\|WP_014501687.1\|506959_507334_-\|Na+/H+-antiporter-subunit-C	gnl\|CDD\|236377	PRK09094, PRK09094, putative monovalent cation/H+ antiporter subunit C; Reviewed.	7.0702e-60
NC_017267.2\|WP_014501690.1\|510707_511193_-\|DUF962-domain-containing-protein	gnl\|CDD\|226914	COG4539, COG4539, Predicted membrane protein [Function unknown].	8.41808e-17
NC_017267.2\|WP_014501688.1\|507333_510162_-\|monovalent-cation/H+-antiporter-subunit-A	gnl\|CDD\|237157	PRK12648, PRK12648, putative monovalent cation/H+ antiporter subunit A; Reviewed.	0
NC_017267.2\|WP_024712412.1\|491263_492352_-\|pyruvate-dehydrogenase-(acetyl-transferring)-E1-component-subunit-alpha	gnl\|CDD\|213783	TIGR03181, PDH_E1_alph_x, pyruvate dehydrogenase E1 component, alpha subunit. Members of this protein family are the alpha subunit of the E1 component of pyruvate dehydrogenase (PDH). This model represents one branch of a larger family that E1-alpha proteins from 2-oxoisovalerate dehydrogenase, acetoin dehydrogenase, another PDH clade, etc. [Energy metabolism, Pyruvate dehydrogenase].	9.02731e-177
NC_017267.2\|WP_014501673.1\|490200_491271_-\|alpha-ketoacid-dehydrogenase-subunit-beta	gnl\|CDD\|223101	COG0022, AcoB, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion].	1.0106e-162
NC_017267.2\|WP_014501686.1\|505418_506963_-\|monovalent-cation/H+-antiporter-subunit-D	gnl\|CDD\|237166	PRK12666, PRK12666, putative monovalent cation/H+ antiporter subunit D; Reviewed.	0
NC_017267.2\|WP_014501671.1\|488307_489819_-\|2-oxo-acid-dehydrogenase-subunit-E2	gnl\|CDD\|223582	COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion].	1.63369e-77

>NC_017267.2|WP_014501681.1|498857_499973_+|4-hydroxyphenylpyruvate-dioxygenase
MSALPNTTATRPDPGMQVTTFDNPMGIDGFEFVEFAAPAGQAVQLHDYFRKMGFSAVLRHRRHLITVYRQGGVNFLLNEDPDSFAADFAAAHGPCACGFAIRFRTPAETVLQTVLGNGGEAVQDKADTRAVPAPVVKGIGDCMLYLVDRYGDAGSIYDADFEPIDGADQHPTGFGLTFIDHLTHNLYFGNMQRWSDYYERLFNFREIRYFDIKGAKTGLVSKALTAPDGIVRIPLNESSDPKSQINEYLDAYQGEGIQHIACFTEDIYTSVEKMRAAGVSFLDTPDTYFDVVDLRIPDHGEDVERLRRNKILIDADPDTKQRKLLQIFTTNCIGPIFFEIIQRKGNEGFGEGNFQALFESIERDQIKRGVL
>NC_017267.2|WP_019301451.1|498246_498735_-|MarR-family-transcriptional-regulator
MSDLDTPHPPQHPVLLNLEQFLPYRLSVLSNRISSNIAKVYGDRYGMAIPEWRVITILALYPGSSASEVSDRTAMDKVAVSRAVARLLERGFIRRETHGDDRRRSMLALSPAGRQVYETAAPLVNEMEQRLMSVFSAEEQQILEKLIDRLAKDGLPRMASKD
>NC_017267.2|WP_014501678.1|497300_497891_+|thioredoxin-family-protein
MPIKPIVCGLLLTVLFSACGQTSSPQEAPKPLDTSMQKPPSADPSQPVSSGNTPTAADIAAAAALNAKYDPSRDPAADLETAKVEAKRGGKRIVINVGNVACEPCKALDELMGGDAELRSFRDAHFVVVKVNRDAANENAAFLSAFAQLNDSPSLLVLDNDGKLLTTQSGPELRKGEGFDRKKLFDFLKQWAPPQA
>NC_017267.2|WP_014501677.1|495780_497289_+|MFS-transporter
MSVDATAPTSASTPPPPEFPTLLGHPRPLWMLFMTEFWERFAFYGIRWALTLYIVAEFYQGSGVGEAPANRLYGAYLALVYASALFGGFVADRLIGYQRSLLIGAVVMSAGLFLIAVPNDQVFKIGLATIIAGNGLFKPNVSTMVGQLYPLNDPRRDSGFTIFYMGINAGGFVAPLLTGLLADKLFGTEAMPAYKYVFIASGSGMLISLVWFWLGRRQLGPVGVPPVGGEGMGRTLAVLVGTVVAVPVAYGLLLIDASILGWILTILFLALCGLILFEGIREGKVQRDRAVAMLIVFVFNVMFFMFFEQAGSSFNFLAQNIVERDLGGWMFPVGWFQSVNTLAILVLGPVFVWLWVALKSANPSITRKFGLGLIFNGLAFALLMYALSALVDDAGKIPFWTLFMVYVIQTVGELCLSPIGLSMTTKLAPAKVVGLAMGGWFLSTAIGNNLSGIFASAISGETGMTVASALKGYTFGFWSLIAAGVLLLLIAPVVNKLMHGVK
>NC_017267.2|WP_014501676.1|494444_495338_+|tryptophan-2,3-dioxygenase
MPVDKNLRDLEPGIHTDLEGRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQHQTSELWLKLLAHELRAAIVHLQHDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQVLQVFAYDPQGRARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYALCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVGVDSRPPQGAAERQD
>NC_017267.2|WP_024712412.1|491263_492352_-|pyruvate-dehydrogenase-(acetyl-transferring)-E1-component-subunit-alpha
MSVAAQFQIDYLQYMDADGHWIRDDLPADAANPQHLLALFKRMLFVRSFDTKSVALQRTGKLGTYAACIGHEATHVGIGASMRSGDVFAPSYREYGTMFERGVRPRDVLLYWGGDERGSDYPRDADAAIDFPICVPISTQCLHAAGSALSFKLQGKPQVAVACCGDGGSSKIDFYAALNSAGAYTLPLILCVINNGWAISVPRSAQTGAQTLAQKGLAGGLQCLQVDGNDLVAVLEAMRQARVRALAGDGGTVIEFLTYRLSDHTTADDARRYRGEEELKQGWAREPLLRLRRYLTAQGLWDGAQEDAWKAECSARVDEEVNAYLNTPVQPVEAMFDHLYGDPPAELLAQRAEVMALESRHG
>NC_017267.2|WP_014501673.1|490200_491271_-|alpha-ketoacid-dehydrogenase-subunit-beta
MDERKHVSTDTSQHASAPYNAAATHGEIAMSSPITLIEAITQALAWELEHDPAVLVLGEDVGVNGGVFRATAGLQQRFGSARVLDTPLDETTIAGLSVGLAAQGMKPVAEAQFDGFVYPMVDHLICHAARLRNRTRGRLHCPMVLRVPWGGGIRAPEHHSEANEAIFTNVPGLRVVLPSSPQRAYGLLLAAIRDPDPVIYMEPKRIYRQYKEVVANDGQALPLDVCFVLRDGTDVTLVTWGAQVKEALEAADALAGEGISAEVIDVATLRPLDFDTIAESVAKTGRCVIVQEAPRTAGFGAEIAARLAEQSMYDLVAPVERVTGYDTHIPLFRLEMKYLPSVERIVTAARRAVAAG
>NC_017267.2|WP_014501672.1|489815_490199_-|variant-SH3-domain-protein
MRARLLCQHRAAYANPVRFQAGQQVSVGVRDEEWPAFAWITNDSGRAGWAPLAWLRPLGDGRAEALRDYDARELDAQAGEDVLLHDEHGGWWWSARADGTQGWLPAADLELLDDTTPQLPAAQENVP
>NC_017267.2|WP_014501671.1|488307_489819_-|2-oxo-acid-dehydrogenase-subunit-E2
MSDNKNFHLPDLGEGLPDATIVEWFVKEGDTVRLDDPLVSMETAKAVVEVPSPFSGTVLKLAGAAGDVIVTGSVLAQFALDASQPQRADGQDTGHSHGPVPTHSPTPSTGDSAAGPTARVVASDNGGESADADAGDGSSDRDDAGTVVGAMQSSNAVQSEQAIAVGGVRAMPVVRALARKLRVDLAQVRATGPDGTVTLADVKQAAAADTARPSPGAQGAPTSPARGSGGPVADSGRARGVADGGRDRPEPATVLPPAGEGARRPDEGSTARSPLSASGKPMRTQSPGTSVKGQPEQLKGVRRNMARVMADAHTKVVPTTLNDDADLHAWHPGNDVTVRLVRGIVRACQAVPALNAWFDGDALSRTLHNQIDIGIAVDTEEGLFVPALRNADMLDAHGIHESINRLRQQVENRSIAASELSGYTISLSNFGMFAGRYATPVVVPPCVAIVAAGRARYQLTPVMGGVETHKVMPLSLTFDHRAATGGEAARFLRALLDDLALAN
>NC_017267.2|WP_014501670.1|488011_488254_+|hypothetical-protein
MSWKLMRIKNKAAPPVAAVELAKVLAATSLAIDAAEDESVSSLAHKNIARLPAPLESATASLLLGCSVHPAVCANIAGLR
>NC_017267.2|WP_014501682.1|501747_503073_+|homogentisate-1,2-dioxygenase
MHNPQHYMTGFGNEFATEAVAGSLPVGQNSPQRVAHGLYAEQLSGTAFTVPRGENRRSWLYRIRPAAVHGRFSLIEQSWLHNDFGGGPVPPDQMRWSPLPLPATPTDFVDGLYTMAGNGSPEAMTGVAVHLYAANASMHGRFFYNADGELLLVPQLGRLRVCTELGVLELEPQQIGVIPRGVRFRVELLDSAARGYVCENFGGLLRLPDLGPIGANGLANPRDFETPRAVFEQRDGVFELVAKFQGHLWRADIDHSPLDVVAWHGNYAPYRYDLRRFNTIGSISFDHPDPSIFTVLTSPSDTHGTANMDFAIFPPRWLVAQHTFRPPWFHRNVASEFMGLVHGVYDAKAEGFAPGGASLHNCMSGHGPDAATFDKASQADLTRPDVIAETMAFMFETRAVLRPTQQALSAAHRQADYQQCWSGLRAAFQHPPAENTTSVLR
>NC_017267.2|WP_082350429.1|503498_503888_-|hypothetical-protein
MNREIPCGNVRTIVPTALLLLALMASSSAQAEPVISTKITSHALGAFAVLVVGNGLKTCVSLVYNKPVLGPDLKFNTSNDYQLYAMSTVNCQPGTSMAGLYGTLGFHGSNSGTLDISLSNSGFSYRAYH
>NC_017267.2|WP_011260422.1|504284_504638_-|Na+/H+-antiporter-subunit-G
MIALTEYLLSALLLVGTFFILIGAFGLVKLSDFFKRLHAPTNASTLGVGCVLLASVGYHLFLGVDPQPRELLITVFLFITAPISAHLMAKAALSLMMENRPEPPNHSDAQQEEVPPR
>NC_017267.2|WP_014501684.1|504634_504919_-|K+/H+-antiporter-subunit-F
MTGHMFIESTIVICMHAVGLAILMALWRLLRGPTVPDRILALDTLSVTAIAELMLLCMYLNSPIYFEAALVIAMLGFGSTVVLSKYVLRRSIVE
>NC_017267.2|WP_014501685.1|504915_505422_-|Na+/H+-antiporter-subunit-E
MTTRIPLRRRLLPSLPLSVMVFLFWLLLSDSFGPQQWGLGMLLGVVVPIFAARLDREFAQIGSLRSVPRMLLVAAGDIVRSNIKVAAQVLGPESRIHPGFIWVRLDIANIHGIAALTSMITLTPGTVSAALSDDRKYLLVHVLHLDDPEALIAQIKSRYEKPLMEIFP
>NC_017267.2|WP_014501686.1|505418_506963_-|monovalent-cation/H+-antiporter-subunit-D
MNHLLILPILIPMLGASASLFVEHRRYGPRVQRSVAWVGMTLLAAAVIALFARAADGEILVYLLGDWPARIGIALMGDRLSAWMLLTTLILGSACLLHACAGWDRRAPHFHALFQFQLMGLNGAFLTGDIFNLFVFFEVMLIASYGLLLSGGRGLQMRVGLHYVVFNVCASTLFLIALGLLFGVFGTLNMAELSQRIADLPAQDVPLAKATLGLLLLVFCSKAALLPLYLWLPETYSRAPAAVAALFAIMTKVGLYATLRVSSLWFGAGAGAMHGFGRHALLWLGIATLLMAAFGVMAASRLRVLVSYLVVFSAATLFIAFSLDDAGALGAGLYYLPHSSLVAAALFMVSDLIRRRRGSASDRKEVVAPLPGRAIPGTMFMIAAVAVAGLPPLSGFLAKAALLQHVPQGLVGPVWGAVLGSSLLVVIGLTRAGVRLFWRVPAAVEDAPALQPQRRARMRPVETAATVVLLSGLLAMTLAADPLMHYTDAAAAQLRDPGAHVEQVRATTPQRRQP
>NC_017267.2|WP_014501687.1|506959_507334_-|Na+/H+-antiporter-subunit-C
MELAVASAIGVLTALAIYLLLHARSFDVILGMTFLSYATNLLIFAGGRLRSGQAPVLREGVPAELMHHTDPLPQALVLTAIVIAFAMTAVCLVLAIRSRSDNHSDHVDAHEDATTGVDTREARR
>NC_017267.2|WP_014501688.1|507333_510162_-|monovalent-cation/H+-antiporter-subunit-A
MPFSLEILLALPFVMAAAAALLWRAPRSITAWLAVAAPLGGLLVLALLTPAVLRGEVIRSEHAWLPQIGLMFSLRLDGLAWMFSLLVLGIGALVVLYAHYYLSARDSASRFFAYLLLFMGAMLGMVLSGNLLLLMVFWELTSISSFLLIGFWSHRKDAREGARMAFVLTAGGGLALLGGLLMIGRIVGSFQLDAVLAAGDVIRASPLYPYALGLVLLGIFTKSAQFPFHFWLPHAMAAPTPVSAYLHSATMVKAGVFLLARLHPALAGTDLFFYTVTSIGAITVLLGAWHAIFQHDLKGVLAYSTISHLGLITMLFGLSTPMAVVAGVFHLINHAVFKASLFMAAGIIDHETGTRDMRELGNLRRLMPVTSALAITASLAMAGIPLLNGFLSKEMFFAVALDTEAPQLMRILASTAALLAGLLGVAYSLRFVHDTFFGDGPRELDTTPHEPPRWMRIPVDVLVLTCVAVGIVPAWTVAPVLRAGATAILGDRLPDYGLALWHGFNVPLAMSIAGIVGGALLYMALRRTLDLYAIQNRSPGKALFQWNLRALFTATTRMTDAVTNGNLQRMLMLLVLSAVVVALVPFLQGGTLPNWPAPTPMPVLGWMVWLLMMACALGSLFLYQQRLLAVLVLGGTGLAVSLTFVFLSAPDLALTQLLVEMVTLVLMLLAMNYLPERSLLEHARLRKIRDAALAIVGGAGLAALAYTLMTQPSHSVAGELLQRALPEAYGRNVVNVILVDFRGFDTFGEITVFAIAGLVVHALLRRSRMAPERTMPGPPIKLPVPADLAQIMFPLTLTVSLFLFLRGHNAPGGGFIAGLVLAVPLLMQYVIQGTASVESRFGLDYIRLIGIGLLCALVSGAGSLVFGLPFLSSGHLEIPLPLLGELELASALGFDIGVYLVVFGAAMLMLSMMGTIKPSRTRSSQRGEIDPTQRSTRTAEQH
>NC_017267.2|WP_014501690.1|510707_511193_-|DUF962-domain-containing-protein
MTERTTTARPIERYFASYSDDHQNATNQQIHVLAVPAILWSVVALLWCIPVGGTWFTSGVWAALSMFAAWSYYNRLSRPLGLGMLGIFFFFGCLCRLIEGRIGLGGLFATALTVFVLAWIAQFIGHKIEGRKPSFLTDLTYLLIGPIWVLAKAYRQLGWRY
>NC_017267.2|WP_014501691.1|511292_512888_-|M4-family-metallopeptidase
MQFHVLGAAICCALSFSAAATAVDLSANAAVSRAQSLLGNNTSALANRASADAFIAGDSIVDADGTEHVRFDRTYQGLPVIGGDVVVHSRRGVMRELSQTMETTVRQSLVPGIESATALRVAGSQFDVAQDAAPRASLVLYARQGAPRLVYEVIYSGVKPDQTPTEMHYIVDAVNQRILESWDTVHTVCSGGTSAAGTGRALSAGSVGLSTTRCSSGYELTDLSGGSGATYNMRNSTYGNGTLVTDADNAWGNGANSDTVTAAVDAHYGVALTWDYYRTTHARSGIANDGAGARSRVHYGSRYNNAFWQDSCFCTTFGDGDGSSFMPLMSVDVAGHEMTHGVTSRTARLVYAGESGGLNEATSDIMGAMVEYSAANSAAPGNYLIGEKIIHNNSTGTLALRYMFKPSLDGNSPDCYSSNLGSLNVHYSSGVANHFYYLLAEGAVVPSGFGTGTSYNLTPAGLVCSGSTALTAIGRAAASRIWYRALTVYMTSSTNYAAARRATLSAATDLYGGTSTQYRAVAAAWSAVLVN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

7559 : 75816

Staphylococcus_prophage(21.43%)

protease,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014501261.1\|7559_8396_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_014501262.1\|8582_9389_+	M48 family metallopeptidase	NA	NA	NA	NA
WP_014501263.1\|9665_10859_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_014501264.1\|11126_11684_+	energy transducer TonB	NA	NA	NA	NA
WP_014501265.1\|11768_12530_+	TonB-system energizer ExbB	NA	NA	NA	NA
WP_010364790.1\|12576_12999_+	biopolymer transporter ExbD	NA	NA	NA	NA
WP_011257016.1\|13002_13416_+	biopolymer transporter ExbD	NA	NA	NA	NA
WP_014501266.1\|13711_14479_-	pyridoxine 5'-phosphate synthase	NA	NA	NA	NA
WP_019301610.1\|14489_14759_-	hypothetical protein	NA	NA	NA	NA
WP_014501267.1\|14833_16294_-	cardiolipin synthase	NA	NA	NA	NA
WP_014501268.1\|17002_17959_+\|transposase	IS30-like element IS1112a family transposase	Q9MBM9	Staphylococcus_prophage	1.6e-42	36.0
WP_014501271.1\|19815_20046_+	hypothetical protein	NA	NA	NA	NA
WP_014501272.1\|20450_23174_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	2.6e-69	29.9
WP_014501275.1\|25391_27080_+	DUF2875 family protein	NA	NA	NA	NA
WP_014501276.1\|27076_27340_+	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	7.5e-06	43.4
WP_108744444.1\|27404_28496_-	AAA family ATPase	Q7M293	Enterobacteria_phage	2.0e-20	30.7
WP_041183555.1\|29085_29511_+	hypothetical protein	NA	NA	NA	NA
WP_014501278.1\|29460_31011_-	MASE1 domain-containing protein	NA	NA	NA	NA
WP_048481635.1\|32890_34267_+\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	6.0e-78	55.5
WP_014501280.1\|34851_35808_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	4.5e-40	34.0
WP_041183558.1\|37132_37402_+	hypothetical protein	NA	NA	NA	NA
WP_014501283.1\|38524_38704_+	hypothetical protein	NA	NA	NA	NA
WP_153296758.1\|38880_39033_+	hypothetical protein	NA	NA	NA	NA
WP_041183559.1\|39066_40023_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	9.6e-43	36.1
WP_014501284.1\|40060_41329_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_014501285.1\|41325_43428_+	peptidase domain-containing ABC transporter	W8CYL7	Bacillus_phage	5.1e-28	26.3
WP_153296759.1\|45286_45529_+	hypothetical protein	NA	NA	NA	NA
WP_014501286.1\|45537_46134_-	hypothetical protein	NA	NA	NA	NA
WP_014501287.1\|46130_46874_-	hypothetical protein	NA	NA	NA	NA
WP_014501289.1\|47342_48308_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_014501290.1\|48441_49500_-	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L339	Tupanvirus	3.9e-77	45.7
WP_014501292.1\|49809_50883_+	glycoside hydrolase family 5 protein	NA	NA	NA	NA
WP_041182980.1\|51636_52689_+	glycoside hydrolase family 5 protein	NA	NA	NA	NA
WP_014501295.1\|53474_54605_+	glycoside hydrolase family 5 protein	NA	NA	NA	NA
WP_041182981.1\|55131_55482_+	PepSY domain-containing protein	NA	NA	NA	NA
WP_014501298.1\|55629_57441_-	M28 family peptidase	NA	NA	NA	NA
WP_041182982.1\|57603_58260_-	hypothetical protein	NA	NA	NA	NA
WP_193388275.1\|58356_59655_+	peptidoglycan DD-metalloendopeptidase family protein	NA	NA	NA	NA
WP_014501301.1\|59759_61289_+	S41 family peptidase	A0A0R6PIZ1	Moraxella_phage	1.7e-25	28.9
WP_014501302.1\|61455_62448_-	D-2-hydroxyacid dehydrogenase family protein	M1HUT5	Acanthocystis_turfacea_Chlorella_virus	1.1e-09	30.1
WP_008572943.1\|62447_62768_-	DUF1820 family protein	NA	NA	NA	NA
WP_010364746.1\|62884_63577_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_014501304.1\|63795_65145_+	outer membrane protein transport protein	NA	NA	NA	NA
WP_014501306.1\|66289_67417_+	PA0069 family radical SAM protein	NA	NA	NA	NA
WP_014501309.1\|70443_71259_+	bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase	A0A127AWE5	Bacillus_phage	2.8e-19	27.3
WP_011258802.1\|72209_73178_-\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	8.7e-100	60.3
WP_014501311.1\|74847_75816_-\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	7.3e-99	60.0

DBSCAN-SWA_2

129795 : 191583

Ralstonia_phage(22.22%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014501361.1\|129795_130812_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.6e-48	36.2
WP_041182994.1\|132160_133642_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_014501364.1\|133836_138309_-	glutamate synthase large subunit	NA	NA	NA	NA
WP_011257161.1\|138510_138891_-	hypothetical protein	NA	NA	NA	NA
WP_041182995.1\|138948_140208_+	DNA topoisomerase IB	A0A0U2TSJ7	Niemeyer_virus	7.0e-41	35.5
WP_041182996.1\|140425_140731_-	hypothetical protein	NA	NA	NA	NA
WP_014501370.1\|143334_144120_-	DUF1868 domain-containing protein	NA	NA	NA	NA
WP_179208374.1\|144130_146788_-	TonB-dependent receptor	NA	NA	NA	NA
WP_014501372.1\|146891_148049_+	ROK family protein	NA	NA	NA	NA
WP_014501374.1\|148239_150384_+	avirulence protein	NA	NA	NA	NA
WP_014501376.1\|150858_152685_-	ribonuclease H-like domain-containing protein	NA	NA	NA	NA
WP_014501377.1\|152681_155177_-	DEAD/DEAH box helicase	A0A1B1IUF6	uncultured_Mediterranean_phage	1.2e-07	36.0
WP_014501378.1\|155353_156016_+	hemolysin III family protein	NA	NA	NA	NA
WP_014501379.1\|156082_156313_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_014501381.1\|157102_158068_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_014501382.1\|158203_159214_-	class 1 fructose-bisphosphatase	A0A1V0SKX4	Klosneuvirus	1.0e-47	36.9
WP_014501384.1\|159484_160687_-	aspartate/tyrosine/aromatic aminotransferase	NA	NA	NA	NA
WP_014501385.1\|160842_162981_+	TonB-dependent receptor	A0A1B0VCF0	Salmonella_phage	4.8e-66	41.2
WP_041182997.1\|164291_165233_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	3.4e-85	55.3
WP_014501387.1\|165280_166447_-	FMN-dependent L-lactate dehydrogenase LldD	NA	NA	NA	NA
WP_041183574.1\|166593_167160_-	DUF1295 domain-containing protein	NA	NA	NA	NA
WP_014501392.1\|169202_170159_-\|transposase	IS30-like element IS1112a family transposase	Q9MBM9	Staphylococcus_prophage	1.8e-41	35.6
WP_014501394.1\|170579_171788_+	trans-2-enoyl-CoA reductase family protein	NA	NA	NA	NA
WP_014501397.1\|172425_173448_-	sugar kinase	NA	NA	NA	NA
WP_024712271.1\|175379_176042_-	DUF938 domain-containing protein	NA	NA	NA	NA
WP_041182998.1\|176195_176990_-	EcsC family protein	NA	NA	NA	NA
WP_014501400.1\|177185_177659_+	SRPBCC domain-containing protein	NA	NA	NA	NA
WP_014501401.1\|178017_179265_-	MFS transporter	NA	NA	NA	NA
WP_014501403.1\|180262_180661_-	host attachment protein	NA	NA	NA	NA
WP_014501404.1\|180730_180961_-	hypothetical protein	NA	NA	NA	NA
WP_014501408.1\|181821_182292_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_011257044.1\|182407_182584_+	hypothetical protein	NA	NA	NA	NA
WP_014501410.1\|182694_183768_+	M4 family metallopeptidase	NA	NA	NA	NA
WP_108744460.1\|184329_184899_-	SRPBCC family protein	NA	NA	NA	NA
WP_041183577.1\|185107_186277_+	HDOD domain-containing protein	NA	NA	NA	NA
WP_014501416.1\|186518_186707_+	CsbD family protein	NA	NA	NA	NA
WP_014501418.1\|187386_187608_+	hypothetical protein	NA	NA	NA	NA
WP_014501419.1\|187732_188182_+	hypothetical protein	NA	NA	NA	NA
WP_014501420.1\|188402_189359_+\|transposase	IS30-like element IS1112a family transposase	Q9MBM9	Staphylococcus_prophage	4.8e-42	36.0
WP_014501421.1\|190614_191583_-\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	4.3e-99	60.0

DBSCAN-SWA_3

225563 : 236161

Acidithiobacillus_phage(60.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082352919.1\|225563_226940_+\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	1.9e-79	63.2
WP_144415622.1\|226949_227267_-	hypothetical protein	NA	NA	NA	NA
WP_161798571.1\|227300_227450_-	hypothetical protein	NA	NA	NA	NA
WP_014501452.1\|227561_228518_+\|transposase	IS30-like element IS1112a family transposase	Q9MBM9	Staphylococcus_prophage	8.1e-42	35.6
WP_153296760.1\|228508_228667_-	hypothetical protein	NA	NA	NA	NA
WP_041183004.1\|228706_230083_-\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	8.3e-80	56.2
WP_014501454.1\|231787_232756_+\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	1.9e-99	60.0
WP_144415623.1\|232968_234288_-\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_082356813.1\|234784_236161_+\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	9.2e-79	55.8

DBSCAN-SWA_4

298036 : 346657

Ralstonia_phage(25.0%)

holin,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014501509.1\|298036_298999_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_014501510.1\|299607_300651_-\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	7.2e-100	60.3
WP_144415624.1\|300787_302107_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_144415625.1\|302356_303154_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_041183019.1\|303282_304167_-	hypothetical protein	NA	NA	NA	NA
WP_014501512.1\|304256_305552_+	acetyl-CoA C-acetyltransferase	NA	NA	NA	NA
WP_014501516.1\|306592_307858_-	porphyrin biosynthesis protein	NA	NA	NA	NA
WP_014501517.1\|307854_308832_-	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_082350436.1\|308935_309739_-	uroporphyrinogen-III synthase	NA	NA	NA	NA
WP_014501519.1\|309914_310724_+	glycosyltransferase family 25 protein	NA	NA	NA	NA
WP_024712159.1\|310994_311465_+	YiiD C-terminal domain-containing protein	NA	NA	NA	NA
WP_014501521.1\|311493_311916_+	hypothetical protein	NA	NA	NA	NA
WP_014501522.1\|311991_312426_+	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_014501523.1\|312535_313048_+	protein-export chaperone SecB	NA	NA	NA	NA
WP_024712157.1\|313063_314089_+	NAD(P)-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_024712156.1\|314411_315008_-	Ax21 family protein	NA	NA	NA	NA
WP_193388285.1\|315384_317094_+	ubiquinone-dependent pyruvate dehydrogenase	NA	NA	NA	NA
WP_014501527.1\|317143_318586_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_014501528.1\|318570_319917_+	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_014501529.1\|320107_320857_+	hypothetical protein	NA	NA	NA	NA
WP_014501530.1\|321077_321689_+	hypothetical protein	NA	NA	NA	NA
WP_014501531.1\|321793_323017_+	MFS transporter	NA	NA	NA	NA
WP_014501532.1\|323358_323835_-\|tRNA	tRNA (cytidine(34)-2'-O)-methyltransferase	NA	NA	NA	NA
WP_014501533.1\|323861_324311_-	hypothetical protein	NA	NA	NA	NA
WP_010370565.1\|324696_325017_+	DUF4156 domain-containing protein	NA	NA	NA	NA
WP_014501534.1\|325118_326135_+	3-oxoacyl-ACP synthase III	NA	NA	NA	NA
WP_178385928.1\|326375_327425_+	Fic family protein	NA	NA	NA	NA
WP_014501536.1\|327565_328468_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_010370556.1\|328689_329073_-	YkgJ family cysteine cluster protein	NA	NA	NA	NA
WP_014501537.1\|329401_331072_+	AMP-binding protein	NA	NA	NA	NA
WP_014501538.1\|331300_332311_+	NAD-dependent epimerase/dehydratase family protein	A0A0E3FNQ3	Synechococcus_phage	9.9e-14	32.2
WP_003468167.1\|332376_332535_+	DUF1328 domain-containing protein	NA	NA	NA	NA
WP_014501540.1\|333135_334239_-	D-alanine--D-alanine ligase	NA	NA	NA	NA
WP_014501542.1\|334473_335118_+	SCP2 sterol-binding domain-containing protein	NA	NA	NA	NA
WP_014501543.1\|335114_336788_+	ubiquinone biosynthesis regulatory protein kinase UbiB	A9YVW0	Ostreococcus_tauri_virus	6.2e-29	29.6
WP_014501544.1\|336902_337292_+	cupin domain-containing protein	NA	NA	NA	NA
WP_014501547.1\|337989_338742_+	pseudouridylate synthase	NA	NA	NA	NA
WP_041183022.1\|338837_339416_-	DUF2059 domain-containing protein	NA	NA	NA	NA
WP_011257289.1\|339472_339904_+\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_014501549.1\|339906_340536_+\|holin	lysophosphatidylcholine acyltransferase	NA	NA	NA	NA
WP_153296761.1\|340565_340766_-	hypothetical protein	NA	NA	NA	NA
WP_014501551.1\|341171_343340_+	peptidyl-dipeptidase Dcp	NA	NA	NA	NA
WP_014501552.1\|343460_345623_-	hypothetical protein	NA	NA	NA	NA
WP_041183585.1\|346180_346657_+\|transposase	IS200/IS605 family transposase	A0A1L2BWN1	Bacteriophage	1.7e-08	31.1

DBSCAN-SWA_5

406569 : 473790

Listeria_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014501608.1\|406569_407532_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_014501609.1\|407557_407815_+	hypothetical protein	NA	NA	NA	NA
WP_024712728.1\|407918_408656_-	3-oxoacyl-ACP reductase FabG	Q06VL0	Trichoplusia_ni_ascovirus	7.0e-09	27.8
WP_014501613.1\|409946_410384_-	phosphotransferase	NA	NA	NA	NA
WP_041183029.1\|410370_412740_-	MMPL family transporter	NA	NA	NA	NA
WP_041183030.1\|412729_412957_-	hypothetical protein	NA	NA	NA	NA
WP_014501616.1\|412946_413228_-	hypothetical protein	NA	NA	NA	NA
WP_193388286.1\|413312_413933_-	fatty acyl CoA synthetase	NA	NA	NA	NA
WP_014501618.1\|413883_414858_-	acyltransferase	NA	NA	NA	NA
WP_014501619.1\|414854_415142_-	hypothetical protein	NA	NA	NA	NA
WP_014501620.1\|415153_415903_-	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_014501621.1\|415957_416641_-	ketosynthase	NA	NA	NA	NA
WP_024712116.1\|416678_416948_-	acyl carrier protein	NA	NA	NA	NA
WP_041183032.1\|417250_418600_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_014501624.1\|418596_419604_+	xanthomonadin biosynthesis pteridine-dependent deoxygenase like protein	NA	NA	NA	NA
WP_014501625.1\|419846_420806_-	5'-nucleotidase	NA	NA	NA	NA
WP_041183033.1\|421262_422609_-	AMP-binding protein	NA	NA	NA	NA
WP_041183034.1\|423354_425715_+	S9 family peptidase	NA	NA	NA	NA
WP_041183593.1\|426159_426879_+	hypothetical protein	NA	NA	NA	NA
WP_041183035.1\|426875_427469_+	hypothetical protein	NA	NA	NA	NA
WP_014501632.1\|428167_429067_+	oxygen-dependent coproporphyrinogen oxidase	NA	NA	NA	NA
WP_014501633.1\|429276_430239_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_014501634.1\|430498_432121_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_014501635.1\|432117_432939_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_014501636.1\|432935_433709_-	beta-ketoacyl synthase chain length factor	NA	NA	NA	NA
WP_014501637.1\|433708_434908_-	beta-ketoacyl-[acyl-carrier-protein] synthase family protein	NA	NA	NA	NA
WP_041183594.1\|435126_435387_+	YcgL domain-containing protein	NA	NA	NA	NA
WP_041183036.1\|435379_438700_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_014501640.1\|438726_439056_+	phosphatase	NA	NA	NA	NA
WP_014501641.1\|439119_440919_+	glycoside hydrolase family 15 protein	NA	NA	NA	NA
WP_014501642.1\|440915_442712_+	glucose-6-phosphate dehydrogenase	M4SP85	Cyanophage	3.2e-79	37.9
WP_014501643.1\|442844_443813_+\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	6.6e-100	60.3
WP_014501644.1\|444207_444660_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
WP_041183038.1\|445364_446021_+	hypothetical protein	NA	NA	NA	NA
WP_014501646.1\|446809_448633_-	cation:proton antiporter	NA	NA	NA	NA
WP_011257400.1\|449313_450681_+	magnesium transporter	NA	NA	NA	NA
WP_014501647.1\|450752_451367_+	hypothetical protein	NA	NA	NA	NA
WP_014501648.1\|451653_454362_+	bifunctional acetate--CoA ligase family protein/GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_024712256.1\|454468_455512_+	DUF475 domain-containing protein	A0A172Q0Y5	Acinetobacter_phage	2.2e-80	51.8
WP_014501652.1\|456125_458624_+	ribonucleoside-diphosphate reductase subunit alpha	A0A088FNW1	Listeria_phage	8.3e-304	66.9
WP_014501653.1\|458801_459845_+	ribonucleotide-diphosphate reductase subunit beta	A8ASV9	Listeria_phage	5.6e-153	75.7
WP_041183040.1\|459890_460874_+	5'-nucleotidase	NA	NA	NA	NA
WP_041183041.1\|460893_461388_+	flavodoxin	A0A068CFW0	Listeria_phage	4.7e-17	36.1
WP_011257407.1\|461359_461686_+	thioredoxin family protein	NA	NA	NA	NA
WP_144415627.1\|461961_463064_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.7e-38	40.5
WP_014501656.1\|463156_466444_-	TAL effector protein Tal1c	NA	NA	NA	NA
WP_014501657.1\|466577_469562_-	TAL effector repeat-containing protein	NA	NA	NA	NA
WP_048484688.1\|472413_473790_+\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	1.9e-79	63.2

DBSCAN-SWA_6

625353 : 699288

Leptospira_phage(11.11%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_144415632.1\|625353_626454_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.8e-38	39.4
WP_193388277.1\|626627_627251_+	hypothetical protein	NA	NA	NA	NA
WP_014501792.1\|627597_629181_-	SDR family oxidoreductase	M1NLX1	Moumouvirus	6.5e-36	27.5
WP_014501793.1\|629572_629764_-	hypothetical protein	NA	NA	NA	NA
WP_014501797.1\|632280_634605_-	S9 family peptidase	NA	NA	NA	NA
WP_014501802.1\|636511_637603_-	DUF1615 domain-containing protein	NA	NA	NA	NA
WP_041183607.1\|638564_639443_-	hypothetical protein	NA	NA	NA	NA
WP_041183059.1\|639639_640515_+	DMT family transporter	NA	NA	NA	NA
WP_014501805.1\|640790_642563_-	cellulase family glycosylhydrolase	NA	NA	NA	NA
WP_041183060.1\|644594_645557_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_048481651.1\|645701_647078_+\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	5.4e-79	63.2
WP_179208376.1\|647520_648951_+	D-serine/D-alanine/glycine transporter	NA	NA	NA	NA
WP_014501812.1\|649037_650033_-	hypothetical protein	NA	NA	NA	NA
WP_014501814.1\|650278_651190_+	magnesium transporter	NA	NA	NA	NA
WP_108744437.1\|651317_652115_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_014501818.1\|652577_652862_-	hypothetical protein	NA	NA	NA	NA
WP_014501819.1\|653192_653645_+	avidin/streptavidin family protein	NA	NA	NA	NA
WP_014501821.1\|654190_655864_-	alpha,alpha-trehalase TreA	NA	NA	NA	NA
WP_041183061.1\|656117_656903_-	DUF72 domain-containing protein	NA	NA	NA	NA
WP_041183062.1\|658147_659143_+	hypothetical protein	NA	NA	NA	NA
WP_014501826.1\|659181_660111_-	GAF domain-containing protein	NA	NA	NA	NA
WP_014501827.1\|660668_663548_-	insulinase family protein	NA	NA	NA	NA
WP_014501828.1\|663803_666386_+	PAS domain S-box protein	G3MA91	Bacillus_virus	2.5e-08	28.6
WP_014501836.1\|671101_672589_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	3.2e-125	57.1
WP_041183063.1\|673991_675641_+	M28 family peptidase	NA	NA	NA	NA
WP_014501840.1\|676642_678580_+	glucans biosynthesis glucosyltransferase MdoH	NA	NA	NA	NA
WP_014501841.1\|678731_679400_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_024711087.1\|679404_680457_+	histidine kinase	Q9EYF3	Enterobacteria_phage	1.8e-18	33.6
WP_014501843.1\|680487_681225_+	response regulator transcription factor	NA	NA	NA	NA
WP_014501844.1\|681255_682170_+	hydroxymethylbilane synthase	NA	NA	NA	NA
WP_014501845.1\|682719_683520_-	DUF481 domain-containing protein	NA	NA	NA	NA
WP_014501846.1\|684082_685048_+	YafY family transcriptional regulator	NA	NA	NA	NA
WP_024711083.1\|685398_685968_-	lipocalin family protein	NA	NA	NA	NA
WP_014501848.1\|686353_686665_+	hypothetical protein	NA	NA	NA	NA
WP_014501849.1\|686732_688826_+	S9 family peptidase	NA	NA	NA	NA
WP_014501851.1\|689634_690834_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_014501853.1\|690943_693079_+	oligopeptidase B	F2Y2Z7	Organic_Lake_phycodnavirus	1.6e-29	26.0
WP_041183608.1\|693422_693821_+	YbaN family protein	NA	NA	NA	NA
WP_014501855.1\|693878_694121_+	lipoprotein	NA	NA	NA	NA
WP_041183064.1\|694110_694965_+	diaminopimelate epimerase	NA	NA	NA	NA
WP_014501857.1\|694961_695633_+	DUF484 family protein	NA	NA	NA	NA
WP_024711077.1\|695826_696744_+	tyrosine recombinase XerC	A0A142F2H8	Mycobacterium_phage	2.2e-12	28.1
WP_014501859.1\|697259_697811_+\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_014501860.1\|697920_699288_+\|protease	ATP-dependent protease ATPase subunit HslU	A0A2H5BJT2	Erwinia_phage	6.2e-43	30.0

DBSCAN-SWA_7

1037834 : 1112676

Bacillus_virus(15.38%)

holin,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_108744372.1\|1037834_1038800_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_014502168.1\|1039017_1041141_-	TonB-dependent receptor	NA	NA	NA	NA
WP_014502170.1\|1041388_1042771_+	3-deoxy-7-phosphoheptulonate synthase class II	NA	NA	NA	NA
WP_014502171.1\|1042871_1043999_+	mechanosensitive ion channel	NA	NA	NA	NA
WP_024711760.1\|1044932_1045352_-	DUF2127 domain-containing protein	NA	NA	NA	NA
WP_011257837.1\|1045421_1047251_-	translational GTPase TypA	NA	NA	NA	NA
WP_014502175.1\|1047494_1047989_+	peptidylprolyl isomerase	A0A1V0SCU1	Indivirus	8.5e-27	53.1
WP_014502176.1\|1048103_1049090_+	malate dehydrogenase	NA	NA	NA	NA
WP_108744371.1\|1049225_1050442_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	5.4e-91	64.1
WP_041183097.1\|1051226_1053041_+	YdiU family protein	NA	NA	NA	NA
WP_011258802.1\|1053166_1054135_-\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	8.7e-100	60.3
WP_010368619.1\|1054401_1054863_-	cell wall hydrolase	NA	NA	NA	NA
WP_041183098.1\|1055411_1056359_-	glycerophosphodiester phosphodiesterase family protein	A0A0S2MYI4	Enterococcus_phage	3.8e-07	38.5
WP_041183099.1\|1058949_1060068_+	ROK family protein	NA	NA	NA	NA
WP_082350340.1\|1060018_1061392_-	MFS transporter	NA	NA	NA	NA
WP_014502187.1\|1061491_1063531_-	NADPH-dependent 2,4-dienoyl-CoA reductase	NA	NA	NA	NA
WP_014502188.1\|1063738_1064761_-	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_014502189.1\|1065176_1066274_+	OmpA family protein	NA	NA	NA	NA
WP_014502190.1\|1066466_1066976_+	hypothetical protein	NA	NA	NA	NA
WP_041183100.1\|1066995_1067856_+	rRNA pseudouridine synthase	NA	NA	NA	NA
WP_014502192.1\|1067806_1068199_-	HNH endonuclease	NA	NA	NA	NA
WP_014502193.1\|1068201_1069410_-	glycine C-acetyltransferase	V5LQ39	Emiliania_huxleyi_virus	1.3e-20	26.5
WP_024711595.1\|1069500_1070598_+	sulfate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_024711594.1\|1070601_1071462_+	sulfate ABC transporter permease subunit CysT	NA	NA	NA	NA
WP_014502196.1\|1071458_1072412_+	sulfate ABC transporter permease subunit CysW	NA	NA	NA	NA
WP_014502197.1\|1072419_1073454_+	sulfate/molybdate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-25	32.7
WP_014502198.1\|1073813_1074527_+	hypothetical protein	NA	NA	NA	NA
WP_014502199.1\|1074596_1075631_-	L-threonine 3-dehydrogenase	NA	NA	NA	NA
WP_082356796.1\|1076133_1078557_-	TonB-dependent receptor	NA	NA	NA	NA
WP_014502201.1\|1078640_1080725_+\|holin	phospholipase C, phosphocholine-specific	NA	NA	NA	NA
WP_014502203.1\|1082030_1082666_+	hypothetical protein	NA	NA	NA	NA
WP_024711588.1\|1083191_1083836_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_014502206.1\|1084165_1085464_+	bifunctional tetrahydrofolate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_014502207.1\|1085531_1086614_+	SPOR domain-containing protein	NA	NA	NA	NA
WP_014502208.1\|1086828_1087575_+	CvpA family protein	NA	NA	NA	NA
WP_014502209.1\|1087605_1089072_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	3.1e-85	39.9
WP_041183625.1\|1089210_1090035_+	ferritin-like domain-containing protein	NA	NA	NA	NA
WP_014502212.1\|1091139_1091559_+	hypothetical protein	NA	NA	NA	NA
WP_014502214.1\|1091738_1092482_-	UDP-2,3-diacylglucosamine diphosphatase	NA	NA	NA	NA
WP_024712221.1\|1093129_1093672_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_014502216.1\|1093652_1094789_-	glycosyltransferase family 1 protein	NA	NA	NA	NA
WP_014502217.1\|1094993_1096514_-	exopolyphosphatase	NA	NA	NA	NA
WP_014502218.1\|1096691_1098794_-	polyphosphate kinase 1	NA	NA	NA	NA
WP_041183101.1\|1098909_1100238_-	phosphate regulon sensor histidine kinase PhoR	W8CYF6	Bacillus_phage	1.1e-28	33.3
WP_014502221.1\|1100310_1101000_-	phosphate regulon transcriptional regulator PhoB	W8CYM9	Bacillus_phage	3.4e-34	35.7
WP_014502222.1\|1101174_1102881_-	M48 family metallopeptidase	NA	NA	NA	NA
WP_012445944.1\|1102970_1103279_+	glutaredoxin 3	A0A2L0UZG6	Agrobacterium_phage	4.7e-07	43.2
WP_014502223.1\|1103275_1103671_+	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_014502224.1\|1103893_1104901_+	isocitrate dehydrogenase	NA	NA	NA	NA
WP_014502225.1\|1105033_1105795_-	Bax inhibitor-1/YccA family protein	NA	NA	NA	NA
WP_144415635.1\|1107049_1108152_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.1e-37	40.5
WP_014502229.1\|1109253_1110546_+	trigger factor	NA	NA	NA	NA
WP_002806026.1\|1110638_1111265_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	1.0e-56	57.4
WP_011257881.1\|1111389_1112676_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	9.0e-137	59.9

DBSCAN-SWA_8

1312420 : 1340072

Acidithiobacillus_phage(33.33%)

plate,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048481586.1\|1312420_1313584_-\|transposase	IS4 family transposase	A0A0F7LAS3	uncultured_marine_virus	3.9e-54	33.8
WP_082356819.1\|1313644_1315021_-\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	1.9e-79	63.2
WP_011258802.1\|1315380_1316349_-\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	8.7e-100	60.3
WP_144415638.1\|1316538_1317279_-	hypothetical protein	NA	NA	NA	NA
WP_014502406.1\|1317271_1320208_-	calcium-binding protein	A0A075BS11	Microcystis_phage	1.1e-07	37.2
WP_014502407.1\|1320232_1322770_-	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_014502400.1\|1322780_1323572_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_014502408.1\|1324553_1325633_-	hypothetical protein	NA	NA	NA	NA
WP_014502409.1\|1325629_1327117_-	hypothetical protein	NA	NA	NA	NA
WP_014502411.1\|1328938_1330285_-\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	1.8e-79	56.2
WP_108744467.1\|1330420_1331520_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.4e-44	41.9
WP_153296765.1\|1331610_1332339_-	hypothetical protein	NA	NA	NA	NA
WP_108744468.1\|1332335_1333091_-	calcium-binding protein	NA	NA	NA	NA
WP_014502416.1\|1335401_1337939_-	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_014502417.1\|1337949_1338741_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_011259947.1\|1338737_1340072_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA

DBSCAN-SWA_9

1633616 : 1698914

Staphylococcus_phage(28.57%)

protease,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014502675.1\|1633616_1634633_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	5.6e-49	36.5
WP_041183163.1\|1634924_1635218_-	hypothetical protein	NA	NA	NA	NA
WP_082348501.1\|1635296_1635710_-	DUF2867 domain-containing protein	NA	NA	NA	NA
WP_014502680.1\|1635799_1636021_+	hypothetical protein	NA	NA	NA	NA
WP_161795294.1\|1636066_1636237_+	hypothetical protein	NA	NA	NA	NA
WP_014502683.1\|1636240_1636453_+	hypothetical protein	NA	NA	NA	NA
WP_041183667.1\|1636420_1637407_-	peptidylprolyl isomerase	NA	NA	NA	NA
WP_011259829.1\|1637467_1637701_-	DUF378 domain-containing protein	NA	NA	NA	NA
WP_014502687.1\|1639444_1640302_-	thioredoxin	A0A1J0GW78	Streptomyces_phage	1.0e-11	41.8
WP_014502688.1\|1640506_1641118_+	DUF998 domain-containing protein	NA	NA	NA	NA
WP_014502689.1\|1641190_1643833_+\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	5.5e-173	40.0
WP_041183165.1\|1644347_1644983_+	lipoprotein	NA	NA	NA	NA
WP_014502691.1\|1645005_1646034_+	DNA polymerase III subunit delta	NA	NA	NA	NA
WP_041183166.1\|1646030_1646930_+	nicotinate-nucleotide adenylyltransferase	NA	NA	NA	NA
WP_011259822.1\|1646986_1647403_+	ribosome silencing factor	NA	NA	NA	NA
WP_014502694.1\|1647414_1648530_+	J domain-containing protein	NA	NA	NA	NA
WP_011409102.1\|1649404_1649875_+	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
WP_193388280.1\|1650311_1650926_-	TonB family protein	NA	NA	NA	NA
WP_014502696.1\|1651305_1654419_-	TonB-dependent receptor	NA	NA	NA	NA
WP_014502697.1\|1654885_1655620_-	SIMPL domain-containing protein	NA	NA	NA	NA
WP_014502698.1\|1655758_1656331_+	Maf-like protein	NA	NA	NA	NA
WP_014502699.1\|1656330_1657830_+	ribonuclease G	NA	NA	NA	NA
WP_014502700.1\|1657970_1661891_+	TIGR02099 family protein	NA	NA	NA	NA
WP_041183668.1\|1661896_1662649_-	hypothetical protein	NA	NA	NA	NA
WP_014502702.1\|1662747_1664193_+\|protease	metalloprotease TldD	NA	NA	NA	NA
WP_014502703.1\|1664449_1665031_-	ribosome-associated protein	NA	NA	NA	NA
WP_014502704.1\|1665176_1666544_+\|protease	metalloprotease PmbA	NA	NA	NA	NA
WP_014502705.1\|1666540_1666846_+	hypothetical protein	NA	NA	NA	NA
WP_014502706.1\|1666862_1667051_+	hypothetical protein	NA	NA	NA	NA
WP_014502709.1\|1667636_1668734_-\|protease	protease	NA	NA	NA	NA
WP_014502710.1\|1669198_1670074_-	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_014502711.1\|1670075_1670336_-	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
WP_014502712.1\|1670367_1671672_-\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_014502713.1\|1671705_1673412_-	alkaline phosphatase	NA	NA	NA	NA
WP_014502714.1\|1673554_1674895_+	dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
WP_014502715.1\|1674904_1675741_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_041183169.1\|1675987_1676479_+	acyl-CoA thioesterase	NA	NA	NA	NA
WP_024745355.1\|1676653_1677403_-	C40 family peptidase	A0A0K2SUC1	Clostridium_phage	1.2e-19	38.5
WP_048481665.1\|1677473_1678055_-	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	1.3e-18	40.2
WP_014502720.1\|1678165_1678645_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_041183170.1\|1678872_1680117_+	DUF418 domain-containing protein	NA	NA	NA	NA
WP_014502722.1\|1680124_1681375_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_014502723.1\|1681371_1682742_+	glutathione-disulfide reductase	A0A2K5B2C5	Erysipelothrix_phage	4.6e-38	26.7
WP_014502724.1\|1683082_1686577_+	TAL effector protein Tal3a	NA	NA	NA	NA
WP_144415645.1\|1687062_1688164_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.7e-38	39.0
WP_014502727.1\|1688296_1691785_+	TAL effector repeat-containing protein	NA	NA	NA	NA
WP_014502731.1\|1693271_1693661_+	phage late control D family protein	NA	NA	NA	NA
WP_014502732.1\|1693700_1696988_+	TAL effector protein Tal3c	NA	NA	NA	NA
WP_014502734.1\|1698215_1698914_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA

DBSCAN-SWA_10

2419004 : 2573611

Ralstonia_phage(33.33%)

protease,plate,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048481679.1\|2419004_2420381_-\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	5.4e-79	55.8
WP_014503336.1\|2421040_2421328_-	hypothetical protein	NA	NA	NA	NA
WP_178385908.1\|2421413_2422691_-	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.3e-14	32.2
WP_041183272.1\|2422751_2423366_-	high frequency lysogenization protein HflD	NA	NA	NA	NA
WP_041183273.1\|2423365_2424502_-\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
WP_014503340.1\|2424498_2424957_-	NUDIX hydrolase	NA	NA	NA	NA
WP_014503342.1\|2425207_2425546_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	8.1e-13	46.9
WP_014503343.1\|2425689_2427972_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.3e-175	44.9
WP_002813418.1\|2428248_2428467_-	translation initiation factor IF-1	NA	NA	NA	NA
WP_044751571.1\|2428548_2429301_-\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_014503345.1\|2429434_2430064_-	cinnamoyl-CoA reductase	NA	NA	NA	NA
WP_014503347.1\|2430740_2431862_-	N-acetyltransferase	NA	NA	NA	NA
WP_014503348.1\|2431919_2432888_-	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	4.5e-64	44.5
WP_014503349.1\|2433171_2435529_+	DNA translocase FtsK	G1D482	Mycobacterium_virus	3.3e-84	45.8
WP_014503350.1\|2435691_2437620_+	DUF3857 and transglutaminase domain-containing protein	NA	NA	NA	NA
WP_041183274.1\|2437684_2438356_+	outer membrane lipoprotein chaperone LolA	NA	NA	NA	NA
WP_014503352.1\|2438457_2442624_-	hypothetical protein	NA	NA	NA	NA
WP_014503354.1\|2442860_2444237_+	replication-associated recombination protein A	G3MBE0	Bacillus_virus	2.6e-73	38.1
WP_014503355.1\|2444268_2444595_-	DUF190 domain-containing protein	NA	NA	NA	NA
WP_014503356.1\|2444591_2444999_-	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	7.5e-21	49.1
WP_024710734.1\|2445030_2445381_-	hypothetical protein	NA	NA	NA	NA
WP_014503359.1\|2445377_2446709_-	voltage-gated chloride channel family protein	A0A1X9I5Z9	Streptococcus_phage	3.3e-41	35.2
WP_014503360.1\|2447029_2448235_-	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
WP_014503362.1\|2448392_2450765_-	3-hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase family protein	NA	NA	NA	NA
WP_011259170.1\|2450789_2451422_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_014503363.1\|2451640_2452066_+	nucleoside-diphosphate kinase	A0A167REB2	Powai_lake_megavirus	6.6e-20	42.4
WP_014503364.1\|2452108_2453290_+	23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN	NA	NA	NA	NA
WP_014503365.1\|2453300_2454089_+	type IV pilus biogenesis/stability protein PilW	NA	NA	NA	NA
WP_014503366.1\|2454085_2454946_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_014503367.1\|2455016_2455655_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_041183276.1\|2455654_2456872_+	outer membrane protein assembly factor BamB	NA	NA	NA	NA
WP_014503369.1\|2456882_2458280_+	ribosome biogenesis GTPase Der	NA	NA	NA	NA
WP_014503370.1\|2458594_2459815_+	molybdopterin molybdotransferase MoeA	NA	NA	NA	NA
WP_014503371.1\|2460011_2461070_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	4.7e-67	41.1
WP_076342601.1\|2461395_2462556_-	molybdopterin-synthase adenylyltransferase MoeB	NA	NA	NA	NA
WP_014503373.1\|2462982_2463174_+	hypothetical protein	NA	NA	NA	NA
WP_011258802.1\|2464775_2465744_-\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	8.7e-100	60.3
WP_144415624.1\|2465880_2467200_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_014501311.1\|2467412_2468381_-\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	7.3e-99	60.0
WP_014503375.1\|2468391_2469081_-	DUF1264 domain-containing protein	NA	NA	NA	NA
WP_014501421.1\|2469250_2470219_-\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	4.3e-99	60.0
WP_082350372.1\|2470367_2470757_+	hypothetical protein	NA	NA	NA	NA
WP_014503376.1\|2470695_2471073_-	hypothetical protein	NA	NA	NA	NA
WP_193388294.1\|2471257_2472532_+	molybdopterin molybdotransferase MoeA	NA	NA	NA	NA
WP_024711962.1\|2472569_2473139_+	molybdenum cofactor guanylyltransferase	NA	NA	NA	NA
WP_014503380.1\|2473122_2473485_+	hypothetical protein	NA	NA	NA	NA
WP_012445407.1\|2474866_2475061_-	hypothetical protein	NA	NA	NA	NA
WP_108744446.1\|2475045_2475498_-	hypothetical protein	NA	NA	NA	NA
WP_014503383.1\|2475514_2476492_-	siroheme synthase	NA	NA	NA	NA
WP_014503390.1\|2479002_2479260_+	stress-induced protein	NA	NA	NA	NA
WP_041183281.1\|2479939_2480425_+	ferritin-like domain-containing protein	NA	NA	NA	NA
WP_041183282.1\|2480531_2481452_+	M14 family metallocarboxypeptidase	NA	NA	NA	NA
WP_011258802.1\|2481822_2482791_+\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	8.7e-100	60.3
WP_014503393.1\|2482946_2483537_+	DUF1349 domain-containing protein	NA	NA	NA	NA
WP_041183283.1\|2483799_2485611_-	EAL domain-containing protein	NA	NA	NA	NA
WP_041183284.1\|2485826_2486009_+	hypothetical protein	NA	NA	NA	NA
WP_014503395.1\|2486581_2496004_+	autotransporter-associated beta strand repeat-containing protein	NA	NA	NA	NA
WP_011259043.1\|2496281_2496893_-	response regulator transcription factor	NA	NA	NA	NA
WP_082350463.1\|2496889_2497912_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_014503398.1\|2498030_2499515_-	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_014503399.1\|2499511_2502604_-	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_014503400.1\|2502596_2503712_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_014503402.1\|2504201_2506937_-	S8 family serine peptidase	NA	NA	NA	NA
WP_014503406.1\|2509080_2513187_+	avirulence protein	NA	NA	NA	NA
WP_014503407.1\|2515537_2519026_+	TAL effector protein Tal5b	NA	NA	NA	NA
WP_014503409.1\|2519756_2522591_+	hypothetical protein	NA	NA	NA	NA
WP_041183286.1\|2522621_2523365_+	hypothetical protein	NA	NA	NA	NA
WP_082352981.1\|2525252_2526629_-\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	1.9e-79	63.2
WP_014503414.1\|2527280_2528009_+	hypothetical protein	NA	NA	NA	NA
WP_011258802.1\|2528071_2529040_+\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	8.7e-100	60.3
WP_011258802.1\|2529231_2530200_+\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	8.7e-100	60.3
WP_011258802.1\|2530391_2531360_+\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	8.7e-100	60.3
WP_108744471.1\|2533439_2534504_+	isopenicillin N synthase family oxygenase	NA	NA	NA	NA
WP_144415655.1\|2534906_2535872_+\|transposase	IS1595-like element ISXo5 family transposase	NA	NA	NA	NA
WP_014503417.1\|2536483_2537170_-	hypothetical protein	A0A2K9R7I4	Dishui_lake_phycodnavirus	8.8e-06	28.0
WP_014503420.1\|2540041_2543167_-	multidrug efflux RND transporter permease subunit	NA	NA	NA	NA
WP_014503421.1\|2543218_2544331_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_014503422.1\|2544455_2545034_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_014503424.1\|2546512_2548600_+	hypothetical protein	NA	NA	NA	NA
WP_041183291.1\|2548975_2550067_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_014503426.1\|2550473_2553554_+	hypothetical protein	NA	NA	NA	NA
WP_014503432.1\|2556382_2557159_+	response regulator	NA	NA	NA	NA
WP_014503433.1\|2557155_2558148_+	c-type cytochrome	NA	NA	NA	NA
WP_014503434.1\|2558144_2560604_+	two-component system VirA-like sensor kinase	NA	NA	NA	NA
WP_014503435.1\|2560717_2561698_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_041183293.1\|2561706_2562735_+	type VI secretion system protein TssA	NA	NA	NA	NA
WP_014503436.1\|2562907_2563234_-	hypothetical protein	NA	NA	NA	NA
WP_014503437.1\|2563230_2566134_-	protein kinase	A0A2R8FF19	Brazilian_cedratvirus	2.5e-09	25.0
WP_014503438.1\|2566130_2566853_-	serine/threonine-protein phosphatase	NA	NA	NA	NA
WP_041183294.1\|2566849_2567497_-	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_014503440.1\|2567493_2570952_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_014503441.1\|2570955_2572272_-	type VI secretion system protein TssL	NA	NA	NA	NA
WP_014503442.1\|2572273_2573611_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA

DBSCAN-SWA_11

2579279 : 2650825

Staphylococcus_phage(25.0%)

plate,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014501361.1\|2579279_2580296_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.6e-48	36.2
WP_048481687.1\|2580310_2580748_-	hypothetical protein	NA	NA	NA	NA
WP_014503448.1\|2580936_2583642_-	type VI secretion system ATPase TssH	H6X3M6	Enterobacteria_phage	1.5e-80	29.3
WP_014503449.1\|2583674_2584685_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_014503450.1\|2584648_2586526_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_011259603.1\|2586529_2587033_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_011259604.1\|2587020_2587854_-	hypothetical protein	NA	NA	NA	NA
WP_014503451.1\|2587889_2588393_-	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_041183298.1\|2588492_2590007_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_024711387.1\|2589999_2590506_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_014503453.1\|2591106_2593869_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	1.0e-44	27.5
WP_053077051.1\|2593810_2594716_+	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_041183299.1\|2594734_2597602_+	hypothetical protein	NA	NA	NA	NA
WP_041183300.1\|2597611_2598634_+	hypothetical protein	NA	NA	NA	NA
WP_014503458.1\|2600721_2601753_+	hypothetical protein	NA	NA	NA	NA
WP_041183301.1\|2603844_2604867_+	hypothetical protein	NA	NA	NA	NA
WP_014503466.1\|2608039_2609863_-	hypothetical protein	NA	NA	NA	NA
WP_011408965.1\|2609876_2610476_-	NfuA family Fe-S biogenesis protein	NA	NA	NA	NA
WP_014503467.1\|2610566_2610923_+	4a-hydroxytetrahydrobiopterin dehydratase	NA	NA	NA	NA
WP_014503468.1\|2610919_2611342_+	energy transducer TonB	NA	NA	NA	NA
WP_071162309.1\|2612180_2614004_+	DUF3300 domain-containing protein	NA	NA	NA	NA
WP_014503471.1\|2614036_2615023_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_193388263.1\|2615424_2619147_+	Rne/Rng family ribonuclease	NA	NA	NA	NA
WP_014503473.1\|2619741_2620389_-	response regulator	NA	NA	NA	NA
WP_014503474.1\|2620601_2621363_-	sulfurtransferase	NA	NA	NA	NA
WP_014503475.1\|2621462_2621828_-	hypothetical protein	NA	NA	NA	NA
WP_014503476.1\|2621886_2622318_+	FKBP-type peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_014503477.1\|2622329_2623592_+	TIGR03862 family flavoprotein	NA	NA	NA	NA
WP_014503478.1\|2623575_2624868_-	nucleotide sugar dehydrogenase	NA	NA	NA	NA
WP_193388295.1\|2625354_2626008_+	4'-phosphopantetheinyl transferase superfamily protein	NA	NA	NA	NA
WP_014503480.1\|2626217_2637842_-	amino acid adenylation domain-containing protein	A0A2K9KZV5	Tupanvirus	7.6e-150	26.1
WP_041183304.1\|2647724_2648687_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_153296772.1\|2648700_2648844_-	hypothetical protein	NA	NA	NA	NA
WP_144415658.1\|2649505_2650825_+\|transposase	IS701 family transposase	NA	NA	NA	NA

DBSCAN-SWA_12

2683334 : 2738169

Staphylococcus_prophage(23.08%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014501361.1\|2683334_2684351_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.6e-48	36.2
WP_014503513.1\|2684417_2687486_-	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_041183306.1\|2687482_2690995_-	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	6.8e-110	26.2
WP_014503515.1\|2690991_2692125_-	MexH family multidrug efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_041183307.1\|2692329_2692722_+	c-type cytochrome	NA	NA	NA	NA
WP_014503517.1\|2692730_2693192_+	cytochrome c	NA	NA	NA	NA
WP_053070547.1\|2694967_2695663_+	hypothetical protein	A0A1B1P9F9	Acinetobacter_phage	2.2e-44	45.2
WP_014501268.1\|2695737_2696694_+\|transposase	IS30-like element IS1112a family transposase	Q9MBM9	Staphylococcus_prophage	1.6e-42	36.0
WP_144415659.1\|2696857_2697424_-	hypothetical protein	NA	NA	NA	NA
WP_041183308.1\|2697417_2697783_-	hypothetical protein	NA	NA	NA	NA
WP_108744434.1\|2697901_2698867_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_011258802.1\|2699817_2700786_+\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	8.7e-100	60.3
WP_014502919.1\|2700957_2701914_+\|transposase	IS30-like element IS1112a family transposase	Q9MBM9	Staphylococcus_prophage	1.6e-42	36.0
WP_014503523.1\|2702278_2702785_+	hypothetical protein	NA	NA	NA	NA
WP_041183309.1\|2703047_2704424_+\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	9.2e-79	55.8
WP_082352983.1\|2704566_2705943_+\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	4.9e-80	56.2
WP_014503527.1\|2708193_2709489_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_041183310.1\|2709510_2710257_-	hypothetical protein	NA	NA	NA	NA
WP_014503528.1\|2710297_2712943_-	class III lanthionine synthetase LanKC	NA	NA	NA	NA
WP_144415660.1\|2713106_2713343_-	hypothetical protein	NA	NA	NA	NA
WP_014502919.1\|2713638_2714595_+\|transposase	IS30-like element IS1112a family transposase	Q9MBM9	Staphylococcus_prophage	1.6e-42	36.0
WP_014503529.1\|2714939_2715224_-	BrnA antitoxin family protein	NA	NA	NA	NA
WP_024710328.1\|2715201_2715477_-	BrnT family toxin	NA	NA	NA	NA
WP_014503531.1\|2715611_2715917_-	putative addiction module antidote protein	NA	NA	NA	NA
WP_014503532.1\|2715913_2716057_-	hypothetical protein	NA	NA	NA	NA
WP_014503533.1\|2716107_2716437_+	hypothetical protein	NA	NA	NA	NA
WP_014503534.1\|2716433_2716652_+	hypothetical protein	NA	NA	NA	NA
WP_143703508.1\|2716793_2717138_+	hypothetical protein	NA	NA	NA	NA
WP_014503537.1\|2717420_2717801_+	response regulator	NA	NA	NA	NA
WP_014503538.1\|2718014_2721410_+	PAS domain S-box protein	A0A1V0SGX0	Hokovirus	8.5e-25	27.8
WP_014503539.1\|2722072_2724433_-	RNA-binding transcriptional accessory protein	NA	NA	NA	NA
WP_024710332.1\|2724536_2724764_-	hypothetical protein	NA	NA	NA	NA
WP_041183313.1\|2724953_2726165_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_014503542.1\|2726122_2726467_-	hypothetical protein	NA	NA	NA	NA
WP_014503543.1\|2726607_2726805_-	PspC domain-containing protein	NA	NA	NA	NA
WP_014503544.1\|2726919_2727996_-	class III poly(R)-hydroxyalkanoic acid synthase subunit PhaC	NA	NA	NA	NA
WP_014503545.1\|2727992_2729219_-	class III poly(R)-hydroxyalkanoic acid synthase subunit PhaE	NA	NA	NA	NA
WP_193388264.1\|2729274_2729937_-	CDP-alcohol phosphatidyltransferase family protein	NA	NA	NA	NA
WP_014503547.1\|2730021_2730780_+	3-hydroxybutyrate dehydrogenase	NA	NA	NA	NA
WP_014503548.1\|2731156_2731645_-	8-oxo-dGTP diphosphatase	NA	NA	NA	NA
WP_014503549.1\|2731729_2732239_-	DUF1249 domain-containing protein	NA	NA	NA	NA
WP_011408465.1\|2732444_2733266_-	kinase/pyrophosphorylase	NA	NA	NA	NA
WP_041183314.1\|2733407_2735801_+	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	2.4e-175	36.9
WP_041183315.1\|2735800_2736787_+	mechanosensitive ion channel	NA	NA	NA	NA
WP_014503553.1\|2736999_2737584_-	oligoribonuclease	M4M9I5	Vibrio_phage	2.4e-20	36.8
WP_024710344.1\|2737656_2738169_-\|tRNA	tRNA adenosine(34) deaminase TadA	S4VYT2	Pandoravirus	1.3e-06	41.6

DBSCAN-SWA_13

3055613 : 3063824

Ralstonia_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011258802.1\|3055613_3056582_+\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	8.7e-100	60.3
WP_014503846.1\|3056798_3057524_-	OmpA family protein	G3M9Z0	Bacillus_virus	1.4e-09	33.9
WP_014503849.1\|3057940_3059359_-	deoxyribodipyrimidine photo-lyase	A0A1V0S949	Catovirus	5.1e-48	31.3
WP_014503850.1\|3059461_3060892_-	replicative DNA helicase	O80281	Escherichia_phage	8.5e-120	53.4
WP_014503851.1\|3061112_3061667_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	2.8e-18	39.0
WP_014503852.1\|3061883_3063824_-	asparagine synthase (glutamine-hydrolyzing)	A0A1B1ISV2	uncultured_Mediterranean_phage	2.0e-26	30.5

DBSCAN-SWA_14

3070703 : 3146815

Bacillus_phage(22.22%)

coat,protease,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014503859.1\|3070703_3071534_-\|tRNA	tRNA threonylcarbamoyladenosine dehydratase	NA	NA	NA	NA
WP_014503860.1\|3071606_3072035_+	cytochrome c	NA	NA	NA	NA
WP_014503861.1\|3072166_3072646_+	glycine zipper 2TM domain-containing protein	NA	NA	NA	NA
WP_014503862.1\|3072895_3073111_-	cold-shock protein	A0A1X9IGI9	Lactococcus_phage	6.5e-16	59.7
WP_014503863.1\|3073338_3073824_+	DUF456 domain-containing protein	NA	NA	NA	NA
WP_041183354.1\|3075481_3076615_+	phospholipase A	NA	NA	NA	NA
WP_041183733.1\|3077047_3077500_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_014503870.1\|3077818_3079336_-	fumarate hydratase	NA	NA	NA	NA
WP_014503871.1\|3079672_3081553_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.0e-25	38.5
WP_024711417.1\|3081755_3082535_+	ferredoxin--NADP reductase	NA	NA	NA	NA
WP_014503873.1\|3082685_3083171_-	glutathione peroxidase	A0A1S7DM81	Molluscum_contagiosum_virus	4.8e-14	36.2
WP_024711415.1\|3085627_3085867_-	hypothetical protein	NA	NA	NA	NA
WP_014503876.1\|3086117_3086831_-	hypothetical protein	NA	NA	NA	NA
WP_041183734.1\|3086933_3088034_-	S8 family serine peptidase	NA	NA	NA	NA
WP_108744394.1\|3088451_3089249_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_041183355.1\|3090532_3091033_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_014503883.1\|3091099_3091933_-	DUF3298 and DUF4163 domain-containing protein	NA	NA	NA	NA
WP_048481690.1\|3091983_3092298_-	N-acetyltransferase	NA	NA	NA	NA
WP_011259018.1\|3092481_3092670_+	hypothetical protein	NA	NA	NA	NA
WP_014503886.1\|3093084_3093693_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_014503888.1\|3094894_3096673_+	M14 family metallopeptidase	NA	NA	NA	NA
WP_041183736.1\|3096801_3098991_+	glycoside hydrolase family 3 C-terminal domain-containing protein	NA	NA	NA	NA
WP_014503890.1\|3099568_3100231_+	DUF2884 family protein	NA	NA	NA	NA
WP_014503892.1\|3101942_3103520_-	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_014503893.1\|3103526_3104720_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_193388297.1\|3104730_3106203_-	AdeC/AdeK/OprM family multidrug efflux complex outer membrane factor	NA	NA	NA	NA
WP_024710314.1\|3106244_3106685_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_041183356.1\|3106807_3107659_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_014503897.1\|3107719_3109963_+	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	5.5e-81	34.6
WP_024710311.1\|3110446_3110983_-	bacterioferritin	NA	NA	NA	NA
WP_014503899.1\|3111078_3113499_+	penicillin acylase family protein	NA	NA	NA	NA
WP_014503900.1\|3114047_3116174_+	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_014503902.1\|3116604_3117657_+	right-handed parallel beta-helix repeat-containing protein	NA	NA	NA	NA
WP_014503903.1\|3117725_3119420_-	asparagine synthase B	A0A0P0C1V4	Ostreococcus_lucimarinus_virus	1.6e-88	39.0
WP_041183358.1\|3119714_3120845_-	succinyl-diaminopimelate desuccinylase	NA	NA	NA	NA
WP_082352989.1\|3120849_3121212_-	GNAT family N-acetyltransferase	A0A1X9I687	Streptococcus_phage	1.2e-14	39.0
WP_014503906.1\|3121351_3121708_-	Spx/MgsR family RNA polymerase-binding regulatory protein	NA	NA	NA	NA
WP_041183359.1\|3121704_3122175_-	hypothetical protein	NA	NA	NA	NA
WP_014503908.1\|3122171_3123368_-	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	NA	NA	NA	NA
WP_041183360.1\|3123384_3125994_-	[protein-PII] uridylyltransferase	NA	NA	NA	NA
WP_014503910.1\|3125990_3126767_-	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_082356805.1\|3127058_3127610_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_041183361.1\|3127618_3128389_+	molecular chaperone	NA	NA	NA	NA
WP_014503913.1\|3128405_3130757_+	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_014503914.1\|3130753_3131788_+\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
WP_024710302.1\|3131834_3132167_+	hypothetical protein	NA	NA	NA	NA
WP_041183362.1\|3132169_3132895_+	molecular chaperone	NA	NA	NA	NA
WP_011258701.1\|3133286_3134090_+	30S ribosomal protein S2	NA	NA	NA	NA
WP_014503916.1\|3134259_3135138_+	elongation factor Ts	NA	NA	NA	NA
WP_024710301.1\|3135413_3136937_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	5.3e-19	36.0
WP_014503919.1\|3137043_3137766_+	UMP kinase	NA	NA	NA	NA
WP_011258697.1\|3137946_3138504_+	ribosome recycling factor	NA	NA	NA	NA
WP_041183363.1\|3138521_3139283_+	di-trans,poly-cis-decaprenylcistransferase	R9W0U9	Flavobacterium_phage	1.0e-15	32.6
WP_014503921.1\|3139279_3140107_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_014503922.1\|3140109_3141300_+	1-deoxy-D-xylulose-5-phosphate reductoisomerase	NA	NA	NA	NA
WP_014503923.1\|3141326_3142673_+\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_014503924.1\|3142756_3145123_+	outer membrane protein assembly factor BamA	NA	NA	NA	NA
WP_014503925.1\|3145822_3146815_-\|transposase	IS5 family transposase	Q38213	Escherichia_phage	8.3e-98	56.7

DBSCAN-SWA_15

3621909 : 3645122

Acidithiobacillus_phage(37.5%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_108744408.1\|3621909_3622893_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-76	56.6
WP_108744407.1\|3623069_3627551_+	RHS repeat protein	NA	NA	NA	NA
WP_011408064.1\|3627556_3627925_+	hypothetical protein	NA	NA	NA	NA
WP_041183418.1\|3628047_3629424_+\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	5.4e-79	55.8
WP_082353003.1\|3629566_3630943_+\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	1.2e-78	55.8
WP_041183419.1\|3630992_3632369_+\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	5.4e-79	55.8
WP_014504332.1\|3632432_3632828_+	type I toxin-antitoxin system SymE family toxin	NA	NA	NA	NA
WP_014504333.1\|3632926_3634261_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_003490678.1\|3634253_3634931_-	response regulator transcription factor	Q6XM27	Feldmannia_irregularis_virus	7.4e-05	27.4
WP_014504334.1\|3635008_3635398_-	hypothetical protein	NA	NA	NA	NA
WP_014504335.1\|3635610_3636528_-	30S ribosomal protein S6--L-glutamate ligase	A0A1D7SR78	Cyanophage	6.9e-30	31.7
WP_014504336.1\|3637002_3639135_+	glycogen debranching protein GlgX	NA	NA	NA	NA
WP_011409118.1\|3641565_3641958_-	H-NS histone family protein	NA	NA	NA	NA
WP_011258802.1\|3642527_3643496_+\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	8.7e-100	60.3
WP_014504341.1\|3644165_3645122_-\|transposase	IS30-like element IS1112a family transposase	Q9MBM9	Staphylococcus_prophage	3.7e-42	36.0

DBSCAN-SWA_16

3975280 : 3981652

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014504627.1\|3975280_3976627_+	phosphomannomutase/phosphoglucomutase	A0A127AWJ1	Bacillus_phage	2.0e-33	26.9
WP_014504628.1\|3976674_3978078_+	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	3.8e-48	29.8
WP_014504629.1\|3978194_3979103_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.8e-27	34.7
WP_014504630.1\|3979099_3979657_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	6.6e-44	47.5
WP_014504631.1\|3979653_3980541_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	2.0e-95	58.5
WP_014504632.1\|3980596_3981652_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	1.2e-83	47.7

DBSCAN-SWA_17

4123842 : 4287842

Acidithiobacillus_phage(24.0%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014504763.1\|4123842_4124811_+\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	1.1e-97	59.3
WP_014504764.1\|4125157_4126753_-	APC family permease	NA	NA	NA	NA
WP_014504766.1\|4127462_4128239_-	response regulator transcription factor	NA	NA	NA	NA
WP_041183796.1\|4128235_4129531_-	histidine kinase	Q9EYF3	Enterobacteria_phage	7.0e-20	31.4
WP_014504769.1\|4129841_4131056_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_014504772.1\|4133360_4133741_+	response regulator	NA	NA	NA	NA
WP_014504773.1\|4133734_4133977_-	hypothetical protein	NA	NA	NA	NA
WP_014504774.1\|4133976_4135257_-	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_041183480.1\|4135790_4136072_+	hypothetical protein	NA	NA	NA	NA
WP_014504776.1\|4136372_4137782_+	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_014504777.1\|4137772_4138789_+	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_014504780.1\|4140584_4141748_+	glutathione-dependent formaldehyde dehydrogenase	E3SJ82	Synechococcus_phage	3.6e-07	26.6
WP_014504781.1\|4141832_4141997_-	hypothetical protein	NA	NA	NA	NA
WP_014504784.1\|4142712_4142934_+	hypothetical protein	NA	NA	NA	NA
WP_014504786.1\|4143356_4143569_-	hypothetical protein	NA	NA	NA	NA
WP_014504787.1\|4143907_4144645_+	DUF3348 domain-containing protein	NA	NA	NA	NA
WP_041183481.1\|4144655_4147313_+	DUF802 domain-containing protein	NA	NA	NA	NA
WP_014504789.1\|4147309_4147984_+	OmpA family protein	NA	NA	NA	NA
WP_014504790.1\|4147980_4148646_+	DUF2894 domain-containing protein	NA	NA	NA	NA
WP_014504791.1\|4148730_4150872_-	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_014504792.1\|4150961_4152230_-	DUF3526 domain-containing protein	NA	NA	NA	NA
WP_041183482.1\|4152229_4153666_-	DUF3526 domain-containing protein	NA	NA	NA	NA
WP_014504794.1\|4153676_4154399_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	5.2e-17	28.1
WP_014504795.1\|4154610_4158306_+	avirulence protein	NA	NA	NA	NA
WP_014501268.1\|4160557_4161514_+\|transposase	IS30-like element IS1112a family transposase	Q9MBM9	Staphylococcus_prophage	1.6e-42	36.0
WP_024712399.1\|4161798_4162317_-	hypothetical protein	NA	NA	NA	NA
WP_048481603.1\|4162478_4165304_+	bifunctional [glutamate--ammonia ligase]-adenylyl-L-tyrosine phosphorylase/[glutamate--ammonia-ligase] adenylyltransferase	NA	NA	NA	NA
WP_014504801.1\|4165399_4165960_-	VUT family protein	A0A2I7SAW6	Vibrio_phage	6.7e-12	30.2
WP_041183483.1\|4169252_4169762_-	hypothetical protein	NA	NA	NA	NA
WP_041183800.1\|4170670_4171618_-	mitochondrial fission ELM1 family protein	NA	NA	NA	NA
WP_014504809.1\|4171752_4172343_+	malonic semialdehyde reductase	NA	NA	NA	NA
WP_014504810.1\|4172553_4173297_+	polyisoprenoid-binding protein	NA	NA	NA	NA
WP_014504811.1\|4173889_4174972_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	7.3e-39	38.6
WP_014504812.1\|4175378_4178066_+	pyruvate dehydrogenase (acetyl-transferring), homodimeric type	NA	NA	NA	NA
WP_041183484.1\|4178924_4180301_-\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	8.3e-80	56.2
WP_082352891.1\|4180350_4181727_-\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	5.4e-79	55.8
WP_041183485.1\|4182215_4182512_-	hypothetical protein	NA	NA	NA	NA
WP_082352919.1\|4184174_4185551_-\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	1.9e-79	63.2
WP_041183486.1\|4185693_4187070_-\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	8.3e-80	56.2
WP_041183487.1\|4187119_4188496_-\|transposase	IS5-like element ISXo4 family transposase	K4ICS3	Acidithiobacillus_phage	1.2e-78	62.8
WP_153296776.1\|4188579_4188729_+	hypothetical protein	NA	NA	NA	NA
WP_144415676.1\|4188768_4189155_-	hypothetical protein	NA	NA	NA	NA
WP_014501311.1\|4189349_4190318_+\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	7.3e-99	60.0
WP_144415677.1\|4190470_4190818_+	hypothetical protein	NA	NA	NA	NA
WP_014504817.1\|4190881_4196926_-	hemagglutinin repeat-containing protein	NA	NA	NA	NA
WP_014504818.1\|4196925_4197312_-	hemagglutinin	NA	NA	NA	NA
WP_014504819.1\|4197648_4197912_+	type I toxin-antitoxin system SymE family toxin	NA	NA	NA	NA
WP_161798570.1\|4198294_4198462_+	hypothetical protein	NA	NA	NA	NA
WP_082350324.1\|4202853_4203357_-	CdiI family contact-dependent growth inhibition immunity protein	NA	NA	NA	NA
WP_193388270.1\|4203361_4211815_-	hemagglutinin repeat-containing protein	NA	NA	NA	NA
WP_014504825.1\|4212144_4212423_+	type I toxin-antitoxin system SymE family toxin	NA	NA	NA	NA
WP_014504827.1\|4212947_4224188_-	hemagglutinin repeat-containing protein	A0A0R6PJK4	Moraxella_phage	1.2e-38	35.5
WP_041183807.1\|4224209_4225952_-	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_014504829.1\|4229164_4230133_+\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	8.7e-100	60.3
WP_014502919.1\|4230324_4231281_+\|transposase	IS30-like element IS1112a family transposase	Q9MBM9	Staphylococcus_prophage	1.6e-42	36.0
WP_041182992.1\|4231312_4232260_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.1e-45	36.6
WP_012444053.1\|4232776_4233061_-	hypothetical protein	NA	NA	NA	NA
WP_014504831.1\|4233645_4234923_+	lytic murein transglycosylase	NA	NA	NA	NA
WP_082356811.1\|4235677_4237054_-\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	8.3e-80	56.2
WP_011258802.1\|4237786_4238755_+\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	8.7e-100	60.3
WP_014504839.1\|4239758_4241006_-	ABC transporter permease	NA	NA	NA	NA
WP_014504840.1\|4241002_4242310_-	ABC transporter permease	NA	NA	NA	NA
WP_082352899.1\|4242322_4243117_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_041183490.1\|4243091_4243973_-	hypothetical protein	NA	NA	NA	NA
WP_144415679.1\|4244094_4245414_-\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_014504847.1\|4247833_4248772_-	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_014504848.1\|4248890_4249679_-	DUF3800 domain-containing protein	A0A1W6JTE9	Pseudomonas_phage	1.0e-53	44.0
WP_178385965.1\|4249642_4250455_-	ABC transporter permease	NA	NA	NA	NA
WP_014504850.1\|4250451_4251447_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.1e-25	30.2
WP_076342635.1\|4251483_4252311_+	ferredoxin--NADP reductase	NA	NA	NA	NA
WP_014504852.1\|4252394_4253384_-	CDF family Co(II)/Ni(II) efflux transporter DmeF	NA	NA	NA	NA
WP_011407380.1\|4253449_4253722_+	metal/formaldehyde-sensitive transcriptional repressor	NA	NA	NA	NA
WP_041183817.1\|4254208_4254796_+	hypothetical protein	NA	NA	NA	NA
WP_011257320.1\|4254792_4254993_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_014504855.1\|4255053_4256655_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_014504856.1\|4256686_4257433_+	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	4.0e-20	27.3
WP_014504857.1\|4257429_4258623_+	ABC transporter permease	NA	NA	NA	NA
WP_014504858.1\|4259021_4260032_-	energy transducer TonB	NA	NA	NA	NA
WP_014504862.1\|4261748_4262762_-	cupin-like domain-containing protein	NA	NA	NA	NA
WP_014504865.1\|4265020_4265710_+	glutathione S-transferase N-terminal domain-containing protein	NA	NA	NA	NA
WP_014504866.1\|4266133_4268371_+	S9 family peptidase	NA	NA	NA	NA
WP_076342545.1\|4270950_4271133_+	hypothetical protein	V9IQN0	Stenotrophomonas_phage	1.9e-08	48.4
WP_024711291.1\|4271968_4272289_-	hypothetical protein	NA	NA	NA	NA
WP_014504870.1\|4272481_4274356_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	1.8e-37	35.5
WP_011257505.1\|4274465_4274906_-\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
WP_014504871.1\|4274904_4275921_+	lauroyl acyltransferase	NA	NA	NA	NA
WP_014504872.1\|4276120_4276642_-	N-acetyltransferase	NA	NA	NA	NA
WP_014504873.1\|4276888_4278022_+	GTP cyclohydrolase II RibA	A0A2H4PQS2	Staphylococcus_phage	7.9e-28	44.2
WP_044751426.1\|4278133_4278643_+	PH domain-containing protein	NA	NA	NA	NA
WP_014504875.1\|4278639_4280145_+	PH domain-containing protein	NA	NA	NA	NA
WP_024711286.1\|4280310_4281369_-	UDP-N-acetylglucosamine 2-epimerase	NA	NA	NA	NA
WP_014504877.1\|4281369_4282194_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_014504878.1\|4282391_4283669_-	O-antigen ligase family protein	NA	NA	NA	NA
WP_014504879.1\|4283833_4285555_-	glycosyltransferase family 39 protein	NA	NA	NA	NA
WP_014504880.1\|4285605_4286919_-	16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB	NA	NA	NA	NA
WP_014504881.1\|4286918_4287842_-\|tRNA	methionyl-tRNA formyltransferase	NA	NA	NA	NA

DBSCAN-SWA_18

4449075 : 4532380

Bacillus_phage(28.57%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014501311.1\|4449075_4450044_-\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	7.3e-99	60.0
WP_014505035.1\|4450774_4451695_-	SPOR domain-containing protein	NA	NA	NA	NA
WP_014505036.1\|4451704_4452433_-	type III pantothenate kinase	NA	NA	NA	NA
WP_048481616.1\|4452429_4453446_-	bifunctional biotin--[acetyl-CoA-carboxylase] ligase/biotin operon repressor BirA	NA	NA	NA	NA
WP_024711521.1\|4453752_4454064_+	hypothetical protein	NA	NA	NA	NA
WP_041183830.1\|4454072_4454828_+	zinc-dependent peptidase	NA	NA	NA	NA
WP_014505040.1\|4454980_4456165_-	DUF1501 domain-containing protein	NA	NA	NA	NA
WP_014505041.1\|4456284_4457874_-	DUF1800 domain-containing protein	NA	NA	NA	NA
WP_024711525.1\|4457994_4459365_-	two-component sensor histidine kinase	NA	NA	NA	NA
WP_002808458.1\|4459439_4460123_-	response regulator transcription factor	NA	NA	NA	NA
WP_193388273.1\|4460194_4460554_-	hypothetical protein	NA	NA	NA	NA
WP_014505044.1\|4460833_4461838_-\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
WP_014505045.1\|4462304_4462529_-	hypothetical protein	NA	NA	NA	NA
WP_014505047.1\|4463250_4463826_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_024711527.1\|4463884_4465390_-	catalase	A0A2K9L0T1	Tupanvirus	2.2e-97	48.0
WP_014505052.1\|4466865_4468998_-	ATP-dependent DNA helicase DinG	NA	NA	NA	NA
WP_041183508.1\|4469459_4469858_-	hypothetical protein	NA	NA	NA	NA
WP_014505056.1\|4469847_4470699_-	shikimate dehydrogenase	NA	NA	NA	NA
WP_041183509.1\|4470751_4471633_+	PD40 domain-containing protein	NA	NA	NA	NA
WP_041183510.1\|4472297_4474832_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_041183511.1\|4475064_4475817_+	DNA/RNA non-specific endonuclease	H6X497	Enterobacteria_phage	2.5e-22	33.8
WP_014505060.1\|4475944_4476859_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_014505063.1\|4478131_4479124_-	porphobilinogen synthase	NA	NA	NA	NA
WP_048481730.1\|4479342_4479546_-	hypothetical protein	NA	NA	NA	NA
WP_014505066.1\|4479794_4480265_+	hypothetical protein	NA	NA	NA	NA
WP_014505071.1\|4483007_4483886_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_014505072.1\|4484022_4484454_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_108744432.1\|4484671_4484863_-	hypothetical protein	NA	NA	NA	NA
WP_014505074.1\|4485131_4486163_-	methionine synthase	NA	NA	NA	NA
WP_041183513.1\|4486190_4487174_-	DUF1852 domain-containing protein	NA	NA	NA	NA
WP_011409673.1\|4487316_4487910_-	FMN reductase	NA	NA	NA	NA
WP_014505076.1\|4488099_4489014_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_011260641.1\|4489013_4489679_+	epoxyqueuosine reductase QueH	NA	NA	NA	NA
WP_087770666.1\|4489946_4490831_+	methylenetetrahydrofolate reductase	NA	NA	NA	NA
WP_041183514.1\|4491529_4492264_+	response regulator	W8CYM9	Bacillus_phage	5.1e-28	32.7
WP_014505081.1\|4492315_4493167_-	formyltetrahydrofolate deformylase	NA	NA	NA	NA
WP_014505082.1\|4493385_4493778_-	hypothetical protein	NA	NA	NA	NA
WP_014505083.1\|4494131_4495010_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_014505084.1\|4495047_4496166_-	NADH:flavin oxidoreductase/NADH oxidase	NA	NA	NA	NA
WP_014505085.1\|4496224_4497106_-	NAD-dependent protein deacetylase	A0A068EPD4	Bacillus_phage	1.1e-13	22.7
WP_014505088.1\|4497999_4499280_-	MFS transporter	NA	NA	NA	NA
WP_014505089.1\|4499376_4500264_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_014505092.1\|4501135_4501948_-	TatD family hydrolase	NA	NA	NA	NA
WP_014505093.1\|4502379_4502838_+	hypothetical protein	NA	NA	NA	NA
WP_041183833.1\|4503015_4505523_-	S9 family peptidase	NA	NA	NA	NA
WP_014501361.1\|4506959_4507976_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.6e-48	36.2
WP_014505098.1\|4507985_4508909_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_144415693.1\|4510600_4510963_+	type VI secretion protein	NA	NA	NA	NA
WP_014505102.1\|4511019_4514406_+	TAL effector protein Tal10	NA	NA	NA	NA
WP_144415682.1\|4515945_4517265_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_014505107.1\|4517668_4518625_-\|transposase	IS30-like element IS1112a family transposase	Q9MBM9	Staphylococcus_prophage	4.8e-42	36.0
WP_014505110.1\|4520327_4523822_-	TAL effector repeat-containing protein	NA	NA	NA	NA
WP_014505114.1\|4525735_4529329_-	TAL effector protein Tal11a	NA	NA	NA	NA
WP_144415694.1\|4529387_4529750_-	type VI secretion protein	NA	NA	NA	NA
WP_144415626.1\|4531060_4532380_+\|transposase	IS701 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_017267

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection