CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_011206	Acidithiobacillus ferrooxidans ATCC 53993, complete genome	3 crisprs	csa3,WYL,RT,Cas9_archaeal,DEDDh,cas3,PrimPol,DinG	0	0	9	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_011206_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_011206_1

141692-141780

Orphan

Consensus_repeat	Method
TGTTAGCCCACACCCACGCGGGGGCAAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_011206_1

>merge|NC_011206|1|141692-141780|CRISPRCasFinder
TGTTAGCCCACACCCACGCGGGGGCAAGGGCATCAGTTTCCTCCTCACTGCCTTCGCTTTCTGTTAGCCCACACCCACGCGGGGGCAAG

>NC_011206|1|1|141692-141780|CRISPRCasFinder
TGTTAGCCCACACCCACGCGGGGGCAAG	GGCATCAGTTTCCTCCTCACTGCCTTCGCTTTC
TGTTAGCCCACACCCACGCGGGGGCAAG

Protein	Signature genes	Signature genes Name	Protein_function
NC_011206.1\|WP_012535832.1\|147045_148416_-\|divalent-metal-cation-transporter	unknown	unknown	gnl\|CDD\|224826
NC_011206.1\|WP_012535819.1\|131808_133446_-\|hypothetical-protein	unknown	unknown	unknown
NC_011206.1\|WP_155115447.1\|137516_137990_-\|winged-helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|379282
NC_011206.1\|WP_049756708.1\|130606_131524_-\|hypothetical-protein	unknown	unknown	unknown
NC_011206.1\|WP_012535798.1\|140710_141025_+\|DDE-transposase-family-protein	unknown	unknown	gnl\|CDD\|227720
NC_011206.1\|WP_012535827.1\|141846_143166_+\|NAD(P)-binding-protein	unknown	unknown	gnl\|CDD\|366721
NC_011206.1\|WP_012535829.1\|144896_146084_-\|carbohydrate-porin	unknown	unknown	gnl\|CDD\|335962
NC_011206.1\|WP_012535820.1\|133472_135074_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379756
NC_011206.1\|WP_012535817.1\|129169_129664_+\|single-stranded-DNA-binding-protein	unknown	unknown	gnl\|CDD\|136097
NC_011206.1\|WP_012535831.1\|146834_147035_-\|hypothetical-protein	unknown	unknown	unknown
NC_011206.1\|WP_012535836.1\|149932_151354_+\|FAD-dependent-pyridine-nucleotide-disulfide-oxidoreductase	unknown	unknown	gnl\|CDD\|184298
NC_011206.1\|WP_155115419.1\|144498_144630_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|214772
NC_011206.1\|WP_012535828.1\|143185_144202_+\|NAD-dependent-epimerase/dehydratase-family-protein	unknown	unknown	gnl\|CDD\|187539
NC_011206.1\|WP_012535816.1\|128216_129107_+\|DNA-adenine-methylase	unknown	unknown	gnl\|CDD\|223415
NC_011206.1\|WP_012535824.1\|138281_138935_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|375435
NC_011206.1\|WP_012535799.1\|139269_140589_+\|ISAs1-family-transposase	unknown	unknown	gnl\|CDD\|372975
NC_011206.1\|WP_012535830.1\|146113_146818_-\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
NC_011206.1\|WP_012535821.1\|135070_136750_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|379165
NC_011206.1\|WP_080515392.1\|149430_149919_+\|organomercurial-transporter-MerC	unknown	unknown	gnl\|CDD\|237490
NC_011206.1\|WP_012535834.1\|148973_149381_-\|Hg(II)-responsive-transcriptional-regulator	unknown	unknown	gnl\|CDD\|131106

Protein	Function_ID	Function_description	E-value
NC_011206.1\|WP_080515392.1\|149430_149919_+\|organomercurial-transporter-MerC	gnl\|CDD\|237490	PRK13755, PRK13755, organomercurial transporter MerC.	2.63769e-72
NC_011206.1\|WP_012535816.1\|128216_129107_+\|DNA-adenine-methylase	gnl\|CDD\|223415	COG0338, Dam, Site-specific DNA methylase [DNA replication, recombination, and repair].	1.21448e-46
NC_011206.1\|WP_155115447.1\|137516_137990_-\|winged-helix-turn-helix-domain-containing-protein	gnl\|CDD\|379282	pfam13592, HTH_33, Winged helix-turn helix. This helix-turn-helix domain is often found in transferases and is likely to be DNA-binding.	8.42733e-09
NC_011206.1\|WP_012535832.1\|147045_148416_-\|divalent-metal-cation-transporter	gnl\|CDD\|224826	COG1914, MntH, Mn2+ and Fe2+ transporters of the NRAMP family [Inorganic ion transport and metabolism].	3.32403e-51
NC_011206.1\|WP_012535798.1\|140710_141025_+\|DDE-transposase-family-protein	gnl\|CDD\|227720	COG5433, COG5433, Transposase [DNA replication, recombination, and repair].	0.00432979
NC_011206.1\|WP_012535827.1\|141846_143166_+\|NAD(P)-binding-protein	gnl\|CDD\|366721	pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase. This family consists of various amine oxidases, including maze polyamine oxidase (PAO) and various flavin containing monoamine oxidases (MAO). The aligned region includes the flavin binding site of these enzymes. The family also contains phytoene dehydrogenases and related enzymes. In vertebrates MAO plays an important role regulating the intracellular levels of amines via there oxidation; these include various neurotransmitters, neurotoxins and trace amines. In lower eukaryotes such as aspergillus and in bacteria the main role of amine oxidases is to provide a source of ammonium. PAOs in plants, bacteria and protozoa oxidase spermidine and spermine to an aminobutyral, diaminopropane and hydrogen peroxide and are involved in the catabolism of polyamines. Other members of this family include tryptophan 2-monooxygenase, putrescine oxidase, corticosteroid binding proteins and antibacterial glycoproteins.	2.1493e-18
NC_011206.1\|WP_012535829.1\|144896_146084_-\|carbohydrate-porin	gnl\|CDD\|335962	pfam04966, OprB, Carbohydrate-selective porin, OprB family.	1.19826e-25
NC_011206.1\|WP_012535820.1\|133472_135074_-\|hypothetical-protein	gnl\|CDD\|379756	pfam15978, TnsD, Tn7-like transposition protein D. TnsD is a family of putative Tn7-like transposition proteins type D.	2.22864e-28
NC_011206.1\|WP_012535817.1\|129169_129664_+\|single-stranded-DNA-binding-protein	gnl\|CDD\|136097	PRK06863, PRK06863, single-stranded DNA-binding protein; Provisional.	3.30033e-60
NC_011206.1\|WP_012535836.1\|149932_151354_+\|FAD-dependent-pyridine-nucleotide-disulfide-oxidoreductase	gnl\|CDD\|184298	PRK13748, PRK13748, putative mercuric reductase; Provisional.	0
NC_011206.1\|WP_155115419.1\|144498_144630_+\|hypothetical-protein	gnl\|CDD\|214772	smart00671, SEL1, Sel1-like repeats. These represent a subfamily of TPR (tetratricopeptide repeat) sequences.	1.93675e-07
NC_011206.1\|WP_012535828.1\|143185_144202_+\|NAD-dependent-epimerase/dehydratase-family-protein	gnl\|CDD\|187539	cd05228, AR_FR_like_1_SDR_e, uncharacterized subgroup of aldehyde reductase and flavonoid reductase related proteins, extended (e) SDRs. This subgroup contains proteins of unknown function related to aldehyde reductase and flavonoid reductase of the extended SDR-type. Aldehyde reductase I (aka carbonyl reductase) is an NADP-binding SDR; it has an NADP-binding motif consensus that is slightly different from the canonical SDR form and lacks the Asn of the extended SDR active site tetrad. Aldehyde reductase I catalyzes the NADP-dependent reduction of ethyl 4-chloro-3-oxobutanoate to ethyl (R)-4-chloro-3-hydroxybutanoate. The related flavonoid reductases act in the NADP-dependent reduction of flavonoids, ketone-containing plant secondary metabolites. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	2.45693e-60
NC_011206.1\|WP_012535824.1\|138281_138935_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|375435	pfam17929, TetR_C_34, Tetracyclin repressor-like, C-terminal domain. TetR family regulators are involved in the transcriptional control of multidrug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity. The TetR proteins identified in overm ultiple genera of bacteria and archaea share a common helix-turn-helix (HTH) structure in their DNA-binding domain. However, TetR proteins can work in different ways: they can bind a target operator directly to exert their effect (e.g. TetR binds Tet(A) gene to repress it in the absence of tetracycline), or they can be involved in complex regulatory cascades in which the TetR protein can either be modulated by another regulator or TetR can trigger the cellular response. TetR regulates the expression of the membrane-associated tetracycline resistance protein, TetA, which exports the tetracycline antibiotic out of the cell before it can attach to the ribosomes and inhibit protein synthesis. TetR blocks transcription from the genes encoding both TetA and TetR in the absence of antibiotic. The C-terminal domain is multi-helical and is interlocked in the homodimer with the helix-turn-helix (HTH) DNA-binding domain. This entry represents the C-terminal domain present in putative TetR family transcriptional regulators found in bacteria.	5.469e-14
NC_011206.1\|WP_012535799.1\|139269_140589_+\|ISAs1-family-transposase	gnl\|CDD\|372975	pfam14236, DUF4338, Domain of unknown function (DUF4338). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 206 and 475 amino acids in length.	5.28673e-47
NC_011206.1\|WP_012535830.1\|146113_146818_-\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	1.31333e-50
NC_011206.1\|WP_012535821.1\|135070_136750_-\|AAA-family-ATPase	gnl\|CDD\|379165	pfam13401, AAA_22, AAA domain.	5.22357e-11
NC_011206.1\|WP_012535834.1\|148973_149381_-\|Hg(II)-responsive-transcriptional-regulator	gnl\|CDD\|131106	TIGR02051, Mercuric_resistance_operon_regulatory_protein, Hg(II)-responsive transcriptional regulator. This model represents the mercury (II) responsive transcriptional activator of the mer organomercurial resistance operon. This protein is a member of the MerR family of transcriptional activators (pfam00376) and contains a distinctive pattern of cysteine residues in its metal binding loop, Cys-X(8)-Cys-Pro, as well as a conserved and critical cysteine at the N-terminal end of the dimerization helix. [Cellular processes, Detoxification, Regulatory functions, DNA interactions].	3.56962e-68

>NC_011206.1|WP_012535798.1|140710_141025_+|DDE-transposase-family-protein
MKDGTLREDCAFGLTSLTKDRTTPENLLGIARGHWEIENRNHHVRDTTYHEDLSQIRTENGPHMMATLRGLAMSILRLIGVKNIAQAGRDFAASARKTLRQFGY
>NC_011206.1|WP_012535799.1|139269_140589_+|ISAs1-family-transposase
MEASTLTSHQQASLHRIEVRPILPTERERWNTLMQAHHYRGFRTMAGRTLRYVATLDDRWVALLGWQAAAYQCQAREQWIGWSWVLRRQRLHLIANNARFLILPRESFPNLASRILSLNLRRLSADWQSVYGHPIVLAETFVESPRFTGACYRAANWVDVGWTKGFARRPGAGYVYHGQPKRLLLYPLHPQARIWLAQPQPQSEWTKTPMQTVTLSDAQMEGLRQIFFRLPDARSRLGKQHPLPAILTIAVAAVLTQAQSYIAMAEWAARLTQAQLKRIRARFNPRTQRYVAPSEPTLRRVLQGANVTALDAAIGAWLLGIAGFEAVAVDGKVLKGAVREDGSQVHLLSAFMHGQGATIAQKEIARKTNEIPELRSLLKDVDIQDKVVTADALHTQRKTARFLVEDKKADYLFTAVKGNQRKLRNSLICLPWGDFPPQR
>NC_011206.1|WP_012535824.1|138281_138935_+|TetR/AcrR-family-transcriptional-regulator
MQKARKARAAPDKQERRESILKAAEEVLPLGGPLPLIASISVAAHLTQGALYRYFSSKEEIYATLLEREMGFLLEHIKQLIAVHYGSPAAIADGIADGITRYCLEHTKTFYLASLSPAILEANTQEAFARQLKRELATEVRTIATALVEAIPSLHFASAVDLLLTSHALIIGLWQVAYPPAVIERILQEEETKVLRIDLDNTLSTAMHSLWRGWIYE
>NC_011206.1|WP_155115447.1|137516_137990_-|winged-helix-turn-helix-domain-containing-protein
MGAARELLRSAKTAEELRRAQAVLLPLDLGLSLEQTARAIGRSVNATCAIRTRFAKIAEGVIEPPRAKTALRNHALADLEHEASILDEVLADTQKGGIVVIPQLKPLIEEKVGKPMALSTVYRMLARHGWRKLAPDTYHPQGDAERREVWKKNCPKP
>NC_011206.1|WP_012535821.1|135070_136750_-|AAA-family-ATPase
MLTGSKEQAVYTPSEDPMYRHNPFIEALPPVLPMEKVASLLRRHPVYHQSERELAASKRLEAVQRIANYVEPLPIFLELEQRFSRMLRNGYSPRNPISAEWIKQLRSGFPDLDWDRGKPDYQPLVRSTAAGFAIIGTSGVGKTTAVESVLSLYAQQIQHSGKYGGHALDRVQLVWLKLECPQDGSLRGLCLNFFQAVDEIVGTRYYPKFGNNRRRSVDELLPEMANVAAVLGLGVLVIDEIQRLNEASSGGAAKMLNFFGQMVNQFSVPVVLVGTFKALPLLSGEFAQARRSAGQGDLVWSNLPQDDVWDFFIEGVWHYQWTKSETPLTPTIRNALYQESQGIVDIAVKLYMLAQWAVIGQEDETISPELIGDVARDSLQLARPILEALKKRDLAALGRIKDIMPPISDLEQYLRGARERVTLEGTLDTMKAQRVAQQQNAHKEPDEILMRVAEVLLEAGFPVDMAHQCAAEALKQHADETELAPVIKDALLRAVGVRPPSRGTKRNPSRKDQHQETQKPAVGKVLAEMINARKGEITPHQALNNAGVIKPIEEFWTNK
>NC_011206.1|WP_012535820.1|133472_135074_-|hypothetical-protein
MIAFFPEPYPDELLYSICARYHIMSRNNDFRHTVEDLFGCRQACAVYDFPSRLAALCGRLPRGSSHTPVSLIRNHTLFPLYQPFLTDNSAGKIAKDMVASDQGGTIHCSIGVMASSIKSPRFLRYCPVCKESDITEFGEPYWHRAHQIANLRACHRHGSPLSDSDAVISAPVNKHAFIALDYNPVIRTGNPSHGKLEMHITVANAVSWILQNNLPTLGFGRIVHAYHRFLKLRGLITCEGHVRQEAFRQTFLNYYGEEFLQEVGCPLVNGGHQGWLAAMVRKRRNSAHPLHHLLLIQWLCSTPEVFYRACLQIQPEIVVPNLLNLSGIHAQHHQPVSTAADREASEISKGAALVQNSPLGKRRREWLAIVRRSSGICRKQLRAANQAAFGWLYRNDHDWLYDHLPAPLPRSKGQDLRVDWDRRDQYLANEVRRSAQVILSEARPKQVTVTAIGTHIGCRTLIRRHLDKMPVTADELRQWVESTEQFQMRRLDIVACRLQSEAVELKSWRLVRVAGLRPGYSPTVAARIQDLVG
>NC_011206.1|WP_012535819.1|131808_133446_-|hypothetical-protein
MARKLLIADWPFGQGELATLHWLRSPYMAGDDRGWCVDAVFRGVESGKSHDISLPWGMLPYLRLGMLFENGRPKTRSADAGQISIVRLFNDAKFGLRRVGGVVLKNLYPLDTQINLDELCIKVENNDQIMLVPCIEIARSFFAQSRFLSYALLQPDSFSDFVRAWHSDGKVTLEFSSFIPKNMIKSDFIISVAKILFDQDWSDRWRAVWSRRAAKALKIEDKNYPKLECWPPVGQNSSWKVRGVTWNNRLLVLEILGTKYRGNLPFHEIEYSHPRLKKGILGDERSVSGSKPVSEDAEDETLVENVASSPSHLDRPIVLYTERAEHRCLTVVTPQSVREKVVVINKLTGGSDRTSSTGDMGTKAIRPVSLQDEGSCGDVDAGEFTGGDKSGEPPNFKKLITAMECVQEAHLRLQFEYQIGLAGSRIGGGDAEPIEYLLITLKYADATGYILDVDQSTGQGISTVVFELVKPDVVVDKIVRKLVDDCIAANGFLSKELLNGQTERIRYALAKHTQTDGYEYGLRLVRKLPGIMKQMGELSVSFGGW
>NC_011206.1|WP_049756708.1|130606_131524_-|hypothetical-protein
MATAHLTVSIQHYSSTGVRVKFLSIQHYYFFLEGEKFQLVDYKKIASIQLFFIYTIAEDFRVRFGQPLDAESLNQSHQIIIVAASLDEHTERIVSYLSKRDIPINVLCFQVFQNGEEQILSRSWLLDPAMTQISAATSLERDKEPWNGEFYVSFGDGPSRSWKDAVEYGFICAGGGTWYSRTLQLLNPGDRIWVKAPGFGFVGVGVVTGEVRPIKDFMVTTGHGDAHVYDVAKGGSYHWEYADDPERCEYFVPVKWLQTVPAEQGVQGVGLFGNQNSVCKPTTPKWRYTVDQLKLKFPSYSRDGD
>NC_011206.1|WP_012535817.1|129169_129664_+|single-stranded-DNA-binding-protein
MAGVNKVILLGHLGRDPEMRYMPDGTAVANMTIATSESYKDRDGNRQERTEWHRVALFARTAEVAGEFLRKGSQAYIEGRIRTRKWTDKDGQERYSTEIVGDRLQLIGGRCDGADGGNPAPQHGGGGGGDMGAAPMEEFDDDIPFITKAETIFQPRWRLPRVRF
>NC_011206.1|WP_012535816.1|128216_129107_+|DNA-adenine-methylase
MSVHPPFPWLGGKGKLADQILARLPEPSRELTYVEPFFGGGAVFFARRPSGIEVINDANGEIVTFFRVLRDRTDELIRYLQNTPYSRQLFYEWRAIPDPASLSDLERAARFFYIARSAFAAESTRKNPAWAFAKVFDNKARSMAAVIDSELRLVRDRLRYALIENDDAIAVVRRFDSPSAVIYCDPPYLQATRRDGQYADEMSDQDHENLLRVLCACDAYVAISGYPSDLYSDHLESGQGWSFVDFAHSCHANRSGRAGEDIDRDRTERIWMNPRLTQWYERHAPRQCSLLDLCAV
>NC_011206.1|WP_012535827.1|141846_143166_+|NAD(P)-binding-protein
MKTVAVVGSGASGVASAFALQAAGYQVVMLEATKNLGGRMGDAYLGDRRIDFGGKNIGRNYPLFRQFAETQLPVHYEFFGINSASVRNGRLYRIDSESRLKTLLNMVDLIGPMNFLRIARLAWAVRRDPENAFLGGPYFRRVAQRYDHAPMSTYFGDQCLRHLLRPMTVRMNGAEPDEYYLGNIGSNIKMILDRYDQIKEGLHTVLDAFFESITVMRETVVDGLLMDGKRVVGLRATQRGKSVDKFYDGVVVGVPAHEGARMLPEALSPLRDLLNGINYHPVAVAVVQYDRPVFPDHTRAVVFSDDHIVSNAGAYGAEDRNIVRYTFSGRAFRENISVTTPIEEMLAMAEADLSPFFPDCKQPRLAFVYRYFQTGLCAYGPYHSQFLDSVDSHLSAVSGLALAGDYIRGGSIEACFRAGYEAAERLGAVFRPETLRTAL
>NC_011206.1|WP_012535828.1|143185_144202_+|NAD-dependent-epimerase/dehydratase-family-protein
MDTVLVTGANGHLGYNLTQQLVERGYRVRAGVRDFTSKTKTRDLVTLGAEITHVDITRPETLSAAMKDVQGLFHVAAVYETISRNPGRDVKQPTIVGTINTLQAAHAAGVQKVVLTSSATTAGNDASLEAPLDESRWNKDAIEPYVQAKTSAERWAWEFATRNHFNLVAILPSAMIGPGFRRHTPTTRIFEELLRNRVPVVLPLGFSFVDVRDVATAHVLAYENPTAAGRYIASARFCELAELFTLVCNVDPTVVIPTRRLPERLLPVVPLLDWIGHRFAGTPRAISCAFVKEYGHREAHFTSARAERELGWMARDFSVSVRDTLSWIKTELLPAGAA
>NC_011206.1|WP_155115419.1|144498_144630_+|hypothetical-protein
MPRNAQGAFNLAFAYNFGEGVPQNTHKAVYWWQQSAKDRHRPS
>NC_011206.1|WP_012535829.1|144896_146084_-|carbohydrate-porin
MNRFLSCRRLACWATGLLMVLPAVSASAAPTGIPAATHASLSSLPLSAAFLPAYQQWFDGLAWAAHIDTETVSNLVGGIAPGTVAILVGHAGFSYHTARAGLWTGGKFTLNVLGIESGNPEDRVGDVQGVSNLYARSQFRLYRLTFRQHLGPATLRLGLMSANDYFDVTGQAAQLINSSFGITPTLSGNIPGMATYPYSGLGVMTAVHGGAWEAKAGWYQGDPIHPFSDPFGQGDMALAELDYRNTKQERTYVLKLGAWHYQQRAIYNAVLGPRTSGLYAVAEYAEPLPRGRRLGLFLQAGSTPQSVNLIPYYLGAGFRVKGLLPGRGADVFSMGMTRAWLRNAPYPAETACEITYAAQVVPHIFLQPDLQWVVHPGGLYPNALVAGLSLHVQLF
>NC_011206.1|WP_012535830.1|146113_146818_-|MgtC/SapB-family-protein
MTPQVPNLILTAEDLLLAFVLGALIGIERQWRQRTAGLRTNTLVAVGAAIFVDLALRMGGSAEAIRVVAYVVSGVGFLGAGTIMKEGANVRGLNTAATLWGSAAVGACAGAEQWLPAILAAGFVISANTLLRPVVNRINRAPLSETGTELNYTFSLIVPRGQEAALLDILSEKLETAGYPVRDLRMHPFGQSETEMHAILLPSSVDGEVLDRLSAQFSQMPQVRQAFWNQSAGE
>NC_011206.1|WP_012535831.1|146834_147035_-|hypothetical-protein
MHHKEDFHAAPTQDFLAFFEEETHLEPQPLTRAPVRGWIQVAFWGLRIYIVVMLVMVAIGFARGIH
>NC_011206.1|WP_012535832.1|147045_148416_-|divalent-metal-cation-transporter
MSAIPETPAAPTEADLLQHLPEDARQRIQDRWRVYQLRHHPSWWRRLLLFLSLIGPGILVMIADNDAGGVITYAQTGAMYGIGFFIPFLLLMIPVAYVVQEMTVRLGAVTHRGHAEMIWGRYGAFWGVFSLLDLTVANILTLVTEFIGIRVGMSIFSVPPIISVPVAWVFVASIMIFLHYSTWERLALWIAAGNIIFVPLAIAAHPDWSRVVAAVGNWHIPAGAALGAFTYVILANLGTTVAPWMLFFEQSSVVDKGLTVNDIPSGQADTAIGSLSMGIIAIAIVVLTGTLVYGHADAVNFDIQAILRILRQSSLGSIGTALFALGLVEAGLIAAIAITASTSWAVGEALKLPRSLNLKPQRALPFYLSGILSAGMAAMVVLIPHIPLGFLNLTVQVIASIFMPAAMLFLLMLLNDRDIMGSYINRPWQNYAAFAIVGFLILANGLYGYTVVFPSS
>NC_011206.1|WP_012535834.1|148973_149381_-|Hg(II)-responsive-transcriptional-regulator
MKLLTIGALAASAGVHVETVRFYQRKGLLPEPDRLPGSIRRYGQSDLERLHFVKSAKGLGFSLEEIGQLLKLADGTHCREAAELASRHLASVQARLRELHRIEYALQKQLEACKSQQGNFSCPLIDSLRELKTVS
>NC_011206.1|WP_080515392.1|149430_149919_+|organomercurial-transporter-MerC
MPNIAHSHSTISAKEGKVNNILMSRILDKTGVLGTVVSGLSCAMCFPALASIGAAVGLGFLSRWEGLFVHTLIPVFLVIALLANGLGWFAHHQWQRSALGCVGPVVALFGDQGMTQHFLPVEMARILFYTGLVIMVIVAIWDMFRPVHKHCPVPSGDNQSHC
>NC_011206.1|WP_012535836.1|149932_151354_+|FAD-dependent-pyridine-nucleotide-disulfide-oxidoreductase
MSQKIFLRITGMTCAHCAHSVEKALLGIHGIDSAQVSLATNQAEVFLQSSIPTEALLAAVTQAGYGAKVEQDSLQVQARSTQEPGQPHIAIIGSGGAAMAAALKAVERGARVTLIERGTIGGTCVKVGCVPSKILIRAAHIAHLRRASPFDAGIAAQEPVIRRDRLLAQQQGRVDELRYAKYEGILAQTPAISVLRGEATFQNAQTLSVVLADGGVHELRFDRCLIATGASPAIPPLPGLADTPYWTSTEALASETIPERLVVIGASVVAVELAQAFARLGSKVTILARSVLLSHEDPAIGEAITSAFRAEGIHVLEHTQPNRADYNDGQFLLTTGNGHLRADRLLIATGRAPNTHSLNLAAVGVEVNAHGAIVIDKTMRTSAPYIRDLKRRLDGGQRKLLANVRNTTGSYIIQHEEVAQLQLGEQVVHTARFSAFYTDRQAPRRYVAHGEPRFIAFLTALATSFFQTARNGP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_011206_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_011206_2

1120281-1120359

Orphan

Consensus_repeat	Method
GGGCGATTCGTTTCACCTCCTCCGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_011206_2

>merge|NC_011206|2|1120281-1120359|CRISPRCasFinder
GGGCGATTCGTTTCACCTCCTCCGCCGCCACCGCGCGTACCCATGGGTATGCCGGGGCGATTCGTTTCACCTCCTCCGC

>NC_011206|2|2|1120281-1120359|CRISPRCasFinder
GGGCGATTCGTTTCACCTCCTCCGC	CGCCACCGCGCGTACCCATGGGTATGCCG
GGGCGATTCGTTTCACCTCCTCCGC

Protein	Signature genes	Signature genes Name	Protein_function
NC_011206.1\|WP_012536521.1\|1130425_1131016_+\|DedA-family-protein	unknown	unknown	gnl\|CDD\|223659
NC_011206.1\|WP_012536513.1\|1122070_1122802_+\|phosphate-regulon-transcriptional-regulatory-protein-PhoB	unknown	unknown	gnl\|CDD\|131209
NC_011206.1\|WP_009562915.1\|1110844_1111057_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378935
NC_011206.1\|WP_009561020.1\|1119705_1119942_+\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133411
NC_011206.1\|WP_009566434.1\|1117918_1118560_+\|c-type-cytochrome	unknown	unknown	gnl\|CDD\|225418
NC_011206.1\|WP_012536517.1\|1126311_1127166_+\|phosphate-ABC-transporter-permease-PstA	unknown	unknown	gnl\|CDD\|183065
NC_011206.1\|WP_012536509.1\|1116455_1117904_+\|hypothetical-protein	unknown	unknown	unknown
NC_011206.1\|WP_012536506.1\|1111840_1112662_-\|UDP-2,3-diacylglucosamine-diphosphatase	unknown	unknown	gnl\|CDD\|277343
NC_011206.1\|WP_012536510.1\|1118633_1119602_-\|cation-transporter	unknown	unknown	gnl\|CDD\|224151
NC_011206.1\|WP_080513192.1\|1112857_1113148_+\|DUF2934-domain-containing-protein	unknown	unknown	gnl\|CDD\|378572
NC_011206.1\|WP_012536520.1\|1128660_1130172_+\|Ppx/GppA-family-phosphatase	unknown	unknown	gnl\|CDD\|223326
NC_011206.1\|WP_012536514.1\|1122863_1124192_+\|phosphate-regulon-sensor-histidine-kinase-PhoR	unknown	unknown	gnl\|CDD\|274368
NC_011206.1\|WP_012536512.1\|1120694_1121951_+\|DEAD/DEAH-box-helicase	unknown	unknown	gnl\|CDD\|236722
NC_011206.1\|WP_012536519.1\|1127944_1128658_+\|phosphate-signaling-complex-protein-PhoU	unknown	unknown	gnl\|CDD\|182974
NC_011206.1\|WP_080513211.1\|1125325_1126315_+\|phosphate-ABC-transporter-permease-subunit-PstC	unknown	unknown	gnl\|CDD\|183070
NC_011206.1\|WP_012536507.1\|1113342_1114479_+\|glycosyltransferase-family-1-protein	unknown	unknown	gnl\|CDD\|340842
NC_011206.1\|WP_012536505.1\|1110491_1110764_-\|DUF1778-domain-containing-protein	unknown	unknown	gnl\|CDD\|226860
NC_011206.1\|WP_012536515.1\|1124261_1125281_+\|phosphate-ABC-transporter-substrate-binding-protein-PstS	unknown	unknown	gnl\|CDD\|182837
NC_011206.1\|WP_012536508.1\|1114512_1115727_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340844
NC_011206.1\|WP_012536518.1\|1127165_1127933_+\|phosphate-ABC-transporter-ATP-binding-protein-PstB	unknown	unknown	gnl\|CDD\|182692

Protein	Function_ID	Function_description	E-value
NC_011206.1\|WP_012536521.1\|1130425_1131016_+\|DedA-family-protein	gnl\|CDD\|223659	COG0586, DedA, Uncharacterized membrane-associated protein [Function unknown].	1.10931e-29
NC_011206.1\|WP_012536513.1\|1122070_1122802_+\|phosphate-regulon-transcriptional-regulatory-protein-PhoB	gnl\|CDD\|131209	TIGR02154, PhoB, phosphate regulon transcriptional regulatory protein PhoB. PhoB is a DNA-binding response regulator protein acting with PhoR in a 2-component system responding to phosphate ion. PhoB acts as a positive regulator of gene expression for phosphate-related genes such as phoA, phoS, phoE and ugpAB as well as itself. It is often found proximal to genes for the high-affinity phosphate ABC transporter (pstSCAB; GenProp0190) and presumably regulates these as well. [Regulatory functions, DNA interactions, Signal transduction, Two-component systems].	2.51037e-100
NC_011206.1\|WP_009562915.1\|1110844_1111057_-\|hypothetical-protein	gnl\|CDD\|378935	pfam12728, HTH_17, Helix-turn-helix domain. This domain is a DNA-binding helix-turn-helix domain.	0.0054491
NC_011206.1\|WP_012536507.1\|1113342_1114479_+\|glycosyltransferase-family-1-protein	gnl\|CDD\|340842	cd03814, GT4-like, glycosyltransferase family 4 proteins. This family is most closely related to the GT4 family of glycosyltransferases and includes a sequence annotated as alpha-D-mannose-alpha(1-6)phosphatidyl myo-inositol monomannoside transferase from Bacillus halodurans. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in bacteria and eukaryotes.	1.35492e-113
NC_011206.1\|WP_009566434.1\|1117918_1118560_+\|c-type-cytochrome	gnl\|CDD\|225418	COG2863, COG2863, Cytochrome c553 [Energy production and conversion].	2.5152e-13
NC_011206.1\|WP_012536517.1\|1126311_1127166_+\|phosphate-ABC-transporter-permease-PstA	gnl\|CDD\|183065	PRK11268, pstA, phosphate ABC transporter permease PstA.	7.8051e-131
NC_011206.1\|WP_012536506.1\|1111840_1112662_-\|UDP-2,3-diacylglucosamine-diphosphatase	gnl\|CDD\|277343	cd07398, MPP_YbbF-LpxH, Escherichia coli YbbF/LpxH and related proteins, metallophosphatase domain. YbbF/LpxH is an Escherichia coli UDP-2,3-diacylglucosamine hydrolase thought to catalyze the fourth step of lipid A biosynthesis, in which a precursor UDP-2,3-diacylglucosamine is hydrolyzed to yield 2,3-diacylglucosamine 1-phosphate and UMP. YbbF belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	5.85975e-70
NC_011206.1\|WP_012536510.1\|1118633_1119602_-\|cation-transporter	gnl\|CDD\|224151	COG1230, CzcD, Co/Zn/Cd efflux system component [Inorganic ion transport and metabolism].	5.04158e-90
NC_011206.1\|WP_080513192.1\|1112857_1113148_+\|DUF2934-domain-containing-protein	gnl\|CDD\|378572	pfam11154, DUF2934, Protein of unknown function (DUF2934). This bacterial family of proteins has no known function.	2.85998e-08
NC_011206.1\|WP_012536520.1\|1128660_1130172_+\|Ppx/GppA-family-phosphatase	gnl\|CDD\|223326	COG0248, GppA, Exopolyphosphatase [Nucleotide transport and metabolism / Inorganic ion transport and metabolism].	2.98293e-127
NC_011206.1\|WP_080513211.1\|1125325_1126315_+\|phosphate-ABC-transporter-permease-subunit-PstC	gnl\|CDD\|183070	PRK11275, pstC, phosphate ABC transporter permease PstC.	2.99531e-136
NC_011206.1\|WP_012536512.1\|1120694_1121951_+\|DEAD/DEAH-box-helicase	gnl\|CDD\|236722	PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional.	0
NC_011206.1\|WP_012536519.1\|1127944_1128658_+\|phosphate-signaling-complex-protein-PhoU	gnl\|CDD\|182974	PRK11115, PRK11115, phosphate signaling complex protein PhoU.	8.75393e-88
NC_011206.1\|WP_012536508.1\|1114512_1115727_+\|glycosyltransferase	gnl\|CDD\|340844	cd03817, GT4_UGDG-like, UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.	7.19548e-99
NC_011206.1\|WP_012536505.1\|1110491_1110764_-\|DUF1778-domain-containing-protein	gnl\|CDD\|226860	COG4453, COG4453, Uncharacterized protein conserved in bacteria [Function unknown].	8.63195e-28
NC_011206.1\|WP_009561020.1\|1119705_1119942_+\|MerR-family-transcriptional-regulator	gnl\|CDD\|133411	cd04784, HTH_CadR-PbrR, Helix-Turn-Helix DNA binding domain of the CadR and PbrR transcription regulators. Helix-turn-helix (HTH) CadR and PbrR transcription regulators including Pseudomonas aeruginosa CadR and Ralstonia metallidurans PbrR that regulate expression of the cadmium and lead resistance operons, respectively. These proteins are comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the C-terminal domains have three conserved cysteines which form a putative metal binding site. Some members in this group have a histidine-rich C-terminal extension. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements.	1.5091e-33
NC_011206.1\|WP_012536515.1\|1124261_1125281_+\|phosphate-ABC-transporter-substrate-binding-protein-PstS	gnl\|CDD\|182837	PRK10918, PRK10918, phosphate ABC transporter substrate-binding protein PstS.	3.08552e-126
NC_011206.1\|WP_012536514.1\|1122863_1124192_+\|phosphate-regulon-sensor-histidine-kinase-PhoR	gnl\|CDD\|274368	TIGR02966, Phosphate_regulon_sensor_protein_PhoR, phosphate regulon sensor kinase PhoR. Members of this protein family are the regulatory histidine kinase PhoR associated with the phosphate ABC transporter in most Proteobacteria. Related proteins from Gram-positive organisms are not included in this model. The phoR gene usually is adjacent to the response regulator phoB gene (TIGR02154). [Signal transduction, Two-component systems].	9.34204e-163
NC_011206.1\|WP_012536518.1\|1127165_1127933_+\|phosphate-ABC-transporter-ATP-binding-protein-PstB	gnl\|CDD\|182692	PRK10744, pstB, phosphate ABC transporter ATP-binding protein PstB.	0

>NC_011206.1|WP_009561020.1|1119705_1119942_+|MerR-family-transcriptional-regulator
MQIGALGQTSGVSPDTIRYDERMGLLSPPGRRANGYRVYGPAHLERPAFVCHCRDLDMPLADIQRLLHLLDHPMEGDV
>NC_011206.1|WP_012536510.1|1118633_1119602_-|cation-transporter
MAHDHTDHTESPHTHAPPHDHGHHHGAHGHAPVNGRAFAIGIGLNLSFVLTEAVFGVLGHSLALLADAGHNLSDVLGLLMAWGASALANRPPSGRFTYGLRSSSILAALANAVFLLVVTGGIAWEAIERLLHPASVASVVVIGVAAFGVVINTGTALLFLSGRKGDLNIRAAFLHMAGDAAISFGVVVAGIVMLFTHWFWLDSAASLLISALIVMATWGLLRDSAHLALHGVPPGIDTDAVRVYLLGIPNVTAVHDLHIWAMSTTETALTAHLVMPDGYPGDALLHEIGEELRAHFQIVHPTLQVETGDPGHPCKLAGEHLV
>NC_011206.1|WP_009566434.1|1117918_1118560_+|c-type-cytochrome
MYPVLSSSRFAPSQKKGVICTAAVALAILSAGPALAQVPQSVHQSCMICHGQTGENTIYPMVPRLSGQQVQYLAWQLKQFKAHTRADQNAQIYMWPVAQAMSQKEIQSVAKYYAAQSPMHSASSPRPGVSAGKQIFLQGVAAQGVPACMACHAVNATGRGIFPRLAGQRYAYIVQQLTYLHDGNRVNPIMQPVAEKLTNRQMREVAAYLSGLH
>NC_011206.1|WP_012536509.1|1116455_1117904_+|hypothetical-protein
MKIESRSSMQWKHKIRWATCATFMVGVAACSGNAWALPTFARQTGWSCATCHTSYPQLTPMGRMFKLLGYTSNNVQRQQKLEAKFGKSTALLLMRVSQFSIFFQASYANVAGGQAAFNGAGVSNPPGNQNDIQFPQQVSLFYAGEITPHIGAFLHLTYSGRGGFGMDDSDIRWAHPWNLGPDQLLITGVEVNNTPTEPDIYNTVPDWYAPFSSSKYSAIRQIPTTFIEGAHGAGYPLAGIGTYEAYIFGQDKANWLYFEADGYTNADGIGVQANSGGAFGYANDGRMQGVAPYVRLAYQRDWGNWNWEVGTYGMWSRLYDSPNTKGGPVDSFDDFDLDSQLQWLDTTDNSNVTLHADWIHEDQGFGAFGGPTSNLSSTATGHLNSLNINGSYWYHDHYGVSGGYLDTWGSANPDLWGTSYSHNGSPDTNGEWIEASYLPWWNTRFSLRYTMFNQFRGLTNSTATSFGASAYNTLELLTWISF
>NC_011206.1|WP_012536508.1|1114512_1115727_+|glycosyltransferase
MRILMLSDTYFPRISGVATSIRSFRRGLQGLGHTVDLLVPDYGSSVPNDDSGIMRVPAWKTGFYPEERLMWPWALLRMSRELAARRYDLLHVQTPFAAHYMGTHLARRLEIPVLSSYHTYFEAYIGHYYAGIPKILRQALARIPSRQQCQAVDGVIVPSMAMANVLWGYGVNTPIRVIPTGIDLTVQTTGDRSAFRDRHGIAADRLVLLYAGRIAPEKNIALLLEVVGHLRAIFPDILLLLAGDGPFRESLEQQVVEKDLTEQVRFLGYLDHDTDLRDAYAAADLLVFASETETQGMVLLEALAAGLPLVAIAAMGAADFVTSGRGTRPAPAQASGFAEVCAGILSNDMLRARMAQEARQLATQWTEPAMAERLQAFYAVAVAGGKSASNPAGTSSAPHRTSSR
>NC_011206.1|WP_012536507.1|1113342_1114479_+|glycosyltransferase-family-1-protein
MTETAMRVTLVTETYPPEINGVAITLGRAVEALQARGHEVTLIRPRQAGESPSPGLMPALPLFFYRQVRIGCATPITLQRWLRDWGSEIVHIATEGPLGLAALIAARRLHIPAVTSFHTNFDQYAAHYGLSLLGHGARIYLRAFHNAGKLTLVPSQSTLDRLQAQGFQQLRRWGRGVDTVRFHPQWRDDALRESLGLGPEGRLLLYVGRLAPEKNLTPLITAFRTLRRNGLTAVLVLVGDGPLRPGFSRLSQEGILCVGMQQGMDLARWYASADLFCFPSCSETFGNVVLEAEASGLPILAYDCPGVNEQVSDAVHGLLLPPGSDWAPMLQLLSKDSGLRQKFGAAGRLRAESQSWVHSFDVLEAAYREQLGSEPAPP
>NC_011206.1|WP_080513192.1|1112857_1113148_+|DUF2934-domain-containing-protein
MTLRYRPSTDIQENAMTSMHETPDSHEQVPFSPVPLPETPASVAAPMMSDPELRHHRIAEAAYFLAEQKGFPADQAEACWLAAEQDIDREGLAAER
>NC_011206.1|WP_012536506.1|1111840_1112662_-|UDP-2,3-diacylglucosamine-diphosphatase
MPPHTAPKNAEEPLGVFCRAIFISDIHLGTRGCQAEALLSFLRHYHCEYLYLVGDILDLWQLKRRWYWPPAHNTVVQKILRLARHGVQVRYVRGNHDPVFEMLSDLVPVEGERILLGDIQIVDSCVHETADGRRLWVIHGDQFDVTMRYAPWLTRLGDHGYTLLLFINRRYQWAIRRIGLHSRWSLSATIKRRVKQAVQFIGDYEQVLAQACRREGYEGVICGHIHHAEIKEIEGILYHNDGDWVESCTALVEHATGRLELVHWDEESQVSLH
>NC_011206.1|WP_009562915.1|1110844_1111057_-|hypothetical-protein
MEVVHLNQQQLAARWHLSEACLERWRSEGIGPKFMKLKGRVLYRQVDIEAYEKSCLATSTKTAEAQTSAG
>NC_011206.1|WP_012536505.1|1110491_1110764_-|DUF1778-domain-containing-protein
MRAAAINLRALPEQRDLIDHAANLLGKNRSDFMLEAACERAQSVLLDQVFFGLDAEKFRQFTAMLDAPPRGNEGLERLMAVKAPWESNQA
>NC_011206.1|WP_012536512.1|1120694_1121951_+|DEAD/DEAH-box-helicase
MSSFESLGLSEPIWRAAAERGYTSPTPIQEQAIPVVMSGVDLLAGAQTGTGKTAAFAMPILHKLAVTAGSASRAPSSVRALILVPTRELAAQVEASVQLYGRYLPLRSLVLIGGVKINPQMQKLRRSVDILVATPGRLLDHIQQRSVDLSHVEILVLDEADRMLDMGFIRDIRRILAVLPKKRQNLLFSATFSPEIRGLADGLLNNPTSVEVAARNATADNVAQRVFAVDQDRKRELLSHLIEEHQWGQVLVFTRTKHGADRLARHLSQDGMQAMAIHGDKSQGARTRALAEFKEGKVQVLVATDIAARGIDISELPHVVNFELPHVPEDYVHRIGRTGRAGNNGQAVSLVSSEERKQLQDVEKLLRRSFDREIVIGFEPRQSFSGHAPSAAARRPAQAAGRGRPGSGAVPSGRARRA
>NC_011206.1|WP_012536513.1|1122070_1122802_+|phosphate-regulon-transcriptional-regulatory-protein-PhoB
MDEDKVSSRVLVVEDEEGIQELLRVTLQRNGFDVRCEGSVESAEAVLQTWGPQLLVLDWMLPGKNGLAWCRMLRRREETRKLPIILLTARGEEGDRVHGLESGADDYLAKPFSPRELVARVNALLRRSYGGTAAGRVRLGGLQVDLRAHRVYADEVQVHLGPTEFRLLRLFVTNPERVFSRDMLLDQIWGRQSFVEERTVDVHIRRLRRGLEHHGYAQIIETVRGEGYRCSALGFQREVVDER
>NC_011206.1|WP_012536514.1|1122863_1124192_+|phosphate-regulon-sensor-histidine-kinase-PhoR
MKYLRAWFYPLALWALIPIFLAADDLHAWSYLPLVIIAFLLALWVGWHRQQSLSFSAWFRNPSTSLPPLAGGMWEETFAEGYHWRRDQEAQHRQLSAQIVQLRDALQAMPDVVVLMDERGQLLWVNPSGIRLLQLQWPDDAGKPLAFWLRTPHLRAFLAGEGPPSLQLPAPADAQQILEGMRYPLADAGALVIFRDVTRIRQLEQVRQDFVANVSHELRSPLTVVRGFLENMLDSPIAADDEVSSQLRLMEQQTLRMQSLVEDLLSLARMEAAEANPEHCETLMIAAMIHNTLDTLAPAIVQKRLQIDTALDGDLGIFAETIDLTSIIRNLLENAIKYTPADRTVSVRWERRSGDLRLVVQDTGDGIAAEHLQRITERFYRVDKGRSRRMGGTGLGLAIVRHAVERYQGYLEVASEVGKGTTFTAHFPLHLARSFPSDSAVS
>NC_011206.1|WP_012536515.1|1124261_1125281_+|phosphate-ABC-transporter-substrate-binding-protein-PstS
MKIKGVAFVLGVMSLGVAGLAQAETISAAGGTAIYPVLSKWAETYKQKTGIMVNYQAIGSGGGIAQIKAKTVAFANSDMPLQPEYLNKDQLVQFPAVIIGITPVVNVPGIKPGELTFNGAVLTGIYLGKIKKWNDAAIADLNKGVHLPDMNITVVHRSDGSGTTFNFTNYLAKVSPEWKQRVGDNTAVSWPVGVGGKGNAGVAAYVQRIPGAIGYVEYAYAKENHMAYGKMINAAGKVVAPDLATFQAAAANADFTKVEDFYVILTNQPGAQSWPISAATYILMRQDAHKTVNAGVLKFARWFLTAPQAQAEARGLDYVPLPKTTVTQIEAYWKRNLGQ
>NC_011206.1|WP_080513211.1|1125325_1126315_+|phosphate-ABC-transporter-permease-subunit-PstC
MAATVPSPAVPSRINPARSRRLHAMDRRFRWLTAGLAFLVLLLLVGVALSLFLRGWEAFHRFGFAFFWSDSWDPVTENFGALVPIYGTLVSSLIALLIAVPISFGIALFISELAPEWLRQPVGSAIELLAGIPSIIFGMWGLFVFAPVLGSAEPWLNDHLGALPAVGALFRGPPMGIGMLTAGIILAIMVIPFISAIMRDVFLVVPALLKESAYGLGATTWEVARHVVLPYTRTAVVGGVFLGLGRALGETMAVTFVIGNAHDLHISLLDAGNSIAAALANEFAEAFSPMYKSALMALGFILFIITFVVLVLAKLMLWRLGQGQGKVGL
>NC_011206.1|WP_012536517.1|1126311_1127166_+|phosphate-ABC-transporter-permease-PstA
MNTARNARYLRRRFWNIFNLGMAMATTLFGLFWLVWILWTTLSYGAGALNLELFTGDTPAPGSIGGLRNAFVGSLLMIGVAVMIGTPVGILAGTYLAEFAQGSRLAAVIRFFNDILLSAPSIVIGLFIYAVVVVPMGSFSGLAGALSLAILLLPVVLRTTDEMLGMVPGTMREAALALGAPHWKMIVQVSYRAARSGILTGVLLAVARISGETAPLLFTALSNQFFSTNLDKPIANVPVVIFQFAMSPYPEWQHLAWAGALIAAMAVLVLSLVSRFLIKDRSPR
>NC_011206.1|WP_012536518.1|1127165_1127933_+|phosphate-ABC-transporter-ATP-binding-protein-PstB
MSEPQKTKISVRHLDFFYGSNKALIDINLEIPENQVTAFIGPSGCGKSTLLRVFNRMYSLYPGQRATGEVLLDGENILAPGMDVNMLRAKIGMVFQKPTPFPMSIYDNIAFGIKLYEKLRKVEMDERVEQALRHAALWEEVKDKLKTSGLGLSGGQQQRLCIARAVAVKPEVILLDEPTSALDPIATLKIEELVSELQNQFTILIVTHNMQQAARVSDYTAFMYMGEMVEFDSTHQLFTNPSKKQTEDYITGRYG
>NC_011206.1|WP_012536519.1|1127944_1128658_+|phosphate-signaling-complex-protein-PhoU
MDKEPHISQRFDEELHEVHALVLAMGGVVEEQITNAIKALQEPDAELAREVIGRDHEVNGYEVRIEEECINILATRQPAASDLRLVMTLIKTIADLERMGDKASKIADMALAMGHGARNDNPAFLRDVGVMADYALNMLRRAMDALARADAEEAIAVAKGDEVLNQEYRSALRRLITYMMEDPRTITPAIDALFIAKAIERIGDHARNICEYVIYLAKGKSVRHLPLDEVEQSIQGK
>NC_011206.1|WP_012536520.1|1128660_1130172_+|Ppx/GppA-family-phosphatase
MAESAATAGLENFLAAVDLGSNSFHMVVAEEIGSDIRLHDRLREGVRLAEGLRDDGSLDPEVEKRALDCLARFGQRLRGIRPERVRVIGTNTLRQASATEGFVRAIENTLGYPLEIVAGREEARLVYLGVAHSLAVDARERRLVVDIGGGSTELIAGQGFIPDLRESLHFGCVASTRAYFPDEQIAAPACERLEKRVRMAVEPMLEDFASHGWDQAVGSSGTIKSIGRILAEGGQGPRITRAGMHWLREQLMRLGSVRALTRLKGLKPDRAAVFPGGFIILFALFESLGLQEMRFSEGALREGAIYDLLGRIHQEDTREMSICSLQERFHSQVLRNQSVARWAERFFTSATGTWPLHEGHQQWLRWAALTHDIGLDIAHSGYHKHGEYVWRNADIAGFSRREQGVVAALLRAQRKRLPGLAQLRSLGVAAEDVVPLQQLAILLRLAILFHRGALPLVAPPDLTVTGRHVVLHLPARWLTDMPLLAADLEQEQEWITPDFHLQW
>NC_011206.1|WP_012536521.1|1130425_1131016_+|DedA-family-protein
MLGWLRLQPITLDMIIAFLRQYGYWILFIGTLLEGEAVVIVAGALAHAGVLDLPLVIFVSWLGSTLNDQVLYQLGYRYGERLLNMLPRFLRRHVGQAEGLIRRFGDWVTLFFRFIYGTRTITPILLGVHRYPAQRYLWMNPAAAAVWAAAIAGIGYALGASLRSLLKSVQHVQIVLLLLLIAVALAYWWWHRRHGE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_011206_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_011206_3

1357260-1357351

Orphan

Consensus_repeat	Method
CCTGGTCAGTACAACAACGGCTACGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_011206_3

>merge|NC_011206|3|1357260-1357351|CRISPRCasFinder
CCTGGTCAGTACAACAACGGCTACGGCAATCCACCACCGCCGCCACCTCCTCCTCCCGGTCAGGGGCCTGGTCAGTACAACAATGGCTACGG

>NC_011206|3|3|1357260-1357351|CRISPRCasFinder
CCTGGTCAGTACAACAACGGCTACGG	CAATCCACCACCGCCGCCACCTCCTCCTCCCGGTCAGGGG
CCTGGTCAGTACAACAATGGCTACGG

Protein	Signature genes	Signature genes Name	Protein_function
NC_011206.1\|WP_009562016.1\|1366429_1367329_-\|GTP-binding-protein	unknown	unknown	gnl\|CDD\|197226
NC_011206.1\|WP_041838688.1\|1367340_1367655_-\|hypothetical-protein	unknown	unknown	unknown
NC_011206.1\|WP_009569333.1\|1356949_1357108_-\|hypothetical-protein	unknown	unknown	unknown
NC_011206.1\|WP_012536720.1\|1369237_1370008_-\|ParA-family-protein	unknown	unknown	gnl\|CDD\|224113
NC_011206.1\|WP_009569339.1\|1356429_1356624_+\|hypothetical-protein	unknown	unknown	unknown
NC_011206.1\|WP_009566825.1\|1362058_1362769_-\|PilZ-domain-containing-protein	unknown	unknown	gnl\|CDD\|377796
NC_011206.1\|WP_012536709.1\|1352867_1353170_+\|hypothetical-protein	unknown	unknown	unknown
NC_011206.1\|WP_049756718.1\|1358482_1360978_+\|diguanylate-cyclase	unknown	unknown	gnl\|CDD\|143635
NC_011206.1\|WP_080515401.1\|1360916_1361921_+\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|238923
NC_011206.1\|WP_012536719.1\|1367997_1369236_-\|ParB/RepB/Spo0J-family-partition-protein	unknown	unknown	gnl\|CDD\|319251
NC_011206.1\|WP_012536710.1\|1353166_1353823_+\|lytic-transglycosylase-domain-containing-protein	unknown	unknown	gnl\|CDD\|381613
NC_011206.1\|WP_012536706.1\|1349260_1350376_+\|conjugal-transfer-protein	unknown	unknown	gnl\|CDD\|377058
NC_011206.1\|WP_012536716.1\|1362939_1365579_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|236645
NC_011206.1\|WP_009564688.1\|1348579_1349248_+\|type-IV-secretion-system-protein	unknown	unknown	gnl\|CDD\|377310
NC_011206.1\|WP_012536718.1\|1367656_1367914_-\|hypothetical-protein	unknown	unknown	unknown
NC_011206.1\|WP_012536708.1\|1351396_1352857_+\|TrbI/VirB10-family-protein	unknown	unknown	gnl\|CDD\|319755
NC_011206.1\|WP_009564689.1\|1347412_1348270_+\|DUF2236-domain-containing-protein	unknown	unknown	gnl\|CDD\|378343
NC_011206.1\|WP_012536711.1\|1353833_1356320_+\|TraM-recognition-domain-containing-protein	unknown	unknown	gnl\|CDD\|237540
NC_011206.1\|WP_009562011.1\|1366003_1366192_-\|hypothetical-protein	unknown	unknown	unknown
NC_011206.1\|WP_012536707.1\|1350377_1351394_+\|conjugal-transfer-protein	unknown	unknown	gnl\|CDD\|274292

Protein	Function_ID	Function_description	E-value
NC_011206.1\|WP_012536711.1\|1353833_1356320_+\|TraM-recognition-domain-containing-protein	gnl\|CDD\|237540	PRK13880, PRK13880, conjugal transfer coupling protein TraG; Provisional.	8.85065e-174
NC_011206.1\|WP_012536716.1\|1362939_1365579_-\|EAL-domain-containing-protein	gnl\|CDD\|236645	PRK10060, PRK10060, cyclic di-GMP phosphodiesterase.	2.70464e-108
NC_011206.1\|WP_012536720.1\|1369237_1370008_-\|ParA-family-protein	gnl\|CDD\|224113	COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning].	2.63425e-38
NC_011206.1\|WP_012536719.1\|1367997_1369236_-\|ParB/RepB/Spo0J-family-partition-protein	gnl\|CDD\|319251	cd16393, SPO0J_N, Thermus thermophilus stage 0 sporulation protein J-like N-terminal domain, ParB family member. Spo0J (stage 0 sporulation protein J) is a ParB family member, a critical component of the ParABS-type bacterial chromosome segregation system. The Spo0J N-terminal region acts in protein-protein interaction and is adjacent to the DNA-binding domain that binds to parS sites. Two Spo0J bind per parS site, and Spo0J interacts with neighbors via the N-terminal domain to form oligomers via an Arginine-rich patch (RRXR). This superfamily represents the N-terminal domain of ParB, a DNA-binding component of the prokaryotic parABS partitioning system. parABS contributes to the efficient segregation of chromosomes and low-copy number plasmids to daughter cells during prokaryotic cell division. The process includes the parA (Walker box) ATPase, the ParB DNA-binding protein and a parS cis-acting DNA sites. Binding of ParB to centromere-like parS sites is followed by non-specific binding to DNA ("spreading", which has been implicated in gene silencing in plasmid P1) and oligomerization of additional ParB molecules near the parS sites. It has been proposed that ParB-ParB cross-linking compacts the DNA, binds to parA via the N-terminal region, and leads to parA separating the ParB-parS complexes and the recruitment of the SMC (structural maintenance of chromosomes) complexes. The ParB N-terminal domain of Bacillus subtilis and other species contains a Arginine-rich ParB Box II with residues essential for bridging of the ParB-parS complexes. The arginine-rich ParB Box II consensus (I[VIL]AGERR[FYW]RA[AS] identified in several species is partially conserved with this family and related families. Mutations within the basic columns particularly debilitate spreading from the parS sites and impair SMC recruitment. The C-terminal domain contains a HTH DNA-binding motif and is the primary homo-dimerization domain, and binds to parS DNA sites. Additional homo-dimerization contacts are found along the N-terminal domain, but dimerization of the N-terminus may only occur after concentration at ParB-parS foci.	3.78907e-30
NC_011206.1\|WP_049756718.1\|1358482_1360978_+\|diguanylate-cyclase	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	3.91281e-59
NC_011206.1\|WP_080515401.1\|1360916_1361921_+\|EAL-domain-containing-protein	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	4.902e-53
NC_011206.1\|WP_012536710.1\|1353166_1353823_+\|lytic-transglycosylase-domain-containing-protein	gnl\|CDD\|381613	cd16892, LT_VirB1-like, VirB1-like subfamily. This subfamily includes VirB1 protein, one of twelve proteins making up type IV secretion systems (T4SS). T4SS are macromolecular assemblies generally composed of VirB1-11 and VirD4 proteins, and are used by bacteria to transport material across their membranes. VirB1 acts as a lytic transglycosylase (LT), and is important with respect to piercing the peptidoglycan layer in the periplasm. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).	1.29002e-47
NC_011206.1\|WP_012536706.1\|1349260_1350376_+\|conjugal-transfer-protein	gnl\|CDD\|377058	pfam03524, CagX, Conjugal transfer protein. This family includes type IV secretion system CagX conjugation protein. Other members of this family are involved in conjugal transfer to plant cells of T-DNA.	7.62485e-25
NC_011206.1\|WP_009562016.1\|1366429_1367329_-\|GTP-binding-protein	gnl\|CDD\|197226	cd09128, PLDc_unchar1_2, Putative catalytic domain, repeat 2, of uncharacterized phospholipase D-like proteins. Putative catalytic domain, repeat 2, of uncharacterized phospholipase D (PLD, EC 3.1.4.4)-like proteins. PLD enzymes hydrolyze phospholipid phosphodiester bonds to yield phosphatidic acid and a free polar head group. They can also catalyze transphosphatidylation of phospholipids to acceptor alcohols. Members of this subfamily contain two HKD motifs (H-x-K-x(4)-D, where x represents any amino acid residue) that characterizes the PLD superfamily. The two motifs may be part of the active site and may be involved in phosphatidyl group transfer.	7.6164e-39
NC_011206.1\|WP_009564688.1\|1348579_1349248_+\|type-IV-secretion-system-protein	gnl\|CDD\|377310	pfam04335, VirB8, VirB8 protein. VirB8 is a bacterial virulence protein with cytoplasmic, transmembrane, and periplasmic regions. It is thought that it is a primary constituent of a DNA transporter. The periplasmic region interacts with VirB9, VirB10, and itself. This family also includes the conjugal transfer protein family TrbF, a family of proteins known to be involved in conjugal transfer. The TrbF protein is thought to compose part of the pilus required for transfer. This domain has a similar fold to the NTF2 protein.	2.40066e-35
NC_011206.1\|WP_012536708.1\|1351396_1352857_+\|TrbI/VirB10-family-protein	gnl\|CDD\|319755	cd16429, VirB10, VirB10 forms part of core complex in Type IV secretion system (T4SS). This family contains VirB10, a component of the type IV secretion system (T4SS), including homologs TrbI, TraF, TrwE and TraL. T4S system is employed by pathogenic bacteria to export virulence DNAs and/or proteins directly from the bacterial cytoplasm into the host cell. It forms a large multiprotein complex consisting of 12 proteins termed VirB1-11 and VirD4. VirB10, interacts with VirB7 and VirB9, forming the membrane-spanning 'core complex' (CC), around which all other components assemble. The CC is inserted in both, the outer and inner membranes, playing a fundamental role as a scaffold for the rest of the T4SS components and actively participating in T4S substrate transfer through the bacterial envelope via conformational changes regulating channel opening and closing. TrwE in R33 plasmid has been shown to be anchored to the inner membrane and its C-terminal is necessary for conjugation; the transmembrane domains of TrwB and TrwE are involved in TrwB-TrwE interactions. TraF protein of the RP4 plasmid is involved in circularization of pilin subunits of P-type pili. In gonococcal genetic island (GGI) of Neisseria gonorrhoeae, T4SS encodes TrbI and circularization occurs via a covalent intermediate between the C terminus of putative pilin protein TraA and TrbI.	3.04363e-69
NC_011206.1\|WP_009564689.1\|1347412_1348270_+\|DUF2236-domain-containing-protein	gnl\|CDD\|378343	pfam09995, DUF2236, Uncharacterized protein conserved in bacteria (DUF2236). This domain, found in various hypothetical bacterial proteins, has no known function. This family contains a highly conserved arginine and histidine that may be active site residues for an as yet unknown catalytic activity.	0.00441316
NC_011206.1\|WP_009566825.1\|1362058_1362769_-\|PilZ-domain-containing-protein	gnl\|CDD\|377796	pfam07238, PilZ, PilZ domain. PilZ is a c-di-GMP binding domain which is found C terminal to pfam07317. Proteins which contain PilZ are known to interact with the flagellar switch-complex proteins FliG and FliM. This interaction results in a reduction of torque generation and induces CCW motor bias. This domain forms a beta barrel structure.	0.0053367
NC_011206.1\|WP_012536707.1\|1350377_1351394_+\|conjugal-transfer-protein	gnl\|CDD\|274292	TIGR02775, probable_conjugal_transfer_protein_TrbG, P-type conjugative transfer protein TrbG. The TrbG protein is found in the trb locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for plasmid conjugative transfer. TrbG is a homolog of the F-type TraK protein (which is believed to be an outer membrane pore-forming secretin, TIGR02756) as well as the vir system VirB9 protein. [Cellular processes, Conjugation].	7.61925e-11

>NC_011206.1|WP_009569333.1|1356949_1357108_-|hypothetical-protein
MNMERPEEFINEYSGADPDLVFLYQTEFALLPRWIGIMSDGWPGFAGFSACL
>NC_011206.1|WP_009569339.1|1356429_1356624_+|hypothetical-protein
MNAVLPSIISEFETAEQEASYTAWLRTKVASSLADQRPSIPHDEVMAEMDAIIAEAETSAQRKF
>NC_011206.1|WP_012536711.1|1353833_1356320_+|TraM-recognition-domain-containing-protein
MTEKIHAPDRSVSDYKVQRLARGGRLKTTLAGVAAGVLGYTLGISYVARDVFPGYQWTDDFIQKAHAYIALPYGWRLYDPLPFLRPMILNIHYPVIHQAFYDAGLPAVVLGILTAGILGKKHKDAQKAVLDNPVHGSAHWAGKSDAIRAALLPSPPPKTVMDSLRPWLGMHPAKGMHPAKGLHPAKGLKGGSDWARWNDRQEKRKKEAAEWRKRRAEREKKRLSEIPEPTVFDRFDSPHVCYVGAFVENGAATPLQHTGAEHILVFAPTRSGKGVGLVLPTLLDGWMDSVVVHDIKGENFNLTAGYRKAMGHHILKFSPGSVSEEGCHFNPLDAVRVGTQYEVKDVMNIATMIVDPDGKGLNDHWQKTGFALLTSIILHVLYAMPDKTLRGVAAYLNDPTLESVDVAFERMMQTEHDPDEQYGWRDGNGQCSRVHPVIAQSAREMLNKAENEKSGVISTMMSFLSLYRDPIVAKWTEYSDFRIADLQDAEQPVSLYLVTSPEDKNRLKPLIRLVLNQIASQFTAEERLEAKDGRIVAKGKHRLLLLLDEFPSLGKLDVFLDSIAFLAGYNVKLYLITQDIAQLEDEGHGYGKAGAKTIIGNCHIRAAYAPNQVETAKWISDMLGTRTVTMENDNQSFDGSLFGQNKGYSTSLSYQSRPLLTADEVMTLRGPEKEGANIQTPGDMLVFAAGFHPIYGQQLLYFKNPEWLERASIRWPEKSDSIPGARKDYKAILGESGGTLPIPHIEKKPEGQDPVEEVSEAERAALAAAAGDLDAVAGECKPLAGCKPFAECKPLAGRKPTGDGKYDTSERDAERGVIGGLMGDDGDG
>NC_011206.1|WP_012536710.1|1353166_1353823_+|lytic-transglycosylase-domain-containing-protein
MILLSQINAECAPMVAPSTMAAIVRVESGGNPLAMWNNSTQSMVIPGSRAQAIRYLRHAMAAGQRVDVGLAQVDTGNFAAFGLRPRNAFNACANLRAGGEILHMDWQQALSSGYRGQQALYHAFEAYNSGRLRGDAQYANRILGAAGVPTSAGCKLAGCKPAGRKPVAYGRLRTVSWGNQGNAALPSNPFPQFRWQAKSPQAVTSGPSDDSHSWPVLP
>NC_011206.1|WP_012536709.1|1352867_1353170_+|hypothetical-protein
MRGSIIIRTEHDCAGLPPARRTAIVTQKVRSLSDEGLQDLARRREKQHPGRHLRPMSITLPADVLERLQCFQGSRWSVSALIDRILESEDARPASSRSSR
>NC_011206.1|WP_012536708.1|1351396_1352857_+|TrbI/VirB10-family-protein
MKSGKDFFSDLLQKKKGLLPAGQQPAGDSRKGPGGQQDPCGQPGPSRPQGPQVSQPGIEVKPDRDRMATRIKRTPLYIAAAVVGLGAYGGYEYLQSHPMFGNAKPQVQAKTIQPASGTGAPVAPAHRKQVHKPTVPGGASDTSATAATNSDADQSHPAKAPASTVPKKNPYATQDAAFASALGTGSAGSGAGEGLAWKTPESTPSAQTPTVLPTALPGASLPGASLPDAEPSAAKKTKKKTPPSLVTRETSPYEILSGSVIPAVLQTGIKSYLPGEITAVVSQNVYSSVNGATLLIPAGAKLVGTYDTQTALGINRLAVAWTRIEFPNGTTMNLPGYEGAGGAGYAGFAGEVNDHTWLIFKNALLMSIVDAGMAIASPSTSTSVTGQMSGNVALQDSEQALAQTFGEAESQLLEKYIDIAPTITIPTGYLFSVVVAHDMVFPGPYDPAMQTGSAMVDQALGPNLNPYGLRPAKGLRPAKGLHPAKG
>NC_011206.1|WP_012536707.1|1350377_1351394_+|conjugal-transfer-protein
MRYGAKTMKKRSVLMMATIAMAASVPASMASTVKVPGVAGQSAPIAGTVNTAQIFRHSLNIRYGEPIRAVEQQSVRAFALGTLSQLPVFTRPGGEVIVPLGQVLPVLQTAPGNFSVVILGKGVKPVSLVGAPRAEWVVKETAAGGLAAGRLAAGRHPILEIMPRFAGLKGSIQIVATSPHGYPLTYTVGLVSGTSRFTPVLSFYRVPHDFPQSREVGTRDQDRQATAPIAHASHANTPPVNATHADLDWKMQCFTGDCKPVQPISVVSDIKDRMTYIRLPTGKTPMVLVRNQAGKSLLVGYRMEGHTLAVGAVPYRIDLLTGNWNHLAEIRLTNEAGA
>NC_011206.1|WP_012536706.1|1349260_1350376_+|conjugal-transfer-protein
MKTKTLLSLGLAVLPGLALAGVDTGLPAVNPISSLQGKPPIQPAGTKTGSAHPSTTPSASGGTTSAGQKVPAISPEAAARMATAHVWQQSIATPPEGPESAATRALARQSLTASQAMDDTLPVIGGANGTVDSLAGRPVLVCSPLHTCIIELPEGVKPVTTVGVSKSEWNVQQALVGKQPEIFLSPKFQGLHQNIVVAATDQGRPINYEIRLVSDAVRYIPALKIEDSGGEVRSWKTDLQSADSRTADNAPTDQSAADHKGNVLPLPNIRLNHVNLRWSIHCGGGGWFRSSDCKPIRPLRVYDDGTHTFIDMPQGLASHGGFPILQARNASGHLIGVDTQIRGNTYVVDSVPAEILLRLGSEVVTIHQEGK
>NC_011206.1|WP_009564688.1|1348579_1349248_+|type-IV-secretion-system-protein
MSSNPDYLAARQEWLERYGSYIAQARNWRIAALSAIGIAALFGAGMVYEADRVHIVPYVVEVDKLGKAVELAQAVRAGSFAQPVVQHIVSRFTWLAFTRSPDKHVQKHFIDESYHYIASSAESSLDAFYAQHNPYAAYSNKTQGNTVTIQSAVPVGQVTGKGGSYIVDFLVKHYGPHGGVDGEQNWQGTVTYATVPPSNNPNVLKGNPFGIYITHFAFSPQV
>NC_011206.1|WP_009564689.1|1347412_1348270_+|DUF2236-domain-containing-protein
MTTAYDREILQLDPVKDHCRITFLMATCVYPFDIARALELALFRTYAVPRISALLRHTGELTERTRKRYDDTDLLLSELIEHGYDSPQGQAAIENINRQHAKYTIRNKDYLYVLSTFIFEPIQWIARFGHRPLSEKERLAWFHFWRAIGVRMNIQDIHDEYAELEQFNRSYEAECFHYSNSNRCVAEKTIDLLLGFYMPPVLFRLGRPAVYALLDRPLLNALGLSGQSIWLSRVLTRALRLRGRIASALPIKNKPVMRTQLRRPTYPEGYRIEDLGPEKPTQQRD
>NC_011206.1|WP_049756718.1|1358482_1360978_+|diguanylate-cyclase
MTAPDTANFLTLDALLTKINQMISGAEDESVLLQHICEIAVQQSGLKLAVVSRPDTQGRFQFLAAAGQVDYLKDLFISSDAQIPEGQGPAARAWREARVYFGTNFTKEPFLAPWKKRAQAYGLADSATLPIFRDGKVWAILSVYRGDEAQFDDALQTILQQLSLQISQGLERLQDVQRLRFLRASVEALEDGVTIADPQRHLIYVNQAFLKLTGYAMKEVLGRDCKFLQAPQTDAQTVRQIAIALAQEQSYTGDILNQRKDGTLFWNRLHIDPVLNDQGALTGFIGLQRDITQERENRNLIQTLLDNAAVGITVVRQRQIVQCNQHLAGMIGLSPERVIGQSSRLFYPDEATWERIGQAYAELLQTGSTIIRHVMLAHYHNQNPPVVDAFVKLLDDQETSIWTVVDVTESVQQAQQLKKLQNIYQALTVEADILLQGRNVQDMLETTCTRLGEMGIFHTVGVVRPDAQGRVRVLAGAGPGIEMMQPFQIHVDDPSSMSARAWREQRTIVHSDFSSSQADRPWGQVLATSGWVSALATPVWRDGTPFAVIKFISTEQVFDADTTTACERLASLLGHSLDEHDLKEHLRLLQEQEAKIARTDLLTGLPNRRFLEIQMEQAMARAERHNQLLAVCMLDLDGFKPVNDTYGHGAGDEVLVALGKRLSEALRKSDFVARLGGDEFVLLVEDLEDLDDLANIMKKIEDTITAPIPLSNGKSVQIGASMGVALYPFGDTDTGDKLLRLADQAMYESKANKAARERFWVLFGEEVQKEKCTPGQQLLDAGALEVWYQPVLDSRTRRVVGVEALARLRDTDGTLWTPAEFLPQLQIGNLS
>NC_011206.1|WP_080515401.1|1360916_1361921_+|EAL-domain-containing-protein
MVPSGRRRSSCRNCRLEIFLDLTGKVLAQSLADLSLLDAHGWSLWVSVNLDPRSVSEGCVTCLEEMIAQSTVDPSRITLEILEGDNFLEQQKALDHLREIKALGVRLALDDVGSAYSSLLRLKDLPIDEIKLDQGFIRFLEQRPQDLHFVGAIQDLAAGMGVDLVVEGVETEDILDAIIVTGAQFLQGYAIAKPMPLSELQAFLQRPPCHGRPHPTSLLGFYAKQIAAHNALKKAMLHTPHLIDYVAVADATICPGHNHIRRLGIGDHKRLERLHQEYHQSIAAMGERSISSPNNGDWSDVDSAENAFEQAIIGAYWYKKMEDGNPACEAEKPT
>NC_011206.1|WP_009566825.1|1362058_1362769_-|PilZ-domain-containing-protein
MEYLPLVFLSGADELPLPEPEALGAVEGRSAIVYGPEEDDDGLLCHAQGWDMGDLVLEPTTPANGEIPSYNKALIFLFAKPNLLGFFADWKSFQKGAHHFRRPNLVLTRRARQKQRLRLDGDIIVRRRNGSTLLSKLYDFGPSGASFYTDAADFRSGEMLLAEFEISGCGSCETTATIVRVETLSHSHYGYLVGIYFHLTKAQLQKAEQLYLCKKAEAIRQLSAPERHRWAPPETV
>NC_011206.1|WP_012536716.1|1362939_1365579_-|EAL-domain-containing-protein
MIIDNSGTLPAFLGLQDSDFQVIDRYRDALDKEASALAHAFYDYLLSHPATAAVFRDFSSARLDALIQKQTEHAKGLLVSRLDRPWRESMRKIGALHHHLGIGPSWIAGAYILYWRHWQKILQVQVPESDRDLLRDALFRLLVGDLMVQLEGYAHASRETDSERLALSNVLMSVLAAPRGKVSLRPEDLLQQICDDLPAKSGSVRLAGYMVSDVMGETLTLEHQAGLLSPGLQLQKSTGDPCWKALGSGQSIIQAVDDPQAPEWIKALRNQVEEIGIFPFGTEDLRGAGLIGVREKGYFQRVGSAYFNAFAHLGELVFLLRNQFLRDPLTALPNRFLFMDFLENARNQTLRHERLLGVAILDLDGFKQVNDRLGHGAGDQVLQAVVQRLQVQLRAGDILARLGGDEFGLILPDLERLDDLDGVSERLLAALREPLEIDGEAASVTGSLGITLFPLDDSDASTLIRHADMALYAAKDAGRDQFQLHSLALDEAMRTEAGTRALLEQALQENRLVLYYQPVVSSAGAVIGVEALIRLQHPERGLIPPAAFFSALDHVRLARPIGRFVLNVALHQAALWQEAGHPLRVSVNISTRHLLDARFLEDLQEMLAKYPGLRPELVEIEITESAPLRDMLEAQRLLVACHRLGVRVALDDFGTGNASLTYLQRLPADSIKIDQSFVRDVIDDPKDLAIVTAVITASRMLGMNVIAEGVETADHVDLLVKTGCNHLQGYFFSKPIPAEDVPAWVAHFRPAPRTKDSLHPLNILSPILEGHILRVQKFIGALRQENPFPAHVIEKDAEEYCHLGLWLRGEGKQRFGATPQFMRLLTRHERLHQVARVAKLHFDAGDADGAMEQGKLLDMENGLLLAELLAMAGESRDNI
>NC_011206.1|WP_009562011.1|1366003_1366192_-|hypothetical-protein
MNESYRQTRIAQLQNHRHILLQRREQRGAPIASIDMELNVVRAKLQALYEAGRMQLVTETDA
>NC_011206.1|WP_009562016.1|1366429_1367329_-|GTP-binding-protein
MLSIEPQAGPAPIIQVIHSSRRELDVGVYYLSDRKILRALAAAHRRGVDVRVIIEGKPYGMKPWQVRREERTIAATGARWKVAPPRFTSHGNDYSFFHCKYCANGHEVEIGTANFDWSAFHRNREYVDVTRNATVVQAVNAVFNADWTAAQGGNQRAPAYAHRVLVLSPGTSAAQLLQVIDQPGPIDVESEELGPYAPILDALAAKGRNLRMILPASINAKDKRAVAFLREHGCRVRLLSKKPLYMHAKMIAGKSLAFIGSENFTQTSLDNNREMGLLLNGSDIGKLQTQFDKDWARAG
>NC_011206.1|WP_041838688.1|1367340_1367655_-|hypothetical-protein
MGISKIFHAPQYGVRRQPKKEQAPIQDTTQPDGDIQEIKQNIVKSCGGAETSMAAGTGGSGFHYPRDLALPEDPVPECRVPSKPQVKIEVRKSRKIPTQTPSLA
>NC_011206.1|WP_012536718.1|1367656_1367914_-|hypothetical-protein
MFGFGEHNDHANVQQVTCTCGTNMAYQGAHGLRMGGLTGMLGAGAAFLGGQVATDGEEAFEKKLEVDIYVCPQCQDVRLKYRKGL
>NC_011206.1|WP_012536719.1|1367997_1369236_-|ParB/RepB/Spo0J-family-partition-protein
MAKVDLSENLFDEMKRTLAEMAGDSGETAAKADRLPGRRLPGQEAARADERNAVAGGTVDRGKVSALFLALSEIEPDPEQPRKTFVASGAQDAIDNDLELLKESILQHGVLQPIAVHPVASGRYRIIAGERRWRASMAARDSGQPCRRKGYDLSRIPAVILEPNTDADRLEMQLVENLARADMTPVDTAKAVKQLMDSLDPKPSLADLGKRLGRSKAWVHQMLSLGSEDAQAVAEYLGVPLESIGQTDISRMKGWMKDEDKRIVLDAIRASLQAGETLSRVLVDREEDRYEQGLSGKPQEVDMQQENRAVMGSHPARAFDANGEEVDLSTIDLSEVDSDEDIEDGGAVDENGVVVGDPADGASLPGASLPNQVTVTLPRPLLERAFAKAGRALPGTMGTVEIVEVLELVLNG
>NC_011206.1|WP_012536720.1|1369237_1370008_-|ParA-family-protein
MPQIITVTNQKGGVGKTALAVHIAAYASMAAKKKTLLVDMDGQRNATFITTGEQYGRGKSVLELWDGDTRLEFQDTRFGDLQILPGHQHVHLVEKQGLKSGQEAMSRLLDIDFDVVVIDTPPAAGVQQLAPLYLGGLLVAPVEPDLLALQGLTSLLKVWREIASQVDLGLSLVINKRVLNSTNQQMVVDAITESGFGQHVLPVHLTNRQIVSNAMKQGMPVWKLDPKDAAAAKWAMACKMILETDRVPTEETVKEG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

139269 : 193098

Streptococcus_phage(37.5%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012535799.1\|139269_140589_+\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_012535798.1\|140710_141025_+\|transposase	DDE transposase family protein	NA	NA	NA	NA
WP_012535826.1\|141168_141801_+	hypothetical protein	NA	NA	NA	NA
WP_012535827.1\|141846_143166_+	NAD(P)-binding protein	NA	NA	NA	NA
WP_012535828.1\|143185_144202_+	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_155115419.1\|144498_144630_+	hypothetical protein	NA	NA	NA	NA
WP_012535829.1\|144896_146084_-	carbohydrate porin	NA	NA	NA	NA
WP_012535830.1\|146113_146818_-	MgtC/SapB family protein	NA	NA	NA	NA
WP_012535831.1\|146834_147035_-	hypothetical protein	NA	NA	NA	NA
WP_012535832.1\|147045_148416_-	divalent metal cation transporter	NA	NA	NA	NA
WP_012535834.1\|148973_149381_-	Hg(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_080515392.1\|149430_149919_+	organomercurial transporter MerC	NA	NA	NA	NA
WP_012535836.1\|149932_151354_+	FAD-dependent pyridine nucleotide-disulfide oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	2.1e-22	31.0
WP_012535837.1\|151505_152192_-	heavy metal transport/detoxification protein	NA	NA	NA	NA
WP_049756731.1\|152205_152628_-	organomercurial transporter MerC	NA	NA	NA	NA
WP_012535839.1\|152743_153151_+	Hg(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_012535840.1\|153521_154436_-	zinc-dependent alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_155115420.1\|154933_155254_+	hypothetical protein	NA	NA	NA	NA
WP_012535841.1\|155528_157553_-	copper-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	6.9e-75	34.0
WP_012535842.1\|157840_158104_-	SHOCT domain-containing protein	NA	NA	NA	NA
WP_080515394.1\|158803_159157_+	hypothetical protein	NA	NA	NA	NA
WP_012535843.1\|159250_160561_+	TolC family protein	NA	NA	NA	NA
WP_012535844.1\|160557_161874_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_012535845.1\|161866_164977_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	2.2e-51	21.7
WP_012535846.1\|165002_165749_+	cytochrome b/b6 domain-containing protein	NA	NA	NA	NA
WP_012535847.1\|165877_166240_+	copper-binding protein	NA	NA	NA	NA
WP_012535848.1\|166354_166663_+	hypothetical protein	NA	NA	NA	NA
WP_012535850.1\|167195_168023_+	hypothetical protein	NA	NA	NA	NA
WP_012535852.1\|168755_168959_+	hypothetical protein	NA	NA	NA	NA
WP_155115421.1\|169725_171033_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	5.2e-47	37.7
WP_012535855.1\|171178_171448_+	XRE family transcriptional regulator	A0A2D1GR59	Pseudomonas_phage	1.1e-12	47.7
WP_012535856.1\|171699_174798_-	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_012535857.1\|174838_175966_-	hypothetical protein	NA	NA	NA	NA
WP_155115422.1\|175962_177423_-	TolC family protein	NA	NA	NA	NA
WP_012535859.1\|177419_179432_-	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	3.8e-89	35.3
WP_012535860.1\|179461_179845_-	winged helix-turn-helix transcriptional regulator	E4ZFI8	Streptococcus_phage	1.2e-12	40.6
WP_012535861.1\|180169_181318_+	cysteine desulfurase	A0A1X7QGF3	Faustovirus	1.9e-29	28.5
WP_012535862.1\|181317_181959_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_012535863.1\|182108_182792_-	glutathione S-transferase	NA	NA	NA	NA
WP_155115423.1\|182895_183297_+	metalloregulator ArsR/SmtB family transcription factor	NA	NA	NA	NA
WP_012535865.1\|183287_183533_+	SHOCT domain-containing protein	NA	NA	NA	NA
WP_155115448.1\|183591_184158_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_155115449.1\|184466_184730_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_012535868.1\|184834_186019_+	pyridine nucleotide-disulfide oxidoreductase	NA	NA	NA	NA
WP_012535869.1\|186311_187421_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_012535870.1\|187639_187849_-	DUF4926 domain-containing protein	NA	NA	NA	NA
WP_012535871.1\|187845_188259_-	hypothetical protein	NA	NA	NA	NA
WP_012535872.1\|188596_188971_-	copper-binding protein	NA	NA	NA	NA
WP_155115424.1\|189316_190882_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_012535798.1\|191342_191657_-\|transposase	DDE transposase family protein	NA	NA	NA	NA
WP_012535799.1\|191778_193098_-\|transposase	ISAs1 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

253329 : 310280

Stx2-converting_phage(20.0%)

transposase,integrase

attL 308892:308923|attR 312274:312305

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012535935.1\|253329_254967_-\|transposase	IS66-like element ISAfe4 family transposase	A0A0P0ZEB3	Stx2-converting_phage	2.0e-104	43.4
WP_012535936.1\|255016_255364_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_012535937.1\|255354_255687_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_155115427.1\|256222_256675_+	hypothetical protein	NA	NA	NA	NA
WP_012535938.1\|257290_258190_-	GTP-binding protein	NA	NA	NA	NA
WP_012535939.1\|258517_258775_-	hypothetical protein	NA	NA	NA	NA
WP_012535940.1\|258858_260097_-	ParB/RepB/Spo0J family partition protein	NA	NA	NA	NA
WP_012535941.1\|260098_260869_-	ParA family protein	NA	NA	NA	NA
WP_012535942.1\|260871_261267_-	hypothetical protein	NA	NA	NA	NA
WP_012535944.1\|261780_262371_-	conjugal transfer protein TraF	NA	NA	NA	NA
WP_041838726.1\|262517_262781_-	hypothetical protein	NA	NA	NA	NA
WP_012535946.1\|262843_264202_-	conjugal transfer protein TraB	NA	NA	NA	NA
WP_012535947.1\|264198_264792_-	hypothetical protein	NA	NA	NA	NA
WP_012535948.1\|265275_265572_+	putative addiction module antidote protein	A0A141GEX5	Brucella_phage	7.1e-13	47.3
WP_012535949.1\|266348_268403_-	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	3.0e-33	30.7
WP_012535950.1\|268615_268861_-	hypothetical protein	NA	NA	NA	NA
WP_012535951.1\|268863_269637_-	SpoIIE family protein phosphatase	NA	NA	NA	NA
WP_012535952.1\|270085_270589_+	hypothetical protein	NA	NA	NA	NA
WP_012535953.1\|270588_272049_+	DUF2779 domain-containing protein	NA	NA	NA	NA
WP_012535954.1\|272041_273073_+	WYL domain-containing protein	NA	NA	NA	NA
WP_012535955.1\|273094_273844_+	DUF262 domain-containing protein	NA	NA	NA	NA
WP_155115428.1\|273759_275316_+	hypothetical protein	NA	NA	NA	NA
WP_012535957.1\|275637_276117_+	hypothetical protein	A0A2I7QW36	Vibrio_phage	1.9e-15	38.1
WP_155115429.1\|276244_276616_+	hypothetical protein	NA	NA	NA	NA
WP_155115430.1\|277141_277819_+	hypothetical protein	NA	NA	NA	NA
WP_012535959.1\|277815_278763_+	RNA-directed DNA polymerase	NA	NA	NA	NA
WP_012535960.1\|278956_281278_+	AAA family ATPase	NA	NA	NA	NA
WP_012535961.1\|281274_283164_+	ATP-dependent helicase	NA	NA	NA	NA
WP_012535962.1\|283487_283793_-	hypothetical protein	NA	NA	NA	NA
WP_012535963.1\|283967_284141_+	hypothetical protein	NA	NA	NA	NA
WP_012535964.1\|284127_284658_+	hypothetical protein	NA	NA	NA	NA
WP_012535965.1\|284754_285138_-	NifU family protein	NA	NA	NA	NA
WP_012535966.1\|285143_285884_-	pteridine reductase	NA	NA	NA	NA
WP_041646706.1\|285779_287021_+	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_012535968.1\|287123_288059_-	cytochrome c oxidase assembly protein	NA	NA	NA	NA
WP_012535799.1\|288536_289856_+\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_012535798.1\|289977_290292_+\|transposase	DDE transposase family protein	NA	NA	NA	NA
WP_009564895.1\|290590_291982_-	oxygen-independent coproporphyrinogen III oxidase	NA	NA	NA	NA
WP_012535969.1\|292019_292952_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_012535970.1\|293187_294030_+	outer membrane porin, OprD family	NA	NA	NA	NA
WP_012535798.1\|294197_294512_-\|transposase	DDE transposase family protein	NA	NA	NA	NA
WP_012535799.1\|294633_295953_-\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_012535972.1\|296659_297790_-	lipopolysaccharide heptosyltransferase II	NA	NA	NA	NA
WP_009566816.1\|297791_298556_-	RMD1 family protein	NA	NA	NA	NA
WP_009566815.1\|298559_299945_-	FAD-binding protein	NA	NA	NA	NA
WP_012535973.1\|299941_301018_-	D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase	A0A0K0KVL9	Prochlorococcus_phage	1.0e-16	42.6
WP_012535974.1\|301014_301380_-	YraN family protein	NA	NA	NA	NA
WP_012535975.1\|301383_303222_-	hypothetical protein	NA	NA	NA	NA
WP_012535976.1\|303291_304167_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	NA	NA	NA	NA
WP_009569274.1\|304696_304942_-	hypothetical protein	NA	NA	NA	NA
WP_111122543.1\|305213_305600_-	hypothetical protein	NA	NA	NA	NA
WP_009565818.1\|305752_306547_-	transferase	NA	NA	NA	NA
WP_012535979.1\|306661_307060_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_009567530.1\|307228_307432_-	hypothetical protein	NA	NA	NA	NA
WP_012535980.1\|307442_308282_-	AAA family ATPase	NA	NA	NA	NA
308892:308923	attL	NA	NA	NA	NA
WP_012535982.1\|309035_310280_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_012535982.1\|309035_310280_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
312274:312305	attR	NA	NA	NA	NA

DBSCAN-SWA_3

443772 : 452558

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012536070.1\|443772_445017_+	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	1.5e-99	54.6
WP_012536071.1\|445023_445515_+	transcriptional repressor NrdR	NA	NA	NA	NA
WP_111122540.1\|445501_446605_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	3.8e-43	34.0
WP_009560911.1\|446608_447265_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	8.4e-30	35.2
WP_012536073.1\|447261_448395_+	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	9.3e-53	36.3
WP_009568607.1\|448391_448856_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	3.6e-35	51.0
WP_012536074.1\|448866_449310_+	transcription antitermination factor NusB	NA	NA	NA	NA
WP_012536075.1\|449437_449719_+	DUF2934 domain-containing protein	NA	NA	NA	NA
WP_012536076.1\|449877_450450_+	sel1 repeat family protein	NA	NA	NA	NA
WP_012536077.1\|450467_450821_-	LapA family protein	NA	NA	NA	NA
WP_012536078.1\|450875_452558_-	ubiquinone biosynthesis regulatory protein kinase UbiB	G9E5W0	Micromonas_pusilla_virus	2.2e-34	29.3

DBSCAN-SWA_4

1689552 : 1745474

uncultured_Mediterranean_phage(12.5%)

transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012536938.1\|1689552_1690668_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	8.8e-88	48.2
WP_012536939.1\|1690664_1691702_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_012536940.1\|1691710_1693060_-	HlyC/CorC family transporter	NA	NA	NA	NA
WP_012536941.1\|1693074_1693668_-	CBS domain-containing protein	NA	NA	NA	NA
WP_012536942.1\|1693730_1694945_-	O-succinylhomoserine sulfhydrylase	A0A0B5JD48	Pandoravirus	8.0e-18	27.8
WP_012536943.1\|1694941_1696387_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	3.6e-57	35.6
WP_012536944.1\|1696376_1696874_-	CvpA family protein	NA	NA	NA	NA
WP_012536945.1\|1696870_1698160_-	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_012536946.1\|1698188_1699073_-	acetyl-CoA carboxylase carboxyltransferase subunit beta	NA	NA	NA	NA
WP_009567136.1\|1699069_1699888_-	tryptophan synthase subunit alpha	NA	NA	NA	NA
WP_012536947.1\|1699884_1701084_-	tryptophan synthase subunit beta	NA	NA	NA	NA
WP_012536948.1\|1701094_1701706_-	phosphoribosylanthranilate isomerase	NA	NA	NA	NA
WP_012536949.1\|1701766_1702582_-\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
WP_009564641.1\|1702594_1704790_-	Tfp pilus assembly protein FimV-like protein	NA	NA	NA	NA
WP_012536950.1\|1704853_1705876_-	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_012536951.1\|1705883_1706960_-	3-isopropylmalate dehydrogenase	NA	NA	NA	NA
WP_009567445.1\|1707061_1707676_+	molybdenum cofactor guanylyltransferase	NA	NA	NA	NA
WP_012536952.1\|1707672_1708167_+	molybdopterin-guanine dinucleotide biosynthesis protein B	NA	NA	NA	NA
WP_012536953.1\|1708169_1709411_+	molybdopterin molybdotransferase MoeA	NA	NA	NA	NA
WP_012536954.1\|1709419_1710061_-	phospholipase D family protein	A0A1B2LRT6	Wolbachia_phage	9.7e-31	46.6
WP_012536955.1\|1710150_1711968_-	signal peptide peptidase SppA	Q8W6U6	Burkholderia_virus	1.4e-10	24.3
WP_012536956.1\|1712175_1715085_-	malto-oligosyltrehalose synthase	NA	NA	NA	NA
WP_012536957.1\|1715090_1716947_-	malto-oligosyltrehalose trehalohydrolase	NA	NA	NA	NA
WP_012536958.1\|1716967_1718203_-	glycosyltransferase	NA	NA	NA	NA
WP_012536959.1\|1718192_1718885_-	hypothetical protein	NA	NA	NA	NA
WP_012536960.1\|1719203_1719845_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_009567699.1\|1720006_1720444_-	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_009567700.1\|1720782_1721790_+	zinc-dependent alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_080513198.1\|1721768_1722569_+	L,D-transpeptidase	NA	NA	NA	NA
WP_009567117.1\|1722891_1723833_+\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_012536962.1\|1723937_1725467_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_146235861.1\|1725837_1726653_-\|transposase	transposase	NA	NA	NA	NA
WP_012536965.1\|1726649_1726970_-	hypothetical protein	NA	NA	NA	NA
WP_012607314.1\|1726979_1727339_-	hypothetical protein	NA	NA	NA	NA
WP_012536966.1\|1728131_1728998_+	hypothetical protein	NA	NA	NA	NA
WP_012536967.1\|1729099_1730404_+	hypothetical protein	NA	NA	NA	NA
WP_155115434.1\|1730513_1731191_+	hypothetical protein	NA	NA	NA	NA
WP_012535936.1\|1731257_1731605_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_012535935.1\|1731654_1733292_+\|transposase	IS66-like element ISAfe4 family transposase	A0A0P0ZEB3	Stx2-converting_phage	2.0e-104	43.4
WP_080515402.1\|1733316_1733691_+	hypothetical protein	NA	NA	NA	NA
WP_148208624.1\|1733745_1734432_+	nucleotidyltransferase domain-containing protein	NA	NA	NA	NA
WP_080513199.1\|1734445_1735030_+	hypothetical protein	NA	NA	NA	NA
WP_111122617.1\|1735297_1737580_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_012536971.1\|1737576_1738674_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_012536972.1\|1738670_1741775_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	2.2e-72	24.7
WP_012536973.1\|1741800_1742520_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.5e-11	26.1
WP_012536974.1\|1742512_1743238_+	hypothetical protein	NA	NA	NA	NA
WP_012536975.1\|1743280_1743664_+	hypothetical protein	NA	NA	NA	NA
WP_012535799.1\|1743718_1745038_+\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_012535798.1\|1745159_1745474_+\|transposase	DDE transposase family protein	NA	NA	NA	NA

DBSCAN-SWA_5

2031454 : 2091693

Streptococcus_phage(22.22%)

transposase,integrase

attL 2029546:2029576|attR 2035436:2035466

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2029546:2029576	attL	NA	NA	NA	NA
WP_012536794.1\|2031454_2032939_-\|transposase	IS21-like element ISAfe9 family transposase	NA	NA	NA	NA
WP_012535983.1\|2033438_2034380_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_009561339.1\|2034372_2035371_+\|integrase	tyrosine-type recombinase/integrase	A0A0K2CP59	Brevibacillus_phage	1.5e-17	26.5
WP_012537169.1\|2036439_2036988_-	hypothetical protein	NA	NA	NA	NA
2035436:2035466	attR	NA	NA	NA	NA
WP_155115437.1\|2037110_2038073_-	hypothetical protein	NA	NA	NA	NA
WP_012607406.1\|2039632_2040007_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_012537173.1\|2040223_2040415_+	hypothetical protein	NA	NA	NA	NA
WP_146235842.1\|2040993_2042304_+	hypothetical protein	NA	NA	NA	NA
WP_012537175.1\|2042313_2044743_+	DEAD/DEAH box helicase	A0A0P0YML3	Yellowstone_lake_phycodnavirus	4.8e-30	27.9
WP_012537176.1\|2045279_2045765_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_009561179.1\|2045998_2046475_-	NADH-quinone oxidoreductase subunit B	NA	NA	NA	NA
WP_012537178.1\|2046551_2048729_-	phosphoenolpyruvate-utilizing protein	NA	NA	NA	NA
WP_012537179.1\|2048817_2049480_-	ATP-binding protein	U5N3V8	Enterobacteria_phage	1.7e-30	38.4
WP_012537180.1\|2049758_2050040_+	hypothetical protein	NA	NA	NA	NA
WP_009567395.1\|2050036_2050279_+	CopG family transcriptional regulator	NA	NA	NA	NA
WP_049756722.1\|2050423_2051245_+	ATP-binding protein	NA	NA	NA	NA
WP_009567396.1\|2051335_2052133_+	hypothetical protein	NA	NA	NA	NA
WP_012537182.1\|2052804_2054280_-	recombinase	NA	NA	NA	NA
WP_012537183.1\|2054511_2055513_-	cation transporter	NA	NA	NA	NA
WP_012537184.1\|2055612_2056089_+	Cd(II)/Pb(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_012537185.1\|2056101_2056752_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_012537186.1\|2056768_2057260_-	ATP synthase F1 subunit epsilon	NA	NA	NA	NA
WP_012537187.1\|2057384_2058011_-	cation transporter	NA	NA	NA	NA
WP_012537188.1\|2058186_2058399_+	hypothetical protein	NA	NA	NA	NA
WP_012537189.1\|2058547_2058856_-	hypothetical protein	NA	NA	NA	NA
WP_012537190.1\|2058971_2059334_-	copper-binding protein	NA	NA	NA	NA
WP_012537191.1\|2059462_2060218_-	cytochrome b/b6 domain-containing protein	NA	NA	NA	NA
WP_012537192.1\|2060276_2060966_-	hypothetical protein	NA	NA	NA	NA
WP_012537193.1\|2061033_2064144_-	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	1.1e-55	22.6
WP_012537194.1\|2064136_2065585_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_012537195.1\|2065581_2066892_-	TolC family protein	NA	NA	NA	NA
WP_012607422.1\|2066984_2067335_-	hypothetical protein	NA	NA	NA	NA
WP_012537197.1\|2068037_2068301_+	hypothetical protein	NA	NA	NA	NA
WP_012537198.1\|2068440_2070465_+	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	8.5e-73	33.8
WP_009569249.1\|2071071_2071383_-	hypothetical protein	NA	NA	NA	NA
WP_155115438.1\|2071736_2071889_+	hypothetical protein	NA	NA	NA	NA
WP_009569252.1\|2072745_2073012_+	hypothetical protein	NA	NA	NA	NA
WP_012537200.1\|2074193_2074589_+	DUF302 domain-containing protein	NA	NA	NA	NA
WP_009560961.1\|2074650_2074857_+	heavy-metal-associated domain-containing protein	A0A218MNH0	uncultured_virus	2.2e-05	42.9
WP_009560960.1\|2074861_2075101_+	glutaredoxin family protein	NA	NA	NA	NA
WP_012607428.1\|2075245_2075548_+	cytochrome c	NA	NA	NA	NA
WP_012537203.1\|2076869_2078471_-	sodium:proton antiporter	A0A2H4J178	uncultured_Caudovirales_phage	1.3e-23	36.2
WP_009569704.1\|2078591_2078858_-	hypothetical protein	NA	NA	NA	NA
WP_012535799.1\|2079554_2080874_+\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_012535798.1\|2080995_2081310_+\|transposase	DDE transposase family protein	NA	NA	NA	NA
WP_012537204.1\|2081671_2083291_-	APC family permease	NA	NA	NA	NA
WP_012607432.1\|2083315_2083729_-	hypothetical protein	NA	NA	NA	NA
WP_012537206.1\|2083800_2084160_-	hypothetical protein	NA	NA	NA	NA
WP_012537207.1\|2084218_2084518_-	hypothetical protein	NA	NA	NA	NA
WP_009561063.1\|2084514_2084886_-	P-II family nitrogen regulator	NA	NA	NA	NA
WP_012537208.1\|2084943_2086134_-	porin	NA	NA	NA	NA
WP_009566656.1\|2086213_2087212_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	2.6e-38	39.4
WP_012537209.1\|2087365_2088922_-	RimK family alpha-L-glutamate ligase	NA	NA	NA	NA
WP_080513212.1\|2088955_2089237_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_012535937.1\|2089335_2089668_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_012535936.1\|2089658_2090006_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_012535935.1\|2090055_2091693_+\|transposase	IS66-like element ISAfe4 family transposase	A0A0P0ZEB3	Stx2-converting_phage	2.0e-104	43.4

DBSCAN-SWA_6

2117402 : 2162934

Bacillus_phage(33.33%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012535798.1\|2117402_2117717_-\|transposase	DDE transposase family protein	NA	NA	NA	NA
WP_012535799.1\|2117838_2119158_-\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_012535799.1\|2120864_2122184_+\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_012535798.1\|2122305_2122620_+\|transposase	DDE transposase family protein	NA	NA	NA	NA
WP_012537231.1\|2123767_2124457_-\|transposase	heteromeric transposase endonuclease subunit TnsA	NA	NA	NA	NA
WP_074874161.1\|2124534_2125236_+	ATP-binding protein	NA	NA	NA	NA
WP_012537232.1\|2125382_2125760_-	hypothetical protein	NA	NA	NA	NA
WP_009561598.1\|2126001_2126484_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_009561601.1\|2127297_2127822_-	sel1 repeat family protein	NA	NA	NA	NA
WP_012537233.1\|2127849_2129469_-	peptide chain release factor 3	A0A2K9L6L3	Tupanvirus	4.6e-13	35.0
WP_012537234.1\|2129475_2129952_-	ribosomal-protein-alanine N-acetyltransferase	NA	NA	NA	NA
WP_012537235.1\|2129953_2130622_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_012537236.1\|2130621_2132547_-	ATP-dependent DNA helicase	A0A127AW80	Bacillus_phage	6.8e-96	33.7
WP_009569361.1\|2132616_2132979_+	hypothetical protein	NA	NA	NA	NA
WP_012537237.1\|2133191_2134289_-	C40 family peptidase	S5MM68	Bacillus_phage	2.5e-10	30.3
WP_012537238.1\|2134789_2136046_+	carbohydrate porin	NA	NA	NA	NA
WP_012537239.1\|2136078_2136366_+	ferrous iron transport protein A	NA	NA	NA	NA
WP_012537240.1\|2136362_2138711_+	Fe(2+) transporter permease subunit FeoB	NA	NA	NA	NA
WP_012537241.1\|2138707_2139007_+	hypothetical protein	NA	NA	NA	NA
WP_012537242.1\|2139104_2139977_+	N-carbamoylputrescine amidase	A7IVZ1	Paramecium_bursaria_Chlorella_virus	3.7e-73	47.3
WP_009562419.1\|2139969_2140722_+	gamma-glutamyl-gamma-aminobutyrate hydrolase family protein	A0A2P9FI75	Pseudomonas_phage	8.7e-07	29.4
WP_009562418.1\|2140718_2141366_-	membrane protein	NA	NA	NA	NA
WP_009562417.1\|2141397_2141754_-	hypothetical protein	NA	NA	NA	NA
WP_012537243.1\|2141750_2142503_-	GMP synthase	NA	NA	NA	NA
WP_009564938.1\|2142504_2143431_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_009564939.1\|2143515_2144118_+	hypothetical protein	NA	NA	NA	NA
WP_012537244.1\|2144139_2145285_-	aldo/keto reductase	NA	NA	NA	NA
WP_012607461.1\|2145281_2146448_-	acetoin utilization protein AcuC	NA	NA	NA	NA
WP_009563394.1\|2146492_2148988_-	VWA domain-containing protein	NA	NA	NA	NA
WP_041838693.1\|2148997_2149828_-	AAA domain-containing protein	A0A2H4N7N3	Lake_Baikal_phage	1.1e-13	30.4
WP_012537246.1\|2149824_2150226_-	hypothetical protein	NA	NA	NA	NA
WP_009563398.1\|2150352_2150676_+	hypothetical protein	NA	NA	NA	NA
WP_012607465.1\|2150730_2151090_-	hypothetical protein	NA	NA	NA	NA
WP_074874163.1\|2151163_2152066_-	lipoate--protein ligase family protein	NA	NA	NA	NA
WP_009567349.1\|2152175_2152589_-	hypothetical protein	NA	NA	NA	NA
WP_012537248.1\|2152715_2154059_-	membrane protein	NA	NA	NA	NA
WP_012537249.1\|2154271_2155408_-	radical SAM protein	NA	NA	NA	NA
WP_009565665.1\|2155432_2156494_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_012537250.1\|2156490_2157561_-	lipoate--protein ligase family protein	NA	NA	NA	NA
WP_012537251.1\|2157609_2158731_-	radical SAM protein	NA	NA	NA	NA
WP_012537252.1\|2158815_2159253_-	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_012537253.1\|2159308_2159707_-	hypothetical protein	NA	NA	NA	NA
WP_009565261.1\|2159703_2160150_-	glycine cleavage system protein H	NA	NA	NA	NA
WP_012537254.1\|2160218_2161130_-	disulfide reductase	NA	NA	NA	NA
WP_012535799.1\|2161614_2162934_+\|transposase	ISAs1 family transposase	NA	NA	NA	NA

DBSCAN-SWA_7

2339472 : 2393627

uncultured_Mediterranean_phage(15.38%)

transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009565976.1\|2339472_2340012_+\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_012537366.1\|2340014_2341337_+\|protease	ATP-dependent protease ATPase subunit HslU	A0A2H5BJT2	Erwinia_phage	1.6e-40	27.9
WP_009568269.1\|2341359_2341692_-	hypothetical protein	NA	NA	NA	NA
WP_012537367.1\|2341688_2342549_-	RNA polymerase sigma factor RpoH	A0A248SJA5	Salicola_phage	5.6e-42	38.8
WP_009568267.1\|2342692_2343598_-	ABC transporter permease	NA	NA	NA	NA
WP_009568266.1\|2343594_2344266_-	cell division ATP-binding protein FtsE	G9BWD6	Planktothrix_phage	3.1e-32	39.2
WP_009568264.1\|2344262_2345294_-	signal recognition particle-docking protein FtsY	NA	NA	NA	NA
WP_009568262.1\|2345416_2345986_+	16S rRNA (guanine(966)-N(2))-methyltransferase RsmD	NA	NA	NA	NA
WP_012537368.1\|2345978_2346503_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	6.2e-28	45.2
WP_012537369.1\|2346531_2346783_+	YfhL family 4Fe-4S dicluster ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	7.9e-21	57.6
WP_012537370.1\|2346766_2348746_-	GTP-binding protein	NA	NA	NA	NA
WP_009567582.1\|2348762_2349575_-	bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase	A0A127AWE5	Bacillus_phage	1.9e-15	25.2
WP_009567581.1\|2349577_2350444_-	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_012537371.1\|2350433_2351531_-	peptide chain release factor 1	A0A0S4KWG0	Pseudomonas_phage	1.5e-07	42.4
WP_012537372.1\|2351527_2352859_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_012537373.1\|2352913_2354575_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_009567130.1\|2354571_2355228_+	outer membrane lipoprotein LolB	NA	NA	NA	NA
WP_012537374.1\|2355224_2356070_+	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
WP_009567132.1\|2356197_2357145_+	ribose-phosphate pyrophosphokinase	A0A2K9L8D8	Tupanvirus	2.3e-44	37.7
WP_041646513.1\|2357978_2358890_-	DUF2034 domain-containing protein	NA	NA	NA	NA
WP_009566528.1\|2359178_2359331_+	hypothetical protein	NA	NA	NA	NA
WP_009566530.1\|2359859_2360099_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_012537379.1\|2360279_2360549_-	hypothetical protein	NA	NA	NA	NA
WP_012535799.1\|2361623_2362943_+\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_012535798.1\|2363064_2363379_+\|transposase	DDE transposase family protein	NA	NA	NA	NA
WP_009561129.1\|2363803_2364046_-	hypothetical protein	NA	NA	NA	NA
WP_012537380.1\|2364352_2365138_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_012536793.1\|2365613_2366441_-	cell division protein ZapE	U5N3V8	Enterobacteria_phage	1.6e-33	33.1
WP_012536794.1\|2366437_2367922_-\|transposase	IS21-like element ISAfe9 family transposase	NA	NA	NA	NA
WP_080515405.1\|2367994_2369320_-	benzoylformate decarboxylase	NA	NA	NA	NA
WP_012537381.1\|2369547_2370168_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_009561617.1\|2370199_2370478_-	hypothetical protein	NA	NA	NA	NA
WP_012537382.1\|2370692_2372717_-	copper-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	8.5e-73	33.9
WP_041646518.1\|2373034_2373388_+	hypothetical protein	NA	NA	NA	NA
WP_155115441.1\|2373481_2373871_+	hypothetical protein	NA	NA	NA	NA
WP_009569871.1\|2373925_2374288_+	copper-binding protein	NA	NA	NA	NA
WP_009569872.1\|2374412_2374721_+	hypothetical protein	NA	NA	NA	NA
WP_041647500.1\|2375167_2375995_+	hypothetical protein	NA	NA	NA	NA
WP_012537385.1\|2376275_2377430_-	outer membrane beta-barrel protein	NA	NA	NA	NA
WP_009569877.1\|2378337_2378691_+	YbjQ family protein	NA	NA	NA	NA
WP_012537386.1\|2378810_2379593_-	hypothetical protein	NA	NA	NA	NA
WP_012537387.1\|2379804_2382873_-	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	3.6e-67	25.9
WP_012537388.1\|2382869_2383655_-	hypothetical protein	NA	NA	NA	NA
WP_012537389.1\|2383642_2384899_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_009565342.1\|2385038_2385260_-	DUF4926 domain-containing protein	NA	NA	NA	NA
WP_009565339.1\|2385294_2385561_-	hypothetical protein	NA	NA	NA	NA
WP_012537390.1\|2385585_2387163_-	SAM-dependent DNA methyltransferase	NA	NA	NA	NA
WP_111122581.1\|2387186_2387672_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_080513214.1\|2387648_2387942_-	PIN domain-containing protein	NA	NA	NA	NA
WP_012537392.1\|2388373_2389054_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_012537393.1\|2389163_2389574_+	hypothetical protein	NA	NA	NA	NA
WP_012607533.1\|2389683_2390208_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	2.5e-21	38.8
WP_012537395.1\|2390245_2391736_-	DNA-3-methyladenine glycosylase 2 family protein	NA	NA	NA	NA
WP_012537396.1\|2391967_2392366_+	VOC family protein	NA	NA	NA	NA
WP_012537397.1\|2392362_2393106_+	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	5.4e-17	30.3
WP_012535798.1\|2393312_2393627_-\|transposase	DDE transposase family protein	NA	NA	NA	NA

DBSCAN-SWA_8

2753139 : 2767473

Enterobacteria_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012535798.1\|2753139_2753454_-\|transposase	DDE transposase family protein	NA	NA	NA	NA
WP_012535799.1\|2753575_2754895_-\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_012536793.1\|2755867_2756695_-	cell division protein ZapE	U5N3V8	Enterobacteria_phage	1.6e-33	33.1
WP_012536794.1\|2756691_2758176_-\|transposase	IS21-like element ISAfe9 family transposase	NA	NA	NA	NA
WP_009565743.1\|2758415_2758643_+	hypothetical protein	NA	NA	NA	NA
WP_012607643.1\|2758752_2758911_+	hypothetical protein	NA	NA	NA	NA
WP_012536826.1\|2760166_2761195_-\|transposase	IS110-like element ISAfe1 family transposase	NA	NA	NA	NA
WP_041646670.1\|2762787_2763084_-	hypothetical protein	NA	NA	NA	NA
WP_012537644.1\|2763313_2764231_-	restriction endonuclease	NA	NA	NA	NA
WP_009565616.1\|2764698_2764959_+	hypothetical protein	NA	NA	NA	NA
WP_012607644.1\|2765129_2765408_+	hypothetical protein	NA	NA	NA	NA
WP_012535799.1\|2765717_2767037_+\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_012535798.1\|2767158_2767473_+\|transposase	DDE transposase family protein	NA	NA	NA	NA

DBSCAN-SWA_9

2779424 : 2818766

Paramecium_bursaria_Chlorella_virus(25.0%)

transposase,tRNA,integrase

attL 2806823:2806838|attR 2824078:2824093

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012535799.1\|2779424_2780744_+\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_012535798.1\|2780865_2781180_+\|transposase	DDE transposase family protein	NA	NA	NA	NA
WP_009568473.1\|2782126_2783956_-\|transposase	transposase	NA	NA	NA	NA
WP_009568474.1\|2783967_2785623_-	ATP-binding protein	NA	NA	NA	NA
WP_012537651.1\|2785606_2787772_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_012607647.1\|2787768_2788605_-\|transposase	heteromeric transposase endonuclease subunit TnsA	NA	NA	NA	NA
WP_012537653.1\|2788778_2790614_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	M1HVL7	Paramecium_bursaria_Chlorella_virus	3.8e-128	42.8
WP_012537654.1\|2790659_2792027_-	UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase	A0A1V0SB89	Catovirus	4.3e-12	29.3
WP_009569104.1\|2792155_2792581_-	F0F1 ATP synthase subunit epsilon	NA	NA	NA	NA
WP_012537655.1\|2792584_2793994_-	F0F1 ATP synthase subunit beta	NA	NA	NA	NA
WP_012537656.1\|2794035_2794902_-	F0F1 ATP synthase subunit gamma	NA	NA	NA	NA
WP_012537657.1\|2794911_2796456_-	F0F1 ATP synthase subunit alpha	NA	NA	NA	NA
WP_009561112.1\|2796472_2797012_-	F0F1 ATP synthase subunit delta	NA	NA	NA	NA
WP_009561113.1\|2797022_2797502_-	F0F1 ATP synthase subunit B	NA	NA	NA	NA
WP_009561114.1\|2797544_2797799_-	F0F1 ATP synthase subunit C	NA	NA	NA	NA
WP_012537658.1\|2797840_2798590_-	F0F1 ATP synthase subunit A	NA	NA	NA	NA
WP_012537659.1\|2798592_2798964_-	hypothetical protein	NA	NA	NA	NA
WP_009566150.1\|2799018_2799903_-	ParB/RepB/Spo0J family partition protein	S5VSZ7	Leptospira_phage	5.3e-11	32.9
WP_012537660.1\|2799899_2800682_-	ParA family protein	V5UP47	Mycobacterium_phage	7.7e-14	31.3
WP_012537661.1\|2800728_2801394_-	16S rRNA (guanine(527)-N(7))-methyltransferase RsmG	NA	NA	NA	NA
WP_012537662.1\|2801398_2803273_-\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG	NA	NA	NA	NA
WP_012537663.1\|2803291_2803741_-	copper resistance protein NlpE	NA	NA	NA	NA
WP_012607648.1\|2803728_2804268_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_012537664.1\|2804277_2804820_-	molybdenum cofactor biosynthesis protein B	NA	NA	NA	NA
WP_009560967.1\|2804968_2805904_+	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_009560966.1\|2805934_2806876_+	magnesium transporter CorA family protein	NA	NA	NA	NA
2806823:2806838	attL	NA	NA	NA	NA
WP_012537665.1\|2806883_2807783_+	hypothetical protein	NA	NA	NA	NA
WP_009566393.1\|2807798_2808713_+	magnesium transporter	NA	NA	NA	NA
WP_012537666.1\|2808793_2809864_-	ADP-ribosylglycohydrolase family protein	NA	NA	NA	NA
WP_009560955.1\|2810254_2810707_+	NAD(P)H:quinone oxidoreductase	NA	NA	NA	NA
WP_009560954.1\|2810710_2811583_+	pirin family protein	NA	NA	NA	NA
WP_012537667.1\|2811789_2812467_+	hypothetical protein	NA	NA	NA	NA
WP_080513205.1\|2812363_2812645_-	TraM recognition domain-containing protein	NA	NA	NA	NA
WP_009568470.1\|2813216_2815523_+	TonB-dependent receptor	NA	NA	NA	NA
WP_012537668.1\|2815608_2818404_+	bifunctional YncE family protein/alkaline phosphatase family protein	NA	NA	NA	NA
WP_009561902.1\|2818550_2818766_-\|integrase	phage integrase	NA	NA	NA	NA
2824078:2824093	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_011206

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection