CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP034669	Corallococcus coralloides strain B035 chromosome, complete genome	11 crisprs	DEDDh,csa3,cas3,WYL,Cas9_archaeal,RT,2OG_CAS,DinG,PD-DExK	10	34	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP034669_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP034669_5

1944101-1944177

Orphan

Consensus_repeat	Method
AACCTGTCCGACAGTCGGACAGGTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP034669_5

>merge|CP034669|5|1944101-1944177|CRISPRCasFinder
AACCTGTCCGACAGTCGGACAGGTTTGCGTCGCTTGCGGCCCGGGGCCACGAACTTGTCCGACAGTCGGACAGGTTT

>CP034669|5|4|1944101-1944177|CRISPRCasFinder
AACCTGTCCGACAGTCGGACAGGTTT	GCGTCGCTTGCGGCCCGGGGCCACG
AACTTGTCCGACAGTCGGACAGGTTT

Protein	Signature genes	Signature genes Name	Protein_function
CP034669.1\|QAT83240.1\|1930335_1931652_-\|glucan-endo-1,3-beta-glucosidase-A1	unknown	unknown	gnl\|CDD\|185693
CP034669.1\|QAT83252.1\|1945789_1946125_-\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT83251.1\|1945429_1945786_-\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT83244.1\|1938245_1939595_+\|EmrB/QacA-family-drug-resistance-transporter	unknown	unknown	gnl\|CDD\|129794
CP034669.1\|QAT83250.1\|1945138_1945426_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|238084
CP034669.1\|QAT83256.1\|1951627_1952563_+\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT83239.1\|1929578_1930325_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|153240
CP034669.1\|QAT83241.1\|1931741_1934327_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379155
CP034669.1\|QAT83246.1\|1941084_1943388_-\|putative-thioredoxin	unknown	unknown	gnl\|CDD\|239245
CP034669.1\|QAT83254.1\|1947358_1950172_+\|serine/threonine-protein-kinase	unknown	unknown	gnl\|CDD\|270916
CP034669.1\|QAT83238.1\|1928697_1929552_-\|glucan-endo-1,3-beta-glucosidase-A1	unknown	unknown	gnl\|CDD\|185693
CP034669.1\|QAT83243.1\|1936756_1937992_-\|acetyl-CoA-acyltransferase	unknown	unknown	gnl\|CDD\|236197
CP034669.1\|QAT83249.1\|1944999_1945185_+\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT83245.1\|1939600_1941082_-\|FHA-domain-containing-protein	unknown	unknown	gnl\|CDD\|366133
CP034669.1\|QAT83247.1\|1943528_1943888_+\|alpha-L-glutamate-ligase	unknown	unknown	gnl\|CDD\|273994
CP034669.1\|QAT83255.1\|1950226_1951570_+\|sigma-54-dependent-transcription-regulator	unknown	unknown	gnl\|CDD\|225114
CP034669.1\|QAT83248.1\|1944239_1944959_-\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT83257.1\|1952611_1953886_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236090
CP034669.1\|QAT83242.1\|1934426_1936688_+\|RCC1-repeat-containing-protein	unknown	unknown	gnl\|CDD\|227511
CP034669.1\|QAT83253.1\|1946228_1947005_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378183

Protein	Function_ID	Function_description	E-value
CP034669.1\|QAT83240.1\|1930335_1931652_-\|glucan-endo-1,3-beta-glucosidase-A1	gnl\|CDD\|185693	cd08023, GH16_laminarinase_like, Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.	1.0504e-88
CP034669.1\|QAT83255.1\|1950226_1951570_+\|sigma-54-dependent-transcription-regulator	gnl\|CDD\|225114	COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms].	1.35978e-118
CP034669.1\|QAT83244.1\|1938245_1939595_+\|EmrB/QacA-family-drug-resistance-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	9.91052e-54
CP034669.1\|QAT83250.1\|1945138_1945426_+\|hypothetical-protein	gnl\|CDD\|238084	cd00146, PKD, polycystic kidney disease I (PKD) domain; similar to other cell-surface modules, with an IG-like fold; domain probably functions as a ligand binding site in protein-protein or protein-carbohydrate interactions; a single instance of the repeat is presented here. The domain is also found in microbial collagenases and chitinases.	0.00244415
CP034669.1\|QAT83239.1\|1929578_1930325_-\|hypothetical-protein	gnl\|CDD\|153240	cd03146, GAT1_Peptidase_E, Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E. Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E. This group contains proteins similar to the aspartyl dipeptidases Salmonella typhimurium peptidase E and Xenopus laevis peptidase E. In bacteria peptidase E is believed to play a role in degrading peptides generated by intracellular protein breakdown or imported into the cell as nutrient sources. Peptidase E uniquely hydrolyses only Asp-X dipeptides (where X is any amino acid), and one tripeptide Asp-Gly-Gly. Peptidase E is believed to be a serine peptidase having a Ser-His-Glu catalytic triad which differs from the Cys-His-Glu catalytic triad typical of GATase1 domains by having a Ser in place of the reactive Cys at the nucleophile elbow. Xenopus PepE is developmentally regulated in response to thyroid hormone and, it is thought to play a role in apoptosis during tail reabsorption.	3.11664e-16
CP034669.1\|QAT83241.1\|1931741_1934327_+\|hypothetical-protein	gnl\|CDD\|379155	pfam13385, Laminin_G_3, Concanavalin A-like lectin/glucanases superfamily. This domain belongs to the Concanavalin A-like lectin/glucanases superfamily.	2.28584e-15
CP034669.1\|QAT83246.1\|1941084_1943388_-\|putative-thioredoxin	gnl\|CDD\|239245	cd02947, TRX_family, TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains. Group I TRX is a small ancient protein that alter the redox state of target proteins via the reversible oxidation of an active site dithiol, present in a CXXC motif, partially exposed at the protein's surface. TRX reduces protein disulfide bonds, resulting in a disulfide bond at its active site. Oxidized TRX is converted to the active form by TRX reductase, using reducing equivalents derived from either NADPH or ferredoxins. By altering their redox state, TRX regulates the functions of at least 30 target proteins, some of which are enzymes and transcription factors. It also plays an important role in the defense against oxidative stress by directly reducing hydrogen peroxide and certain radicals, and by serving as a reductant for peroxiredoxins. At least two major types of functional TRXs have been reported in most organisms; in eukaryotes, they are located in the cytoplasm and the mitochondria. Higher plants contain more types (at least 20 TRX genes have been detected in the genome of Arabidopsis thaliana), two of which (types f amd m) are located in the same compartment, the chloroplast. Also included in the alignment are TRX-like domains which show sequence homology to TRX but do not contain the redox active CXXC motif. Group II proteins, in addition to either a redox active TRX or a TRX-like domain, also contain additional domains, which may or may not possess homology to known proteins.	7.13376e-28
CP034669.1\|QAT83254.1\|1947358_1950172_+\|serine/threonine-protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	5.28613e-84
CP034669.1\|QAT83238.1\|1928697_1929552_-\|glucan-endo-1,3-beta-glucosidase-A1	gnl\|CDD\|185693	cd08023, GH16_laminarinase_like, Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.	7.16388e-90
CP034669.1\|QAT83243.1\|1936756_1937992_-\|acetyl-CoA-acyltransferase	gnl\|CDD\|236197	PRK08242, PRK08242, acetyl-CoA C-acetyltransferase.	0
CP034669.1\|QAT83257.1\|1952611_1953886_-\|hypothetical-protein	gnl\|CDD\|236090	PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated.	0.000114511
CP034669.1\|QAT83245.1\|1939600_1941082_-\|FHA-domain-containing-protein	gnl\|CDD\|366133	pfam00498, FHA, FHA domain. The FHA (Forkhead-associated) domain is a phosphopeptide binding motif.	4.32903e-20
CP034669.1\|QAT83247.1\|1943528_1943888_+\|alpha-L-glutamate-ligase	gnl\|CDD\|273994	TIGR02144, lysine_biosynthesis_enzyme, Lysine biosynthesis enzyme LysX. The family of proteins found in this equivalog include the characterized LysX from Thermus thermophilus, which is part of a well-organized lysine biosynthesis gene cluster. LysX is believed to carry out an ATP-dependent acylation of the amino group of alpha-aminoadipate in the prokaryotic version of the fungal AAA lysine biosynthesis pathway. No species having a sequence in this equivalog contains the elements of the more common diaminopimelate lysine biosythesis pathway, and none has been shown to be a lysine auxotroph. These sequences have mainly recieved the name of the related enzyme, "ribosomal protein S6 modification protein RimK". RimK has been characterized in E. coli, and acts by ATP-dependent condensation of S6 with glutamate residues.	4.33941e-10
CP034669.1\|QAT83242.1\|1934426_1936688_+\|RCC1-repeat-containing-protein	gnl\|CDD\|227511	COG5184, ATS1, Alpha-tubulin suppressor and related RCC1 domain-containing proteins [Cell division and chromosome partitioning / Cytoskeleton].	2.55238e-50
CP034669.1\|QAT83253.1\|1946228_1947005_+\|hypothetical-protein	gnl\|CDD\|378183	pfam09414, RNA_ligase, RNA ligase. This is a family of RNA ligases. The enzyme repairs RNA strand breaks in nicked DNA:RNA and RNA:RNA but not in DNA:DNA duplexes.	0.000506058

>CP034669.1|QAT83247.1|1943528_1943888_+|alpha-L-glutamate-ligase
MDFAADDCAVVEPFIDYERDVRCLAVGERMWAMTRASAGWRANVDTRKYHVIDPPPELAEHTRRAMRHLGADVLGLDFLQAKDGAYTLLECNDTPGLSGFPEELREDVAECLRVRMRQR
>CP034669.1|QAT83246.1|1941084_1943388_-|putative-thioredoxin
MAGVPVELTPEDFEAVTQKPGMCVVDFWAPGCEPCHAFAPIFTEAAARFPDITFARLDAEAHEAVAEPLGIDAYPTLVAFKDGLEVRRVSEALPAEALDRLLIALRAVDVEEEERRKANRERTQAGQLPTGVPEGATWDDGDEEWSFGPKDAKGRPHGTWRYWRADGTLCNECIMVQGRPHGPFKRFHEDGSVSQEGAFAQGQLHGPRTWIASDGFTTERMHEGGVSERVRKTVMHYDRGTVRQVEHFNGDGQRVVPSTGEPYPTRPAHLPEDAELREDLNQWARVTLNADRERHGLTRFWDAQGQLLWEAEFDNGRRHGRYWSRAEDTYADFRVHFEEGRAEGDFACGEWSLLDAQRAVVLQRDLGQAMDEQTLARSPVFSNLPRSAEGWRELAKEARADRRYREALLATARACATSLDVQPLKQGLEELTLPRTQDSARQVAHSVVEDAGQAWAPMADALMRGGEAATLLRGYAVLLDQTDRPRAALDFLHAAMLLAPERKAYLFTRGLILLNLGVADQVRKDAEGLAAVEPDTARFLATYARALFPRFDFWAGQEPPHCTYDGLPEKPEQPLEAIQQLVRKYATRLQAMRGALLQRYKPGAAVSWLPPDLSGLLGEGPVELKQEALESDEDEQVEIDETLDLEMGFADLAMMLRGDWSALSWLLWSCGETAFQMPTRIAPPAGYGQAAGQASQRLWQSRDRKFRGNASTTKPGQGFLFEGVALGDLHPNLVSIAERQYAETQAMFYWLNDPDHVSPWQSNLRGS
>CP034669.1|QAT83245.1|1939600_1941082_-|FHA-domain-containing-protein
MNRIRETIEVAEPLWRALEQMSHDLGVDRNALVAQALFMLARQNGYVAPTPVALGVMGAGEPVRASVARAPEPVVRPAELPAPAVIPAAAVPAAAVVPAVAAVPAAAAVSAKETVAAVPAATVSEPAKAQSAVDEAAHTRARMQEVLAAVDAVAQPRDVPVASDDEEEADDEEESDSDEDSDDEESDDEAADESSDDEESDDESSADESDEEAADESSDDEESDESSDDEESDDEASDDEESEDDDASEAAAGDSDDEDASEAAAAADQDSDDEDASQDSEEDDASAADIAAAIGSEELPGTDEDSEPEEAKTGEEATGSEEDDSADEPDAQVASSSEAAEDDQQDSGAEEQDLPFVAPPAAKAPAARRQGRVLRPSTPEDDAPRRPAPAARAPVRMDLFVRLSPDGPATRVDVERFTLGRGPQCSLVVKSGRVSREHAAVTRDGADYFIEDLGSSNGTWINHQRIKRQKIADGDTFNLGTEAVYFSFQPAED
>CP034669.1|QAT83244.1|1938245_1939595_+|EmrB/QacA-family-drug-resistance-transporter
MTPPQRLVLGIAVLASLVTFLDGAIINVALPAMVRDLGGGLKLQQWVVDAYLITLGSLMLAAGSLSDVFGRKRILRLGLLGFGATSLLCAVAPTGAVLVLARALQGATGALLVPGSLALILSFFSGPEQAKAIGAWTGWTGGAFIAGPLVGGLLVDTVGWRWIFAINVLPIGLTLALLARMEEPTRPGGARIDVLGAVLACVGLGGPVYALIEQGTVGWTHPTVLASLGVGVPAFIAFLWQERRSPHPMMPLGLFRARNFWVGNLATTFIYGALALSEFLITLFLQQVGGFRATLAGLSLLPTTILMLLLSSTFGGLAGRFGPRLFMAVGPCVAGAGFLLMLRVGTPLDFWTQMLPGVLVFGLGLTTTVAPLTAAVLGSVHKAQAGIGSAINNAIARVAGLVAIAFAGLIVGPRLDVAGFHRAMLVSAVLLVLGGVTSALGIRNPSRKA
>CP034669.1|QAT83243.1|1936756_1937992_-|acetyl-CoA-acyltransferase
MTASYIIDAVRTPRGRGKMGKGALTGLHPQELLAQTLNALQRRGGWDAREVGDVIAGCVSQVNEQGANIARNAVLAAGWPQDVSAVSLNRFCGSGLQAVNFGAMGVASGAMDFVVTGGVESMSHLSLGADGGGQDGGNVRLRERVYQVPQGISADLIATLEGITREDVDAWALRSQRQAARAIEENRFAKALFAVKDPATGAVLLERDEYPRPDTTAQGLAALKPAFVAMGETAVGPNGETLDGIALAAYPRAKRIQHVHTAGNSSGIVDGAAVVALASERYVKEKGLKPRARIRAMATLGTEPLIMLTAPAPVSEKALRMAGMKAGDIDLWEINEAFAGVVLQTTRALGIDPDRVNVNGGSIALGHPLGATGAMLLGTALDELERTGKQTALITLCIGGGQGIATIIERV
>CP034669.1|QAT83242.1|1934426_1936688_+|RCC1-repeat-containing-protein
MSALRGGGRSRFVLGLVLCLGWLSGCAGPVAPQEEAADPGVAQAAVTAPTWTVVRAGQLHSLGLQADGTVWAWGYNRYGQLGNNTTTDRLAPVKVTGLTGVVVDIAAGNEHSVAVKADGTVWAWGRNDLGQLGDNTTTQRLKPVKVSGLTGVMAVAAGYRYSLALKTDGTVWAWGDNASGKLGDGTRVRKLTPVQVVGLTGVAGVSAGYGHAVAFKTDGTVWGWGSNSVGELGDGTSYYERLTPVQTSGLTGVVALAARSGRSFALKSDGTVWAWGSNFGGELGDGTTVNRLSAVQLPGFTTAVALGTGVGANLVATADGTVWSWGYNSRGELGDGTTTSRMTPSPVLALTGAVSLSSGQEHALAVKGDGSLWAWGGNLTGQLGDGFPEEYVSRTASLFTGAKAVAGGDSFSVGLKPDGTVWTWGRNEQGQLGDGTTQAHWAPAQVPGLGSVTAVFARGSTALALKTDGTVWAWGDNASGQLGDGTTVSRASPAQVPGLTDVSALAMGWGFVLAARTDGTVWAWGSNSSGTLGDGTTTSRATPQAVAGLTDVRAVAAGSGFSVALKTDGAVWTWGSNALGQLGDGSSSNWPPRTTPGLVPGLAGVSSVASGNSHTVVLKTDGTVWGWGDNYRGQLGDGSRSMGRSPVQALDFTGGTAIAAGNSHTLALQSDGTVWAWGYNGSGQLGDGFTDDQLAPAQVPGIIDATDVAAGNYHSFARRASGAVWGWGDNGYGQLGTGNAGYRVVPYQVSPTP
>CP034669.1|QAT83241.1|1931741_1934327_+|hypothetical-protein
MKKLLSGALGVVLGTALAGLPGAVLAEGRPSLVNTRIGTPFGANGHSSTVDGRIFVGNIGEDHATTTTTWIARVFRPEAVTYDTAGKPSFAGTFSAGKTVTVRNGENALAFCFTNPAQPYALASGVAVYQPYLFDSMMFNGDNVFRRRTTDLRVSQPFTTAAEVASFSTGPLETLRTVTGATIRGIEPTMTSDGRLLIWQGAPANTGGIDHMMYAYNPTPCAATGWSTPRPLSMMFNDPNAGVKRYPLAWKRLKAATGEDFGDTTSGALVRGAYAWVDHEGRNLLYIAVTYTDGARREAVSLVGADTNWTAYHIDGAINTDRMDLAHLFYSGPMWNFEQERLPSQSFPPGRSNAAHYLPVTKTHDVLALFGSNTADYNEVDLGELMDPFHLLFLPMNELVTRAGAYDLTRTPDLSGRFFTGTLVGGASISPGNALTRSSPDSLWQPHGKGKALVVPGGSALSVNLADPSGTVPGVGAFVRGLSVEFAVRPDADIQQGCTTGNPYRYLMHKSGGLDIIYEASNQVQFSLVVNGQRVRLGGGPVLPVGQWSHLAYTWDGTTGVFREYLNGVPTNRALPVAPGTARLGTGTLYIGAGANLDTQRCPANGEGSFRGAIDEVRIFTHARSNRSICMTAHGANCREEAIQHTPSAGQFVLSAQAPACNGTSALNSAACLSAMHRACAQRGAGDALANTSNTWDTILQLVSNRPPISLAGVPVASTATDLTVACAPIQHESVAVTFEELTRIHAGCTDERGVTSTHCSAAAHRFCNSQGWTTGQVFEVTSRPWVGCFNSGLRTDVEKSVLGPVSNLGDYTAPGSRLEVSQWCRAQGYGAGVVQEIPSATKAHVHCFQPAVTAPWRYLP
>CP034669.1|QAT83240.1|1930335_1931652_-|glucan-endo-1,3-beta-glucosidase-A1
MATRAGKTLWALAAVLGLTACGGGSAPAQDATLRTPVVAEREQSATAAPLGQTVWLKACATQKFVSADRNLGATAPLVANRDSAQGWEQFQVADAGNDFISLRVVETGLYVSADPNAGGQVTGFRTAVGDWERFTWVPFADGSVGLRAKSTGQYVSADANQGASAPLYANRATAGCWESFSFGVVGGGEDRWVQIWSDEFDGNSVNTANWTPNTTVHVNNEQQQYTNSGDNISVSNGTLKLTARLQWNNGYPFTSGRLESAGKREFSHGRIEARIKMPVGAGLWPAFWMLGNDINTIGWPACGELDIMENVGYGDWVSGALHGPGYSGNTPINGRFYPSSSVSNWHVYRTEYSSSDIKWFIDGALVKTTTRAEVLRYGAWAYDKPLFIILNLAVGGGYPFGVNGASTPYYGVPQSTVDLVRNAPQTMEVDWVRAYQWR
>CP034669.1|QAT83239.1|1929578_1930325_-|hypothetical-protein
MTLPPLLLLADSAPLFWRVEGRPFLDYVRVLTGAELRVPPVKAAYLGASNGDVPEFYDIFVAAMEGIGIQRCRSIPARPSGEDLTWLKDADVILLAGGDPRVGWNAFQAHGVDAVLRERHQAGAVLMGVSAGAMHLGLGAWCEDLPGDGEPFPVLGLAPYLIGVHEPPEWPGLKLAVRRMGLPTRGLGIPQGGGVLLHADGSVEPVRQTVVDVTVDVEGRLHESLLLPPATPYRGESPEAPVDRRTLQ
>CP034669.1|QAT83238.1|1928697_1929552_-|glucan-endo-1,3-beta-glucosidase-A1
MATSTGRTVTAWALVAGLTACAGAPKRAEAVAPTEGGWVQVWSDEFNGTEVDASNWRIQTDVHVNNEQQQYTTSPDNVSVSGGTLKLTARMQTANGYPFTSGRVESAGKREFKHGRVEARIKLPVGVGLWPAFWMLGSDIHTTGWPACGELDIMENVGYGDWVSVALHGPGYSGNTPINGRFFPRTPVSDWHEYGVETSPEAIHWYIDGERVKTSTREEVERHGAWAYDKPLFIIFNFAVGGGYPEGVNNAKEPYFGVPQATADLLRDAPQTMEVDWVRVSERR
>CP034669.1|QAT83248.1|1944239_1944959_-|hypothetical-protein
MTSRRNAAALQVREQELVRLRLVPHRVDAVDVHLPRRKPLQRVQRRRVVLRPALAGERTQEDARRRLERDRRFRLRQPEVLRRLRRAAAGEAEREGEPASKPRGYPPRDGETAHEGAPGEGGVPRVSACPNGCRRPPTEGSSQEARWPLLHGGTAPTMALEPHQRRSTSPGEREWSVMTDRGREGLSPLMRPRGTENAEGGGLPSAISRSSCASTYATSPPRFLPIPVPASPSNHRGLT
>CP034669.1|QAT83249.1|1944999_1945185_+|hypothetical-protein
MTLVPYSFQSGAADAFWPGGTYVDWVGADAYNWNGCNPMAGDTSMVGGLLGVQRGRLSCIG
>CP034669.1|QAT83250.1|1945138_1945426_+|hypothetical-protein
MDSSASSVDGFHALGDSGYTHATAAAWLQPSTTTGTGNDAWSLDYGDGSAQVTGRGRPTALQTHRYTAKGTYRASLTVTDWKGVRNTDTRVLTVK
>CP034669.1|QAT83251.1|1945429_1945786_-|hypothetical-protein
MPELSPIVAGVIAIGPFRRSLVPFLEYSAHAYEHTREGARIIVTILHDSHDPVMLRDVGECLGLDPWDFNTHVIDFAKIDLECLGIVWENDELPERMTALKDAGFQFYFRMQHWKFAA
>CP034669.1|QAT83252.1|1945789_1946125_-|hypothetical-protein
MGMYGEVLGIGPFRRELVPFLQQPEAWHRDTREGALIVVPVFSAPEGSSRSRALAGCFGADPWDFNTHALDPWRADVDALKRFEQPGEEHRLECFLRLRDAGFSFYFQPNG
>CP034669.1|QAT83253.1|1946228_1947005_+|hypothetical-protein
MTFSVRTANLRTLNSLTKYPSIPTYHTLGDKGRLAEPAIAFDGPVVGTEKVDGTNARIVFLPDGTYLLGSREELLYASGDLIGNPALGIVEHLRPVADALREKRLDAGGITVVFGEVYGGNVTAHSKQYTGEKRVGYRVFDVVRLTDYETPLTWSAEQLSGWRESGGQPFVTEDALMAFTREHGLETTPRILEQDGAAMPKDLEGAFAWLRSHAPATRCALDAGAGQHPEGIVVRTRDRRTIAKLRYEDYERTQRVKR
>CP034669.1|QAT83254.1|1947358_1950172_+|serine/threonine-protein-kinase
MTKRDTGRRNTGTGNSDSVRSGAGTGRGSGYGTGPRPRRAEDVPPVPQVGRYLLLRKLGQGGMGVVYAAYDPDLDRKIALKLLHPNANHDNEEARSRLLREAQAMARVSHPNVIPVFDVGMWGDQVFVAMELVEGGTLGSWLKEAKPSWREVLERYLQAGRGLQAAHAAGLVHRDFKPANVLVSHAGRVYVTDFGLARQVGDGPEAPVSPEEAQVLESSDRRMLDTTLTEAGLLVGTPNYMSPEQFRGTQLDARTDQFSFCAALYGALYGTRPFDPGSIKAYASASRSAELEATGTQSLGGTQSLNAAPAKAPVISPPPALIREPPREAKVPGWVRQAVLRGLALDADARFPSMQALLDALSQEQRHGQRKRWLGAAGAMATSLAVAGGVAWQQSQVCADAGSLMDSVWTPDAKARLESAFRATGKPFAEGMAVRAVQVLGQYADAWKHQRVQACEDARVSGVKPEEQLDRQVVCLERRRKDLRATVDLLASADAAMVEKSVDMAHALPALHECEDVEALAEQQRRPADPALRGAIEALEDQLSEVRAQVDAGRYPAALAAVKALEAPVEKTGYLPLKAEMRFHLGWLQEQTGQSPEASRLLSRAVFDAEAGRADRLKVAILNKLLYVEDGQKHFDPAANWGALAEATLQRLGGEPVLQADVKVNQANLAMSQGHMEEARARLTEASALYDKALPPEHPKRARALFLLGRLLLGTGDAKGAVPLLEASLAKTLAAVGPVHPDVARRHGLLSLALRDAGQPARALPHAQAVVDLYKTLHGEKSAQVAEALDELGMCQLGMKRYDDALKTYEQAVALKRELLPEGDEGLQPSYDGVGQALLGLGRARDSVAPLQLAVSFASAPPDALAESGFALARALYQTGQSPEARAEARSEATRARERFSESGMDARVGEVDSWLETLPQEPPRPPARRPSRGRRR
>CP034669.1|QAT83255.1|1950226_1951570_+|sigma-54-dependent-transcription-regulator
MSLPPDEDEALLDATATLNRGRAGQVRMVLRVLSGAEAGKAHPLKQGTYVVGKAPTCDIVLSDKAVSRQHLKLEVHDEHVVATDLGSHNGSFVEGLRFTAMELRPGSVITLGATELKLVPEDTRERSLPLSSRDRFGALVGGSRKMREAFTVLERLAPGGADVLIHGETGTGKDLCAEAIHQQSPRAKGPFVIVDLAGVPSTLIESELFGHVKGSFTGAQADRAGAFERAQNGTVFLDEIGELPLELQPRLLRVLERRQVKRVGGNDYFTVNVRVVAASHVNLEQAVQQGKFRRDLFHRLAVLRVTLPALRERPEDIPFLIDHMLKQMGRPPGALSDQTRALLMQYPWPGNVRELRNVVEQVVNLGEEALPDLEAPPGADGRKGPDLDLPFKEAKEHLIEVFERDYLKNLIERCEGNISRASREADIDRVYLRKLLRKHGLDPSGDP
>CP034669.1|QAT83256.1|1951627_1952563_+|hypothetical-protein
MSVNISSNVLRTFQQLAEAKPSAPPQQAAQQAGLPEEKVVSQVEGTPTTAQTEQATDAFAVVQALNQAWASRFQPVSGASAKDLGVNGTLANAPKAPEIGGWNAAAGTDPGVVKQTNANDCGAAVAVMLGKEIGTSQAQPASDKEKMAALESRFTQGQGTSPHELSNMLANQGAKVTQTSSKLDTKALDDALARGAKGAVMVDSCLVDPTTKPGETGRAHWVSVEGKDDKGRYLIKDPSTGSKIPVDAQRLADSMQISWDRHQGGGQMIVESAQGMSEAQAAKEGGLKAVALGNTDGGGSRAMSNFGRESS
>CP034669.1|QAT83257.1|1952611_1953886_-|hypothetical-protein
MSVRLPSGLPRPGLPLQSPAQEKEEKAQSGEGRSSGKASGKGGAGKGGVAVKGGSAKGASAKGGLEQAGPQDGMDFGRSGEAERNEAGGGGARGAQQQAGMAPGTSQGAASLGSLEQPPALAAQTPQTAPALPQPPPPTPQAPGAPQLERRPAASESSRERTASDGQSSEAAKQALEGRAKLRMAVLNRLYRGLTEVEGKMSAFLANPGRQGVVTLPVVLSVSTVTFEWWQSANAVPEDRAYLAQVLGEPGTADDATLLGTLRAEIAQAFAEFPRTPQGVEARKLYDAVLQKYEAARIQPIIAGHDSGPVVEECARLGLSCETDFTRSLLLSPWMLATSQSPDEGSATQVMVAGLTLPQLGALVGHLRQLNPLLSNPQLRALLLRASTDKRLALRKAMGLEEVEQVQELARQLLRLQAVQHLTV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP034669_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP034669_6

1965195-1965336

Orphan

Consensus_repeat	Method
GCACGGGGGGGCGCCGCGACCTCCAAACCTGTCCGACAGTCGGACAGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP034669_6

>merge|CP034669|6|1965195-1965336|CRISPRCasFinder
GCACGGGGGGGCGCCGCGACCTCCAAACCTGTCCGACAGTCGGACAGGCTTCCGCGACCCGGCCGGGGCGGAGAATGTCCAAAGGAGCCTGTCCGCACGGGGGGGCGCCGCGACCTCCAAACCTGTCCGACAGTCGGACAGG

>CP034669|6|5|1965195-1965336|CRISPRCasFinder
GCACGGGGGGGCGCCGCGACCTCCAAACCTGTCCGACAGTCGGACAGG	CTTCCGCGACCCGGCCGGGGCGGAGAATGTCCAAAGGAGCCTGTCC
GCACGGGGGGGCGCCGCGACCTCCAAACCTGTCCGACAGTCGGACAGG

Protein	Signature genes	Signature genes Name	Protein_function
CP034669.1\|QAT83265.1\|1964241_1964748_+\|Rrf2-family-protein	unknown	unknown	gnl\|CDD\|224870
CP034669.1\|QAT83274.1\|1982180_1984133_+\|asparagine-synthase	unknown	unknown	gnl\|CDD\|132152
CP034669.1\|QAT83266.1\|1965584_1969940_-\|exoglucanase-B	unknown	unknown	gnl\|CDD\|212128
CP034669.1\|QAT83256.1\|1951627_1952563_+\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT83258.1\|1953911_1954919_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|366020
CP034669.1\|QAT83269.1\|1974666_1975254_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|176860
CP034669.1\|QAT83262.1\|1961839_1962712_+\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT83261.1\|1961335_1961605_-\|transglycosylase	unknown	unknown	gnl\|CDD\|225170
CP034669.1\|QAT83264.1\|1963298_1964294_+\|ferredoxin-reductase	unknown	unknown	gnl\|CDD\|99791
CP034669.1\|QAT83257.1\|1952611_1953886_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236090
CP034669.1\|QAT83260.1\|1958582_1961252_+\|putative-lipoprotein	unknown	unknown	gnl\|CDD\|365943
CP034669.1\|QAT83263.1\|1962910_1963276_+\|putative-methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|381253
CP034669.1\|QAT83275.1\|1984129_1985254_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|235874
CP034669.1\|QAT83268.1\|1973229_1974528_+\|acetamidase/formamidase	unknown	unknown	gnl\|CDD\|225279
CP034669.1\|QAT83272.1\|1978329_1980423_+\|WD-domain-/G-beta-repeat-containing-protein	unknown	unknown	gnl\|CDD\|238121
CP034669.1\|QAT83267.1\|1970119_1973191_+\|putative-S-adenosyl-L-methionine:-L-methionine-S-methyltransferase	unknown	unknown	gnl\|CDD\|215360
CP034669.1\|QAT83271.1\|1976812_1978156_+\|erythromycin-esterase	unknown	unknown	gnl\|CDD\|377470
CP034669.1\|QAT83259.1\|1955426_1958474_+\|branched-chain-amino-acid-ABC-transporter2C-amino-acid-binding-protein	unknown	unknown	unknown
CP034669.1\|QAT83273.1\|1980397_1981513_-\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT83270.1\|1975265_1976441_-\|Beta-lactamase-class-C-related-penicillin-binding-protein	unknown	unknown	gnl\|CDD\|365903

Protein	Function_ID	Function_description	E-value
CP034669.1\|QAT83265.1\|1964241_1964748_+\|Rrf2-family-protein	gnl\|CDD\|224870	COG1959, COG1959, Predicted transcriptional regulator [Transcription].	1.42497e-40
CP034669.1\|QAT83274.1\|1982180_1984133_+\|asparagine-synthase	gnl\|CDD\|132152	TIGR03108, eps_aminotran_1, exosortase A system-associated amidotransferase 1. The predicted protein-sorting transpeptidase that we call exosortase (see TIGR02602) has distinct subclasses that associated with different types of exopolysaccharide production loci. This model represents a distinct clade among a set of amidotransferases largely annotated (not necessarily accurately) as glutatime-hydrolyzing asparagine synthases. Members of this clade are essentially restricted to the characteristic exopolysaccharide (EPS) regions that contain the exosortase 1 genome (xrtA), in genomes that also have numbers of PEP-CTERM domain (TIGR02595) proteins.	1.07123e-112
CP034669.1\|QAT83266.1\|1965584_1969940_-\|exoglucanase-B	gnl\|CDD\|212128	cd11663, GH119_BcIgtZ-like, putative catalytic domain of glycoside hydrolase family 119 (GH119). The prokaryotic subgroup is represented by IgtZ, an alpha-amylase from a Bacillus circulans strain. The GH119 family is related to GH57, a chiefly prokaryotic family with the majority of thermostable enzymes coming from extremophiles (many of these are archaeal hyperthermophiles), which exhibit the enzyme specificities of alpha-amylase (EC 3.2.1.1), 4-alpha-glucanotransferase (EC 2.4.1.25), amylopullulanase (EC 3.2.1.1/41), and alpha-galactosidase (EC 3.2.1.22). GH57s cleave alpha-glycosidic bonds by employing a retaining mechanism, which involves a glycosyl-enzyme intermediate, allowing transglycosylation.	0
CP034669.1\|QAT83261.1\|1961335_1961605_-\|transglycosylase	gnl\|CDD\|225170	COG2261, COG2261, Predicted membrane protein [Function unknown].	2.67156e-07
CP034669.1\|QAT83258.1\|1953911_1954919_-\|hypothetical-protein	gnl\|CDD\|366020	pfam00314, Thaumatin, Thaumatin family.	2.50568e-11
CP034669.1\|QAT83269.1\|1974666_1975254_+\|hypothetical-protein	gnl\|CDD\|176860	cd07818, SRPBCC_1, Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins. Uncharacterized group of the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands. SRPBCC domains include the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of mammalian STARD1-STARD15, the C-terminal catalytic domains of the alpha oxygenase subunit of Rieske-type non-heme iron aromatic ring-hydroxylating oxygenases (RHOs_alpha_C), Class I and II phosphatidylinositol transfer proteins (PITPs), Bet v 1 (the major pollen allergen of white birch, Betula verrucosa), CoxG, CalC, and related proteins. Other members of the superfamily include PYR/PYL/RCAR plant proteins, the aromatase/cyclase (ARO/CYC) domains of proteins such as Streptomyces glaucescens tetracenomycin, and the SRPBCC domains of Streptococcus mutans Smu.440 and related proteins.	4.83439e-58
CP034669.1\|QAT83264.1\|1963298_1964294_+\|ferredoxin-reductase	gnl\|CDD\|99791	cd06194, FNR_N-term_Iron_sulfur_binding, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an N-terminal Iron-Sulfur binding cluster domain. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.	2.17295e-86
CP034669.1\|QAT83257.1\|1952611_1953886_-\|hypothetical-protein	gnl\|CDD\|236090	PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated.	0.000114511
CP034669.1\|QAT83260.1\|1958582_1961252_+\|putative-lipoprotein	gnl\|CDD\|365943	pfam00200, Disintegrin, Disintegrin.	0.000783151
CP034669.1\|QAT83263.1\|1962910_1963276_+\|putative-methyl-accepting-chemotaxis-protein	gnl\|CDD\|381253	cd00454, TrHb1_N, truncated hemoglobins (TrHbs, 2/2Hb, 2/2 globins); group 1 (N). The M- and S families exhibit the canonical secondary structure of hemoglobins, a 3-over-3 alpha-helical sandwich structure (3/3 Mb-fold), built by eight alpha-helical segments. Truncated hemoglobins (TrHbs, 2/2Hb, or 2/2 globins) or T family globins adopt a 2-on-2 alpha-helical sandwich structure, resulting from extensive and complex modifications of the canonical 3-on-3 alpha-helical sandwich that are distributed throughout the whole protein molecule. They are classified into three main groups based on their structural properties and named after Mycobacterium sp. genes glbN, glbO, and glbP: TrHb1s (N), TrHb2s (O) and TrHb3s (P). Typical of the TrHb1s (N) group is a protein matrix tunnel. It includes a Mycobacterium tuberculosis TrHb1, Mt-trHbN, which is encoded by the glbN gene. Mt-trHbN is expressed during the Mycobacterium stationary phase, and plays a specific defense role against nitrosative stress. The cyanobacterium Synechococcus sp. PCC 7002 TrHb1 GlbN, is constitutively expressed, and likely also protects cells from reactive nitrogen species.	1.32961e-48
CP034669.1\|QAT83275.1\|1984129_1985254_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|235874	PRK06847, PRK06847, hypothetical protein; Provisional.	2.64599e-49
CP034669.1\|QAT83268.1\|1973229_1974528_+\|acetamidase/formamidase	gnl\|CDD\|225279	COG2421, COG2421, Predicted acetamidase/formamidase [Energy production and conversion].	5.05648e-50
CP034669.1\|QAT83272.1\|1978329_1980423_+\|WD-domain-/G-beta-repeat-containing-protein	gnl\|CDD\|238121	cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.	1.45912e-74
CP034669.1\|QAT83267.1\|1970119_1973191_+\|putative-S-adenosyl-L-methionine:-L-methionine-S-methyltransferase	gnl\|CDD\|215360	PLN02672, PLN02672, methionine S-methyltransferase.	1.57411e-93
CP034669.1\|QAT83271.1\|1976812_1978156_+\|erythromycin-esterase	gnl\|CDD\|377470	pfam05139, Erythro_esteras, Erythromycin esterase. This family includes erythromycin esterase enzymes that confer resistance to the erythromycin antibiotic.	4.94929e-158
CP034669.1\|QAT83270.1\|1975265_1976441_-\|Beta-lactamase-class-C-related-penicillin-binding-protein	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	1.71754e-56

>CP034669.1|QAT83265.1|1964241_1964748_+|Rrf2-family-protein
MPSFRACREGGPSPEPPDLHLTLHADYSLRVLMYLAARPGRPSSTQEIADAYGISKHHLVRVVQTLAQEGHVEVKPGRAGGVLLAKAPGDIRLGKVVRAAEPDFHLVECFDRERNTCPIAPACGLKGVLAEARDAFLATLDKYSLEDLLRRSKPGLSDLLLTPAAPQE
>CP034669.1|QAT83264.1|1963298_1964294_+|ferredoxin-reductase
MAKVRHESEWYPLEPGETVLDGLLRQGVRVPHACRAGACQSCLMRATSGTVPEAAQVGLKDTLRARGYFLACACKPQEGTALEVAGASELRVPARVVDLETLSADVFAVRLEAETPLDYRAGQYVTVVRADGLARSYSLASLPREGRLELHVRLVPGGAMSGWFAREVRPGDRVHVQGPAGDCFYVPGQPDAPLLLAGTGTGLAPLYGILRDALEAGHTGPIHLFHGAKDPGGLYLVDALRALAARHPNLTYRPVVLAGGGGEVEEGALEAKVLTGLPKRPVGWRAFLCGNPEAVLSLRKKLFLAGFSMKDIHADAFLPSVSRGGPVAGAA
>CP034669.1|QAT83263.1|1962910_1963276_+|putative-methyl-accepting-chemotaxis-protein
MTSVYEKIGGEPAMAAAVDVFYRKVLADERISHFFEDVDMERQAAKQKAFLTMVTGGPSNYSGKDMRAGHKHLVERGLNATHFDAVVGHLKETLEELGVPAELVGQVMTVAEGARADVLNR
>CP034669.1|QAT83262.1|1961839_1962712_+|hypothetical-protein
MKRIFESVGSPLQFDRESFRCRHTLLGHPALELENLAGVVQRLPSENVFFSSGLVPKDADFDRAHLDYRTGLSLKDTVENMMTSNSYIMLRAPEQDPSFHDLYRALLSEVEDLMRAQGVGTHAVDPMLYLFIASPGSVTPFHLDRYSTLLMQFRGSKAVHVSKAWDEQVVPAPDLEAFVARSGSKVSYREAFDATAQRYAFGPGDALHIPFVAPHYVKNGADDVSVSLSIIFNTRETARHLRALRANHALRKHLGPLGHRPTPVNRFLPLDHVKSGMERVVRRARGLLHA
>CP034669.1|QAT83261.1|1961335_1961605_-|transglycosylase
MALETILLWAVIGLIAGWLASAVVGGGYGLIGDIVVGVVGAFLGGFILRALGTGAPFGGLAGTIFVAFIGAVVLLLILRLIHSSTVRRV
>CP034669.1|QAT83260.1|1958582_1961252_+|putative-lipoprotein
MSLPRSVRALMGTAVLCVLSLLSVSCASDALDDACDAGCVAGEACQDGGCIDEACVGVVCPDGQVCTGGDCVQPAVIIPTPVEAQWGTKKENGEACAANRDCNSGSCADGVCCDSACNGACDACSLPGNEGVCTVSPRGTACDDGDACTLEDVCDGESATACGGTPKECKTPPNQCHETVGTCSEGACTYTTKPVGTACDDGNACTSGETCGTGASCGSGTLKVCESPGGVCLENAGACQPETGACSYTPRAQGSACRAAVGPCDVAEVCTGAGGECPPDLKQPAGTACVDDGNPCTTDVCDASGSCLHPVLAMGTVCGAGSVCNASAQCISSCFIDGALVAAGTTNPSGACQVCDPARSTSAWSFKSAATQCRGAADACDAVEYCTGSGAQCPADGDAAAGTSCGAGSICDASGQCSANCFINGTLYASGATNPAGACQVCNPTLSTTGWSFKPATTQCRGAAGVCDTAEYCSGSSAQCPGDAVVGNGTTCGGGSEGAWSACEGFSGTCGETGTQSRTVTAQACFNGGCQASTTTETRACTRSTQGNACGSSNTGSWGTCGYSGTCGESGSRSRTVTEAFCNAGACQPSSRTETEACTRDTDGITCGTTTTGSWGSCGYSSTCDEESSRSRTITERICSAGTCQAFSDTETADCERNTEGDSCGTTTTGSWSSCGGYSSSCDESGKQWRNVTTRTCSSGSCGSSTSTEEADCSRSTSGNVCGTQESAWSACGGFSGTCDRWGSRSRTMTLLACGGGSCGGGDALIYTKTEDCERDTTGDWCNDGNACTTGDTCDSGGSCSGTQMSCPGGGTCSNGVCPAVCNGPGEAMCNDVCTNLVNNNNNCGGCGIRCAVNAGEVCQGTDCVCVGLRSEKDGEPGALPRCAPDNPL
>CP034669.1|QAT83259.1|1955426_1958474_+|branched-chain-amino-acid-ABC-transporter2C-amino-acid-binding-protein
MPLRAPPPSWGRFLVVVSALLTLAGCQKAAAPSEPQAEETGAARFVVAVHQAVTASDVQRVDLTVDGPGQPELTVQLAPDGSVWTGLLSQLPAGTGRRFRAFAYDSNARLIYRGEALDVTITANQTVQVNILLQQVDPSPEFENAGPVITSLVVSRSTVEMGGFVDVKATAYDPNTGDVLTYAWTATAGTFSTPAALSTRWTAPMTEGVQTLTMTVADQLGASTAVSFPILVEGTGVGEAEVFVRFNSWPQVVSLTGFPTQVVPGQSIGVSAQGQDNDDVAANLHYAWTASCAGTWTDEGTANARFTPSELPAQSTCDNCQLTVRVTDGRGGEGLGHLGVCVGAPVSANVAPRITSAFQTARTVGPGSTVRFNVRAMDPEGTALGFAWEAPAGTLGTPAPISEGSEVTWTAPACVDAQATPVVRARVTDAEGLEAVQTFSLTWTGPACATALGFLTQPSDVLATNVITPAVRVVLLDSLGRTSLAPVGPVRLSLGANPGAGTLSGTVEAAVVTGIATFADLSIDASGVGYTLVASVAGLPSLASQAFTIQPLAVRGASVDRLVTTGNAQLSRSTDLGTTVVQALVEQGNGTFTTFNGAGAADGTFSIQGVPSGAYYLRLGKDYVVTNSRAPDLGRDGQGRPDAAPASASTTLSVDLQGLAPWQAGDDIEIFSAGTGLWAQGVPEYALTGAALGAGSQRWTQTLEYAGMRNASPVDASAGDTVTFHQLSLKSEATSGAPVAYTAATRAFSAPLAVAQGGTASFTGTLAVLAQDQALNVDLRTQAFEALRTQVHPSAQPVDHVLFVAAFPDGTRGSYASAPDLLTYFPAPGAANRAFSFSYGNPFPGFTQAGLAETSFTVSLLAPGATTALTVRPSVGQADALPSFHASALAPRLGPARSPTLAGQDAFGNVTGVGLTPRLAWTAPSVGTATHYRVRVYEVFVNAQGRTAQAAGGPVAQLYTAATSLRFPPGVLAAGKQYYAILEAASSGNADFQGHPFRSAWPEAHAMLVTGIFAP
>CP034669.1|QAT83258.1|1953911_1954919_-|hypothetical-protein
MALSPLSKSSVASSSFSPRTSATELSSPVARPTADAAKTRCGAGSLQGMFQADGFDAPAGVGKKGALQGGNPMEQLAQMVQMVQMVNQLVDLLGGMNGAGAQQAAGPAAAPATAQGAAPATAQAAAPAAQGTPAPAAPQKDAAVAGPQSVGDSGAAKGKNTITLNNDGDKPMTVNFTPNAGEKAVDSVTLKPGESRTVQFPDNWSGNFRSDSGDGKNATLGEVKFDGGFGNTYYDVSYIEGHNTAMTIQPDGGGRLSGTMDNLLANAPDSVKAKGADGSAYGIKKSTTSNVQDPEVVDFFRKHVGADQGYVIPTDDASTLGSKDSNLVVHLKNLA
>CP034669.1|QAT83257.1|1952611_1953886_-|hypothetical-protein
MSVRLPSGLPRPGLPLQSPAQEKEEKAQSGEGRSSGKASGKGGAGKGGVAVKGGSAKGASAKGGLEQAGPQDGMDFGRSGEAERNEAGGGGARGAQQQAGMAPGTSQGAASLGSLEQPPALAAQTPQTAPALPQPPPPTPQAPGAPQLERRPAASESSRERTASDGQSSEAAKQALEGRAKLRMAVLNRLYRGLTEVEGKMSAFLANPGRQGVVTLPVVLSVSTVTFEWWQSANAVPEDRAYLAQVLGEPGTADDATLLGTLRAEIAQAFAEFPRTPQGVEARKLYDAVLQKYEAARIQPIIAGHDSGPVVEECARLGLSCETDFTRSLLLSPWMLATSQSPDEGSATQVMVAGLTLPQLGALVGHLRQLNPLLSNPQLRALLLRASTDKRLALRKAMGLEEVEQVQELARQLLRLQAVQHLTV
>CP034669.1|QAT83256.1|1951627_1952563_+|hypothetical-protein
MSVNISSNVLRTFQQLAEAKPSAPPQQAAQQAGLPEEKVVSQVEGTPTTAQTEQATDAFAVVQALNQAWASRFQPVSGASAKDLGVNGTLANAPKAPEIGGWNAAAGTDPGVVKQTNANDCGAAVAVMLGKEIGTSQAQPASDKEKMAALESRFTQGQGTSPHELSNMLANQGAKVTQTSSKLDTKALDDALARGAKGAVMVDSCLVDPTTKPGETGRAHWVSVEGKDDKGRYLIKDPSTGSKIPVDAQRLADSMQISWDRHQGGGQMIVESAQGMSEAQAAKEGGLKAVALGNTDGGGSRAMSNFGRESS
>CP034669.1|QAT83266.1|1965584_1969940_-|exoglucanase-B
MKRQPQLALLAVFAVILIHAQPAQAQIAAAHVYHNHMPNFWAYYDLTQYNATPVGGPIRYAYDGQVIQIKQSPPANYTYFLPSGAPMPHDDLVTYYSHHAKVGAYQYWPPDVAADMKAHASTGQIHVTMSGAVVNNVNDLVTRRNVSGYDNANWGATWRDRYANLRTPAGNRSLDLIHFTGHHSMGPLVGPDYFLKDLIHQSATLSQSYFLGSGFTASKGFFPTELGFSERLIPTLAKLGVKWSVIGDNHFSRTLKDYPFLNDPGSDTLVSPPNRADLQNTSTVGAWVSEPMAHEQQVIRNKYPFASTPHWVRYVDPATGAESRVVGIPVNQNGSWLEGWEGQATVDVVGLRDFEGLVSQKQFFVLAHDGDNSGGRAGSLDTWLNGRAVTCTGGVQCLGIDEYLVNNTPVSTDVVHVQDGSWVDTRDSSSDPQWHHWRLPFGIWKGQFPAFNSATGLNLAPKTNLSGVQEGMTVSLEHGWHYLERNFALLQAAMNYAKTAEQLWLDAHPNHWKPTTALDSQVTHAGNQLNPWMLSFPVKGDSANDWAGGANPAELAWYFLLPAMDSGFGYYDENVDDNVKPTLSFNQSLYFSKPYVQDRLAQDRTGPSVWWPQRWPYNPGSANTDKSEGWTLHHFDNNFALYTYAFDVSGITSIKARVRVHTAKSIDPLDNTPRVYDPVALKAAGVPGITPSRVGAWVDYPLQRRELRPVMNGVAWQPAHLPVMQKVAAQEIGDLYYVYLGAYRDQLLDYYIEATDSRGNVTRSEIQSVYVGAGKYRLEGGKYIEDLNGSVTGTYPFLRVDTTAPSVPTGLAATRTDRSVTLTWTASTDNVGVTGYQVFRNGTQVGSPSTTGYTDSGLTAGTAYSYTVKARDAAGNTSAASSALSVTTLPPDTTAPSAPSGLSASGVTSSSVVLSWTAATDNYGVSDYLVFRNGTQVAAPTATTYTDTGLSSSTTYSYTVKARDAAGNTSVASAALSVTTGLGYTTTVYYKKGFATPYIHYRPAGGTWTTAPGVLMPDAEVTGYAKYTVNLGSVQQLEAVFNNGSGTWDNNNGVNYLFPTGTSTFNAGVITAGAPVSDTSAPSVPTGLVSPSKSATTVSLSWTASTDNVGVTGYLVFRNGTQVGTPTSTSYTDSGLSSNTAYSYTVRARDAAGNTSSASTALSVTTSAGNTATVYYKKGYATPYIHYRPAGGTWTTSPGVAMATAEVSGYAKYTVSLGSATQLEAVFNNGSGTWDNNGGLNYFFPAGTSTFNAGSISAGAPSQDTTAPSVPSGLTAPAKTATTVSLTWTASTDSSGIAGYDVYRNGSLVGSPTTASYTDTGLTAGTAYSYTVRARDTAGNASAQSSALSVTTSTSGATVTFNVTASTVMGQSVYVVGNVAALGSWSPASALLLSAANYPTWSAAVALPGSTAVEYKFIKKDAANNVTWESGANRALTTPATGTSTVNDTWR
>CP034669.1|QAT83267.1|1970119_1973191_+|putative-S-adenosyl-L-methionine:-L-methionine-S-methyltransferase
MATYPASAREAFVQLRTLSEALARPQERARALAELRELAELSRDQPEGAPLRLASVVVAVGASQERLELLIPPSIFAPEAWAFTFLEGLLKVPLDEYAGKQLVEVGSGSGWICIALAKFTGLARIRGLDLNPQAPAVGLCNAWLNGDEALVSRLSFGESDLLLGLPQKPEWDFIVGCIPQVLRSDELPAELAQADEQALLDLSNYTSLQNVYEDHFGLGLIARLLNEAPERLLPGGRLLLNLAGRPGRAIIARMFTRRGFTTRVRVARRVMQAADTDIRPLVSLEQRTGREFEFFMEAHSPEPLRAATALGWLQSGHPIWHEVAVWEAQLSLPRETLALRAALRSLGIAALQEELDLGAASAEQLGFVTALAERLSQAPFLPYAHEAGDASFRRLVARYLDRHFGLRLSEDSLFVAPEREQAVYSFLLATCDPGDTVLVSRSLHPLYARALDKAGVRATVTHNTLGEIRRLLSAFDVKAVLLTVEPGERTNLAVLRDIVAEAARRGIWVVLDESAFFNITGDVEPRTLFEFLARTQHSPNLVILYGLIKNAVWPDLELTLLLPVPEPLRADLEVAAEVTYSRISVLAEWFYERTFSELLAFRMAFAEPVPPSPHRAPEVPLPRSSRIVRLSELPAFAPKFFREDDPELVRLDYGENEGPMPLPLVEGLIAAGVAPRADGAQTGLAEAVAAFLLETRGARYAPEDVVVAPGVWPLMHHLGVALRQRLGRMPRVFLVTPCYGVLEPTFLAAGCEVDSGPLGTLLSRRARGTTPDAVVLSQPANPTGHYLSHEELMALATFVVEQRCLWISDEIFGLVNLTNPTAETVHSPVTLEGAVPGIGARTVLLGGLSKEFAAGGLRVGWVATKDRALVAALRDSAPGVLHTPTARAAAYLYAAHARGPDGQLLYAARHKALRSYLARMRRELAEKRALVAEALPDDGRAEATEAGGLFLAPRMTAWLGRSVDGVKLTPENLPRVVYEHTHVVLNGGAWCGDPERVRAVFSIPREKLLKARDRLRTFGQRLR
>CP034669.1|QAT83268.1|1973229_1974528_+|acetamidase/formamidase
MIRSLAVLLCCLPAGALAASESWLVTTDLWGNPAYQLLSLERDGKRLSGELDGDALKGERAGNAIHFVVTDSRQKTYVFDGKVSGESLRGTADYPDSNNPKTRASHAFTGRLLPSRPAGGPRVHDFTPTSWSNEFTAHRAPVLTVWPGDTVRTSTLDSGGMDSKGVTRALFGNPQTGPFFIATANPGDTLAIRIRRLKLNRTFADSLDGIVGRALTPGLAAKATELGKPVRWTLDPERGVATPENPTERLKAFTVPLRPMLGGLAVAPGFGSAPLSTGDTGRYGGNMDFNEVVEGNTVYLPVAQPGALLYLGDAHAAQGDGETSQYALETSMDVEFTVDVLHGKPPPSTPRVESPTHLMALGQGGSLDDALRSATQGLTQWLEQDYGLTLSESAQVLGSSVQYVVANLAGRSVGVAAKLDKARLQALRPSVK
>CP034669.1|QAT83269.1|1974666_1975254_+|hypothetical-protein
MASKIAIAVLVLVLALGAFVATRPDHFRIERNAHVAAPPATVFALINDLHRFDTWNPFRSEPAPGVTKSFDGPNEGPGASFAYAGGESGDGRMTIVESQPGARVVLKLEFFKPFEATNQATFTLTPENGGTRVSWAMEGENTLMGKAMSLVVNMDTMLGKEFERGLANLDATARGITPPSSASAQSDAATPAPAL
>CP034669.1|QAT83270.1|1975265_1976441_-|Beta-lactamase-class-C-related-penicillin-binding-protein
MTSALRGHVERGDLPGVVALVAREDTVHVDVLGTQGLTPSGPPMRRDSLFRLASMAKPITAVATLMLVEDGKLPLDGAVDPWLPELADRRVLRTPGGPLDDTVPAKRAITVRDLLTLRWGLGAVMAPPGTHPIQRAMSEARVAPGFHALTDPPDEFMRRLGTLPLMHQPGERWSYHTGYEVLGVLVARASGMRLDDFLRERLFVPLGMKDTAFTVPAEKLDRLTTAYALDDVTGRLEAWDTPADSYWSRPPAFLSGGGQGGLVSTADDLLAFCRMLLGGGQAGNTRLLSSASVQELLTDQIPEEQKAASPFFPGFWDASGWGFGGAVCTKPDGISPTAGRYGWAGGYGPTFFIDPRQDLTAILLTQRRMQGPDDEALALEFSKGAYRALED
>CP034669.1|QAT83271.1|1976812_1978156_+|erythromycin-esterase
MAHRDDGLLVRALAESVRPLQGTREDFGPLMDLVGDATCVLMGEATHGTHEFYRLRALLTRRLIEEKGFNAVAVEADWPDAYRINRYVRAMGTDVDAVESLSDFQRFPAWMWRNAEVLDFAGWLRTHNDRHSAREKVGFYGLDLYSLHASMGAVLKYLDRADPEAAKRARYRYACFEHFGEDPKDYGHAASLGLSPDCERQVVDQLRELQREREALLRRDGFIAEDAQFEAEQNARVVQNAEEYYRSMFHGRISSWNLRDTHMADTLDALMGFLKRRLGAARIVVWAHNSHVGDARATEMGASGEVNLGQLTRQRHPRATRLIGFSTYRGTVTAASNWGGSAERKQVRHGLAGSCESVFHQVGLPGFLLDLRELGEAAGALREPRLQRAIGVIYRPETERRSHYFHTRLPEQFDAMLHIDETRALEPLERTAGWERGEAPETYPTGL
>CP034669.1|QAT83272.1|1978329_1980423_+|WD-domain-/G-beta-repeat-containing-protein
MRWWCLMLLLASCSAHRSSGGGAPDEANARDLRARIHEARGEAATESRRWSVAAASFALARASRDSLAAQWGQGQAVDRASTLRWSKRIQGSVLALAFTPDGRVLASGHYDSVVRLWDVERGELLAELKGHTAEVHAVAFSPDGRWLASAGRPGELRVWDWRQGQPRAVIPGHTDVVLGLAFSPDGRRLASGGLDKAVRVWDFETGAEQLRFEHDDNVIAVAFSPDGGRLLSTSADRSARVWDLESRKELHRLVGHEEKVESGAFSADGQRIMTAAGDRAVRFWDARSGQLTDVFRNSGDVSVAAIDGGFQLLVQGGWDGRVQLVDGHGGALLERMDAHQAFVMSVSMSPDGRTFASGGMDGLLAVWRRPEVPAQVLLRGPGVWVEALAFSQDRELMTGSEDGWRRWRIAEERELRPEGGGAEAAVSLAVSPDRERIAVGTLKGRALVLDARSGRVLLELPGGSGSVRAVAFSPDGALLAVAGDPDIQLWSVADSRPVGLLQGHTGKVWALAFDSTGRRLASGSTDKTVRTWDVERRQPLLRLDMGEPVRAVVFTPSEPHLVTAGMRQPLRIWDVTEGRLLKTLGEKTVGVLALAVSPDGRFLASSGMAAGVKVWGLPSGEQLGTLAGQQGFLAALAFSPDGALLVSAASDQTLQLNRFDSVAHPPPAGAGLDGLLRRYGLVWDEARFRFTPAAGSD
>CP034669.1|QAT83273.1|1980397_1981513_-|hypothetical-protein
MEGPGIRVRPPSARWGLLTLLSLLVLSAVPLSGVTSRGTLKEGYTDHVRHPYVVWVGLHRGLQALYTAPLGELREGVPYRQALDQWLEVPYVYPPGALVLFLPLALVGEWVPLSPQAFGQACLLYLLVFAHLALYAALRLLDGLPAGGRWAVGFLCWLVLMRLALYGQYDGAWLVCGVLALAALAKDRPVVALRWLALAALLHYRALVLVAVGVVALWRVVHARPVRQWPWGTLLGVAAAGVLCVRTFLWMAPLAARTDAATPSILGEPGTVALVMGLSAAALALSWRGADGLVTASVGLGVLLAVIDTRHWWHASALLLVPLCVGVLRAPRWPTAVRLGLVVWAGVLELAVWYGNPLWLFRDLNRFLRLV
>CP034669.1|QAT83274.1|1982180_1984133_+|asparagine-synthase
MCGFIGVYQRSPSGFDERSLITALTTLHHRGPDERSLWHDPAGRAVLGHVRLSIIGLDNGRQPIVADEGDIALVVNGELYDHERIRRELQALGCHFKTDSDSEIALHLYRRSGLAGLKQLRGEFAILLFDRQRRLMLAVRDRLGIKPMFYAQHRGVWYFASEVKALLAAGVPAEWDEHAYASRAFYLRDHTLFKGVKSVQPGCWVMADSGGLHHGRYWDMEFARQDAPDPADEQGMVQAIRAAVEQSVRLRLRADVPMGVYLSGGIDSSAMLGVASQLSGQPLDAFNLSFTDMDDYDENAFARLAAEHNGARFHTVAVSQDDLADHFEQALWHNETPFFNAHGVAKYILSQTVRDAGMKVVLTGEGADEVFAGYPHFRRDMLLYNPERQDPALVTKLRQRIQESENGYVRPDMPQDIHWMVQQLSHGVSWLDNQAGWFKALEALYRPDFRERFEGSDPYRQFYDRLDHRNLEGRDPVHKSMYLWAKSYLPNFVLTTLGDRMEMAHSIEGRVPLLDHHVVELACQMPVWMKVRGSTEKYVFREAMRPYLPDALYKRKKHYFRAPPATLQQKGRLYQLVRDVLNGSELDALPFFDAGRVRGLLERLPSLSAHEQGLLDPMLMELTSLCLLQNRYALRASASQPAWSAREEAA
>CP034669.1|QAT83275.1|1984129_1985254_+|FAD-dependent-oxidoreductase
MRVAIIGAGLNGLACAVMLKRLGVDCVVFEKGTGPRDSGTGIYVWPQAMQVLRFVLKDRAFLARGQPIEFLDTHDKHGRLVHSQPVRPAGLGLPAPAMMFLRTELFRLLADRLDADDIHYGMGCEALENVGDQVRLTFSNGHRFDFDLAVGADGVSSTTRAFVNPGLTPHDTGLVASRGVVNFDSPLLHSDRCQIFTSRHSRVVTYPLNKATSLRYWFAAYQHRNQPLLDRQGLLELFAPLPPDLLRMIGQTPEEDILTHKLKALTGEGQWFRGRVVLLGDSIHAMLPTLGYGLTLGLENGFMLAQALVGHCDADLGAALQRYEIRAARRSREMLQVMNDFTRLYYFEPEGEVSPVRLAPIVQRFQELAQSTVF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP034669_7

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP034669_7

2023446-2024036

Orphan

Consensus_repeat	Method
GGNAACNTGTCNGACAGTCGGACAGGTT	CRT

8 spacers

The CRISPR arrays of CP034669_7

>merge|CP034669|7|2023446-2024036|CRT
AAGAACCTGTCGGACAGTCGGACAGGTTGGGAGGACCGTGCCCGGGTCCTCGCGCCGGCTCCTGGACGCGGAAACCTGTCGGACAGTCGGACAGTCGGACAGGTTGGGAGGACCGTGGCAGGCCCCCCGCGCTGCCCCGCGCAGTTGGAAAACTTGTCGGACAGTCGGACAGTTGGGCGGACCGTGACCGGGGCCATCGGCGCTGGCTCCAGGAAACGGGAACCTGTCGGACTGTCGGACAGGTTTTGGGGGACCAGGCGAGCCCTGGGGCGACCCCGAATGGCGGAAACCTGTCGGACCGTCGGACAGGTTGGGGAACCTTGGTGGGACTCCCGGGAGCTGGCTGCGGACCGCGGAAACTTGTCCGACAGTCGGACAAGTTGGGGGACCTTGGTGGGGCTCCGGGCGCTGGCCGCGGACCTTGGAAACTTGTCCGACAGTCGGACAGGTTTTGGAGCACCGCCGCCGAGGGAGGTCTCTCTCCGCTCGGGCCGAGGAACTTGTCGGACAGTCGGACAGGTTGAGGGGCCTTGGTGGGGCTCCGGGCGCTGGCCGCGGACCTTGGAAACTTGTCCGACAGTCGGACAGGTT

>CP034669|7|2|2023446-2024036|CRT
AAGAACCTGTCGGACAGTCGGACAGGTT	GGGAGGACCGTGCCCGGGTCCTCGCGCCGGCTCCTGGACGC
GGAAACCTGTCGGACAGTCGGACAGTCG	GACAGGTTGGGAGGACCGTGGCAGGCCCCCCGCGCTGCCCCGCGCAGTTG
GAAAACTTGTCGGACAGTCGGACAGTTG	GGCGGACCGTGACCGGGGCCATCGGCGCTGGCTCCAGGAAAC
GGGAACCTGTCGGACTGTCGGACAGGTT	TTGGGGGACCAGGCGAGCCCTGGGGCGACCCCGAATGGC
GGAAACCTGTCGGACCGTCGGACAGGTT	GGGGAACCTTGGTGGGACTCCCGGGAGCTGGCTGCGGACCGC
GGAAACTTGTCCGACAGTCGGACAAGTT	GGGGGACCTTGGTGGGGCTCCGGGCGCTGGCCGCGGACCTT
GGAAACTTGTCCGACAGTCGGACAGGTT	TTGGAGCACCGCCGCCGAGGGAGGTCTCTCTCCGCTCGGGCCG
AGGAACTTGTCGGACAGTCGGACAGGTT	GAGGGGCCTTGGTGGGGCTCCGGGCGCTGGCCGCGGACCTT
GGAAACTTGTCCGACAGTCGGACAGGTT

Protein	Signature genes	Signature genes Name	Protein_function
CP034669.1\|QAT83315.1\|2026763_2029037_+\|MMPL-domain-containing-protein	unknown	unknown	gnl\|CDD\|225272
CP034669.1\|QAT83317.1\|2030163_2031573_-\|monooxygenase-family-protein	unknown	unknown	gnl\|CDD\|223727
CP034669.1\|QAT83304.1\|2016268_2017198_-\|transglycosylase	unknown	unknown	gnl\|CDD\|381617
CP034669.1\|QAT83313.1\|2025967_2026408_+\|ECF-subfamily-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|132002
CP034669.1\|QAT83312.1\|2024657_2025869_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|369439
CP034669.1\|QAT83308.1\|2020895_2021306_-\|glyoxalase/bleomycin-resistance-protein/dioxygenase	unknown	unknown	gnl\|CDD\|319923
CP034669.1\|QAT83310.1\|2022094_2023399_+\|amine-oxidase	unknown	unknown	gnl\|CDD\|224154
CP034669.1\|QAT83318.1\|2031659_2032706_+\|phytoene-synthase	unknown	unknown	gnl\|CDD\|366130
CP034669.1\|QAT83307.1\|2020044_2020887_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
CP034669.1\|QAT83311.1\|2024152_2024680_+\|ECF-subfamily-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|132002
CP034669.1\|QAT83309.1\|2021311_2021848_-\|peptidyl-dipeptidase-Dcp	unknown	unknown	gnl\|CDD\|341051
CP034669.1\|QAT83306.1\|2019154_2019892_-\|oxidoreductase	unknown	unknown	gnl\|CDD\|226674
CP034669.1\|QAT83314.1\|2026489_2026657_+\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT83301.1\|2013845_2014547_+\|sigma-54-dependent-DNA-binding-response-regulator	unknown	unknown	gnl\|CDD\|381085
CP034669.1\|QAT83305.1\|2017378_2018962_-\|bacteriophytochrome	unknown	unknown	gnl\|CDD\|223715
CP034669.1\|QAT83316.1\|2029033_2030224_+\|ceramide-glucosyltransferase	unknown	unknown	gnl\|CDD\|132512
CP034669.1\|QAT83320.1\|2034614_2035121_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|370447
CP034669.1\|QAT83302.1\|2014543_2015656_+\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
CP034669.1\|QAT83319.1\|2032705_2034667_+\|putative-squalene--hopene-cyclase	unknown	unknown	gnl\|CDD\|274591
CP034669.1\|QAT83303.1\|2015662_2016184_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP034669.1\|QAT83315.1\|2026763_2029037_+\|MMPL-domain-containing-protein	gnl\|CDD\|225272	COG2409, COG2409, Predicted drug exporters of the RND superfamily [General function prediction only].	4.92496e-96
CP034669.1\|QAT83317.1\|2030163_2031573_-\|monooxygenase-family-protein	gnl\|CDD\|223727	COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion].	4.92725e-43
CP034669.1\|QAT83304.1\|2016268_2017198_-\|transglycosylase	gnl\|CDD\|381617	cd16896, LT_Slt70-like, uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.	9.28974e-25
CP034669.1\|QAT83313.1\|2025967_2026408_+\|ECF-subfamily-RNA-polymerase-sigma-factor	gnl\|CDD\|132002	TIGR02957, putative_sigma_factor, RNA polymerase sigma-70 factor, TIGR02957 family. This group of sigma factors are members of the sigma-70 family (TIGR02937). They and appear by homology, tree building and bidirectional best hits, to represent a conserved family. This family is found in a limited number of bacterial lineages. This family includes apparent paralogous expansion in Streptomyces coelicolor A3(2), and multiple copies in Mycobacterium smegmatis MC2, Streptomyces avermitilis MA-4680 and Nocardia farcinica IFM10152.	2.56897e-16
CP034669.1\|QAT83312.1\|2024657_2025869_-\|hypothetical-protein	gnl\|CDD\|369439	pfam07592, DDE_Tnp_ISAZ013, Rhodopirellula transposase DDE domain. These transposases are found in the planctomycete Rhodopirellula baltica, the cyanobacterium Nostoc, and the Gram-positive bacterium Streptomyces.	0
CP034669.1\|QAT83308.1\|2020895_2021306_-\|glyoxalase/bleomycin-resistance-protein/dioxygenase	gnl\|CDD\|319923	cd07262, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	2.98536e-40
CP034669.1\|QAT83310.1\|2022094_2023399_+\|amine-oxidase	gnl\|CDD\|224154	COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism].	7.93033e-31
CP034669.1\|QAT83318.1\|2031659_2032706_+\|phytoene-synthase	gnl\|CDD\|366130	pfam00494, SQS_PSY, Squalene/phytoene synthase.	3.7504e-47
CP034669.1\|QAT83307.1\|2020044_2020887_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	1.40873e-24
CP034669.1\|QAT83311.1\|2024152_2024680_+\|ECF-subfamily-RNA-polymerase-sigma-factor	gnl\|CDD\|132002	TIGR02957, putative_sigma_factor, RNA polymerase sigma-70 factor, TIGR02957 family. This group of sigma factors are members of the sigma-70 family (TIGR02937). They and appear by homology, tree building and bidirectional best hits, to represent a conserved family. This family is found in a limited number of bacterial lineages. This family includes apparent paralogous expansion in Streptomyces coelicolor A3(2), and multiple copies in Mycobacterium smegmatis MC2, Streptomyces avermitilis MA-4680 and Nocardia farcinica IFM10152.	3.71037e-38
CP034669.1\|QAT83309.1\|2021311_2021848_-\|peptidyl-dipeptidase-Dcp	gnl\|CDD\|341051	cd06456, M3A_DCP, Peptidase family M3, dipeptidyl carboxypeptidase (DCP). Peptidase family M3 dipeptidyl carboxypeptidase (DCP; Dcp II; peptidyl dipeptidase; EC 3.4.15.5). This metal-binding M3A family also includes oligopeptidase A (OpdA; EC 3.4.24.70). DCP cleaves dipeptides off the C-termini of various peptides and proteins, the smallest substrate being N-blocked tripeptides and unblocked tetrapeptides. DCP from Escherichia coli is inhibited by the anti-hypertensive drug captopril, an inhibitor of the mammalian angiotensin converting enzyme (ACE, also called peptidyl dipeptidase A). OpdA may play a specific role in the degradation of signal peptides after they are released from precursor forms of secreted proteins. It can also cleave N-acetyl-L-Ala. This family also includes Arabidopsis thaliana organellar oligopeptidase OOP (At5g65620), which plays a role in targeting peptide degradation in mitochondria and chloroplasts; it degrades peptide substrates that are between 8 to 23 amino acid residues, and shows a weak preference for hydrophobic residues (F/L) at the P1 position.	1.54813e-35
CP034669.1\|QAT83306.1\|2019154_2019892_-\|oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	2.04525e-88
CP034669.1\|QAT83301.1\|2013845_2014547_+\|sigma-54-dependent-DNA-binding-response-regulator	gnl\|CDD\|381085	cd00156, REC, phosphoacceptor receiver (REC) domain of response regulators (RRs) and pseudo response regulators (PRRs). Two-component systems (TCSs) involving a sensor and a response regulator are used by bacteria to adapt to changing environments. Processes regulated by two-component systems in bacteria include sporulation, pathogenicity, virulence, chemotaxis, and membrane transport. Response regulators (RRs) share the common phosphoacceptor REC domain and different effector/output domains such as DNA, RNA, ligand-binding, protein-binding, or enzymatic domains. Response regulators regulate transcription, post-transcription or post-translation, or have functions such as methylesterases, adenylate or diguanylate cyclase, c-di-GMP-specific phosphodiesterases, histidine kinases, serine/threonine protein kinases, and protein phosphatases, depending on their output domains. The function of some output domains are still unknown. TCSs are found in all three domains of life - bacteria, archaea, and eukaryotes, however, the presence and abundance of particular RRs vary between the lineages. Archaea encode very few RRs with DNA-binding output domains; most are stand-alone REC domains. Among eukaryotes, TCSs are found primarily in protozoa, fungi, algae, and green plants. REC domains function as phosphorylation-mediated switches within RRs, but some also transfer phosphoryl groups in multistep phosphorelays.	8.89002e-25
CP034669.1\|QAT83305.1\|2017378_2018962_-\|bacteriophytochrome	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	5.33724e-48
CP034669.1\|QAT83316.1\|2029033_2030224_+\|ceramide-glucosyltransferase	gnl\|CDD\|132512	TIGR03472, HpnI, hopanoid biosynthesis associated glycosyl transferase protein HpnI. This family of genes include a glycosyl transferase, group 2 domain (pfam00535) which are responsible, generally for the transfer of nucleotide-diphosphate sugars to substrates such as polysaccharides and lipids. The member of this clade from Acidithiobacillus ferrooxidans ATCC 23270 (AFE_0974) is found in the same locus as squalene-hopene cyclase (SHC, TIGR01507) and other genes associated with the biosynthesis of hopanoid natural products. Similarly, in Ralstonia eutropha JMP134 (Reut_B4902) this gene is adjacent to HpnAB, IspH and HpnH (TIGR03470), although SHC itself is elsewhere in the genome. Notably, this gene (here named HpnI) and three others form a conserved set (HpnIJKL) which occur in a subset of all genomes containing the SHC enzyme. This relationship was discerned using the method of partial phylogenetic profiling. This group includes Zymomonas mobilis, the organism where the initial hopanoid biosynthesis locus was described consisting of the genes HpnA-E and SHC (HpnF). Continuing past SHC are found a phosphorylase enzyme (ZMO0873, i.e. HpnG, TIGR03468) and another radical SAM enzyme (ZMO0874), HpnH. Although discontinuous in Z. mobilis, we continue the gene symbol sequence with HpnIJKL. Hopanoids are known to feature polar glycosyl head groups in many organisms.	3.56844e-26
CP034669.1\|QAT83320.1\|2034614_2035121_-\|hypothetical-protein	gnl\|CDD\|370447	pfam09351, DUF1993, Domain of unknown function (DUF1993). This family of proteins are functionally uncharacterized.	4.36746e-72
CP034669.1\|QAT83302.1\|2014543_2015656_+\|sensor-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	5.82324e-48
CP034669.1\|QAT83319.1\|2032705_2034667_+\|putative-squalene--hopene-cyclase	gnl\|CDD\|274591	TIGR03463, osq_cycl, 2,3-oxidosqualene cyclase. This model identifies 2,3-oxidosqualene cyclases from Stigmatella aurantiaca which produces cycloartenol, and Gemmata obscuriglobus and Methylococcus capsulatus, which each produce the closely related sterol, lanosterol.	0

>CP034669.1|QAT83310.1|2022094_2023399_+|amine-oxidase
MQVTKVAVVGGGLGGLTAAALLARGGCEVTVYERSKHLGGRARTTEVEGFRFNLGPHALYRAGAAFRVLERLGVRPTGGIPNQTGSHALVGGRLHTLPRGAVTLMTTDVLSLASKLEVAKLLAGLARIDTQPLGAMSMREWLETHLARKDSRALVGALIRVSSYCADFEALSAEAGLKQLQCATAANVLYVDGGWSTLVDAVERLGRDAGARLELSARVEAVVLQEGGKRVEGVRLADGTVHRADAVVMAGSPADVAALMPGDAVLAQEAREAVPIQAATLELGLSALPRPDALFALGLDGPWYASVHSASAKLAPEGGAMVHVAKYLGGADMEASESALESVMDALQPGWRAKVVARRYRPSLTVSAGLPRAVSGGLTGRPAVEVPHVGGLFRVGDWVGAEGMLADASLASAEAVEQALVRRTATSQRRAAAT
>CP034669.1|QAT83309.1|2021311_2021848_-|peptidyl-dipeptidase-Dcp
MPPRQETATVSGSERSGSPMLPKASPTTYRVQQRFRGEVPALVAISMPFVKPGAGSPALLGWRDAQTLFHEFGHALHTLTGDVTRPSLGGGGVVSGSAVFPSKLFEHRLATPEGLSRLAVHHATVQPMPQALVARIQQAATFNQGFYTVDLLTFQEAGGAYDAKVAALMRERGFAPVH
>CP034669.1|QAT83308.1|2020895_2021306_-|glyoxalase/bleomycin-resistance-protein/dioxygenase
MIDHTGIGVADVARSAAFYDAALGALGLRRAMQLPEDTGADGIGYGLDHPIFWIDRFHPHGVKQHTAFAATSRAQVDAFHAAAVAAGGTDNGPPGLRGVEAGYPAGYYAAFVLDPDGNNIEAVFREPSRQRRPQVL
>CP034669.1|QAT83307.1|2020044_2020887_+|AraC-family-transcriptional-regulator
MPALPHAVVDGPFSIQTFLFPELPGLRLVRYRTDGRLLRSVKERFSVMVTQRGHSEWWGRGKVHSSSPRTVDLKQMGEVHRDLRRDGPARFQVIAFDESLVAGAREALGALASARLRQLQLETSQPAAAAFVRLHAVLDAGLEGRSSALALQTSLAEALSSLVGCLEPSGAVERRYRWPIRRVVEALHEAIPEGITLESLAQQVGWNRFHLCRAFREESGMPPHAYLTHLRVSRAQRLLSQGLAPAEVALQVGLCDQSQLNRHFKRIVGLTPGQFARAVQ
>CP034669.1|QAT83306.1|2019154_2019892_-|oxidoreductase
MSGIQDKVIAITGASSGIGEAAALLLAGRGAKVVLGARRLERLEPVVERIAQAGGEALCARTDVRRREDAAGLVHLARERFGRLDVLINNAGSLATSPLDDLRVDDWEELVDTNIKGVLYGIAAALPVFREQGFGHFINTASTSAHRIVPGQAVYAGTKFAVRAISEGLRQEAGPRLRVTVISPGMTRTNFLEHVKNPELRARFEEVRDQLAIPPDAIARAMAYAIEQPADVDVGEVIVRPTAQD
>CP034669.1|QAT83305.1|2017378_2018962_-|bacteriophytochrome
MARMECTHAIQDTDVLFRFLVQSAKDRAIFGLDLQGHIISWNPGAEHIKGWRAEEVLGQHFRMLFPEEYRQQGRPENELKQAFETGHYQGEEPRQRKDGSFFIAEIDLWLLRDDAGQPCGFVKVAQDITARKQAEEAHVSLLARERSSHAEAEAERHKLYAIFEQAPVGIAIYRGPHHVIQFANPVQCRFWERGCEEVLGRPLREVLPEELWPSIIERACDSVFQQGESRVFTEERFEFTRQDTGERVEHYFNYTHVPMRDQEGTVEGFMAVAWDVTDAVRSHQRAAVLTQQLQDRVDFEQQLIGIVSHDLRTPLNAIHLTVSAMARREELDARTAQSVLRIQSAVHRAVRLVGDLLDFTQARLGEGIPISPRAADLNQVTRQVLDQVDAAHPGRTLRVQERGDATGVWDSERIAQVVQNLVTNALKYSPEASPVQVTTRGEDGWVCLSVHNQGTPIPPEKLPRIFEPLQRASSELDSTGRSVGLGLYIVKQLVESHGGTVDVTSNLKQGTTFTVRLPRHGDSGGFG
>CP034669.1|QAT83304.1|2016268_2017198_-|transglycosylase
MAISPLRSPSASVSRMPAQDAASPRLAVDGFSSSQKPGSPGLAALQKDGFDIGSGKGAELGKLLQDTLSALTSIVQLVAQGVSGAQGASGGKCGTGSQPFSDSSFTPQDASRPPVALNGNTGVVGPAASQSQASHGNTGVVGPATSSSSGGTKLGGNLPPGLEKFRSAIESASAKTGMPAEMLAAQIWQESRGNLEAVSTNGGNGLTDTGLMQVNPNTYGELQAKHPELQGKNLSDPETNILAGAFYMKDMKEQFGSDELALRAYNSGPNGVDKSNPDAIPAGTGDATYVQKVKSFMSTLATGQGTLPA
>CP034669.1|QAT83303.1|2015662_2016184_-|hypothetical-protein
MTSSFRPFVLAAVSSCALVLGACAGGTAATRPAESLSVRELNIVDEKGQTRIRIAAPMPDPQGLKRAVTAHGIQFLSPSGQEIGGLGMLDAIGIRGLCFDSEEGYEAMCMGLEQGKPTVTFRHDWKERITMGVVDGVASIVLHDAQGTPRLKLEVDKDGKARTAGVTPEPAAP
>CP034669.1|QAT83302.1|2014543_2015656_+|sensor-histidine-kinase
MTGSAGERPRVLVVDDNAAFLDNMKELLEDQGYVVSSATSCAGALERAPAGFDVALVDVRLPDGEGSWLAPRLKALVPDGEVVLLTGLGMLEAAVAAVHAGACAYLLKPCATPELLVTLEQALRQVRLHREKQVLARRAQVSEKLAAVGTLTAGLTHEIRNPLNAAGLQLTVLERRVRRLEEAVQGPLLEPLLLVRDEIRRLDHILEDFLQFARPREFRSDAVAVAPLFERVGSLLSWQAEQRGVTLEVEPPGALEVWGEEERLRQVLLNLALNALEATPPGGRVRFSASAQREEVALFVDDSGPGVPVQSRGRLFEPFFTTKASGSGLGLSIVHAIVTQHGGTLQVEDGPLGGARFSVHLPGAPGTQAR
>CP034669.1|QAT83301.1|2013845_2014547_+|sigma-54-dependent-DNA-binding-response-regulator
MGRFLLVDDNRAFAENLAEILEDAGHSATVVDGGEAALQAAREVRYDVLITDMRMAGMSGAALVHHLRQRDPGLAAIIVTAHPGEAELARARAEGVLAVLPKPVPVPALMTLLARARRDGLVVLVEDDAHLADNLTEVLRERGFTAVVARSVPDVVGLESVRPFAALVDLRVPGGPDGEALRRVRERFPGTTPFVVTAYPEVLPADFEGRWVSKPFDTGALLAALEHVHGERA
>CP034669.1|QAT83311.1|2024152_2024680_+|ECF-subfamily-RNA-polymerase-sigma-factor
MDSQARGALGQAAREHERFLWGLCYRMTGVAADADDLVQDVYARALATPPERLDMLRPWLTRVAVNLARDHLRRRRREGYVGPWLPSPVETGDEEVLPAVEARLPDGGSTEGRYELLESVSFAFLLALEALSPKQRAVLLLRDVFDYSVLEVAEALRMSEANVRARSEITYPNWD
>CP034669.1|QAT83312.1|2024657_2025869_-|hypothetical-protein
MDAEKAVAERYQALRDVMDERVTRRWAGAEALALGRGGVTAVARATGLSRMTVRTGRDEVSGRKPLGELVRVRRKGAGRPPVEVAQPGLTEALESLVDPVTRGDPESPLRWTCKSTKVLAAELMKQGYEVSPQKVGELLKSQGYSLQAGAKSLEGESHPDRNAQFENINAQVREFQARGQPVVSVDTKKKELVGEFKNGGREWQPTGAPVLSLTHDFPDTAVGKAIPYGVYDIGDNSAWVSVGVDHDTPVFAVNSIGAWWRKMGQERYPEAKELLVTADSGGSNSARSRVWKAELQRLADATGLAISVCHFPPGTSKWNKVEHRLFSHISMNWRGRPLEDYETVVNLIGTTTTAKGLKVKARLDRRRYRTGVSVSQAAMHQLRLVRSDFHGDWNYVLNPNSDK
>CP034669.1|QAT83313.1|2025967_2026408_+|ECF-subfamily-RNA-polymerase-sigma-factor
MAAYDQARCVPTRDVQARTRASLEAFLGALVTGDVAAAEALLASDVRALSDGGGKVRAALVPIVGPQRVILFLRRLMEMRGPPVAWEERMLNGLPAVVAVFHPGADPMLALHMVLRVDLDSSGRIHALHSVLVDRKLMGVRMPVPE
>CP034669.1|QAT83314.1|2026489_2026657_+|hypothetical-protein
MRISTLLRNGTSLSPGTTYTQLGTVQDSSRPRVAIRPTDGVPHVCYPRDGKVTFP
>CP034669.1|QAT83315.1|2026763_2029037_+|MMPL-domain-containing-protein
MAGRGDDSPAGGGPSLFARLAVGVFRHRSWVLVGTLLLLAAAVWALLRGGHLTTGTIEGIESARAEALARGAAAGSNDQTLAVIFHHDEWATDEPRFAQAVTSVLSRVERLPEVASVVSPIGAPEALRARFVARTGHDLLALVRLKGGEREATAAFPAVRSALQDPDLRTTLTGKVAFLAALNELLEHDLLRAELLSFPLALVVLLWVFRTVVAAMLPLVVGGLAVLCGVAGVMLLSHATNMAQYTLNVVSLIGLGVAIDYSLFIVSRFRSELALGLSTEQALTRTLDTAGRAVAFSGLAVTVGLGGLLFFRGSYLSAMGLGGALVVAFAVLFALTVLPALLAWLGPRVDRGRLPFARKEGRGGAWHALATWVMRHPWWVLLPTLTLLLAMGLPFRRLQLAATDITALPEGTEARQGAETLARLFPREAATRVLVAVEFPGGNPLTPERAGALHDASRRVASMPGVVGVESAVDLGPGMDRATVLRMAAAPPQFLPPELQAARAAYVTGNVAVMQVLTSSAPSSLEARNLVRALREDRTVGDGRWRVGGQTATDVDAAAFVKEHTPAAVGFVMGMTCIVLFVLLRSVVLPLKALLMNLLSLAGSFGALVWIFQEGHLHRLLRFEPGPIEPSLPILLFCALFGLSMDYEVLLLSRIREEYLRTGDNTHAVAEGLERTGGLITSAAAIMVAVFAAFTLASVVVVKAMGLGMAIAVALDATLVRVLIVPAMMRLMGDFNWWGPGHWRRSHPRPQGTEVRP
>CP034669.1|QAT83316.1|2029033_2030224_+|ceramide-glucosyltransferase
MSAQSLAWTAAALGVLAHGHRELMAGLRRRQAPPVKRFEPPSVTVIRPIRGLDVDARENVRALLDLDYPGEWEVLFVFDSEDDPAFLPTREEAATHPTRAKRVDLMVAGEPPAGMTGKLHAMQVGVDCSRGQLLAFSDSDTRPSPGVLTALVGALLEDGGTGATFAPIYAAADAPLAGDVGYGLLVNAWYGASVACTAEPDGALPFIMGQLMVFRRQALEAIGGVGCAAGQFVDDMYLGRRLYLAGWKNRVVHVPLRVVTGRLGLGAFLRIFRRWILFSEAGLPGTFARPHWVRGAVSWLSWGALATAVARRAWGPALLSAAPIGFSVWSQLRLQRACHGPQVAPRHYWVPAVLPLLGAGVAVSARLSREVDWRGRGYRLDAKARLGEAQPARASV
>CP034669.1|QAT83317.1|2030163_2031573_-|monooxygenase-family-protein
MGDTEVVIAGGGPAGCAVAAALSDLGWSVLLLDAGVDRHKQLAGELLHPPGVRDLRALGFGDVVDGWASHPVRGFAVRFHAPARTLVLPYGRGVTGLSLEHAALTLPLQESVSRRRGVTVHTRARVTAVEHNCERGVRLRYSHAGTEHTVYARLLVAADGRASPVRRMLGIAEHHQRLSTMLGVTVDSACLTHPEYGHQFVGGAVHALAYTIQPGVARVMVDLPLGSTAQTLKEQPELLLALPSRLREAVRQALEQRPAVRMASNDDWLAETVWMGSAVLVGDAAACCHPLTASGMASCFHDARALQESLERHPGHVARALEHYAHARRPAQRTRVALASALYSAFARQDEGMHALRMGLLHYWEHSPGGARASMALLSSEEPRMRVMAREYLRVVAHAFAAMLSPNGPGGSLRSAAPLLRSAGPPLRGTVASAVEQVGSWLHRRVRRPVYTLARAGWASPRRAFASNR
>CP034669.1|QAT83318.1|2031659_2032706_+|phytoene-synthase
MKVQVASFCRTQLPRVSRTFALNIPLLPEPLDLAVTVAYLLCRIADTLEDEAPGALHGALLDELGALVSLEPGWEARARSFARRARLALRDEVPPAEAELISETPAVLETLASLPSWVHPPIARCVRTMTGGMNQIQRMHGGSGQVMGLPDLQATFMYCYYVAGVVGEMLTGLFVASSPRAAWREARLLSRAPAFGRALQLTNILKDVREDLDRGSCWLPRDRMAAHGLTPATLALPSLRANAVALMDELVAVARRELDVALEYSLALPVEEPGLRLFCLYPLFFAAATLDALEGNPAVFEPEPVKIPRETVATLMRLTQERVGSDEALRALYARFSRASRGGAEAWS
>CP034669.1|QAT83319.1|2032705_2034667_+|putative-squalene--hopene-cyclase
MRRARDLLAATQAADGSWKGDYSGPLFLGPVYVAGLYVMGRAPEAAVRDGLVAHMRAHQNPDGGWGLDVESPSLVFTSVLNYVAQRLLGVGADDPGLVRARAWFLPRGGPLGSASWGKFILALLGLYEYEGLAPVPPELWLLPRGLPFHPSRLWCHCRMVYLPMGWLYGRRVRAPETPLLAELRRELYPQPFADVDWGAARGRVAGTDAYSPHGLGLRAVHRVLGVYERFHSKRLRARALAESLALIRGEDEATHFVCIGPINKVLDMVVWHVARPDGPEVRAHLERLPDYLQQTRRGITVNGYNSSQLWDTAFAVQALVASGESPWARDTLARAGRFLEAQQVLEDSPDAARHHRHPSRGGWPFSTRAHGWPISDCTAEALRACLLLEPLGLNRVPRERLAQAVAFILSLQNRDGGWATYEQQRGPRWLERFNPSDVFAGIMVDPSYVECTSACIQALAAWREAFTDAPVGHAIARGADFLRRQQRPDGGWEGSWGVCFSYGTWFGVTGLVASGAGTGDPALRRAVTFLKAHQREDGAWSETLQACRERRWVEGRTGHAVMTSWAVLSLVAAGEAHAEATRRGVAWLRERQEAEGQWPPEPLAGVFSRTCGIHYDAYLRIFPLWALSLAERQAKDFKAREGSATPGSPPCPG
>CP034669.1|QAT83320.1|2034614_2035121_-|hypothetical-protein
MYFETFSQMKKQLGRLSKWLETAAAHAKAKSFDPNLYLDFRLAPDQLPFVRQVQIGCDAVKLAASRLSGKAAPSNPDTEQTLEELSARVRSTIAYLDTFTAKDFEGAAGRTVTHPRWEGQVMSGADYFLENAVPNFFFHVTHAYALLRHNGVNLGKADYLGSLSLRAP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP034669_8

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP034669_8

2221621-2222429

Orphan

Consensus_repeat	Method
GATGGCNGCGGNCTGGGGNGC	CRT

14 spacers

The CRISPR arrays of CP034669_8

>merge|CP034669|8|2221621-2222429|CRT
GATGGCGGCGGCACGGGGCGCGGCGGTGCCGGGGAGCGGGATGGCCGGACCCGCGCCCATGGGGATGGCCGCGGGCGGGGGGCAGCCTGGCCCGGGAGCGGGATGGCGGCGGCGCGCGGGGCGGCGGTGCCGGGGAGCGGGATGGCCGGGCCCGCGCCCATGGGGATGGCGGCGGACTGCGGCGCGGCGCTACCCGGGAGCGGGATGGCGGCGGACTGCGGCGCCGGAGCGGCGGCGCGCGGGGCGGCGGTGCCGGGGAGCGGGATGGCCGGGCCCGCGCCCATGGGGATGGCGGCGGACTGCGGCGCGGCGGTGCCGGGCAGCGGGATGGCCGCGGACTGGGGCGCGGCGCTGCCAGGGAGCGGAATCGCGGCGGACTGGGGAGCCGGAGCGGCCGCGCGCGGGGCGGCGGTGCCCGGCAGCGGAATGGCCGCGGACTGGGGCGCGGCGCTACCCGGGAGCGGGATGGCGGCCGGCTGGGGCGCGGCGGTGCCCGGCAGCGGAATGGCTGCGGACTGGGGCGCGGCGGCGCCCGGCAGGGGAATGGCGGCGGATGGGGGGGCAGCCTGGCCCGGGAGCGGGATGGCCGCGGACTGGGGCGCGGCGGTGCCCGGCAGCGGGATGGCGGCGGGTGGGGGGGCAGCCTGGCCCGGGAGCGGGATGGCGGCCGGCTGGGGCGCGGCGGTGCCCGGCAGGGGAATCGCGGCGGATGGGGGGGCAGCCTGGCCCGGGAGCGGGATGGCGGCGGACTGGGGGGCGGCACTGCCCGGCAGCGGGATGGCGGCGGGCTGCGGCGCGGCCTCGGGAGC

>CP034669|8|3|2221621-2222429|CRT
GATGGCGGCGGCACGGGG	CGCGGCGGTGCCGGGGAGCGGGATGGCCGGACCCGCGCCCATGGG
GATGGCCGCGGGCGGGGG	GCAGCCTGGCCCGGGAGCGGGAT
GGCGGCGGCGCGCGGGGC	GGCGGTGCCGGGGAGCGGGATGGCCGGGCCCGCGCCCATGGGGAT
GGCGGCGGACTGCGGCGC	GGCGCTACCCGGGAGCGGGAT
GGCGGCGGACTGCGGCGC	CGGAGCGGCGGCGCGCGG
GGCGGCGGTGCCGGGGAG	CGGGATGGCCGGGCCCGCGCCCATGGGGAT
GGCGGCGGACTGCGGCGC	GGCGGTGCCGGGCAGCGGGAT
GGCCGCGGACTGGGGCGC	GGCGCTGCCAGGGAGCGGAAT
CGCGGCGGACTGGGGAGC	CGGAGCGGCCGCGCGCGGGGCGGCGGTGCCCGGCAGCGGAAT
GGCCGCGGACTGGGGCGC	GGCGCTACCCGGGAGCGGGATGGCGGCCGGCTGGGGCGCGGCGGTGCCCGGCAGCGGAAT
GGCTGCGGACTGGGGCGC	GGCGGCGCCCGGCAGGGGAATGGCGGCGGATGGGGGGGCAGCCTGGCCCGGGAGCGGGAT
GGCCGCGGACTGGGGCGC	GGCGGTGCCCGGCAGCGGGATGGCGGCGGGTGGGGGGGCAGCCTGGCCCGGGAGCGGGAT
GGCGGCCGGCTGGGGCGC	GGCGGTGCCCGGCAGGGGAATCGCGGCGGATGGGGGGGCAGCCTGGCCCGGGAGCGGGAT
GGCGGCGGACTGGGGGGC	GGCACTGCCCGGCAGCGGGATGGCGGCGGGCTG
CGGCGCGGCCTCGGGAGC

Protein	Signature genes	Signature genes Name	Protein_function
CP034669.1\|QAT83484.1\|2225861_2227295_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|313268
CP034669.1\|QAT83485.1\|2227386_2228241_+\|acyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|153249
CP034669.1\|QAT83486.1\|2228237_2229203_+\|putative-UDP-glucose-4-epimerase	unknown	unknown	gnl\|CDD\|187551
CP034669.1\|QAT83488.1\|2230092_2233719_+\|Beta-barrel-assembly-enhancing-protease	unknown	unknown	gnl\|CDD\|274350
CP034669.1\|QAT83483.1\|2224912_2225860_+\|polysaccharide-deacetylase	unknown	unknown	gnl\|CDD\|200565
CP034669.1\|QAT83489.1\|2233720_2234119_+\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT83475.1\|2210445_2211654_-\|DNA-polymerase-III-subunits-gamma-and-tau	unknown	unknown	gnl\|CDD\|237871
CP034669.1\|QAT83474.1\|2209166_2210201_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237871
CP034669.1\|QAT83481.1\|2222793_2224107_+\|UDP-galactopyranose-mutase	unknown	unknown	gnl\|CDD\|224153
CP034669.1\|QAT83487.1\|2229550_2230000_-\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT83470.1\|2204292_2206260_+\|putative-lipoprotein	unknown	unknown	unknown
CP034669.1\|QAT83471.1\|2206263_2208141_+\|masK-protein	unknown	unknown	gnl\|CDD\|270916
CP034669.1\|QAT83482.1\|2224185_2224896_+\|group-2-glycosyl-transferase	unknown	unknown	gnl\|CDD\|133022
CP034669.1\|QAT83469.1\|2202677_2204243_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372685
CP034669.1\|QAT83477.1\|2213379_2214846_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|281842
CP034669.1\|QAT83490.1\|2234124_2236173_-\|ATP-dependent-DNA-helicase	unknown	unknown	gnl\|CDD\|223588
CP034669.1\|QAT83472.1\|2208150_2208744_-\|recombination-protein-RecR	unknown	unknown	gnl\|CDD\|234616
CP034669.1\|QAT83473.1\|2208750_2209068_-\|Nucleoid-associated-protein	unknown	unknown	gnl\|CDD\|376829
CP034669.1\|QAT83476.1\|2211731_2213270_-\|phytoene-dehydrogenase	unknown	unknown	gnl\|CDD\|224154
CP034669.1\|QAT83478.1\|2216188_2217469_-\|seryl-tRNA-synthetase	unknown	unknown	gnl\|CDD\|235461

Protein	Function_ID	Function_description	E-value
CP034669.1\|QAT83484.1\|2225861_2227295_-\|hypothetical-protein	gnl\|CDD\|313268	pfam10009, DUF2252, Uncharacterized protein conserved in bacteria (DUF2252). This domain, found in various hypothetical bacterial proteins, has no known function.	1.72801e-63
CP034669.1\|QAT83485.1\|2227386_2228241_+\|acyltransferase-domain-containing-protein	gnl\|CDD\|153249	cd07987, LPLAT_MGAT-like, Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: MGAT-like. Lysophospholipid acyltransferase (LPLAT) superfamily member: acyltransferases of de novo and remodeling pathways of glycerophospholipid biosynthesis which catalyze the incorporation of an acyl group from either acylCoAs or acyl-acyl carrier proteins (acylACPs) into acceptors such as glycerol 3-phosphate, dihydroxyacetone phosphate or lyso-phosphatidic acid. Included in this suubgroup are such LPLATs as 2-acylglycerol O-acyltransferase (MGAT), and similar proteins.	3.34677e-38
CP034669.1\|QAT83486.1\|2228237_2229203_+\|putative-UDP-glucose-4-epimerase	gnl\|CDD\|187551	cd05240, UDP_G4E_3_SDR_e, UDP-glucose 4 epimerase (G4E), subgroup 3, extended (e) SDRs. Members of this bacterial subgroup are identified as possible sugar epimerases, such as UDP-glucose 4 epimerase. However, while the NAD(P)-binding motif is fairly well conserved, not all members retain the canonical active site tetrad of the extended SDRs. UDP-glucose 4 epimerase (aka UDP-galactose-4-epimerase), is a homodimeric extended SDR. It catalyzes the NAD-dependent conversion of UDP-galactose to UDP-glucose, the final step in Leloir galactose synthesis. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.82931e-113
CP034669.1\|QAT83483.1\|2224912_2225860_+\|polysaccharide-deacetylase	gnl\|CDD\|200565	cd10940, CE4_PuuE_HpPgdA_like_1, Putative catalytic domain of uncharacterized bacterial polysaccharide deacetylases similar to bacterial PuuE allantoinases and Helicobacter pylori peptidoglycan deacetylase (HpPgdA). This family contains many uncharacterized bacterial polysaccharide deacetylases (DCAs) that show high sequence similarity to the catalytic domain of bacterial PuuE allantoinases and Helicobacter pylori peptidoglycan deacetylase (HpPgdA). PuuE allantoinase appears to be metal-independent and specifically catalyzes the hydrolysis of (S)-allantoin into allantoic acid. Different from PuuE allantoinase, HpPgdA has the ability to bind a metal ion at the active site and is responsible for a peptidoglycan modification that counteracts the host immune response. Both PuuE allantoinase and HpPgdA function as homotetramers. The monomer is composed of a 7-stranded barrel with detectable sequence similarity to the 6-stranded barrel NodB homology domain of DCA-like proteins in the CE4 superfamily, which removes N-linked or O-linked acetyl groups from cell wall polysaccharides. In contrast to typical NodB-like DCAs, PuuE allantoinase and HpPgdA do not exhibit a solvent-accessible polysaccharide binding groove and might only bind a small molecule at the active site.	7.84489e-102
CP034669.1\|QAT83475.1\|2210445_2211654_-\|DNA-polymerase-III-subunits-gamma-and-tau	gnl\|CDD\|237871	PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional.	0
CP034669.1\|QAT83474.1\|2209166_2210201_-\|hypothetical-protein	gnl\|CDD\|237871	PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional.	4.98395e-16
CP034669.1\|QAT83481.1\|2222793_2224107_+\|UDP-galactopyranose-mutase	gnl\|CDD\|224153	COG1232, HemY, Protoporphyrinogen oxidase [Coenzyme metabolism].	2.08739e-43
CP034669.1\|QAT83478.1\|2216188_2217469_-\|seryl-tRNA-synthetase	gnl\|CDD\|235461	PRK05431, PRK05431, seryl-tRNA synthetase; Provisional.	0
CP034669.1\|QAT83471.1\|2206263_2208141_+\|masK-protein	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	5.00501e-97
CP034669.1\|QAT83482.1\|2224185_2224896_+\|group-2-glycosyl-transferase	gnl\|CDD\|133022	cd04179, DPM_DPG-synthase_like, DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.	9.3116e-39
CP034669.1\|QAT83469.1\|2202677_2204243_+\|hypothetical-protein	gnl\|CDD\|372685	pfam13715, CarbopepD_reg_2, CarboxypepD_reg-like domain. This domain family is found in bacteria, archaea and eukaryotes, and is approximately 90 amino acids in length. The family is found in association with pfam07715 and pfam00593.	1.20707e-10
CP034669.1\|QAT83477.1\|2213379_2214846_+\|hypothetical-protein	gnl\|CDD\|281842	pfam03901, Glyco_transf_22, Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.	4.70022e-25
CP034669.1\|QAT83490.1\|2234124_2236173_-\|ATP-dependent-DNA-helicase	gnl\|CDD\|223588	COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair].	5.82254e-163
CP034669.1\|QAT83472.1\|2208150_2208744_-\|recombination-protein-RecR	gnl\|CDD\|234616	PRK00076, recR, recombination protein RecR; Reviewed.	8.60964e-113
CP034669.1\|QAT83473.1\|2208750_2209068_-\|Nucleoid-associated-protein	gnl\|CDD\|376829	pfam02575, YbaB_DNA_bd, YbaB/EbfC DNA-binding family. This is a family of DNA-binding proteins. Members of this family form homodimers which bind DNA via a tweezer-like structure. The conformation of the DNA is changed when bound to these proteins. In bacteria, these proteins may play a role in DNA replication-recovery following DNA damage.	1.2317e-29
CP034669.1\|QAT83476.1\|2211731_2213270_-\|phytoene-dehydrogenase	gnl\|CDD\|224154	COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism].	3.19777e-68
CP034669.1\|QAT83488.1\|2230092_2233719_+\|Beta-barrel-assembly-enhancing-protease	gnl\|CDD\|274350	TIGR02917, TPR_domain_protein, putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.	8.02706e-26

>CP034669.1|QAT83478.1|2216188_2217469_-|seryl-tRNA-synthetase
MLDLRNVAQNFDAVVARLKTRGGSLDLGLFQTLFTERRDLYVSMEALAARRNAANEEMKRKAKEDPSAMEKLRGDLRGVSQEIKEKESRLKEVEEELNRILLVIPNVPHDSVPVGASADENVQVKTWGEKPNLLFAPKQHFELGESLGMLDFERAAKVSGSRFTFYKGALARLERALVTFMIDVHTSKGYTELLPPYLVLRETMMGTGQLPKFEDDAFKTSGDPERFLIPTAEVPVTNYHADEILEGEQLPIRYCAFSPCFRAEAGAAGRDTRGLIRQHQFHKVELVKFSQPDKSLEELEAMTDDACDILRRLGLHHRVMLLCTGDMGFGARKTYDIEVWLPGQGAYREISSCSDCGDFQARRAKIRFRPQKGDKPQMVHTLNGSGLAVGRTSIAILENYQREDGSVAIPEALVPYMGGLKELRPL
>CP034669.1|QAT83477.1|2213379_2214846_+|hypothetical-protein
MNAPTSDAPPAPVLPQAPLEVPAPVRTELPGTLRVLGLLAVALVPCVLAVSELGRIHPDEVFQALEPAYWRVHGYGVLAWEWREGLRNWAVPGVLAAFLKVAHGFGVTDPRVYRGVVALPQFALHAWSLWAVHRFAERRAGPWGGALAVLLVGLSAPVLLFAGRTLSESFSASFLLVAMEALDRPDSGADARVRRAGLVGGMALGLAVVTRYPSALFVVAALFWLAAARRWRLLAFTCVGGAAVAVGLGLLDWGTWGTPFHSFLAYVDYNLLSGKAAAAFGASPPDFYWEPLLQAVPLWAWAAVPLSLAPLPRFRALSLPLTCAAVYIAVLLATPHKEERFLYPALVVALLAAAAQLAASITALLRPGLRNGAAVLALALGFVHGRGFPSSDLRADQLRAIVRATRGDATGLLIVNEGLWGSGGFFYIGKNIPWRTCDWPRDAAFQASIRDRAFNRAVTFEGRALPELQAAGFRVVREVGRETLLVRD
>CP034669.1|QAT83476.1|2211731_2213270_-|phytoene-dehydrogenase
MPDVIVVGAGHNGLVAAAMLARRGLSVTVLEEKDQVGGACKTEYPFRTAPKLGVSTGAYLLGLMPPELLQELQLELPLKRRDPHYFLPTMDKRYLLFGSDERELERQFREFFSEADWNAHVAMNTELAALREDLAPAWLLPPLSLEETAERYVRPALRQHFIRLCRGTAREYLERFGYKSDFVKAMYAVTDAFSGLDGGYDTPGTGMNLLVHNLCRLPGSGGTWMIVEGGMGTVTQRIAALARKHGAQLRTNAKVASVRVDGGVVKGVVLENGEELSAKVVVSNADPFRTLKLVDTKALPEDYRRKVDGLSAPGTTLKVNLCLKSLPTFTCLPEDRGQFGPTIHLLPQEDDVLGALAHGYKEAQAGRLAEFPSIEWYVHTTVDPTLKDAEGHHNSALFVEWVPEKLEGTTWEKEEARYVKHLLSICDRFAPGTSDLVQEYFALTPPKIESHFGITRGHIHHVDNKRGFTDRLPYETPVQGLYFCSAGCHPAGSVIGAAGHNAANVVLQALGR
>CP034669.1|QAT83475.1|2210445_2211654_-|DNA-polymerase-III-subunits-gamma-and-tau
MSYLVLARKWRPQKFDDMTGQEHVVRTIGNAIKMDRVAHAYLFCGPRGVGKTTAARLLAKALNCEQGPTATPCGTCRACTEITAGTSVDVAEIDGASNNGVENVREIRENAKYLPQRDRHKIYIIDEVHMLSGAAFNALLKTLEEPPGHVKFIFATTEAHKLPDTILSRCQRHNFRRISAARMLQRLKEICQAEGAGISEQSLSLVVRQSEGGMRDALSLLDQILASCGPNPTDEAVAEAMGAIDRTVVQDFAEALVRKDAKRVLGRVDEVFNRGLDLKRLAEELALQLRHLFVTKSLGEAPAELAESEQKALVALAKEADTAQLSRLFDIVHGCIWDVSRAAQPRLALEMALLKAIQLSPAGSIPDLLARVERLSASLGAEGAKNTTGAPGGRSGPANFRV
>CP034669.1|QAT83474.1|2209166_2210201_-|hypothetical-protein
MEGLSPSAARPLSFLRNGGSAGGPVPTPAAVSPAPVVMDDLSPSAARPLSFLRNGGGAAPAMEPPPAPGVVMDDLPPSAARPLSFLRDGGAQPPAPVPTPAARAPEPATPTVRITNMRKPEPVAPPEPPRHGDEDVDERMFPEEGSAEGCASGECIPVAEPAAPEPEPPEPEPPPAMAPVSTSRDNPNRSLPERWRAAVETVKSTSVRHGTALANGRLQSMKAGEIVLGFPPSAAFHKAAVVSPGGKATVDAALASHFGRAVKLTITDVPQTQDALPGGMGQSLSEVDTQTRNTHEKSTEGKVRSHASVRAILKMLGGEIEHIQVYEPERPPASLPDVPAAPDD
>CP034669.1|QAT83473.1|2208750_2209068_-|Nucleoid-associated-protein
MPGIDLNYFIRQANKLTEKIEERKKQLAEETVEAKSGEGLVTVVANCVQEIRSIKIDKSAIDPNDPGMLEDLVTAAVNAALANSRQHMNAELAKISGGVKIPGIN
>CP034669.1|QAT83472.1|2208150_2208744_-|recombination-protein-RecR
MTPDPLNRLVAQLAKLPGIGEKTAQRLAFHILRAPGEFAVDLSQAIREVKEKVHLCVRCFSLTDSELCGFCRDNRRDERALCVVETYSDLMALERTREFKGRYHVLHGVLSPLEGVGPEQLRIKELLHRLNDSRVEEIILATNPDIEGEATALYLTRLLKPMGLRVTRIAQGLPMGGDLEFADQATLAKALSARRDL
>CP034669.1|QAT83471.1|2206263_2208141_+|masK-protein
MAQTHVPIPDPAGASTATLLQPYGQYVLVRKLAEGGMAEIFLAKLLGADGFERNVVLKRMLPTLSAIPDFVEMFRDEARLAAKLSHPHIVQIHELGFTDGCYYICMEYLAGEDFSTTLRLAGRRRQYVPLPVVMRVLIDAARGLHFAHTFTNEQGQPLHVVHRDVSPSNLYVTYQGQVKVLDFGIAKAESRLVQTRTGVVKGKYIYMAPEQAQGKEVDHRADVFSLGVSLYEAVTHVRPFSRENDLAVLNALLQGDFEKPRALRADLPQGLEDIILKAMAFKPEDRYATAEDFAVALEAFASDFQGGAASAPALGTFLRNHFGEERVTEKTRIPTLATLTAARPTDPEFAAIAQPVAGAGTNTYGQQVSRPSSTGVRALTSQNKAAPEPEVVPSAPVVKPASRRWVLGVVGGLGLVAAGVAFVVARPGGTATNVTPPPPVQQAVAPVASGTPAAPAQQAAAGRQGQGAPTGTQAQGPEGTTPGAIQGAVQDGTPGGDAVATSVTDSRPVDDGAEDTSPRKGVKKPAAKEPVSLGIDDIQRVVSGGRSKITGCFERYKSDLPAAAGEVQVELTIVSSGKVRAGTRGPLASTAVGRCLETQAQSLRFPVHRDQEVTVLMPFSWKVTQ
>CP034669.1|QAT83470.1|2204292_2206260_+|putative-lipoprotein
MSPVRILALSLLVLLSGCSGCEREEAPKPPPGVEVDAGAVVPIGRLEGLSGDVRLERGGKVGPAVEGPLLAGDAVETGESGSATVRFPGDRTVEVGSEGRFAVGSDATGIVMKVERGIVLSRVPAGGKADSAGSKVTLNILTPFGLTRVGPDPSEVKVAVAEDSARVEVKLGAIELVSKDGKTLRAAQGDAVDLTRERAQVTPAAPRVVELAPIPVTVRATSGVAEVKAKDTGRWRKVRREGEVLAFGDGVRTKGGEAVLSLKDSGTVLTLAPGAEAVLERAGQQGTVDEARVNLLQGLLAVQLAMGRESRVVLPEMTVESGGGARLEIRRTGAGMQVAAHTGDVTLRRGEARQELRAGERATVGTDGNAKVEPLEEAVVAVGPGDGTEVFHRGLSEVALTWEGEGDAVVEAAQDAAFKRPVLWGRVHRASVNVSALAKGTLYWRARKDDGTQVAAGSIRFAPESPTRSLARVRNVVPEGPEKTTIFYQDKPPAVTFTYGEEPQARSYRVAVYKAGSLATPVVQRTVSEPRAALEAGQLGEGSYLWSVTPLSQAGAALKGGRMNKLELVYDNSVVGLVVDSPRQGVPAAEKVRASGVAPVDARLSINGRAVPLDAKHRFDTWVAPMGMPPLLVFKMTRPGAPDVLTVRTLKQRGP
>CP034669.1|QAT83469.1|2202677_2204243_+|hypothetical-protein
MRRPSPLPDILPPLVVLVLALAWTGAAHAQAPESERASLRLRYGLSSRQGEQVDVGPGLTYSGLTPNDVALTLMGWAGEYLGGQVDLQREAFELRDASSRVTGGSLVRGSLGPRGRLSLGPVRLELGVGYGFAQLPLFGGFTYAPVLQRGVRHAALISGRVLVALPARLQLEARGEVPLTLSAHAADGLKASSSGYVVGAALSYPVVRRDGWTGRVLLDVQQAHDTMELEDRGLRSEQRMRRIGLGFEVVLGSVVRTSRPVGPRQAFVALSVVDAETGAPLPGARVRVPSLTTPGTDEERVADAQGQLRVLLPEGAQSTQARVDGYEDATAVTTVSGDATESEPVQLRLRKKAPKTGALKVKVVQGRNSAPVPDVQVVSGTARLRTDKAGEVLLEGLEPGPVAVAMSAPGFRPTEEAAVVVAGRTSELVVVLSQDRKGELATLVGQVRSARSGQPLVATVSIPQAKVRTRTDKSGAFTARVRGGTYRITLSAPGHRTQTKRVTVREGEQAILNVDLFPRGR
>CP034669.1|QAT83481.1|2222793_2224107_+|UDP-galactopyranose-mutase
MDPIVILGAGLAGLSTAHFLKRPWRLIEKSDRVGGLIKTEVIDGCYFDPTGHWLHLRDPEIQQLVNTLWMPDQLVRIQRRAAIFSRDTFTRFPYQVNTHGLPPEVVAENLVGYVEAIYGEKGRALRERDPVNFEEFILRYMGEGFAKNFMLPYNQKLWTVHPREMSAAWVGRFVPRPTLKEVVDGALGAGSDQLGYNASFLYPREGGIESLARAMKQHLTGGELSVRTEPVSIDWKAKQVALSDGRTVPYSGLVSSIALPALVELLGKGASGVPDEVRAAAKRLRAFIVTYVCVGARGANRQPWHWIYLPEPEFHSYRIGAPSAVYAPLAPPDTASFSVEFSHHGELSVADAERFAVEDLVRSRMIHSADDILFAKGREIPNAYVLYDDAYGPAMAEVKRFLEHAGILMAGRYGKWEYASMEDAILDGRACARTLNG
>CP034669.1|QAT83482.1|2224185_2224896_+|group-2-glycosyl-transferase
MALHLSVVIPVYNEESIIAQAAEELRQGLDARGLDYEIIFAENGSRDATPRILEELCAKNPRLRWFHSETPNYGVALKAGILKARGTYVVCDEIDLCDLTFYDSALPRLERGEADMVVGSKAAKGASDQRPLIRRAATRVHNKLLRVALGFQGTDTHGLKAFRREALLPVIQKCVVDMDVFASEFVIRAWREGLNVMEIPIQLHEKRQPSIHLFKRVPNVLKNVGKLFYVIRVRGT
>CP034669.1|QAT83483.1|2224912_2225860_+|polysaccharide-deacetylase
MTAARLASISVDLDSLPHYCRIHGLPESLLDERARTLIHRVAVPRFLELFAAVGVPGTFFVIGDDLESDPGASDGMRRSHAAGVEIASHSHAHDYALTRRGPDAIAEDLARADAAILKAVGVRPSGFRAPGYTLNADLYAATVAQGYRYGSSAFPAAPYYAAKAAVMGALAALGRPSRSVLDTPRVLLAPRVPYRPDPAQPYRRGSGPVLELPMTVTPVVRFPFIGTFATTLPRGTMRAAYRTCRADAFFNFELHGVDVLDATDGIPPELARQQRDLRTSAAKKMERLRSIFQWLKDDFDVVTLRDAAGQLSATL
>CP034669.1|QAT83484.1|2225861_2227295_-|hypothetical-protein
MRIPSKPSLPSRTSTSGSTVAATVLTLATSGAAAGRLASGVSDFQPQATTSRTGNTVAGNTLAPKQARASGLERPPSQAVSFVRDFNARLDLPPARLKEKLAQMRQSPSAMFRAMPALFHADLRGPYAQEARLTDRPAPDIRVVGDAHVGNLGTFRGPDGKPVWGLNDFDQTGTGSPEADLTRLATSAVLTAREAGLSGSEQIKAVEALAKNYFETLELLADGDANPGAFLDKKESSGPVKDLINQARDTSAKELLSKYVKLDGAKGPRFLTTDTLKPLDAEKKAAVRTALASYEKTLDGTACVAVPLKVLDLAERLDAGGSSYGLERDYVLVGAADPKAPPVLLELKELLASGVASPPVPANGADVVKAQEALGGTLNPLTAAVNMGGRAFLVREVEPEKNTLDDAVLGKKKSLRSTFEQAGVVLARAHGNTQAQARCLEDWVGPDTKEATKRLVAFAQAYADQAEADWKALKASR
>CP034669.1|QAT83485.1|2227386_2228241_+|acyltransferase-domain-containing-protein
MLERFSDKVKKGLRGWTERMAGEQQSDQLQALARTENEYGVDPFGFNLDYSLAAIAPFMWLYRHYFRVEAYGADRIPSGRVLLVSNHSGQLPLDGAMIGIALMVEGNPPRAIRSMVEKWVPSLPYVSTFMARVGQIVGTPENCRRLLEAEEAILVFPEGTRGLNKLWPQRYQLQEFGLGFMRLALETNTPIVPIAVVGAEEQAPALMNLKPVAKLLGFPSFPITPTGTPFPLPTKYRIYFGDALHFTGRADDEDSELDKKVRTVKASIQAMLHQGLKERRGVFW
>CP034669.1|QAT83486.1|2228237_2229203_+|putative-UDP-glucose-4-epimerase
MSASTEEKDAVVVDKRPAVVVTGISGNLGRTLAKMLHKRERIIGIDRRPFIGKPKDVEMHQLDLRKKKAEDVFRKNEVRAVIHMGIMHDPRMSEEEHHSFNVVGTTRLLEYCAKYGVKKVVVLSSANVYGPSPDNSNFLTEDAPLMAASRFSGVRDLIEVDMLAHSFFWKHPDIETVILRPVHIVGPTIKNAPSNYLRLRHPWTMAGFDPMVQLIHVEDVARAMVEALRPEPKGVYNVVGPGQVPLSAVLRELGHTAIPVPHPVARPLLGLMFRYRLANFPPPELDHIQFLCAVDGNRWVQDVGWKSRHSMRDTIRSVIGE
>CP034669.1|QAT83487.1|2229550_2230000_-|hypothetical-protein
MKRLSALMVALVLGGACAHTPPKSDLEALKPVVEGFHKNLRWRNYRALSTFLVPEERKDFDSKRRELHDDRDLTVTDYEIEDVKLAEDGRRATVQSRIQWMRLPSVTEQNDTVTSEFIFRDGVWLLEQQQSGPFAGELEPREAPPAPSP
>CP034669.1|QAT83488.1|2230092_2233719_+|Beta-barrel-assembly-enhancing-protease
MAKSMVERYEQLLRQDPTSSVFVELAKALLEKGDAQRTIEVCTQGISHHPTSTVGRVLWGKALIQLGRPAEAMEQFDQAIAIERDNPYAYNLIGDVLLQRGLYRSALPILRKAVALQPNNGRVKQWLEQAQQALSGGPAPIFEDLGVLATPAAAPEEDAPEPPAPEAAPSAFEARAAAAAGLEPRRAARTETPAGGTDAQAASRVASVEAHGGPTAPVGAPVLEDARGPGSVEAGEQDASRGGPVDPGQEPGPGREHAASGPSDPGMEPGADPASEGASAAGQEPGSGDPADPAAGDAAPSDPEQGLEVPPAPVQAADPGASSRGRKSGMLADLPDAPPEDEPSASQGGGLLGDLPPPETERARAAAPVTPAPVASGGKRSLLDDIPDATELAAAAARNKAAANAKDTEALAAKYEREMHEKIAKERAKQSLLERYGAKTVALFVALIFLGASAGFFILYRSRQGGQTLSETLELAKRAVAQDTGASLDEALRQLDRARDMDEASPAAWALAGYAHALRYLDHGARADDRRLALEALEKPGVKDGFNGLVLATNALVADDRARESANRALLASQDDVTEVHALAGSLLIAARDEKKALDRFDRALKASPGNVRALVALGNYYLASEDFAQALEMFKRARDVSKEHAAARIGMAESRLALEQDLDAALADVAPLAQDAKVPPALQPRQQLVHGEILSALGKYDEARTLLSKGTQGPLAMDFQLALGAAGRAAGKLEAAQQAYEAALKLQPRSEAAKEGLGRTLLDRDREKEALLRLEADGGRKVSLVRGAAYARLGDWKRARAELGKTRVNDRYPPEAVVWLALADAHEGNAAQARDVLEKAVAKKPRTDLRVALGQVYWRERALDKAQAQFDEAMKDPRDYEGACSLGRLLLSRGLPDMALKPLTQAVERNGAHGEARDALGRTLLALGRTPEALKQFEAWQLDNPGSAAAQKGFALALYQSGRRKEAEGASGRAVKLAPDDAEGQRLRAALLFASGDAKGGFFALERANKLDSKDPDTFCEIAQAFLRQGQVESADAAFAAARREGPDATCGRVGELYTQLPGGGRGAARTLKDLADKAPTVWDKAFAQVTLARVLLGAGAVKEARAAADEAVKLAPYNGRAYLALGLVAFKQRQEAPAREALAKAVELEPTDGLAHLALADVLVRETAELPRAVEAYEAFLKLAGGAPEANRVKKALPLLKRRASR
>CP034669.1|QAT83489.1|2233720_2234119_+|hypothetical-protein
MVDVSDPRPPSSPLLKVMWGNAFLLSVLYLLTGIVVESIRRRYHAPFFERLSMALDSLPARALELVRAMEPLREAYFTGRITDLGVRVVFGLVTVAVIFLLALVVGAIMAVLRWALLRATRGGGEGPRPGKG
>CP034669.1|QAT83490.1|2234124_2236173_-|ATP-dependent-DNA-helicase
MRAMTESLPFLEDAQQGLVRHFGLSEFRPGQAPVISSVLSGRNTVVVMPTGAGKSLCYQLPALLLPGITLVVSPLIALMKDQVEQLAAKGIAATYINSSLSDVERADRLRKLRAREYKLLYVAPERFRSGSFLELVSGLGVELLAVDEAHCISQWGHDFRPDYALLGQVRKRLRPPRTVALTATATPEVREDIVRVLLMKDPAVFAQGFDRPNLFLDVVNVSGDEERRDACASLAAKGGGSGIIYCSTRKAAEGMHSALVTRKVKAVLYHAGMEDDARRRAQDDFMSAKEAVAVATNAFGMGIDKPDIRFVAHANIPRAVEAYYQEIGRAGRDGNPATAVLLFNHADVYTQERLIEGSHPSESVLSDIWAQLQAVEEFDRGVHALAGMVGASEFEVSAALKIFEREGKLERGGRGEGEYGITLTDKAASAQPHAAESQRLLRSLLETFPVGRQATTELPILARRTGLTEDDVRHALGLLEKSGVVRVRRPFAGRSIRALERVPFRELSVDLSRVREQERLNRLMLKRMADYAYTPKCRRAFILRYFGQADAAAVCGKCDRCAGSMMPKPSGSASRSMPAASGAPVMAYSELASMELRRWRKDLAKDLDVPPFIIFNDATLLGLAAALPVDRESFLAVKGTGESRWERFGPKVVDICLMARAAGHEPQAAPVAPRIRKAKSRR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP034669_14

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP034669_14

3644458-3644540

Orphan

Consensus_repeat	Method
ACGCACCGGGCAGGCGCCACGGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP034669_14

>merge|CP034669|14|3644458-3644540|CRISPRCasFinder
ACGCACCGGGCAGGCGCCACGGCTCCGAGGTGGTGCTCGGCAAGGGCGCTGGCGGCCACCACGCACCGGGCAGGCGCCATGGC

>CP034669|14|9|3644458-3644540|CRISPRCasFinder
ACGCACCGGGCAGGCGCCACGGC	TCCGAGGTGGTGCTCGGCAAGGGCGCTGGCGGCCACC
ACGCACCGGGCAGGCGCCATGGC

Protein	Signature genes	Signature genes Name	Protein_function
CP034669.1\|QAT84601.1\|3642738_3643386_-\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT84599.1\|3641206_3642136_+\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT84598.1\|3640723_3641008_-\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT84610.1\|3652578_3652860_-\|general-secretion-pathway-protein-C	unknown	unknown	gnl\|CDD\|273770
CP034669.1\|QAT84605.1\|3647409_3649155_-\|serine/threonine-protein-kinase	unknown	unknown	gnl\|CDD\|270916
CP034669.1\|QAT84604.1\|3645846_3646761_-\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT84606.1\|3649279_3651241_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223562
CP034669.1\|QAT84594.1\|3636456_3637269_-\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT84596.1\|3638268_3639636_+\|protease-B	unknown	unknown	gnl\|CDD\|372084
CP034669.1\|QAT84595.1\|3637441_3638059_-\|glutathione-S-transferase	unknown	unknown	gnl\|CDD\|223698
CP034669.1\|QAT84611.1\|3653013_3654951_+\|ATP-dependent-OLD-family-endonuclease	unknown	unknown	gnl\|CDD\|226121
CP034669.1\|QAT84612.1\|3654947_3656609_+\|ATP-dependent-DNA-helicase	unknown	unknown	gnl\|CDD\|350690
CP034669.1\|QAT84603.1\|3645086_3645419_-\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT84600.1\|3642171_3642423_-\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT84607.1\|3651250_3651457_-\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT84602.1\|3643449_3644214_-\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT84608.1\|3651456_3652113_-\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT84597.1\|3639884_3640709_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378680
CP034669.1\|QAT84593.1\|3633360_3636342_-\|M28E-family-peptidase	unknown	unknown	gnl\|CDD\|380075
CP034669.1\|QAT84609.1\|3652223_3652499_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP034669.1\|QAT84611.1\|3653013_3654951_+\|ATP-dependent-OLD-family-endonuclease	gnl\|CDD\|226121	COG3593, COG3593, Predicted ATP-dependent endonuclease of the OLD family [DNA replication, recombination, and repair].	2.03822e-24
CP034669.1\|QAT84612.1\|3654947_3656609_+\|ATP-dependent-DNA-helicase	gnl\|CDD\|350690	cd17932, DEXQc_UvrD, DEXQD-box helicase domain of UvrD. UvrD is a highly conserved helicase involved in mismatch repair, nucleotide excision repair, and recombinational repair. It plays a critical role in maintaining genomic stability and facilitating DNA lesion repair in many prokaryotic species including Helicobacter pylori and Escherichia coli. UvrD is a member of the DEAD-like helicase superfamily, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.	1.13114e-53
CP034669.1\|QAT84610.1\|3652578_3652860_-\|general-secretion-pathway-protein-C	gnl\|CDD\|273770	TIGR01713, Type_II_secretion_system_protein_C, type II secretion system protein C. This model represents GspC, protein C of the main terminal branch of the general secretion pathway, also called type II secretion. This system transports folded proteins across the bacterial outer membrane and is widely distributed in Gram-negative pathogens. [Protein fate, Protein and peptide secretion and trafficking].	2.32916e-06
CP034669.1\|QAT84605.1\|3647409_3649155_-\|serine/threonine-protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	5.57485e-105
CP034669.1\|QAT84606.1\|3649279_3651241_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	0
CP034669.1\|QAT84593.1\|3633360_3636342_-\|M28E-family-peptidase	gnl\|CDD\|380075	pfam17957, Big_7, Bacterial Ig domain. This entry represents a bacterial ig-like domain that is found in glycosyl hydrolase enzymes.	3.8612e-17
CP034669.1\|QAT84597.1\|3639884_3640709_-\|hypothetical-protein	gnl\|CDD\|378680	pfam11583, AurF, P-aminobenzoate N-oxygenase AurF. This family is a metalloenzyme which is involved in the biosynthesis of antibiotic aureothin by catalyzing the formation of p-nitrobenzoic acid from p-aminobenzoic acid. AurF is a non-heme di-iron monooxygenase which creates nitroarenes via the sequential oxidation of aminoarenes.	0.000918986
CP034669.1\|QAT84596.1\|3638268_3639636_+\|protease-B	gnl\|CDD\|372084	pfam12388, Peptidase_M57, Dual-action HEIGH metallo-peptidase. The catalytic triad for this family of proteases is HE-H-H, which in many members is in the sequence motif HEIGH.	2.04586e-101
CP034669.1\|QAT84595.1\|3637441_3638059_-\|glutathione-S-transferase	gnl\|CDD\|223698	COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones].	6.40388e-44

>CP034669.1|QAT84602.1|3643449_3644214_-|hypothetical-protein
MLISIAMAALAFMGAKSNLQRGLKLAESVRITLPRVVMMETAGAGGSAVAVPIFQPGAITAVPTTLPLNPWGWGTPLMSQAAKSGTASKPPLTDRVLGDAELERLLEKLPNWDKLKQFVGRQIPKEGTPAFDAFKKELQEAGYRLEKLSDGPQPYRLRRPNGQALGDEYAALTVTEDGLIVLKSSKAPSRISIFTRYRKNYLDWVKQPHDEAARAAAEARISQGPPPASPHSGRGGTDEPAGPRGHEACRGVTD
>CP034669.1|QAT84601.1|3642738_3643386_-|hypothetical-protein
MIHELLPDVTHITEDGVHDAEIIEFDGFEYVTFHEPSIDYQREQGAPEVVEFVGNLENAAWLDHLVTTPLGLLLVSKRMVRVLESVGPFRHRAIPTVIYSKRIKHLVRDRFTRQRTWYPVTDPSMKNEDFVILQLLEETPCLDRERTLVKGVPFHQSGESVLGQDEALPLVLRQPPGGFPPVFCVPELTFYCFTEEARQACEAAELKGLWWRPQR
>CP034669.1|QAT84600.1|3642171_3642423_-|hypothetical-protein
MLGCGGVDSEATTGDERMVQAQGAMADEFEVKADVESGVSCNSEQRKLAEAHMVKHHSSFAKMDSCEIVSINYTLYIRYTYYF
>CP034669.1|QAT84599.1|3641206_3642136_+|hypothetical-protein
MSELDDAALLELLDLTFDALCASRVSDWVDPDRVLAAVDLALTPARVMDWHARLVVPMRTRLLARAAKSRTRLGAWLPAEATASLTALLGQPVHLPRKAIDEMVASEQVRETVRTTLQETLSSLVSKVIAGAPGAGSGGLRDALSWGARAAASAGKGILGGLGGSVQDRVREVIDGSMALVQRRIAERLASEETARALGARRQKVFLSTLEKTEAEASQALSQVPHEHLDALVPQVLAHNLARPEVREGLKAELHAVLEDLSRHTVGELLDQAGLRDATRQWLHAHGLPFARTLARSAPFIAWRARPAR
>CP034669.1|QAT84598.1|3640723_3641008_-|hypothetical-protein
MSDFPPKPVVPSPPLPLESTPPERRRGRVLLAATAASAAFTMVACDPFMTTNPAPCVYDGGLVDDDCEPSNGTNDSIRDAGTDAGTDAGLPQDP
>CP034669.1|QAT84597.1|3639884_3640709_-|hypothetical-protein
MRTEALFELDLTDGPALTLHERASGHVATLYPWDALEPSRYPAALLERARYSWTLRALNEFGSATVMGQLVQVMGEARVPLDLWSLAARFPAEEIHHVELCARMAMRLGGGTRLSYSPGAFAVAFDPSLSYLQRASELIVRVCCVGETLSFALLSGCLRATSHPLTRAVLTTLVQEEALHGRLGFLYLDWIAPDLDAAEKDRLGRVAREALDAQAPLWEKLRSTTKDGVTSEGFLLEHVTELGWMESRDYVTVSQETAETQVRAPLSRLGIRVP
>CP034669.1|QAT84596.1|3638268_3639636_+|protease-B
MRRLSMALLIGVSIAGCGGDPEVENREIISNLIEAGFPANDIQVFDGNVYVGRDAHVTLEASRELLQPLEEGSAEQYRTTNQVGTGVTKICVNPTAAFNSYSNLSQGLDLAIANYNEQGLRLTFARGPTTGCTANISAETTTGTGGQAGFPSNGMPYGVFYIGTGLNSYSADVNEHVITHELGHAIGFRHSDYYNRSISCGAGGDEGDAGVGAIHIPNTPTTATVGGSVMNSCFRSTETGEWTGSDITALAALYSTGGGVQSCSNYNILSYRGQNGAQIRCGCDAVGGGAVWGTDLYTDDSNVCVAAVHAGAIGTAGGTVVVTIQPGQSSYAGTTRNGVTTYSYGAWAGSFSVSGTTPPLNTCSSYSFTSYRGQNGTSIRCSCGPVSGGTVWGTDLYTDDSNACAAAVHAGVIPASGGNVSVTIQPGQSSYTGTTRNGITTLSYGAWGGSFSLSP
>CP034669.1|QAT84595.1|3637441_3638059_-|glutathione-S-transferase
MIKLHQFHPSGNCYKVRLLLHQLAIPFETREVDLSAGETRTPEFKAMNPIARTPTVELEPGVFLAESNAILWYFAEGTPFIPTDRLERARMLQWMFFEQYSHEPYIAVARAWLTFFGIPSGKEKELEERIQKGYAALDIMESELRKRPFFAGEHYSLADIALYAYTHVAEEGRFDLGRHPAIRAWFERVQAQPRHLRITDVLKAP
>CP034669.1|QAT84594.1|3636456_3637269_-|hypothetical-protein
MKQNLKQWLSVLCMGMTGLSATAWADVGTPVDCGTVECEAIREMRSLFAAESGYFAEQDVFTLSLASVGFAPAACPNGSRAPVPGAGWVSGCNFSYKVTGITPHPSPGFTAVAQGVAGTPSAGIALQIGTHPVSGRLFWLERQGVRRYVDSAECLPPQAFTCEAQLREARSNLNYIHVVEQSYFAERDQYSTNLPLIGFVPEGCSNGTRASVPDASWVAGCRFIYKVTLNGTTGFTAMAKAVTGATAGSILTLTESGQTVITPSYPASCQ
>CP034669.1|QAT84593.1|3633360_3636342_-|M28E-family-peptidase
MRVSLRLTQTLLLCLAGGSCAPGPSDTTSAPDASASVAQTLASTDARYDAQLAAPACTSHGALCDSNTTLTGRGTVGPESNAPNTLGGSCADGNDGTFPSDASVEALRVSTVDGVSWLAQGRTVKVEADVWGAPSASSALMLFRAVDATAPQWVYLATLPATGGAETLSTTFMLPAGGLQAVRAVLVDAAQAQGAPCTPGAVHDHDDLAFAVSAPDVTQPTVTHLPAAGTTVSGQVTLVAQAVDDQAMGRVDFFIDNTLVGSDSSAPFEASWDSFSVPNGMVYWMVRVYDAVGNARASSVNLYIRNDYAAPTVSLIAPVDGATVGGSRSVVANATDDIRVTHVEFYLDDTVLLGTSVQAQFGIPWNVQTAPPGPHTLTARAYDASGKVTTSAPVHITVDPPPTVAVASPAAGAVLSGSVPLTATVADNAPISRVDFRAELNNTILCNAYSPSYSCSWYTRNLPNGPIRVRAEVLDTAGNLVYSEWRTFTLDNDLTPPTVTLTSPVAGATVRGSLVFSADASDNRGVTSVEFKVDGNTVAVDTTAPYTLTWTSTQLANGSHTVSARAWDAAYNLANSATVNITVDNDAVAPVVSFTSPVEGAVLQGTVTLAASASDDPSGITRVEFYRGATLLGTDSSEPFTHDWATRALVNGAYTLTAKAYDGAGNVGSTSLNVTLNNDFIAPTVSITYPAPNDILLRETSYIVTASASDNVGVARVEFFLDGMPAGTSTTTPYAVSWYIYTTAGLHSVSAKAYDAAGNVTSSASVMVTVQYPPFPNHSPFSYSASNTSDATMGTANQTLAMTAGQTFTVGTCGVAGSAFTGDTYLRLYNPDGTQVAFNDNACGGAGSSFVYTVPAGAGGNYQLRAGCSASTRCTGTVAWTLSAAPGAGPLQYNASFTSSATVNTVNQTLTLTAGQVLTMGTCGVTGSSFSGDTYLRLYGPSGTQVTFNDDACGSVGSNFVYTVPAGGSGTYQLRAGCYSSSSCSGTVAWTLR
>CP034669.1|QAT84603.1|3645086_3645419_-|hypothetical-protein
MAQQFRHPGDALHVSPHGLPSLKLPWDRPTPEIPYYLGWLNYWSAAAAQAIGFPDPARDSELLSRARRTASGGWVVQLTDAPLDLDNPAHLDTLLRAYERFPEIGGRAAP
>CP034669.1|QAT84604.1|3645846_3646761_-|hypothetical-protein
MRLRACAALLLFLAACATPAPSPRARASRNPRIANLQRAAALPWTDGGRCVVREASQSWPVLVERCYRALDHDRIEFHDTTGRCAVASADAAAVGIGFCVLAAPEIAVGAVIVLGVVVVGFAIKEVLDAYELRHAFPEEAGSSRGTKVSSREAEVQRKPKLKPEPAGQDWLPPVPPESPDRERRSECRPVPVRHLGGNDPHNECADRIPNNSFPGWDVLVNGKNFDGLVLINRTLWDIKTDDFEKQPPRSQRFFVRMKLPELRREAKLARDCGYNFVIGVRSAAHKAVLFDEDPTLKVVIMDWC
>CP034669.1|QAT84605.1|3647409_3649155_-|serine/threonine-protein-kinase
MAAPCPHCGSTEGQDHLCAAQSLQLLGQVLDGRYKIESVLGQGGMGMVFRATQTSVQRPVAVKTLNPSLAAAPQFFERFRREAEIASRLRHPNVITIFDFGRAADGTCYYVMELLKGESLKELVKREGPMTLRRAVNLLEQATLGLAHAHDEGCVHRDLKPHNIMVQALDGKDFVKVLDFGLVKALEQDEEEQLTSTGQVLGTPQYMPPEQAGGESVDQRSDLYSMAGVLYFCLTGSSPYGANTVRKALTASLTQPVPPVNSKRQGAPVPPELDAFFTKALAPEKEDRYQNAQEFIDALLDAVEGLSPEELDAHPTGGTPGAERGTGSRSRAGSGSRAGSGSRLGSGSRAGRAPATGKTGSRVGMAPPRGGTSAGAQAAAPRATSNGNSPAPVAASRSRPPASRAVEPELPPPPKGMSGGVKAALIGVPLLLIGAGVAVVMTRGGGETAPQAPVGMTPPKAPVDAPPSRVQEPATPPPAALPQDVTVEFTSSPSGAAIFDGDAQIGTTPTKLLMPRSKVTELRFKLSGHQDQEKTLDYSRLADTAEQRVNVRLEPVRAAPPPRPTKPAKTGGNDPGIGVFE
>CP034669.1|QAT84606.1|3649279_3651241_+|ABC-transporter-ATP-binding-protein
MSLVIAQDISLAYGKKVLFDEDNFTLGPRDRVGLVGANGTGKSSLMKIIAGASQPDGGTVQYSRRARAGYLPQEIAGLPEGTVVEAVMSTVPGRDSLESRLKDTEAALAASTDEEEQLELAQTLADLHAELDDFENRYGRHHAERILKGLGFKDADLSKPTQALSGGWRMRAALAGLLLQDPDLLLLDEPTNHLDVPTLAWFDGFLRRSNKAMVLISHDRDFLNRQINRVVSLEMEGVREYAGNYEDYKRQRAEEMVLLQARAEKVEQRRAELQGFIDRFGAKATKAKQAQSRAKMLAKLEKVQVLEERQTMKFRFPEVERSGRDVVLMEDITKRYGPLTVYDGLNARLERGQRIAVVGANGAGKTTLLKMVAGELAPDSGKVTVGHNVVVGYYAQHHADKLNRDNTIIEEVRPLAADKPESYVRGVLGAFLFSGDDVEKPIGVLSGGERARVALAKLLLIPSNFLLMDEPTNHLDLDSSEMLIEALKLYGGTLLFVSHNRSFINNLCTHVWEVADGKLTSHAGNLDEYLYHQEQLRLMAEGADTGAASGKSAAAGAGPVSEKDRKRLEAEARQRRSVVEGPIKKEIAKLEERIAKVEAEQKEREAQLADPVLYNDFARAKPLMDAHRTGKEELEDLYARWEAAQEKLAAAQA
>CP034669.1|QAT84607.1|3651250_3651457_-|hypothetical-protein
MGDFNSSTAEVGAAFGKVGLERVVGGAKANGDTFDQVWTTAGIDTQNSAQVKTDGVADHKYAGYTEIS
>CP034669.1|QAT84608.1|3651456_3652113_-|hypothetical-protein
MNVNRTGNVNTALDVIARVNPDFGVFASGAVPRFDINDASAPDTAVRTGVDGTTLYQTPSGTLITGESFSGDDRLIQGKEISDAERDSGADATYGNAIYVAAPEQVTEAYTLALPNSAEEGALGAADSWQLAALANGNLTPEERDALMTRTRPCATRTALSPAAGSLPVSRARTARSGRSSTSTSPPPMIRSCARPSSNTSHRSSPPRARARRHARWW
>CP034669.1|QAT84609.1|3652223_3652499_-|hypothetical-protein
MSLLRLATRNLLSRPVTPPPPRIQGSGLPTASKPQAKDLRHADGFTPAPTRRPGEAKKPELTPAPPRARVTATPSAPTRCPRPTRAPASSR
>CP034669.1|QAT84610.1|3652578_3652860_-|general-secretion-pathway-protein-C
MESPHGLGAGSINVTAKRIDANRPGFKLFSIREESFYSRLGLRNGAVIQRINGLDLNGPDKVLEAFTKLRDARRIELQIERGGVPVRKVFDVQ
>CP034669.1|QAT84611.1|3653013_3654951_+|ATP-dependent-OLD-family-endonuclease
MKLVSLRISNFQSFGASPTSISLESLTFIIGPNGSGKTAVLQSLARLFSFESSLRRIRQTDFHVSAEQLAKGELGNPRTLWIEAQFEFPELQDEKSRHLAVPGNFAHMRLVTEGGIPCVRMRLTAKLDEYGDIEESLEYVLEVDAQGEPVKTAPVQKHERNTIQVHYLPARRDPTDHISYASSSLLGRALRAADWKIEREKIGQLTRSISESLAGHAAIAGIGAQLSSHWGRLHKGTYYADPSLSFARNELESLLRHLTVGFTPGPGDLIVDYSRLSDGQQSILYISLVLSMQAIGRKVLEGANSDFDVGKLRPAIFSLVAMEEPENSLSPHYLGRVIKSLGEFSKNRDAQAVITTHSPSLLKRVSPENIRHLRLGDDRATVVRQIVMPDAADEAYKFVREAIQSFPELYFSRLVVLGEGDSEEVVLPRALQADGLFEDDSSVSIVPLGGRHVNHFWRLLSDLQIPYVTILDLDLARHQGGWGRVRYALQQMLKLGVGPGLTLELIESLPKWNGDDQLGSSERAKKALVFLEEHGVYFSSPLDLDFSMIRHFPAAYGVEQEELQVPDAKVISAVLGKSHGDVGQYSAEQQSYFSAYHSRFKLGSKPVAHIAAMARLSSDEIRAGMPREISNLVELIKIKLSGLPE
>CP034669.1|QAT84612.1|3654947_3656609_+|ATP-dependent-DNA-helicase
MIKPSQWKPSEGLVLEPNALAAATEIERSLVLTAGPGAGKTEMLAQRAGFLLRTGTCRYPQRILAISFKVDASKNLKERVRRRCGPELAARLDSYTFHGFAKRLIDRFRPVLTGDNALDADYTVGDPRVHRRQIGFMDMVPLAIDILKQSPMARNAVRQTYGYVFLDEFQDCTGFQYELICAAFKGTSVKITAVGDVKQSIMAWAGALDGVFQKFASDFSAISLNLYQNFRSLPRLRRMQNAMVKVMDPAAAVPDEQISQDAGTIEVLFYEDCEKEADSLATTIRRWINDEEIPPSEIAVLVSRQVEHYAERLMLALDRLGISYRNEVSLQDLSTEPLARLIVDFLLVVVGEHEPDAYRRLMDVLLDADEDEVEAYSSRLRWRRFIDDARLRLRQESPQLVNAGALEGLATGFLRSVGVQVLRSLSADYEQGGRLDEVALQTFQRIGELLRDGQGVVLALSRFSEDGNVRLMTIHKSKGLEFSSVVVLGVEKETFWGNPVEERSTFFVGVSRAKQRLVLSVVGARERPSGMKKRWNVVRTPHKEFLGYVAAAK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP034669_16

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP034669_16

5118352-5118455

Orphan

Consensus_repeat	Method
ACCGCGAACCTGTCCGACTGTCGGACAGGTTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP034669_16

>merge|CP034669|16|5118352-5118455|CRISPRCasFinder
ACCGCGAACCTGTCCGACTGTCGGACAGGTTTTCATCGTTCGCCGGGCCGGCGCGCCCCCGGGCCGCGGGCACCGCGAACCTGTCCGACTGTCGGACAGGTTTT

>CP034669|16|11|5118352-5118455|CRISPRCasFinder
ACCGCGAACCTGTCCGACTGTCGGACAGGTTTT	CATCGTTCGCCGGGCCGGCGCGCCCCCGGGCCGCGGGC
ACCGCGAACCTGTCCGACTGTCGGACAGGTTTT

Protein	Signature genes	Signature genes Name	Protein_function
CP034669.1\|QAT85609.1\|5133021_5133918_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378600
CP034669.1\|QAT85594.1\|5107412_5109656_-\|DnaK-family-protein	unknown	unknown	gnl\|CDD\|234715
CP034669.1\|QAT85592.1\|5041997_5042792_+\|DedA-family-protein	unknown	unknown	gnl\|CDD\|223659
CP034669.1\|QAT85591.1\|5041220_5041691_+\|cyclic-nucleotide-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|237999
CP034669.1\|QAT85608.1\|5132466_5133018_+\|putative-lipoprotein	unknown	unknown	unknown
CP034669.1\|QAT85603.1\|5121040_5123989_-\|malonyl-CoA-acyl-carrier-protein-transacylase	unknown	unknown	gnl\|CDD\|225858
CP034669.1\|QAT85596.1\|5111370_5111955_-\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT85595.1\|5109820_5111278_+\|inosine-5-monophosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|235507
CP034669.1\|QAT85605.1\|5129281_5130556_+\|erythromycin-esterase	unknown	unknown	gnl\|CDD\|225194
CP034669.1\|QAT85610.1\|5133975_5135028_-\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT85597.1\|5112079_5113633_+\|GMP-synthase	unknown	unknown	gnl\|CDD\|234614
CP034669.1\|QAT85593.1\|5042881_5076364_-\|non-ribosomal-peptide-synthetase/polyketide-synthase	unknown	unknown	gnl\|CDD\|237054
CP034669.1\|QAT85607.1\|5131971_5132352_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|370553
CP034669.1\|QAT85598.1\|5113645_5114410_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|368580
CP034669.1\|QAT85606.1\|5130576_5131740_-\|chromate-transporter	unknown	unknown	gnl\|CDD\|273350
CP034669.1\|QAT85604.1\|5123985_5129058_-\|Linear-gramicidin-synthase-subunit-C	unknown	unknown	gnl\|CDD\|237108
CP034669.1\|QAT85602.1\|5120300_5121044_-\|Linear-gramicidin-dehydrogenase-LgrE	unknown	unknown	gnl\|CDD\|225749
CP034669.1\|QAT85599.1\|5114550_5116644_-\|Dipeptidyl-aminopeptidase-BII	unknown	unknown	gnl\|CDD\|371067
CP034669.1\|QAT85601.1\|5118558_5120304_-\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173850
CP034669.1\|QAT85600.1\|5117034_5118279_+\|amidohydrolase	unknown	unknown	gnl\|CDD\|238624

Protein	Function_ID	Function_description	E-value
CP034669.1\|QAT85609.1\|5133021_5133918_-\|hypothetical-protein	gnl\|CDD\|378600	pfam11219, DUF3014, Protein of unknown function (DUF3014). This family of proteins with unknown function appears to be restricted to Proteobacteria.	8.09053e-69
CP034669.1\|QAT85594.1\|5107412_5109656_-\|DnaK-family-protein	gnl\|CDD\|234715	PRK00290, dnaK, molecular chaperone DnaK; Provisional.	0
CP034669.1\|QAT85592.1\|5041997_5042792_+\|DedA-family-protein	gnl\|CDD\|223659	COG0586, DedA, Uncharacterized membrane-associated protein [Function unknown].	7.55928e-42
CP034669.1\|QAT85591.1\|5041220_5041691_+\|cyclic-nucleotide-binding-domain-containing-protein	gnl\|CDD\|237999	cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor. In all cases binding of the effector leads to conformational changes and the ability to activate transcription. Cyclic nucleotide-binding domain similar to CAP are also present in cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) and vertebrate cyclic nucleotide-gated ion-channels. Cyclic nucleotide-monophosphate binding domain; proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues; the best studied is the prokaryotic catabolite gene activator, CAP, where such a domain is known to be composed of three alpha-helices and a distinctive eight-stranded, antiparallel beta-barrel structure; three conserved glycine residues are thought to be essential for maintenance of the structural integrity of the beta-barrel; CooA is a homodimeric transcription factor that belongs to CAP family; cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) contain two tandem copies of the cyclic nucleotide-binding domain; cAPK's are composed of two different subunits, a catalytic chain and a regulatory chain, which contains both copies of the domain; cGPK's are single chain enzymes that include the two copies of the domain in their N-terminal section; also found in vertebrate cyclic nucleotide-gated ion-channels.	2.53527e-24
CP034669.1\|QAT85593.1\|5042881_5076364_-\|non-ribosomal-peptide-synthetase/polyketide-synthase	gnl\|CDD\|237054	PRK12316, PRK12316, peptide synthase; Provisional.	0
CP034669.1\|QAT85603.1\|5121040_5123989_-\|malonyl-CoA-acyl-carrier-protein-transacylase	gnl\|CDD\|225858	COG3321, COG3321, Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism].	0
CP034669.1\|QAT85598.1\|5113645_5114410_-\|hypothetical-protein	gnl\|CDD\|368580	pfam05721, PhyH, Phytanoyl-CoA dioxygenase (PhyH). This family is made up of several eukaryotic phytanoyl-CoA dioxygenase (PhyH) proteins, ectoine hydroxylases and a number of bacterial deoxygenases. PhyH is a peroxisomal enzyme catalyzing the first step of phytanic acid alpha-oxidation. PhyH deficiency causes Refsum's disease (RD) which is an inherited neurological syndrome biochemically characterized by the accumulation of phytanic acid in plasma and tissues.	0.00139032
CP034669.1\|QAT85605.1\|5129281_5130556_+\|erythromycin-esterase	gnl\|CDD\|225194	COG2312, COG2312, Erythromycin esterase homolog [General function prediction only].	5.01743e-33
CP034669.1\|QAT85597.1\|5112079_5113633_+\|GMP-synthase	gnl\|CDD\|234614	PRK00074, guaA, GMP synthase; Reviewed.	0
CP034669.1\|QAT85602.1\|5120300_5121044_-\|Linear-gramicidin-dehydrogenase-LgrE	gnl\|CDD\|225749	COG3208, GrsT, Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism].	1.74229e-61
CP034669.1\|QAT85595.1\|5109820_5111278_+\|inosine-5-monophosphate-dehydrogenase	gnl\|CDD\|235507	PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed.	0
CP034669.1\|QAT85606.1\|5130576_5131740_-\|chromate-transporter	gnl\|CDD\|273350	TIGR00937, Chromate_transport_protein, chromate transporter, chromate ion transporter (CHR) family. Members of this family probably act as chromate transporters, and are found in Pseudomonas aeruginosa, Alcaligenes eutrophus, Vibrio cholerae, Bacillus subtilis, Ochrobactrum tritici, cyanobacteria and archaea. The protein reduces chromate accumulation and is essential for chromate resistance. [Transport and binding proteins, Anions].	5.7669e-84
CP034669.1\|QAT85604.1\|5123985_5129058_-\|Linear-gramicidin-synthase-subunit-C	gnl\|CDD\|237108	PRK12467, PRK12467, peptide synthase; Provisional.	0
CP034669.1\|QAT85607.1\|5131971_5132352_-\|hypothetical-protein	gnl\|CDD\|370553	pfam09543, DUF2379, Protein of unknown function (DUF2379). This family consists of at least 7 paralogs in Myxococcus xanthus and 6 in Stigmatella aurantiaca, both members of the Deltaproteobacteria. The function is unknown.	1.97173e-21
CP034669.1\|QAT85599.1\|5114550_5116644_-\|Dipeptidyl-aminopeptidase-BII	gnl\|CDD\|371067	pfam10459, Peptidase_S46, Peptidase S46. Dipeptidyl-peptidase 7 (DPP-7) is the best characterized member of this family. It is a serine peptidase that is located on the cell surface and is predicted to have two N-terminal transmembrane domains.	0
CP034669.1\|QAT85601.1\|5118558_5120304_-\|acyl-CoA-dehydrogenase	gnl\|CDD\|173850	cd01161, VLCAD, Very long chain acyl-CoA dehydrogenase. VLCAD is an acyl-CoA dehydrogenase (ACAD), which is found in the mitochondria of eukaryotes and in some bacteria. It catalyzes the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. VLCAD acts as a homodimer.	3.22345e-41
CP034669.1\|QAT85600.1\|5117034_5118279_+\|amidohydrolase	gnl\|CDD\|238624	cd01299, Met_dep_hydrolase_A, Metallo-dependent hydrolases, subgroup A is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site. The vast majority of the members have a conserved metal binding site, involving four histidines and one aspartic acid residue. In the common reaction mechanism, the metal ion (or ions) deprotonate a water molecule for a nucleophilic attack on the substrate. The function of this subgroup is unknown.	3.47967e-125

>CP034669.1|QAT85600.1|5117034_5118279_+|amidohydrolase
MLKAARLFDAKAGKIITPGVVVVSEGRMVGVGPKAPVPEGASVVDLGDATLLPGFMDAHTHMTVEPGPDWRKDLIDSFQRTLPEQTLDTLPWARATLMAGFTTVRNLGAEDFIDVGLRNATARGIVVGPRILAATSSLSSTGGHCDYGNSFRKGLLAHDASPGVADGPDALRAKVRENVKYGADVIKVCATGGVMSLNADPDAPQFTQAELDAVVDEAHAHRRKVAAHAHGAEGAKRAIRAGVDSIEHGTLMDDEGVALMKQKGTWYVPTAFAFFGIKELADQGKLPPDTVAKLRAVDRRREHVLRKAISLGVRIAFGTDAGVFAHGRNAEEFALLVQAGLTPTEALRTATVNTAELLGVSDKLGTLEPGKLADVVAVPGNPLQDIRMTQKVFFVMKEGVIHRNDTAATSRTAP
>CP034669.1|QAT85599.1|5114550_5116644_-|Dipeptidyl-aminopeptidase-BII
MKRLVVIAALVGAAPALADEGMWTYNNFPAAKVKEKYGFQPDQQWMDKLRLGAVRLAGGCSASFVSPDGLVMTNHHCARGCIEQLSTAKQDYLANGFYAKTQGEEKQCPAMEVNQLVEITDVTEQLNKATASLTGKQYSDTLKAEMSKVEKACSNGDDKVRCDLVTLYQGGKYNLYKYRRFQDVRLVFAPEHAIAFFGGDPDNFEFPRYDLDVTFVRVYQDKQPVKTPDYFKWSQGGAKENELTFVAGNPGRTSRALTIAELEYTRDVALPKTLMYLSELRGMLTEFQKRGPEQKRISSNLLFGVENGLKASKGRHEALLDKKFFASKVAAEQELRKKVDANPELKKKYAAAWDEIAKAEAQLLLIRKDLNFIEQGLGLSAGLFHTARALVRAGDELPKDNGQRLREFNDANLPALKAQLFSPAPIYPELEIARLTFGLTKMREELGAKHPFVKKVLGKESPEQVATRVVKGTKLKDPKARKALWDGGKKAVDASKDPMVQLALLTDPDARAIRKKFEEDVESIIKKNSELVAKAKFDIYGTSQYPDATFSPRVSFGSVKGYTDEGQQVAPFTQMSGTFEHATGQDPYALPKSWLKSQKVITGTTPMNFITTNDIIGGNSGSPVVNKNQEVVGLVFDGNIQSLGGEYGFDESVNRTVAVHSEAIIEALQKIYGATRVLEELRPGSTKVAPVKANPAG
>CP034669.1|QAT85598.1|5113645_5114410_-|hypothetical-protein
MDARAEQFMRDGYLRIDGAFPREFADEARALLWRDTGCDPDQPSTWTRPVIRLGMYPQKPFVDAANTPVLHAAYDALVGAGRWLPPRAMGTFPVRFPSPVDPGDAGWHVDVSFDFDKPDFMEWRANVASKGRALLMLFLFSDVGEDDAPTRIRVGSHQDIARLLGPAGEAGLTLRQLAANGFAESAHRREVLATGEAGTVYLCHPFLVHSAQPHRGPRPRFMAQPPLLPREPLSLARLPEDTSPVEEAIRRAVT
>CP034669.1|QAT85597.1|5112079_5113633_+|GMP-synthase
MDLHSEKILILDFGSQYTQLIARRVRELGVYCEIHRPDLPAADIRQFAPKGIILSGGPASVEAPGSPRCDPFVFEAGVPVLGICYGLQLLAKLLGGRIDRGAHREFGSAAVEVLAARGPFAEFRPGDQVQVWMSHGDRVDELPPGFEAIGRSGNSPFAAAAHKTNPWYGFQFHPEVVHTPQGKAMLRAFLFNDCKVSGSWTMKGFIDEAVESIRKQVGDEGRVICGLSGGVDSSVAALLLHRAIGPRLQCIFVDNGVLRQGERAQVEALFVDRFHVPLKTVDARERFLSKLAGVTDPEQKRKIIGREFIAVFEEASRDVQDAGFLAQGTLYPDVIESVSWKGPSVTIKSHHNVGGLPETMKLKLVEPLRELFKDEVRALGRELGLPDEMVSRQPFPGPGLAIRVLGEVNEKRLDLVRRADAIVQEEIHKAGLYKEVWQAFAVLLPVQSVGVMGDERTYESTCVLRAVTSVDGMTADWARLPYPLLEKISSRITNEVRGINRVVYDISSKPPATIEWE
>CP034669.1|QAT85596.1|5111370_5111955_-|hypothetical-protein
MLLLSASGCVKEITSDERLERDTRSVAVKDAPGVEQLSKLTCDDTTAPLNKARDVNRPESDRLVDYVNLYSSLKDRTHTFEEAMARNPDLSYREGSQSLVSAKDTCIQQTADVRVEFETYLRELVDVPTVQEIKGGNTVTVARLDFGTLKKAIETLDPDDRESLLQRVNAAEKRVSSLAAPAEDTSTGGKRRGK
>CP034669.1|QAT85595.1|5109820_5111278_+|inosine-5-monophosphate-dehydrogenase
MLNPDIRLALTFDDVLLQPGESAVTPRDADLTTRLTRNIRLNVPLLSAAMDTVTEARTAIAMAQEGGIGVIHKNMTPEQQALEVLKVKKFESGMVVDPITIDPKAPLARALELMKIHGVSGVPVVQGKRLVGILTSRDVRFEKNLSQKVEDVMTTKLVTGREGITQDDATKLLHEYRIEKLLVVDEAYELKGLITIKDIEKRRTHPYAAKDAKGRLLCAAAVGVSADREARIDALVKAGVDVIVVDTAHGHSKGVIEGVRDTRKNFKGFDLIAGNVATAEGTRALIEAGVDAVKVGIGPGSICTTRVVAGVGVPQVTAVDDCSREADKHGIPIISDGGIKYSGDIVKALAAGASSVMIGSLFAGTEESPGDVILYQGRSYKSYRGMGSLGAMKQGAKDRYFQSDVEAVKLVPEGIEGRVPYKGTLAMNVHQMLGGIRSGMGYVGCATIEELRTKATFVRITSAGLKESHVHDVIITEEAPNYRME
>CP034669.1|QAT85594.1|5107412_5109656_-|DnaK-family-protein
MAELNQAGAVGLVVKLPFATPEEFLAKYGGNITRGGIYLRAKAVRSPGTAVTLDLRLASGDRLLYTAAIVHFVTGQQGQGISGMGLKFGEADPPTRRFLETAVAILPHAQSDLPPVPNGVGPADFTVPAPAAAPALPPAVAADPGAPARMDAPASAPAPALEMVTDASLGLNIEEPPRTGPVIGIDLGTTNSCAAFVRGNKPGVLPSREGHNTVPSILAFNQRGKLVVGHPAKGQMLTNPRQTVYGAKRLVGRPYASPIVGQIKGRFHYEIAAGQAGEAAVRLGDRIYSLQQISALILREVREVAQNQLGQPISRAVITVPAYYNDNQRHAVREAGKLAGLYVERILNEPTAAALAYGYGRKLNQRVLVYDLGGGTFDASVLELHDTVYEVISTGGDTFLGGIDFDNAIVEYLLQEFERQTGRAFQGDRVALQRINDAAERAKCALSERSEMRVHVAFITMIDNKPYDLDVTLTRQKLIALTEGLVDRTVQVCEEVLQAKGLKPSDIDEVILVGGQSRFPLVHEKITKFFGRPPSKGVHPDEAVALGAALLAHSLGQLEGVVLIDVLPMAIGVGLPGGRFKPVLERNVSLPAAKSYTLSTHRDGQTELELTVFQGDSDRAQDNEYLGTLRLAGLPKKPRGAVQVSVTFEVNNESLLKVTAKEGTTGREVVSTFTTRDTPESVKARLAQEESSAAAPAAPAVAPGNAAPVARKVAASPPVVPEAAPEVAVVSKQKGFMGWLKGLFGRA
>CP034669.1|QAT85593.1|5042881_5076364_-|non-ribosomal-peptide-synthetase/polyketide-synthase
MHDFSRTLPGVLLKRVQGPSAHAPLYTFLGDADGEETVWSAFDLDVRARRIAMALRERGAQGERVWLLYPPGLDYIAGFFGCLYAGAVAVPAYPPDPMRLERTLPRLRAIIQDARASVVLTTSGILGLSDFVFEQAPDFRALHWLATDELPEGGERDWVAPEGLGAESLAFLQYTSGSTGTPKGVMLTHGNLLHNLSLIHGAFGARADSVGVIWLPPYHDMGLIGGILEPLYGGFPVTLMSPMSFLKRPMAWLEAVSRFGGTISGGPNFAFDLCVRKSTPEQRRALDLSRWEVAFCGAEPIRPETLERFVEAFGPSGFRREAFYPCYGLAEGTLIVSGGEKSKPPVSVTLSGAALERHRAEEVGAAEPGARTLVGCGQTLAEQRIAIVDPETLERRGPGEVGEVWVWGPSVAQGYWGREEATRETFHARIAREEGGPYLRTGDLGFLRPEGELYVTGRRKDLLILRGRNHYPQDLEATVEGAHPALRPGGGAVFSVEVGGEERAVVVQEIDVRRLGGLREQLAAADAAVGTIRQRLAESHEVQAHAVVLIEPGSLPKTSSGKVQRHACRAAFVAGTLQEVTAWRAEGLNSSAPLPSAPAISSVEAGPKAEVDLPANADEAALVAWLRDVVARHVRMRREEIDVDAPVTRYGLDSLGAVELAHEISIGTTTLTVPMEWLLQGPSITSLARQLRSLQTAEASPAASPLRRRDAEGDRAASFAQARLWFLDRYAPGDVTYNLPAAVRLEGELDVAALENSLLVLAARHDALRTSFREQDGRPLQVIASIASLPLARVSLESLPADTREAEASRWAHEEARRPFVLTQGPLVRATLLTLDARTHVLVLVMHHAVSDGTSMAVLVRELSALYTALREGGPSPLRALPVAYADYAEWQREWLDGAALASHLDYWREQLSGAPRLLELATDRPRPAERGTQGARVPVVLDSRLAEAVRTLAVQEGVTPFMVLLAGFQAVLARRSGQDDVSVGTAIAGRDRAELQGLVGFFVNTLVLRTRLSGAPTFRELLGRVRATAMGAYAHQDVPFEKLVEALQPTRERGHTPLFHVMFILQGAQVGAPMLPGLQSRLLDVHSGTAMFDLTLSLSESARGFEGWLEYATGLFDADTVARIAGHLRVLLEAAVADPSRQVDALPWLEADESEHLLALSRGPDIEFPSDTTVSARFAAQVARTPDAVALVAGEGRLTYRELRARARAVAHTLRQRGVGPESVVGLCVDRSVELAVGMLGILEAGAAYLPLDPAYPAQRLAAMWEDSGAKVLVGPRRLEDVLAVPAERRLFLDDVPPSVGADFVRSASDARTLAYVLYTSGSTGRPKGVGVPHRTVMNFFRAMDAHVSPCPGTWLAMTSISFDISVLELLWAWTRGFQVVLAPTGLEPAAFADLLERHAVTHFQCTPSYARALVEEPRALQALGGLRQLLVGGEALPGSLAAKLRAHVPALLNMYGPTETTVWSSMHRVETDTAGTVSLGRPLANTGLHVLDDRLRPVPVGVPGELFIGGEGVVRGYLRRPDLTAERFVPDAFRDAPGTRMYRTGDRVRWLADGTLEFLGRIDHQVKLRGFRIEPGEIEAALRTHPEVREAVVDVREQRLVAYVVPATVDDGVLREHLRSRLPAYMVPSAVVGLDALPLTPNGKVDRHALPAPAAPAAVEDTGPLTPLQEKLAALFQDVLHVERVGAHDDFFALGGHSLLATQLVTRVSARFGVDLPVRAVFDAPTVVRLAERIEALPARFPAAPIPTVSRDDALPLSFAQQRMWFLQRLEPGQALYNIPLALRLSGPLDVEVLRRTFAELVRRHEPLRTTFEEHEGQPLQRIHAPPFDWFLPVETLPEGAVRDVILMRRMRLDATRPFDLRTGPLLRTRLLRLSPDEHVLLLCMHHIVTDGWSMGVLVHEVGSLYPALAAGRPSPLPALEVQAADIAAWQREQEDSETARARLDALKESLKDVPVLTLPAEQGQPGTRSTRGGSHVFTLPASLVRSLEQVGRDRDATLFMVLMAGYQAVLSRYSGQDDFAVGTPVAHRNRPELEPLIGVFLNTLVLRANLDGAPRFTELLDRVRESSLAAYAHQDVPYERLVEAVAQARGGDRASLFQVMFVLQNAPLSTPALPGVRVERLHTSTETARFDLHLSLTASDDGLEGTLEYSRDLFSEDAAARFATHFQVLLEAVARDAATPVHLLPLMGDAEQRLLVDWNATERDYPLEGTLHGLVEAQVARTPEAIAVDFEGARLTYRELDGRANQLARALRAHGVGPEVRVGVCAERSLELVIALLGVLKAGGAYVPVDPSAPAERRTYQVEDSAVAVVLTQQHLRSSLSVGSTPVLCLDADWPQVASLSPEPVESGVGAEHLAYVIYTSGSTGRPKGAMNTHAGIRNRLLWMQDAYGLEPRDVVLQKTPFSFDVSVWEFFWPLMTGARLVVARPGGHQDAAYLVDVMAREGITTVHFVPSMLRVFLEEPGLERCTALRRVVCSGEALPLELKDRCLERLGVPLHNLYGPTEAAVDVTAWTCERHDGRRSVPIGRPVANTRIHILDAALQRVPVGIAGELHIGGVQVGRGYLGRPALTAERFIPDPYGPPGTRLYRTGDRARVLADGTLEYLGRLDFQVKLRGFRIELGEVESALRQCEGVRDTVVVVREDAPDDQRLVAYVVGQGVTAEALREALKAKLPEYVVPSAFAVLDALPLSPNGKVDRKALPVPDVQPVAVVPSKSQRMTPFQQRIADLFRDVLRVPKVGVHDDFFALGGHSLLATRLLSRVRSTFQVELPLRGLFDGATVAEVTEQVEAQLLSRTDLPRVPAIRKVPRDGGQVLSFAQQRLWVMEQLQPGATPYVLLGAVRLDGALDVESLRRALEFLVERHEALRTTFAMKGRDPVQDLHPTPVWALPVTDLGEQPDPESAVQRLAREEAGRPFELGTGPLLRTRLLRLTSTQHVLLLGMHHVVSDGWSLGVMVREVATAYAAFASGTAPVLPELPVQYADFAAWQRGWLQGDVLADEVAWWKEQLAGAPRVLELPTDKPRPTTRSPHGALMPVHVPRDLTDRLAGLARREGTTPFMALLTTWQVLLSRYSRQEDLLVGAPIAGRTHGDVEGLVGFFVNTLVLRARIHPEASFRTLLGQVRDTTLAAYEHQDLPFEKLVEELQVPRDLGRTPLVQAVFALQNAPAEAFDAPGLRMEPLEVDVGTAHFDLSLLLTETPDGLRGSIEYSTDLFERDTAARLASHLRVLLEAAVTGPDVPLSRLPWLTPEERQQVLVAWNDTALPYPADSTLAERFALQASLRPDAIAVEDGDERLTYAQLDARANQLAHVLRARGVGPDVPVALCLERSVGFVVTVLGIVKAGGAYVPLDASYPAQRLSFMLEDARPHLLVTTRELRGRLHLPDASLPCLFLEELALAGQPVTAPRTGVGPRNLAYVIFTSGSGGRPKGVGVEHRGLLRVLHAAPYLHYGMRDTVLLFAPVSFDGSVLELWMPLVHGSRLVVFPGHVPAGDMDALARVVERHGVSFIHMPAGLFSQLMEHRPDLLGRLRELHTGGDIVSAPHVRRAVESLGIPFTNGYGPSECSIVATAFTVERPEQVGTSVSIGAPLANTSVYVLDAKLNPVPVGVPGELFLGGDGVGRGYVSRPDLTAERFVPDAYGTTPGSRLYRTGDMGRWRPDGTLEFLGRIDTQVKVRGFRIELAEVEAALRDLPAVQDAAVVVREDVPGDKRLVAYAMPGPGHVLEASALRAALRQRLPEYMVPSVFVMLDTLPLNPSGKVDRKALPAPDAASTGRQGRFVEPTHPLEQRLAPVFARELGTDRVSAQDHFFEDLGATSLTVVRLAARLREELQREVPVVWLFEHPTLEGFVQRLEREAQGPGTATAPVSQAPGHRPREAPKAGASGSIAIIGMAGRFPGAMTVAEFWRNLRGGVESITRFSPEELEHLSLLPEGLELWHQPAFVPAAGVIDGADRFDHAFFDMSLREAQFTDPQQRLFLQTAWAALEDAGIDPERFPGAISLYSGATGSGYTDAVRQAMPLDAASYMELNGTGTHESLATKASFKLGLTGESVLLYTACSTGLVAVHLASQSLRTGQSDVALAGAMRLSLPQRTGYVHEEGLIFSPDGHCRAFDAKAGGTLSGNGVGAVVLKRLEDAVRDGDAIYAVIRGSALNNDGRNKSGFTAPSVQGQAAVVSQALANAGVAPESVGYVETHGTATPLGDPIEVAALTRAYGLGAEHRGRIALASLKTNVGHLDTVAGLAGLMKAALSLHHGEIPPSLHFEKPNPRIDFDAGPFFVNTTLRPWPRGETPRFAAVSSFGIGGTNAHAVLEEAPPRRSGSTSRSHQLVVLSARSLEALQAAARQLDAHLAEDVDAQALADLAFTHAVGRKAFEYRHALVVKDAADLVWQLRKPVAAVKTEKRAPRVAFVFSGQGAQRVAMGRELSEASPRFRAHLDACLALLETPLRERVSRLLSPEAGLEAEATAALADTRVALPALFSVQVSLARLWQDLGVTPYAVLGHSFGEYAAACVAGVLSLEDAMRLTVARGELMHRMPPGAMLAVALPVARVQPLLSGRLELAAVNTPDRCVVSGPVEEVERLEAALRSQKAGAVRMPAPHAFHSVDVEPLMPELARVVGTLRRSEPAVRYVSSLTGTVAQPGQLADPRYWAEQMRKPVHFTRAVETLQEEGCAVLLEVGPGQDVTPLVRANLMGMESGAPRVRGLPSLRSGGKTPEQMGWLQAVGELWTAGVPVDWSAFYAHEQRLRLHLPTYVFQEKTVWVEQKAQGRVTVKAVEAAALPASIASEAARPAPVAASASFEESTEAPAAPSQPARDDAPRGEVEERVAALWRARLGLEFVGRHDDFLEIGGNSLTAAQLLNQVRDAFGVNLPLAALFEAPTVAGIAERLVPLLRQAPQATVSAELPLVPLTRTGELPLSFVQERVWRLEQHLPGQSAYNIPFVLRLEGDLNADVMERGIQEIVQRHEALRTTYDAVDGRPVQRFHAHMRVPLTRVELRGPLEDREPEALRLAREDAAKPYDLVHGPVLRTTLVRVDTRLHLLLCGIHHIVSDTLSITLFVHELGQLYDAFLQGRPSPLPPLPVQYADFGAWQRNSIAGGHLPEQDQGWRQRLAGMPRKLDLPTDRPRPAESPLTSERMTVEFPPALAHELVAFARREGFTGYMTVLAAWQTLLHRYSGQTDVVVGTPIANRTRPELLPLIGYVAHSAAFRTRFTDGLTFRELLAQVRDEVADAQTRPDVPFEYLVEALIPGHDIGRGRLTDSVFVYHTGVAAGAGTLTLTGLRGSLVEVPGTPVQWGATLADLTLLLSEAPGRVHGVLEYATELFDAATVERLMEHFQVLLGAALARPETPVSQLPLTTEAERSAWPAPRASPGFTSVPALLAERRSRHADATAVSRGDAHWTWAELGARADALAARLKSLGVTAGTPVAVCLRSSPEKLAALWGVLAAGGAGIALGPADLTQLPVYAPEGTRVPVLITTRALVASVRVEASRVVYVEDVDASGAPLRAVEDAHALAWLLPTGSGQPAWALGHRELSEFFTGLDARLSPPDGGAWLSASEASADRPELEALWALTRGLRVVYPPERITARLVSLGGGGPRAKAMDLSLIYFANDEDSLQGPKYELLMEGAKFADANGFSAVWTPERHFHSFGGLYPQPAVISAAVAAVTKHLHVRSGSVVLPLHDPLIIAEQWSVVDNVSQGRVGLSVATGWHTQDFTFAPANFEKRRDILLEKLATLRALWRGERFKRPGGAGTMVEGALRPKPVQKELPVWLTATSNPETFRMAGELGAGVLTGLLSHSLEELKPKVALYREAWRRNGHPGRGHITCMLHTYLGDDDQEVLRIVRKPLLAYFRSSVDILTSLLLTQGYQGDIQKLSPEDIDALLEHTFENHAKTTGLVGTVDGAVRRLRDVRAADVDEVAALIDFGLDTPVVLEGLRRLAVVRERMDAEAAARQEQVLVEAEAGVEGLLELARQSGAVLLHTSARLARSLSELPGARESLSRVGALVLEGASVELGSALHRAAGVEVWLSGDAQEGALLPRTLAERIPANLQAWVLDAAGQPVPAGVVGELALAGAGLPSALWRASDDDRRLVPHPREAQARLYRTGRHARLRADGRVEPVASPSRLPPPPVARPAVVEAPRPAVAPVAARPAAPVVNEGPPPIPRVGRDQPLPVSFAQQRHWYLQQLEPGSGAYNNPSLFRLVGELDVDALQATLDALVARHEVLRTTYALEGDRAVQKIHPPRGLPLPRRDVEGDTPEAREAEMQRFCRAYALLPFDLEQSVLRATLLRLEPQVHVLALVFHHAVSDAWCNMVVAHELTANYAAFHSGQPSPLTELPVQYADYAVWQRAWLEGGVMEAQLGWWKQQLAGAPVLELPTDRPRPARQSFEGARYRFAFPSDVSAPLLALGRRNGATPFMVMMALFQTLLSRYSGQDDFVVGTPIAGRTRPEVEWLLGCFINTLPFRSKLSGQPSFVELLGRVRAQALEAYARQDAPFERVLETLELPRDLSRTPVFQAVLNVINTPEAKGQLPSLALSQVEVPTDTAKFDLSLEVLESRTGIACHLEYATALFDAATVERMAEHLVVLARELIAAPEAPLAKLSLLTPSAREQVLRGWNDTRVDFPASATLHQLFESQAERTPEAIALQFEDQRLTFAQLEARANQLAHHLRAHGVGPETLVGVCMERSLEMGVALLGVLKSGAAYVPLDPATPAERLAGMLEDTAAPVLLVQERFRAALPPHAAHVIALDTQWEAIAREPTVRPPPLAGEDSLAYVIFTSGSTGRPKGAMNAHAGVVNRLRWMQGRYGLTPSDTVLQKTPFSFDVSVWEFFWPLMTGARLVLARPGGHQEPDYLVALMAREGVTTTHFVPSMLRAFVEEPGLHSLPRLRQLMCSGEALPADLVLRAQARLPHTTLHNLYGPTEAAVDVTSWECPRDEALRVIPIGRPVANTSLYILDAHAQPVPVGIPGELFIGGIQVGRGYWRRPTLTAERFIPDAFSDTPGARLYRTGDIARWRTDGTLEYLGRADFQVKLRGFRIEPGDIEAALLSHPDVREAVAVVREDAPGARRLVAYVVSGADLELASLRTLLSRRLPEYMVPALFIPLPALPLTSSGKVDRKALPTPELQRAATRAYVAPRTEMERTLSEVLAQVLRVERVGLDDNFFELGGDSIISLQAVARARQAGIQLFVRDLFQHPTLAALASVARVSGVRLAEQGPVVGEVPLTPIQRQLLERDPTHAHHFNQVLLLQPRQPLKAAWVEEALQALVVHHDALRMRFVREDGGAWRQQDAAPDEVQVSLLQVDLSGLPEDLRPARLEEEAERLQASFDLARPPLLRAALFHSGAGQEQRLLLILHHLVVDAVSWRVLAEDLETTYLRLRAGQSPALPAKTTSFLAWARRLEAHALSDALHAQKSLWLDEARRDVAPLPMDGSGPGTAGSHLTVSVRLDSEETRLLLQETPGAWRARINDVLLTALSLALREWTGQSRLLIDLEGHGREELFADADVSRTVGWFTSLTPALLQLPEAGSTGDCLRAVRDSLSTWPDRGIGYGLLRYMGPAELRQRLEALPSAQVVFNYLGQLDGSTGASTLFALGTGPTGTAVSPKALRAHPLAIDGFVVDGRLRMDFGFSQEWHYTPTIEALAQAFTRSLRELIHRRHSEDARKRTPSDFPLARLSQASLDAVLAAQGPTVEDLFPLSALQEGMLFHALNDPEAGFYFEQTAWSVHSDVDLALFQRTWQTAVDRNPVLRTAFVWKDLEAPLQAVHSHAALPFEAHDWRHLPEPEQQAGLERLMADERARGFDVSRAPLSRMTAVRLGDARWRFVWSHHHLLLDGWSLALFFQEVFALYDALSAGTPLPAAGRPPFRDYIAWLGQRDAAGDERFWRGQLGGLSSPTPLPAVRPPSSNPTGTVNQPHEVLTLPEARTAALEGFARQHRITVNTLTQAAWALVLARHADTRDVLLGTTFAGRPPELTGSETMLGLLISTLPVRVTLPDEDAPVLPWLQSLQARLLDLQQHQHTPLVAAQGWSDIPRGLPLFQSLLVFENYPLDESVLRRSTALDLRDLVVGESTNYPLAATVHPGRELQLHLAYDENRFDAAAVQRVLGQWSQALESLIQPGARLTDVSLLPAEDRAWLLRAGTGDVVDFERDATVHARFERQAAATPDADALVFEETKLSYRQLNARANRLAWHLRSLGVGPEVTVGLCLERSVEAIVALLAVLKAGGAFVPLDPKAPAARKSFVLKDSGASVLVTTQALQEAWHPEVPHLVRLDAKPVGQSDRFAEAGQAPGDTEPVGQSDRFGRAASAAPGEAEPVGQSDRFSENPPPVAGPGNLAYVIYTSGSTGAPKGVMVQHRSVSHLHLAMTRSIYEELPPARRITVNAPLYFDAAIEQVIQLLDGHCLVIVPEDVRLDPEAMLDWLERQRIHLLDGTPSQIKLLLSAGMLERAHGPVRFSIGGEAMDEVTWRQLAAAKHARAYNGYGPTEVTVDATTIAVQGATQPLPVIGRPITNLRAYVLDANLRLAPIGTPGELCLSGEGVTRGYLGQPALTAERFLPDPFSSEPGARMYRTGDKARWREDGTLDFMGRLDFQVKLRGNRIELGEIEATLRAHPGIRDAVAQVHDDRLVAYVAPQVDTSPLREHLLRHLPEYMVPAVFIALDVLPLTPNGKVDRKALPAPEAVPATERVIAPPATPTEAALIPLWSEVLRIPAVGRHDGFFELGGHSLLATQLVSRVRTHFGVELPLRALLEGPTVAALAERIDALRQPASEAREVSGSTLPALVRAERPDVLPLSFAQQRLWFIEQLGTASNVYSLPSMLALEGTLDIIVMLAAFDELVRRHEALRTTFHSIEGTPSQVIHPPFPMPLRHVDLSASPTVEAREAEVSRLALEEVRTPFDLEQGPLFRGLLMKLGPTTHRLLLNTHHIISDGWSTGVLVREMGALYSAFSEERPSPLPELRVQAADHALWQRGWLQGDVLQAQVEWWKSQLSGAPFVLDLPTDRPRTATSTQRGGLVRVTLPRVLSERVDALAQAEGATPFMALLAAFQAVLSRMSGQDDVLVGSPIANRRQAETEGLIGFFVNMLVLRGRFSAKTTFRELLAQVRATTLGAYEHQDIPFEHLVEAFQPERDLGRTPLFQAMFALQNAPVPELAVPGLTVGPAAFDGGSPTQFELALDLSRTRDGYEGHLGYAADLFDTATIERLFAQLRRLLEAVCDAPDLPLADVSLVSPEELVRLVRVGSGELVDFERDATLHGLIERQVARTPDAPAVVFEASTLTYRQLDTRANQLAWRLRSLGVGPEVRVALCLERSVEALVALLAVLKAGGAFVPMDPGAPPARRDFVLKDSGAAVLVTTEAACGDWSPYGVHEVWLDVEQSGLGALSHEPLPAVTGPEHLAYVLYTSGSTGKPKGVMVQHRTILNMHRAFIRAFYAGQPRGQRVSVNAPLYFDAVMDRVVQLIDGHCLHIVPDALRVDPEAMLAWLEEHRIDSFDCTPAQLKPLMAAGMLERDWVPPLVMMGGDALDAEAWRKLAATDRTRVFNGYGPTECTVCTAGVTIQGSLRAEPFIGRPVANLNAYVLDSRQRLVPFGTPGELCFSGESVTRGYLGRPDLTAERFVPDPFSAEPGARLYRTGDKGRWRPDGTLEFMGRLDFQVKLRGYRIEPGEIEATLRTHAGVSDALALVREDVPGDARLVAYVVTDGDTEGLREHLRRHLPEYMVPSAFVTLPALPLTPNGKVDRKALPSPEAQWRAARSYEAPATPAEVALASLWEELLNVPVVGRNDHFFELGGHSLLATQLVSRIRARFGVDVGVRALFESPTVAALAQRLPDAPEANTLPPLRPATSPGPHPLSFAQQRLWFIDQLDPGSALYNMPSALRLSGAVDVPALQQAFDALVERHEALRTTFEAHDGEPRQHVHPAPTGVLSVVDLTGLPDDEREAEAVRLASEDALKPFDLATGPLARLMLLKLGEQEHVLLLCLHHAIGDGWSMGILVREVTALYEAFRQGQASPLTPLPVQYPDFAVWQRGWLQGEVLDAQLAWWTQQLSGAPQALALPTDKPRPPQRSARGATFPVRFSQSLSEAVEALAQAEGATPFMVLLAAFQTLLHRYSGQEDLLVGTSIAGRRHAETEGLIGFFVNTLVLRARFDGRPSFRRLLAQVRTTTLGAYEHQDLPFERLVEAVQPTRDLSRTPLIQALFALQNMPDAEVRLPELTLRPVEVDLPTTKFDLDLTLARTERGFEGDLSYATDLFEPATARRLSEHLVQLLEGATAKPDAALDTLPLMTAEERQWVLEEWSGETARFDADLPFHARFEQQVTRTPKAPAVVMGDTTVSFHQLNVRANQLAHYLRSLGVGPDVPVAFCLERSPEAIVALLGILKAGGAYVPLDPAAPEARRAFILENSGATVLLTTQAQVAVWQPAVRHVVRLDADARRIEASSPANPRVATRPEHLAYVIYTSGSTGTPKGVMIQHRSLAHLHRSLTEACYTQAPKVMRVSLNGPLYFDASVTQLLLMADGHCLCLVPEAVRQDPEAMLAWLEQRRIDALDCTPSLFKLLLEAGFLEQTHVPSICFIGGEAMDEVTWRTLAATHRTRAYNAYGPTEGTVASTTECIQITAQPTPVIGRPMLNVGVYVLDANLNPVSVGVPGELFISGEGLARGYRNRPDLTAERFIPHPFSTERGARLYRTGDRVRWKQDGTLDFMGRVDFQVKLRGYRIEPGEIEAALRTHPGIRDAMVLVREAVPGMQRLVAYVAPEVDTAPLRSRLQRSLPDYMVPAAYVALPVLPLTPNGKVDRAALPAPVDEATSPEARVGPRDEQEAMLERLWAEALGVASVDVRTSFFELGGHSLLAVRLMAAVHRETGRKLPLSALFQAPSVERFAVLLGETEPKPFTPLVPFTKEGTGSAPPFFCVHPVGGNVLAYAEFARRLGPDQPFYGLQARGLDGTDQPLDTVEALAASYVREVRKVQPHGPYHLGGWSLGGVIAYEMAYQLREAGEAVELVAMIDSYVPETVPDSEPDLDRMLAVGLFAQDLMGVSLADLDVDTAELEPEAALTKVLEAAAQAGALPTGVDATALFQVFEANLEAARRYHPPSMDQHVLRIHAEERDETRTPDGGWAALVGEQLESHALPGTHHTLLREPAVQAVAELLAKALRDSGQE
>CP034669.1|QAT85592.1|5041997_5042792_+|DedA-family-protein
MEELLTNLLGSSQGLFAYLSVFAILVACGLGVPLPEDISLILGGFLAHKGAANLPVMMAVGFFGILVGDSLIYLAGRRLGTKLGRDPGAKGGGFFSKIVTPEKRAKVESLFVTHGQKIVMIARFMPGVRAVTYFTAGSVHMSYWRFIFWDGLAALLSAPVFVWLGFHFGGELDMVIRKLKDGQVVVLGSLAVLAVGYFLYRRRKNAKLKVEAAAKEQVTQVALPPVPETLDNSMSPTRAASPGAFFDVPADKAPASEPDLNAHK
>CP034669.1|QAT85591.1|5041220_5041691_+|cyclic-nucleotide-binding-domain-containing-protein
MALAPETTLKACPLFKGFTDTGISIFAAAAVSRAYPKGSALFTEGKAGDSLLIVGEGTVRLSARSPSGEDVPLGEVTAGEPLGELALVQKGERLCSATAQTDVLALEIRSADFQKLLAQKPQACIKLLMGIVSHFGAKARDNRDMLRTLVARAPGS
>CP034669.1|QAT85601.1|5118558_5120304_-|acyl-CoA-dehydrogenase
MSHEPLHPATRGREGFLGQLFAGKLRWDLVRAFPEQDPEERRQGDAVIAEVEQFLQAHVDPDEIERTGRIPPELREALRSRGYYKLQVERELGGRGLSMLNTFRVIEAVMSVCLPVGYTLAIHSGLGAGAIIEAVQDGPLKDYVRGRVADGAISGWADTEPIGASVRRASTTAVPTEDGAAYVLNGEKVFIGNGSIAELLNVTATLQEDGREQISLFFVETSSPGFHVRAEHGLMGLRGLPIAALSFDNVRVPKERMLAMSQEHWRNTPLLEPLSALGRMYIIVAASLALSKKCLQWSREFLHRRLEQGRRLGDFDEIQRQVSATAAEVFAMESVARWSLTGVTADTLPLRWFEQVAAKNIASLTCARITDRTMSLLAAEGYETSESKAARGADPAPLERTLRDARAFRVAGGVDFLVDHKAAREGLFSLYYPSAAHAAELESPPAPLPVEEHLSPRNRDHLQHTAREVHRLAKRSLDLSRRHPDAGALHARQRTLILMNQLCNELFTMSVTLAHAAALASRGQPQADALADVYCAAARYRLEDLWRQADADAEPDFAGVSERWLTGDTLDFLLSDVLIRK
>CP034669.1|QAT85602.1|5120300_5121044_-|Linear-gramicidin-dehydrogenase-LgrE
MTSPAPWLACRIRRPEATVRLYCFPHSGGSVGEYVRWADLLPDIEVWGVQLPGRGARAEEAPFTRLDALVDALVRAVDFGSSFAFFGHSLGAFVAFETARRLRDLGRVLPEALFLSAAPAPQLPPRGIPASHLDEDGLLTALEPTYGELIHELREDEELRELILPGLRADLLLMESHRHEGRAPLPCAMTITGGTQDDLTRAELEPWSIHTSGPFALHLLPGGHFYLRDAEAKSALLSLIAQRNPNP
>CP034669.1|QAT85603.1|5121040_5123989_-|malonyl-CoA-acyl-carrier-protein-transacylase
MSASLDVMEEEDRSAHLAVVGLSCRLPGASNAAEFWSNLAGGVESITFFGPDSQPCAEPPTERAVGEAVPAFGLVTDADRFDAQAFGMSPQEALMLDPQHRVFLECAREALEDAGYDPARYRGAIGIYAGGSETDYLSALRTRRDLLAGASDWQLRLATGVDFLTSRVAYKLGLRGPAVTVQTACSTSLVAIHLAAQALLAGDCDIALAGGASVHVPPRFGHYSEGGPLSPDGRCRAFDARAQGTVGSNGAGIVVLKRLADALEDGDTIRAVLRGTAVNNDAAGKIGFTAPSVEGQSRVIETALHAAGVDPASIRYLEAHGTGTRLGDPIEVAALTKAFGAREPRSCWLGSVKTNIGHTDAAAGVAGFIKTVLALEHRKLPPSLNFERPNPEIDFEHGPFRVNTELRDWDTGGQPRRAGVSSLGIGGTNAHAVLEEAPTLPASKRSRTPQLMVLSAHGPASLARAVERLGGHLRAHPEVDLGDVAWTLQMGRAAHKHRAFAVGQDTDEVLEQESFAPHEASERQVVFMFPGHGGQHVGMGRELYGSQPAFREAVDACRAHLTPLLGFDLGTVLHPDPTDAAALELASTRMGEFVTGQLSVFVIEYAVARLWKRWGVQPAAVVGHSLGAYAAATVAGVFRLEDALRLVLERSRILASLPAGAMLAVPLPESELAPLLHGGLALAAVNGPAQCAVSGPAVEIEALQARLMERGVESKLLRIPGAGHSPLVEPSLAAFTACVQRVERRPPRLPWISDRTGVAVTAEEAVDPAYWAAHLRHTVRFGDALDTLFAGPPGVFLEVGPGRTLATLARQNPGAGSHLAVATLPHPSDTTSDAFSALTAAGRLWSAGVAISWQGLHGGDSRRRVPLPTSPFERQRYLVEAPATSTTVAAVSPPPEPEPRDVPEPPEDEVVRRVAAAFAEVLGLARVGLHDNFFALGGDSLMAAQVIARLRPHVATPLKVKALFRAPTVARLTRFIAESSPA
>CP034669.1|QAT85604.1|5123985_5129058_-|Linear-gramicidin-synthase-subunit-C
MLPPVHQLVERRATELSSQIAVASRTRSLTHAALNAHANRLAHALIARGAGPDVLIGVCLPRSVELVASVLGVLKAGAAWLPLDPSAPPERLRYMAVSSGARFVIGAGPAVERLAADGIQVLAPEALTLQAFPDVNPGVTVQPDHLAYVIHTSGSTGLPKGVMISHRALSAFTGYHLGTFGLSPADRIGVVASSGFDAFVMTLLPSLAAGARLELPPDEETRLSPQRLQDWLLARDITCVFLPTPLAERVLPLSWPESCALRLILTGGDRLHLHPRPGLPFQLVNGYGPAECTIYSTSGVVPPGDASTGERLPSIGRPIGGVEVHVLGPALRPVADGETGELFIGGPSLARGYVGTPDLTADRFIPDPFSRFGGERLYRTGDLGRRLPDGSLEFHGRSDRQVKVRGIRIEPAEITAALLTHPHVGAAHVLALGTEGHDVFFVAWFAPKDARAVPGTEQLREHLRAWLPEAMFPRTFVVVDALPLGPTGKVDVQALPTPEAHATRSSAYVAPRTELERGLVQVWQEALRLERIGIEDDFFELGGHSLLATRITARVAEVLGLPLSLTELFEHRRISQLANVLEPRRAAPAKDVLPSVVRVTDPERAPLSVQQEQVWFLQKLSPGSISYQAQTTLRVLGGLDLAVLERALTEITRRHELLRTTYEEIDGRPWQRVLPVTPVQVPLIDLSGLPADEREHRREEALRQELRRPLSLFEPPLVRWTVVRLAPDDHELVLVEHHVVHDGVSFSVLMRELDALYNAYLRGEPSPLPELPVQYRDFAAWQREALDGPAMKAQLDFWRTRLAGAPEVLPLRTDHPRPRVQTFNGDLLRLELPPALPGALRAFCQQEGVTLFNALFAAFATLLHRYTGEQDLCIGSAFAARAGVRNIENVIGMFVNAVVLRCDVSGAPTFRELVRQVRDLTVAAAEHQTYPFLKLIEALGVKRDPSRNPLVQAMFSFHDSAVRSPRLGEASCTIFERGNGSSKVDLDVVAIPHAGRHLGDRERGDARISLIWEYNRDLFDRSTMERMAAHFLRLIEAAVASPGTPVSRLPMLSDAERRVLVANGSTKPVVSADPPVHQQVLEQALRTPDAVAVRDDSGTLTYAELVRRATLLAEHLHARGAGAESVVGVCAPRGAELVTAELGVMLSGAAFLPLDPEHPAERLALILGDAGVRQVVTTGPLAERLPATVERVCIESFHAPGMPQGGLPTEVRPGQRAYVMYTSGSTGVPKGVVVEHGALAHLVGWHRRAFGLGPSSRTTLLYSPAFDPSVAELWPALTAGATLHVPGQDVRLSPERLQAWLLSERITFTDLPTALAERLLALPWPASCELRTVLAGGDRLHARPVPGLPWRLFNQYGPTETTVTATSGEVLPAGPIETLPAIGQPIDGTSAQVLDAELQPVPPGIAGELYLGGAGVARGYLNRPDLTAASFVPDPYAAHPGARMYRTGDRVVCRPDGMLEFLGRMDAQLKIRGFRVEPAEVAVRLRTHPGLAEAHVRAWSPPGGAPQLVGYLVPLAGQPLPTPSRLREHLARELPAYMIPSAYVELKALPLTHGGKVDERALPDPTPGTQAPRVPLANEHERRIAGIWCETLHLEHVGAEDNFFDLGGHSLLLAQVQYLLKHRMGHDVPMVTLFEFPTVRALAAHLQGRNDGGEAEAAQAQRQEQRRSGRARLLGRQGRLSADRSREEVE
>CP034669.1|QAT85605.1|5129281_5130556_+|erythromycin-esterase
MPLSSSCPLPLMKGTRMRCLLLLLPLLASCASPSRGATAPETVAVSDADRLVRDLCDKRIALLGEDGHHGSGRAHAFKAELTRRLVEECQYDAFFIETGTYDFLHIQSGVEEGQPVSDGVLAAAIGGFWANEETAPLIPFLSERINAGTLVAGGIDDQLNRGTYATGQMTRDLMSLLEGPRQAECTEKAERHVLWKYDDASQLTVENVKFILGCWTELESVLSRPGAAATARAQRQLQMVRNLERNFIRQVSQMSRTPEQGRGGRDSRDFNTRDHSMFMNLEWLLAQSPKPRKAIVWLATIHAAKDLKGLGTDYRNTVSFGSHVHEKFGSQSFALGFSALSGRYALGPTDRTHTLEPARADSLEAWAFSNHTADTRYLDGSQLRDLGARVARPLDYSWMTTPWATVLDGLLIFREEALPHRVPW
>CP034669.1|QAT85606.1|5130576_5131740_-|chromate-transporter
MDSPHSDDVTRGSLGEVARVFLRLGLTAFGGPAAHIAMMEDELVRRRRWLPREEFLDLLGATNLIPGPNSTELAIHLGHRRAGWPGLLVAGTCFIVPAMLLTLAAAWAYVRFGTLPQAGALLYGVKPVILAVVLQALWGLGKTALTTRPRIAVAVGSAVASALGANELLILALAGGSLAAWSHFRSSPASGSTFALTPFALHGLTAMTATAAAPFSLGGLFLFFLKVGSVLFGSGYVLLAFLRADLVERWGWLTEAQLLDAVAVGQFTPGPVFTTATFIGYLVGGVPGAGLATLGIFLPAFVFVALSGPLIPRLRRSRTAGAVLDGVNAASLALMAVVTWQLGRAALVDGWTVALAVLGAVLLLRWRVNSAWLVLGGAAAGMLLAGV
>CP034669.1|QAT85607.1|5131971_5132352_-|hypothetical-protein
MTSDDWRKVIDLGLALANGADLPQDPEMPELLRRMAPEVGLSRADANAALASAADTASLVREIHRRTREGTYRLGRAFGASDSLKMSGDRAGARKVLEDAMAAEVVPLYRAQLQAYLDHVDEPDDT
>CP034669.1|QAT85608.1|5132466_5133018_+|putative-lipoprotein
MRLFRRTGLAALCGLTAALLTGCPDKTAQAPVDGGVTGPTAAPDSGPEAVVFTLQYLSPDGGSALIPLALEEKPLVEPTSDLELRSTLGLKNYRVRLMDEADRAMVSDDSVSEADDGLVYRIHLPQPLKTGYAYTLVVDSQTGSSFQDSRGRDVEDLRASFQIIGDKEKPKPPPAKGGKKRSR
>CP034669.1|QAT85609.1|5133021_5133918_-|hypothetical-protein
MSGTMSDPNFVNQGPGAVPPPPPETEPPKAPSRGKVLGILVALMVVGVVGSYFGLRRQSEAPPVVTAPPVVDAGVAEVPAEVSLPESDGRIRDLVGKLSVDPELAKWLQERDLARRFTASVSNIAEGESPRASLLFMAPVGAFQVGAAGANGRSEIAPLSYARYDLVARALGSLDASGAATVYRELKPLIDQAYREIAPPDQGFETAFGRAIQHLLAVPVPEGPVEVEPKGALYVYASPELEGLSKAQKHLLRMGPGNMRLIQAKLRELRTALNLPTPAPATPEPLPDQAPGQSEAQE
>CP034669.1|QAT85610.1|5133975_5135028_-|hypothetical-protein
MPWVGRPRPGTPWGIPSRRVALTRITTLPVTDAEWAGDGFVLPPSGGSVGLALGVRRLAVLGAREEWPPGRVLELPRAAGLVALHPSLGCVAVLGPGRIEMVGRALDGSPVETPARAWTRHTQALGFDVTGESLWTSGVQDGRASVRVLDARTLSDVAGTEAGLELGTPVLGEDDLDGLHEWMPHPSLPVMGASVSLGQEGTWLTFVERGAAGLVRGAAVASVEAPFYPAGFLPDGSGFIGVGGTWVRRWTYPEATLAAEFLLPEQGTLATGYSGLVTERAVLVAVEDLLEVGEWYLLQLDPGSLRPVCAWELPLSTEAVTSVHLLPGGFILSPEDGQLWRLPDEVLAAR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP034669_20

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP034669_20

6184062-6184173

Orphan

Consensus_repeat	Method
CCCGCGAGGTCGGACCGCGGAAACTTGTCCGACTGTCCGACA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP034669_20

>merge|CP034669|20|6184062-6184173|CRISPRCasFinder
CCCGCGAGGTCGGACCGCGGAAACTTGTCCGACTGTCCGACAGGTTTTGGAGTTCCTGGACCGGCGGGGTCCCGCGAGGTCGGACCGCGGAAACCTGTCCGACTGTCCGACA

>CP034669|20|14|6184062-6184173|CRISPRCasFinder
CCCGCGAGGTCGGACCGCGGAAACTTGTCCGACTGTCCGACA	GGTTTTGGAGTTCCTGGACCGGCGGGGT
CCCGCGAGGTCGGACCGCGGAAACCTGTCCGACTGTCCGACA

Protein	Signature genes	Signature genes Name	Protein_function
CP034669.1\|QAT86452.1\|6185537_6186650_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|367632
CP034669.1\|QAT86458.1\|6193778_6195863_-\|serine/threonine-protein-kinase	unknown	unknown	gnl\|CDD\|270916
CP034669.1\|QAT86449.1\|6180322_6182683_+\|phosphoketolase-2-like-protein	unknown	unknown	gnl\|CDD\|235379
CP034669.1\|QAT86442.1\|6172614_6172737_+\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT86457.1\|6193094_6193619_-\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT86459.1\|6195871_6198592_-\|serine/threonine-protein-kinase	unknown	unknown	gnl\|CDD\|270916
CP034669.1\|QAT86455.1\|6190893_6192438_-\|bifunctional-phosphoribosylaminoimidazolecarboxamide-formyltransferase/IMP-cyclohydrolase	unknown	unknown	gnl\|CDD\|234854
CP034669.1\|QAT86444.1\|6174055_6174964_+\|transcriptional-regulator2C-LysR-family	unknown	unknown	gnl\|CDD\|176169
CP034669.1\|QAT86448.1\|6178538_6180008_+\|EmrB/QacA-family-drug-resistance-transporter	unknown	unknown	gnl\|CDD\|129794
CP034669.1\|QAT86450.1\|6182679_6183855_+\|acetate-kinase	unknown	unknown	gnl\|CDD\|234680
CP034669.1\|QAT86456.1\|6192545_6193037_-\|DNA-binding-protein-AsgB	unknown	unknown	gnl\|CDD\|223642
CP034669.1\|QAT86454.1\|6187907_6190889_-\|putative-adventurous-gliding-motility-protein	unknown	unknown	gnl\|CDD\|274350
CP034669.1\|QAT86446.1\|6176200_6177067_-\|acetyltransferase	unknown	unknown	gnl\|CDD\|379240
CP034669.1\|QAT86451.1\|6184422_6185541_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|367632
CP034669.1\|QAT86447.1\|6177093_6178359_-\|O-antigen-polymerase-family-protein	unknown	unknown	gnl\|CDD\|377422
CP034669.1\|QAT86443.1\|6172748_6173861_-\|inner-membrane-transport-protein-ydhP	unknown	unknown	gnl\|CDD\|225371
CP034669.1\|QAT86441.1\|6171267_6172566_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376573
CP034669.1\|QAT86445.1\|6175168_6176161_+\|putative-lipoprotein	unknown	unknown	gnl\|CDD\|368175
CP034669.1\|QAT86460.1\|6198694_6199030_-\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT86453.1\|6186646_6187906_-\|phosphoribosylamine--glycine-ligase	unknown	unknown	gnl\|CDD\|234856

Protein	Function_ID	Function_description	E-value
CP034669.1\|QAT86452.1\|6185537_6186650_-\|hypothetical-protein	gnl\|CDD\|367632	pfam03739, YjgP_YjgQ, Predicted permease YjgP/YjgQ family. Members of this family are predicted integral membrane proteins of unknown function. They are about 350 amino acids long and contain about 6 transmembrane regions. They are predicted to be permeases although there is no verification of this.	2.14119e-79
CP034669.1\|QAT86458.1\|6193778_6195863_-\|serine/threonine-protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	1.75809e-92
CP034669.1\|QAT86449.1\|6180322_6182683_+\|phosphoketolase-2-like-protein	gnl\|CDD\|235379	PRK05261, PRK05261, phosphoketolase.	0
CP034669.1\|QAT86455.1\|6190893_6192438_-\|bifunctional-phosphoribosylaminoimidazolecarboxamide-formyltransferase/IMP-cyclohydrolase	gnl\|CDD\|234854	PRK00881, purH, bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase; Provisional.	0
CP034669.1\|QAT86459.1\|6195871_6198592_-\|serine/threonine-protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	9.02964e-99
CP034669.1\|QAT86444.1\|6174055_6174964_+\|transcriptional-regulator2C-LysR-family	gnl\|CDD\|176169	cd08480, PBP2_CrgA_like_10, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 10. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.43508e-90
CP034669.1\|QAT86448.1\|6178538_6180008_+\|EmrB/QacA-family-drug-resistance-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	8.38403e-65
CP034669.1\|QAT86450.1\|6182679_6183855_+\|acetate-kinase	gnl\|CDD\|234680	PRK00180, PRK00180, acetate kinase A/propionate kinase 2; Reviewed.	2.38112e-152
CP034669.1\|QAT86456.1\|6192545_6193037_-\|DNA-binding-protein-AsgB	gnl\|CDD\|223642	COG0568, RpoD, DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) [Transcription].	3.4505e-07
CP034669.1\|QAT86454.1\|6187907_6190889_-\|putative-adventurous-gliding-motility-protein	gnl\|CDD\|274350	TIGR02917, TPR_domain_protein, putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.	4.7528e-21
CP034669.1\|QAT86446.1\|6176200_6177067_-\|acetyltransferase	gnl\|CDD\|379240	pfam13527, Acetyltransf_9, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	7.40724e-07
CP034669.1\|QAT86451.1\|6184422_6185541_-\|hypothetical-protein	gnl\|CDD\|367632	pfam03739, YjgP_YjgQ, Predicted permease YjgP/YjgQ family. Members of this family are predicted integral membrane proteins of unknown function. They are about 350 amino acids long and contain about 6 transmembrane regions. They are predicted to be permeases although there is no verification of this.	1.27606e-60
CP034669.1\|QAT86447.1\|6177093_6178359_-\|O-antigen-polymerase-family-protein	gnl\|CDD\|377422	pfam04932, Wzy_C, O-Antigen ligase. This group of bacterial proteins is involved in the synthesis of O-antigen, a lipopolysaccharide found in the outer membrane in gram-negative bacteria. This family includes O-antigen ligases such as E. coli RfaL.	3.94064e-11
CP034669.1\|QAT86443.1\|6172748_6173861_-\|inner-membrane-transport-protein-ydhP	gnl\|CDD\|225371	COG2814, AraJ, Arabinose efflux permease [Carbohydrate transport and metabolism].	2.03941e-82
CP034669.1\|QAT86441.1\|6171267_6172566_+\|hypothetical-protein	gnl\|CDD\|376573	pfam01609, DDE_Tnp_1, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. This family contains transposases for IS4, IS421, IS5377, IS427, IS402, IS1355, IS5, which was original isolated in bacteriophage lambda.	3.35529e-12
CP034669.1\|QAT86445.1\|6175168_6176161_+\|putative-lipoprotein	gnl\|CDD\|368175	pfam04885, Stig1, Stigma-specific protein, Stig1. This family represents the Stig1 cysteine rich plant protein. The STIG1 gene is developmentally regulated and expressed specifically in the stigmatic secretory zone.	0.00213547
CP034669.1\|QAT86453.1\|6186646_6187906_-\|phosphoribosylamine--glycine-ligase	gnl\|CDD\|234856	PRK00885, PRK00885, phosphoribosylamine--glycine ligase; Provisional.	0

>CP034669.1|QAT86450.1|6182679_6183855_+|acetate-kinase
MSGPGAVLAINSGSSSLKFGLYVEQGGQEVVRFKGSATRIGAEQGRLVVKDGAGKQVRAVDVRHPSQEDAFREAVRHLEELGGERPRAIGHRVVHGGPRLREHQALTPEVMKALEEATHFAPLHIPPALRLIRATERQYPGVPQFICFDTAFHATLPEAASTFPLPRSVRDQGVQRYGFHGLSYESIVARLEPQVPARTVVAHLGNGASLAALERGRSVDTSMGFTPTGGIPSGTRTGDLDPGVLLFLMRTGGMDTDAMERLVNHDAGLRGLSEGTSDMQALTRDAAAGNAAAALAVDVFTRSIAKTVGAYAAVLGGLDLLVFTGGIGENSARVREGVCARLGHLGIQLDAQRNEAGAAVITADASSCRVRVLPSDEEVQLARHTRRLLRG
>CP034669.1|QAT86449.1|6180322_6182683_+|phosphoketolase-2-like-protein
MAGPLSDEELGKIDAYWRAANYLSVGQIYLKDNPLLERPLTREDIKPRLLGHFGTTPGLNFIYVHLNRIIRNHRANMMYLIGPGHGAPGIIANTFLEGSYTELYPNIERNRDGMKRLFRQFSWPYGVPSHDAPEVPGSISEGGELGYALLHAYGAVLDNPDLIVPCVVGDGEAETGALAASWHSNKFINPITDGAVLPILHLNGYKIANPTVLARIDADELEALFKGYGYTPYILEGDDPKDMHQRMAQVLDTLYAEITRIQRHAREKNDPTRPRWPMLVLRTPKGWTGPKVVDGKPVEGTWRAHQVPLEEVRDNPEHLKILEAWLHSYRPRELFDANGTFREELADIAPKGRLRMGVNVHSNGGQLLVPLVLPGFRDYAVDPGVPGSRQVSATRVLGGYLRDVMRHNLAAKNFRMFAPDENASNRLQDVYAVSGKSWDAKLESTDENLSVDGRVMEVLSEHLCQGWLEGYLLTGRHGFFSCYEAFIHIIDSMFNQHAKWIKSAREIPWRKPIASLNYLLSSHVWRQDHNGFSHQDPGFIDHVANKKADTVRIYLPPDANTLLSVTDHCLRSKNYVNLIIAGKQLSPVWLDMESAVRHCATGIGAWDWAGNDGGDPDVVMACAGDVPTLETLAAVTLLREWAPELKVRVVNVVDVFTLAPVHVHPHGLNEEDFNRLFTTDKPVVFAFHGYPTLVHKLTYNRANHGNIHVHGFKEEGTTTTPFDMTVLNDMDRFTLALDAIRHSKAARHRLGDAEQRFSEVRQRHKLYVSEHGEDMPEVANWKWTAR
>CP034669.1|QAT86448.1|6178538_6180008_+|EmrB/QacA-family-drug-resistance-transporter
MRTTHRPFTTLALALSLFVAALEMTVVSTAMPTVVSDLGGIQHYAWVFTAYMLSSTITVPIYGKLADLYGRKPIVLFGSTLFLLSSLACGFSTSMNMLIAFRVLQGLGAGAMQPIALTIIGDIYTLEQRGKVQGAFSAVWGIAGLAGPLTGGLIVKYLTWHWIFFINIPIGIASMVLLVTFFHEQLKPKVRARLDYAGAALLSSGVVALLFGVQGSGRTLLALPVAAVLLTAFVFVELRAAEPIIPMSIFKIPTIAISSVAGALFSAAQFGATTYVPLYVQGVLGGSATMAGGMITPMIVGWPLASLIGGRLMVRTGFRPLIVGGLGLASIGTVLMALLLKPGASMLVPQMAMGLFGIGLGFAAMATMVAVQTTVGWELRGVATASSMFFRTIGGSLGVGVMGGVLVSQLMKDPNVPVSAATELLGPEHGRGLAPAVLETLGGALNTGLSINFWIMCAAMIAAFAAGLFFPKVKRVTTPVNMSDVTASH
>CP034669.1|QAT86447.1|6177093_6178359_-|O-antigen-polymerase-family-protein
MSTDTKTVESGRWKTAVAAVLGLYAVGLVLAEAVLQAGAILATALALAVTKRLRLEKDVRAFVLASVALCAWQLVSPAVALMTGAATKWPRGARYGQALDTVAGAAVACIGTLGVPWLMLGSLVAGGWLLAAALGFFQHRVPWPWEPPKFTKLNLSRLHENFGTEENPRYAAGGFFFHRLRFAHGAIAVLGPALAVIGRSKVTRRRVVAGVMVLGLLLSIYGAFARAALGAALGVCVLALLLLLRGTARKAGLGVAVALVAVVLLTPAWRERFGKAVDNLFGSGERSLAMSVGWRLVREHPWVGVGFGNHKPAALATQAETGITDLLATDSHNIWLTTWAETGLVGLVLLATMHFLLARALVRRHRAGSIPATGALLSFVGFHVLALVHYLPFHPSVHLSFMLIWGLGLCEFNTPLRHEPD
>CP034669.1|QAT86446.1|6176200_6177067_-|acetyltransferase
MEPVAVTEIGQFDTGLQDLFCDYVPQVFRRADFRRWRAWGEWDDAYRAFSLLEAGRVVANTSVMRMRLLLEGREVTAYQLGAVGCLPSHRGRGLARVVMNAALDACGDAPVLLFANPTVRQFYPRFGFQSWKQMLFAATYDAVPEGPPAPTLSLEDAEVRAGLAALSSEGLPSTERFGARGYGTVASWPVANGFARPLRQLGPDAWVFAGVEGDTLYLDDVFAREPFDLRAWLPRLIDRPIRTIRFGFTPERYWPGAVEAGEDTEADLFVRGLRLSPEAHRFPIMAHT
>CP034669.1|QAT86445.1|6175168_6176161_+|putative-lipoprotein
MADGSVPEMCTDAGTTQCGDTCVRTDNDPAHCGGCDQACASTEACESGVCVAVCRIDGQQFAAEAGNPANACEQCVPTTSATAWTSFEDGTACGTGQVCSTGACGPKCFINGTLYDEGTPSPTNACEVCTPATSTTAWSPREAIPLLVGGTDIVAQGWTTHTQAPNTLTYGEDHVRLATSTDSGGRTSGQLLLAKTNAVAPTQPFTLRVTMQVESVSRHNQLDSGAAILGSLTGSAGNGTDRSQMIYLDSAAIGWADESQSSAFAVTDGAYHVYELAVDADKVATVSVDGVAKLTRNNFTTNGTIAIGDQTNDPNVDGVVRIKSVEKLCQ
>CP034669.1|QAT86444.1|6174055_6174964_+|transcriptional-regulator2C-LysR-family
MNAKVQPGGADRAHEMAVFSAVVATGSFSAAGRELDLSPSAVSRTLDRIEARLGVRLMLRTTRALTLTPEGHAYLRAARRILAELDDAEQAIADLGAPRGRLRVSAAQSHGRLCVVPLLGDFTARYPHILVDINLTDRVVDIAAGEADVAIRFGPLADSGLTARKLGESPRVIVASPDYLARRGTPRVPEDLHHHHCLNFNFRRAEALWPFVRDGHEYSLSVKGCIEANNGETLGQLAAAGVGVTRVGAFSVEEELRSGRLVPLLEQYNPGDVENIHAVFVGGANLPARVRVFVDYLADALR
>CP034669.1|QAT86443.1|6172748_6173861_-|inner-membrane-transport-protein-ydhP
MGMLPVIAADLGVSIPAAGLLVSAYAFGVLVGAPVMTLTTGRVPRRTLLVGLMGIFTLGNLLSALAPEYWTLMAARVVTSFNHGAFFGVGAIVAASVVAPNRRAGAVAAMFMGLTVANITGVPLAAWAGESLGWRASFWGIAGLGALAMIALRLTLPHGQVERSSDSGAMKAELAVLRRGPVLAALALTVIGSSAMFTVFTYIAPILKEQTRASAGFVTAMLVTYGLGLTIGNWLGGRFADRSVDRTLIVTLAGLATLLVVFAGIMPWQVPAAGVIFLWGVASFALVPPLQMRVMTVASDAPNLASAMNIGAFNLGNATGAALGGAVIGLDLGYPAVALAGAAMAGAGLILVLLLVRREARVSVTLAARC
>CP034669.1|QAT86442.1|6172614_6172737_+|hypothetical-protein
MGITFLEFLRAQLVGEWYPSTEGRKTLWSVAPGIGLELGL
>CP034669.1|QAT86441.1|6171267_6172566_+|hypothetical-protein
MKVAEGLRALVSAEDILEAARRLGALQRQRKVDLVALVESTVAAVTPMPGTQTTAFANYIALTGQKLSPSAFFERFNHAFGQLMREVASRAVQAVREAVGEDKPFNELGALLDEFTDVQVADSTCQLLQRLAADWAPSTSEARPAAFKWHALVSLKDELPVADGVTPQRTQDTRALPDEALSPGTLTLMDLGYTDTGRFLDAIEAGAHFLVRLKAQHDPKVLRVHVGKGERVRARGMRLTDALLQGVLKEEGGVIDVDVQLEKHGRTAQARVVAVEGPEGERRWYLTTVGRDVLTAQQVAEAYRLRWRVELLFKALKSGVGLSALRATRPGAVLSLVYAKVIALALSRLLELSMQQKAGEPGQAQATGRLALVLALTRCAPLLLSHAMMSRGVTLEQMEERILLIAEVTARSRQQRRERERRKREASLGSGG
>CP034669.1|QAT86451.1|6184422_6185541_-|hypothetical-protein
MRGTLFRYVVGAYVRYTLGILAGVVAVFLVVDFVDRAKAYGGEGWVLDVLKLYGYKALVTVQQLGPAALLLAAGTTVSALRKKGEVTALRSLTFGPAALYLPVGICALVACVGLVAFDETVAARAGRRVDEITTQRFNRWGDWRMYYTPKQWFRRGDSIFFLRGGNPQEGFENVSIFTLTPEFKLRRRVDAGRMRPVEGTRWELTDVVERTFTEDGRTSVTQQPAAEYELGVGATTFRIRPGRPEQMSLGELGEQIVARAEVGLATKAFQLAWHNRFAYPLAGLPAALLAVGLALRTNRRGHLTAAVVEGLLIAVAMWGLMVVSRTLVLTERLAPAVAAWMPTALLTVVAAALWLRREGLLHLPRRSVTRQA
>CP034669.1|QAT86452.1|6185537_6186650_-|hypothetical-protein
MKLLARYLLKELLVPLCVWVAFMFLLLFVMQFLRGTDVLLGSAVTLVDLGRLIAYLAPHFLVMALPIAFLLAILLGLGRLGEDRELTSLQALGISPLQLLAAPLGVGLALSAFMVLLTSTVEPWGLTGVKDLVGEVIQKNVAGDVKSGVFYEDLSDLTLYAQKVAPKGGGWTNVLLHDDRDPSSPLLVLAHKGSVGTSERGEALRIELKQGEVHRANRSSVDASVVAFEKAEINVGLGGSLSRRNRFRSPKEELTPAELLAAAKDAEERREDSRPFLMALHSRMGNAVAPVAFALLGTPLAIGRRQSGRAWGYLLTLGGYVLYYLLSRAFEQMGQKGQLPVLVAGQLANVLFMVVGAFALYRVTRSGTVR
>CP034669.1|QAT86453.1|6186646_6187906_-|phosphoribosylamine--glycine-ligase
MKVLLLGSGGREHALAWKLAQSPRLSRLLVGPGNPGTARWGTNVPLQADSPEAVVSLARRERVDLVVVGPEAPLVAGVADALAQVDIPCFGPVAAAARIEGSKAFAKEIMAEAGVPTAAFRVFTDAAEAEAYAVAQGRIVVKADGLAAGKGVIVAPDAQAARDAVRAVAQMGQAGQRMVLEELLEGEEVSLMALCDGERYVLLPLSQDHKRVGEGDTGPNTGGMGAYCPAPFLTTAQLAQVGEQVIAPTLAVLKKRGTPLRGVLYAGLMLTASGPKVLEFNARFGDPETQVLMMQVDEDLLPLMEACARGTLEPRPLKQFPGASVGVVLAAEGYPEAPKKGARIEGLDAVASNAPVFLAGVAKQDGALVTAGGRVLTVCARGDSLATARERALESADAVRFEGKHFRRDIGARGLRARP
>CP034669.1|QAT86454.1|6187907_6190889_-|putative-adventurous-gliding-motility-protein
MRIVCQKCAAAYAIDDRLITTKGVRAQCPRCRHLQLVKREASAASVTAPAEGAVPPAAAEPKPPAAAPAPLVAREPRSHPAAAPVAAKPPEPLAAPKSDLFGDFGELPELGPPGSVDPFADLGPPASQVTGGLPPDPFANLGPSVPAPAAKAAPAAKPGPPVPAAPGVAAQAKPAAPAVPEDPLLDFLGPAPGGLEPDGAPTPGRASSPPAGAVSLGRMSARAPAPVLPKPETHTNCRSCGKDLADPFDQALGICEACKQRESAFPREPTVLVAPEVAPPPSDGGALVELPVMSGLDGAGAGDEPRSEGATALAPDSRVSSVKPARTSHLTAAPVRSAQRGGSGGSRAGVFSLLALAVLGAGGAGYYFLVHKPQQEQRVRDAQPAAPAAVPAEVLATVGRWKLQFLELEGTREQHLAAGQKQLALDQRIAYAEAEESFQQALLLDPHSTDAIAGYVQALALGRGPGMDDNSFQEARELIQAATRMAGETPALLVAHANLLLARSRQAGNLEEAARLATEVLSQSNAADAYKAEAHLVLGRSQVATSRALANQEFEAARKLAPNLQRVDFYSALAHEQAGQYGLALKQLRQRMELDPQDWNSAEAAARIYVEVGETARARKLYEDRLKAKAGDVRASLALAVLRYQAEGNAREAVRVLKELTKNASRYGPRDASEIFSHLAAAERTAGNDAAAATAAAAALKAVPAMPEAHLQWFLVALAQKDAALAREHLKGFQGRLEDAALEKVLEGRVHLLEGDVAKAQERFQQAVRLDDRRMDAKLLEGVAAASAKKRDEAFRLFYPVLEARVWDPLRLAPRPALSRFWLRPGDTLVGVENVVKSLGDRPEDVQPLLYEALVRFHQGDRQTAERLLSSVVEVNANSGGAQAYRALIALDTKGPQARNLAVRAVGVERGLPVARLSLGLALAAAGDVAGAMRALQSALDVAPKMLSAQTKLAELLVTSKPQEARAVLEKVVGLDPSYFPAKKLLFKLDERG
>CP034669.1|QAT86455.1|6190893_6192438_-|bifunctional-phosphoribosylaminoimidazolecarboxamide-formyltransferase/IMP-cyclohydrolase
MLALLSVSDKRGLVPFAQGLVRLGYRLLSTGGTLEALKAAGIPATQVSEHTQSPEILGGRVKTLHPRIHGGILGRPDLDSDKAEMAAHHIEPISLVVVNLYPFRQTVASGAGEDDVIENIDIGGPAMVRASAKNFKHVAIVVDPDDYAPVLAEIEGHKAVGLETRRRLMRKAFAHTAAYDASISGWLSGEAQEPFPEELSLAFRKVQGLRYGENPHQRGAFYKEYAAPKEPSVAFAKVLQGKELSYNNILDLDAALGLVLEFPEKPCAVVIKHNTPCGVAVDDVLEKAYRTARAVDEVSAFGGIVAFNREVDEATAKAMAETFLEAVIAPSYSAVALQVLAGKKNLRLLEAGPALASATAAPRAQVDARSVSGGMLLMDRDAVEPPLEWKVVSKRAPTPEEERALRFAWKVCKHVKSNAIVFAAPARLLAQGGGQTNRVDSVRIAMTRGGEALKGSAVASDAFFPFRDGLDEAARAGATAVIQPGGSVRDAEVIAAADEHGMAMVVTGVRHFRH
>CP034669.1|QAT86456.1|6192545_6193037_-|DNA-binding-protein-AsgB
MSEVKQLQEGEGGNEEEQPAERRRSKTMSRKEMARDLRRRRLAGQLDPEEAETLKAVDEQRPRTRADCINGPRPCLFVSCKHNLYLDVNPETGSIKLNFPDKEITELEHTCALDVAEKGGITLEEVGEIMNLTRERIRQVETRGLMKLREATEAEPPVSARKP
>CP034669.1|QAT86457.1|6193094_6193619_-|hypothetical-protein
MESMDLLAPDELERIERENAGGLPANAILEIFRPRGVRLSEATFRKYVQAGLLPRSRRVGRKGKHQGSLGLYPVEAVRRINVIKKMMAEGHTLEDIRRSFVFHRNHIDQLQRDLSEVLDGFQEELGGRPLGGERRRSLEAQLATLRQRAQDLVRDVARLGSAVTAREDETLRPQ
>CP034669.1|QAT86458.1|6193778_6195863_-|serine/threonine-protein-kinase
MDPSVTLEAGTHVGKYVVRRKLAEGGMAEIFLCTARGPEGFEKEVVIKRVRAFLASDPDFVQMFIAEARLASRLNHANVVQIFDFDKHEDTYYLAMEYVRGCSLWELRKRSKEAMTPMPPVLVAHIGAEVARGLHYAHRLRVNGELLNLVHRDVTPHNVLVSYDGAVKLTDFGIAKAGNKLTNPGVLKGKFAYMSPEQARGESVDVRTDVFALGVVLWELLTGGRLFQGDSEIAVLRAVQESAIVPPARLNPDVPPDLDAAIRRALERDLSKRFQTAGELERALAQCVLNHARSVDDTDVGAFVRPLFPIAASNQALPALPERTALQDGALPAAGAPPREPTAVMPSREHASGAKRGASPDEDRHGTTLVLSRDDPAPNGRPPQPTPQMPLQSMGREAPLARRSESREVPAARAEAPSDENSMAWTGSADDDVGAPGDGGSRSSASARRREESSSRKPDTASARRAGSSGKADSVSARRAAPLADAFPGADDRELDTVSATEPGPPVAPGRKRALWAGAAALGLAGLVGVLAVARSNTGARDAGQGSAPAQGTAPATKPPPATTAAPPAEPARPPAAETVDAELEGQRREAALAPAPSTEPAAPATAPTADPATEPPAADSAKAMGTLQVKATPYATVYLGAKLLGDVQGRANYKVPAGTYAVTFQHPTSKKTFTVVVPADGTVLQEFRAPRGR
>CP034669.1|QAT86459.1|6195871_6198592_-|serine/threonine-protein-kinase
MSIETYGSYQLLKRLATGGMAQIYLARRPGSDAPDKLLVLKRILPHLSENDEFVRMFLDEARIAARLAHPNVVQIYDLGAEGDTFFIAMEYIHGVDARRLWKRSETAGRPLPVPLVCRILLEACAGLDYAHKKTDAAGRPLGIVHRDVSPQNILVTFDGGVKVVDFGIAKAADQATVTRSGVLKGKYSYMSPEQAAGQRVDRRSDVFALGVVLHELLTGGRLFKRVSDMLTLSAVAECNVPVPSQVAPRVPAELDAIVLKALAKDPDARYQHAQELQRALEGWLASQPQPCGTPADLAGYMRELYSDRLTEEARSGEVQVTDEEAGVAPPSAPRRSVMRPATALARTENEPTTTLRPNRPSRPSGKVEARREDAEAEGARSEVRGPDTRPEGRNAEARVEARNAEARSVDARPEPRSEVRNAEARSVEARAVDARPEPRSEVRNADPRAEAPRGMTGSRRALESPPSRSTRPVRLEEPSLPTVTQDEDGPTLAMVDTQGKLSGGFQVEEDGPTLAMVDTQGKLSGGFQVEEDGPTLAMVDTQGKLSGGFQVEEDGPTLDQRSMTTLTQEDEDDSTLDMRAVSRADVDEGPTQDLRAVPRSEIPVPRPGGPTPSGEHRGHRLPVPAPHATLEEMTASTAPRSASRAPVPNAWVPPARTGTLTEQSAVERPKRRALLYGAIVLVAILVGVGIVWGLGPGASGVHVESEPEGARVVFEDRVLPERTPLTLPTVKPGRYWVVLIKEGYRELRTQIVIPPSGRLDVGPLKLVPLPSSGRPGAEPPATAPPPPSTTPEPGVGPSGVAGPREPDALTPEVKQAQESPGAQAPAPGVREAARAAERSAPVSFVVTPRAEVSCNGRKLGETPLQPVTLGVGLYDCTFTNPELKRTVSRRVEVRPIDLNVVTVKFE
>CP034669.1|QAT86460.1|6198694_6199030_-|hypothetical-protein
MNTWTPDEPMKSSPRAGAPGLRVIRGEGQRKQEPLADRNAVARVLMEAGADMLLKRISPVRAQEIERKVDRVLDLFDRVDAAPVLMPVLKRHLDELEALMRETREVRAARR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP034669_22

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP034669_22

6368424-6368674

Orphan

Consensus_repeat	Method
CCGGCCGTGGGCGCGGTGACTCCGCCCCAGGCTCCCGC	PILER-CR

3 spacers

The CRISPR arrays of CP034669_22

>merge|CP034669|22|6368424-6368674|PILER-CR
CCGGCCGTGGGCGCGGTGACTCCGCCCCAGGCTCCGGCAGGGCCCGCCACGCCTCGCGCGACCGTGACCGCGATTCCAGCCGTGGGCGCGGTGACTCCGCCCCGGGCTCCGGCAACTCCCGCCGGTGCTCGCCCCACCGTCACCGCGATTCCTACCGTCGGCGCGGTGACTCCGCCCCAGGCTCCCGCCGCTGCGCGTCCCACCACCACGACGCCGGCCGTGGGCGCGGTGACTCCGCCCCAGGCTCCCGC

>CP034669|22|3|6368424-6368674|PILER-CR
CCGGCCGTGGGCGCGGTGACTCCGCCCCAGGCTCCGGC	AGGGCCCGCCACGCCTCGCGCGACCGTGACCGCGATT
CCAGCCGTGGGCGCGGTGACTCCGCCCCGGGCTCCGGC	AACTCCCGCCGGTGCTCGCCCCACCGTCACCGCGATTCCTA
CCGTCGGCGCGGTGACTCCGCCCCAGGCTCCCGCCGCT	GCGCGTCCCACCACCACGACGCCGG
CCGTGGGCGCGGTGACTCCGCCCCAGGCTCCCGC

Protein	Signature genes	Signature genes Name	Protein_function
CP034669.1\|QAT86575.1\|6363801_6364413_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379142
CP034669.1\|QAT86582.1\|6370632_6371709_-\|ATP-dependent-protease-ATP-binding-subunit-ClpX	unknown	unknown	gnl\|CDD\|235422
CP034669.1\|QAT86572.1\|6360957_6361614_-\|molybdenum-cofactor-biosynthesis-protein-B	unknown	unknown	gnl\|CDD\|238451
CP034669.1\|QAT86589.1\|6379117_6379486_+\|putative-NADH-dehydrogenase-I-subunit-A	unknown	unknown	gnl\|CDD\|376344
CP034669.1\|QAT86588.1\|6377310_6378858_-\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|223910
CP034669.1\|QAT86587.1\|6376478_6377309_+\|5'-3'-exoribonuclease	unknown	unknown	gnl\|CDD\|223686
CP034669.1\|QAT86576.1\|6364409_6365135_+\|CAAX-amino-terminal-protease-family-protein	unknown	unknown	gnl\|CDD\|376806
CP034669.1\|QAT86571.1\|6360014_6360944_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378237
CP034669.1\|QAT86574.1\|6362021_6363782_+\|DNA-polymerase-IV	unknown	unknown	gnl\|CDD\|236311
CP034669.1\|QAT86580.1\|6368792_6369848_+\|DnaJ-domain-containing-protein	unknown	unknown	gnl\|CDD\|365959
CP034669.1\|QAT86585.1\|6374586_6375015_-\|OsmC/Ohr-family-protein	unknown	unknown	gnl\|CDD\|376823
CP034669.1\|QAT86581.1\|6369869_6370643_+\|CvpA-family-protein	unknown	unknown	gnl\|CDD\|367140
CP034669.1\|QAT86579.1\|6368032_6368209_-\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT86578.1\|6366191_6367799_+\|heat-shock-protein-70-family-protein	unknown	unknown	gnl\|CDD\|234715
CP034669.1\|QAT86586.1\|6375060_6376284_-\|deoxyhypusine-synthase	unknown	unknown	gnl\|CDD\|179117
CP034669.1\|QAT86573.1\|6361640_6361955_-\|Rieske-family-iron-sulfur-cluster-binding-protein	unknown	unknown	gnl\|CDD\|239604
CP034669.1\|QAT86577.1\|6365143_6365977_-\|class-II-glutamine-amidotransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|238889
CP034669.1\|QAT86584.1\|6373966_6374494_-\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT86583.1\|6371946_6373953_+\|arginine-decarboxylase	unknown	unknown	gnl\|CDD\|235427
CP034669.1\|QAT86570.1\|6357981_6359937_-\|sensor-histidine-kinase/response-regulator	unknown	unknown	gnl\|CDD\|236901

Protein	Function_ID	Function_description	E-value
CP034669.1\|QAT86575.1\|6363801_6364413_+\|hypothetical-protein	gnl\|CDD\|379142	pfam13365, Trypsin_2, Trypsin-like peptidase domain. This family includes trypsin-like peptidase domains.	6.85578e-05
CP034669.1\|QAT86582.1\|6370632_6371709_-\|ATP-dependent-protease-ATP-binding-subunit-ClpX	gnl\|CDD\|235422	PRK05342, clpX, ATP-dependent Clp protease ATP-binding subunit ClpX.	9.75159e-163
CP034669.1\|QAT86572.1\|6360957_6361614_-\|molybdenum-cofactor-biosynthesis-protein-B	gnl\|CDD\|238451	cd00886, MogA_MoaB, MogA_MoaB family. Members of this family are involved in biosynthesis of the molybdenum cofactor (MoCF) an essential cofactor of a diverse group of redox enzymes. MoCF biosynthesis is an evolutionarily conserved pathway present in eubacteria, archaea, and eukaryotes. MoCF contains a tricyclic pyranopterin, termed molybdopterin (MPT). MogA, together with MoeA, is responsible for the metal incorporation into MPT, the third step in MoCF biosynthesis. The plant homolog Cnx1 is a MoeA-MogA fusion protein. The mammalian homolog gephyrin is a MogA-MoeA fusion protein, that plays a critical role in postsynaptic anchoring of inhibitory glycine receptors and major GABAa receptor subtypes. In contrast, MoaB shows high similarity to MogA, but little is known about its physiological role. All well studied members of this family form highly stable trimers.	1.44698e-62
CP034669.1\|QAT86589.1\|6379117_6379486_+\|putative-NADH-dehydrogenase-I-subunit-A	gnl\|CDD\|376344	pfam00507, Oxidored_q4, NADH-ubiquinone/plastoquinone oxidoreductase, chain 3.	5.98877e-43
CP034669.1\|QAT86588.1\|6377310_6378858_-\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|223910	COG0840, Tar, Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms].	6.51364e-48
CP034669.1\|QAT86587.1\|6376478_6377309_+\|5'-3'-exoribonuclease	gnl\|CDD\|223686	COG0613, COG0613, Predicted metal-dependent phosphoesterases (PHP family) [General function prediction only].	3.92764e-46
CP034669.1\|QAT86576.1\|6364409_6365135_+\|CAAX-amino-terminal-protease-family-protein	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	4.065e-12
CP034669.1\|QAT86571.1\|6360014_6360944_-\|hypothetical-protein	gnl\|CDD\|378237	pfam09674, DUF2400, Protein of unknown function (DUF2400). Members of this uncharacterized protein family are found sporadically, so far only among spirochetes, epsilon and delta proteobacteria, and Bacteroides. The function is unknown and its gene neighborhoods show little conservation.	5.49588e-105
CP034669.1\|QAT86574.1\|6362021_6363782_+\|DNA-polymerase-IV	gnl\|CDD\|236311	PRK08609, PRK08609, DNA polymerase/3'-5' exonuclease PolX.	1.94431e-179
CP034669.1\|QAT86580.1\|6368792_6369848_+\|DnaJ-domain-containing-protein	gnl\|CDD\|365959	pfam00226, DnaJ, DnaJ domain. DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature.	1.12981e-15
CP034669.1\|QAT86585.1\|6374586_6375015_-\|OsmC/Ohr-family-protein	gnl\|CDD\|376823	pfam02566, OsmC, OsmC-like protein. Osmotically inducible protein C (OsmC) is a stress -induced protein found in E. Coli. This family also contains a organic hydroperoxide detoxification protein that has a novel pattern of oxidative stress regulation.	4.50656e-19
CP034669.1\|QAT86581.1\|6369869_6370643_+\|CvpA-family-protein	gnl\|CDD\|367140	pfam02674, Colicin_V, Colicin V production protein. Colicin V production protein is required in E. Coli for colicin V production from plasmid pColV-K30. This protein is coded for in the purF operon.	1.21864e-16
CP034669.1\|QAT86578.1\|6366191_6367799_+\|heat-shock-protein-70-family-protein	gnl\|CDD\|234715	PRK00290, dnaK, molecular chaperone DnaK; Provisional.	0
CP034669.1\|QAT86586.1\|6375060_6376284_-\|deoxyhypusine-synthase	gnl\|CDD\|179117	PRK00770, PRK00770, deoxyhypusine synthase.	3.14693e-87
CP034669.1\|QAT86573.1\|6361640_6361955_-\|Rieske-family-iron-sulfur-cluster-binding-protein	gnl\|CDD\|239604	cd03528, Rieske_RO_ferredoxin, Rieske non-heme iron oxygenase (RO) family, Rieske ferredoxin component; composed of the Rieske ferredoxin component of some three-component RO systems including biphenyl dioxygenase (BPDO) and carbazole 1,9a-dioxygenase (CARDO). The RO family comprise a large class of aromatic ring-hydroxylating dioxygenases found predominantly in microorganisms. These enzymes enable microorganisms to tolerate and even exclusively utilize aromatic compounds for growth. ROs consist of two or three components: reductase, oxygenase, and ferredoxin (in some cases) components. The ferredoxin component contains either a plant-type or Rieske-type [2Fe-2S] cluster. The Rieske ferredoxin component in this family carries an electron from the RO reductase component to the terminal RO oxygenase component. BPDO degrades biphenyls and polychlorinated biphenyls. BPDO ferredoxin (BphF) has structural features consistent with a minimal and perhaps archetypical Rieske protein in that the insertions that give other Rieske proteins unique structural features are missing. CARDO catalyzes dihydroxylation at the C1 and C9a positions of carbazole. Rieske ferredoxins are found as subunits of membrane oxidase complexes, cis-dihydrodiol-forming aromatic dioxygenases, bacterial assimilatory nitrite reductases, and arsenite oxidase. Rieske ferredoxins are also found as soluble electron carriers in bacterial dioxygenase and monooxygenase complexes.	2.55343e-14
CP034669.1\|QAT86577.1\|6365143_6365977_-\|class-II-glutamine-amidotransferase-domain-containing-protein	gnl\|CDD\|238889	cd01908, YafJ, Glutamine amidotransferases class-II (Gn-AT)_YafJ-type. YafJ is a glutamine amidotransferase-like protein of unknown function found in prokaryotes, eukaryotes and archaea. YafJ has a conserved structural fold similar to those of other class II glutamine amidotransferases including glucosamine-fructose 6-phosphate synthase (GLMS or GFAT), glutamine phosphoribosylpyrophosphate (Prpp) amidotransferase (GPATase), asparagine synthetase B (AsnB), beta lactam synthetase (beta-LS) and glutamate synthase (GltS). The YafJ fold is also somewhat similar to the Ntn (N-terminal nucleophile) hydrolase fold of the proteasomal alpha and beta subunits.	2.23449e-30
CP034669.1\|QAT86583.1\|6371946_6373953_+\|arginine-decarboxylase	gnl\|CDD\|235427	PRK05354, PRK05354, biosynthetic arginine decarboxylase.	0
CP034669.1\|QAT86570.1\|6357981_6359937_-\|sensor-histidine-kinase/response-regulator	gnl\|CDD\|236901	PRK11360, PRK11360, two-component system sensor histidine kinase AtoS.	9.79915e-50

>CP034669.1|QAT86579.1|6368032_6368209_-|hypothetical-protein
MGARPAGVGRGGAPVVGAPAGGMDGTPLDDAGRAVAGAAGATEGTWPDAGFAGGTAGT
>CP034669.1|QAT86578.1|6366191_6367799_+|heat-shock-protein-70-family-protein
MADDIAIGIDLGTSYSCVSVVHEGQPTVIPNEWGETTHASCVSFLEEGSVLVGNAAKKNIITSPENTVYSAKRLIGRYYFSDEVKKAQAVMPYRIVEGDNNSVRIGVRERSYSLPEISALVLKEMKAVAETYLGREVHKAVITVPAYFNDNQRQATKDAGRIAGLEVLRILNEPTAAALAYGFGRDVNQRVVVYDLGGGTFDVSILEIGKDVFEVLATAGDTYLGGDDFDDRIMTWMADDFLSRTRLDLRQNKYCLQMLKDAAEKAKIDVGQNGTADILCQGICQDANGNVLDLRNTLNQDQFNRMVMDLVQRTFKVCDEALQSARLTAADIDAVILVGGPTRLPIIRNSVKHYFQKEPLEGINPDQVVAMGAALQSHALLDSKTETFLVDVTPLTLRIGTVGGYTEKIIDKNTPVPIDRSKTFTTSRDGQEKVKIRVYQGESNRAEECEMLGEFEFSGFRIGYRGEVKIEVTFEINTDGLVNVSACDVETGQKTSTTITLSSGMTEADIQQSIQSNRNTRLAGHNSSDLPAVAS
>CP034669.1|QAT86577.1|6365143_6365977_-|class-II-glutamine-amidotransferase-domain-containing-protein
MSAILAALSSDPNLLRCELHRLGGQVVLRPDARANALGVGSYAQEEVLLRRLAPDRELTLDDLGPPHESEAVLFHANRLPLGLSPEDNTQPFRARHWLFAHQGPLPDFEPLRAPLLSRVPEHLQRLVRGPTDSEVLFALFLTHLRELGRTDDPRLEPSVAGRVLRDTVREVEAACVKAGQRRMPPLNMVATNGAVLAATRRGEAPLYYTRLEGSAECAHCGVTPATPETHPEVGAHRRRRTVVVASHVTRTQGWVELAQGTTLTVGADLQVQHLPPG
>CP034669.1|QAT86576.1|6364409_6365135_+|CAAX-amino-terminal-protease-family-protein
MSRPSGPPFRLSAVQEAMGLWALGFLGIILAFLLAGGTSVPKLVATVGFLYLPLIPMRWRDEDYRDYGLTLRAWREDLRLFLVMCAIVGPLFFAGFAAFVQVVPHLPPGLARHLTPIIGEGHFQPRLPPRFGEWVIDQLFVVALPEEFFYRGYLQARLRDAWPQGRVVLGARLGRAFWVTALLFALGHLAIFQTWRLAVFFPALLFGWMRERTGTLVGCSLFHAACNLYVRFLEASFFGGP
>CP034669.1|QAT86575.1|6363801_6364413_+|hypothetical-protein
MFRPLLLVPALLWLLLALPSRAGAEARPSRADLQRVLDLHARSSVRVRGPQNAGPGIIVGADGQVLTAVCHVGPDSAQVVHAGNALTARVVLSSTSLQVAVVAGPQGTWPAVPVRLVPEGLAGHWVVGVMPARKKGQRDTPRAAVAKAAPAPFFDVDLTLAPGSPLYDGDGRLVGVVVERRGRGARALPLSAVKAELASADAP
>CP034669.1|QAT86574.1|6362021_6363782_+|DNA-polymerase-IV
MTPDVTPSTAVLTDKAAVAQLLRDMSLLLQLQGQSGFRVRAYDIAADRIANLPQDLGPIVTEGRLQELQGIGPGLAEKLTELVTTGRMTAFEELKAQFPAGLLELMKLPDVGPKKVAALWSELQVGSVEDLERACKDGRVRELKGFGAKSEAKLLDGIAVYRRARGERKLLGDALPIAEGLLELIRQAPGVVRASLGGSVRRRAETVSDVDLIASAKEAGPVLDALANAPGVATVIGKGDSKCSVRMVQGDLQVDLRVLPDEDFATALHHFTGSKAHHIRLRNLGHEKGLKISEWGVHREDGTKVPVPDEAALYRLLGMQEVPPELREDNGEVEAARAGKLPEDLVTLEDVQGAVHAHSTWSDGRDSLEEMARAAQALGLKYLTITEHSEAAIHAGGLKVDDLKRQWEEIDRVNAAVPGMRLLKGIEVDILESGALDYADSVLEQLEVVIASIHVRHSMDEDQMTRRVLAALDNPHLHILGHPTGRLIQSREPYALRMEEVLERARERGVAVEINGKPARLDIKSEYVRQAVGRGVKLVVSCDAHRQDDLKNLAFAVATARRGWARKQDILNTRSAESFLAALRER
>CP034669.1|QAT86573.1|6361640_6361955_-|Rieske-family-iron-sulfur-cluster-binding-protein
MTKIKLGPADFAEREMRGYEIGKRNVCIAKIHGRYKGLDDWCNHAGCLLSGGRLEDNMVVCPCHEVGFDMDSGKNATSPGVCDDQPTVQLTVEDGTLVVDLPDV
>CP034669.1|QAT86572.1|6360957_6361614_-|molybdenum-cofactor-biosynthesis-protein-B
MGHDGHDHDHDHGHGHGHHHHGHSHDHGHGHSHDHGHDHHHSHDHGHSHEGSPVAAEHKSRAPVHVSAYVVTCSDSRDEAHDGSGKDLREGLAAAGHTVAGHTVVKDDPEAIRGALAQAQAAGARAVLFTGGTGIGRRDCTVETLRALFEKELPGFGELFRMLSFQRIGSPAMMSRATAGTYQGMILFALPGSPQAVKLALDALILPELGHAVRELTR
>CP034669.1|QAT86571.1|6360014_6360944_-|hypothetical-protein
MKKRRVAHTGLSTQAADLLRPRLDAFLASTDPKARIGFDPVEFPHRYTDPRDVEVSALLAAALAYGRADLFRPKVDALLKQMGPSPAAFVRALDVKGAKALLTGFVYRFNVGTDLAVLLLGMGRALREHGSLEALFARGFKASGTLHGAISAFTAALRDVPMDALRKALGPERGLHHLLPSPLGPGAAKRLNLYLRWMVRGPDAVDFGIWKQVPASALLVPLDTHIGRMALHLGLTQRTDLTWRTAEEVTASLRALDPEDPVRYDFALCHYGMSGACPAKTLPRHCEGCSLLPSCKVGPRVIARGSLQF
>CP034669.1|QAT86570.1|6357981_6359937_-|sensor-histidine-kinase/response-regulator
MRSGDAGGVILRGARSDAVHAMLVAVPAPVAQDVERDLCATAEGRACRVIRVESPPEPLPEGLLVLWDHGGPLEAVQARCQWAHARRLPTRTWLVVLTKREGEEAEALVAAGADECVEPPGTRWGARLVALRRRSADGDAQALRRARDMFQGALDAVPEPLFIKDREHRLVAVNGAYCRLLDQPAEALRGTVSSAQVPQHEAEASWRQDERAFTTGQTVEDEGSFTDARGRSREVLTQRAAYMLPNGERFLVGLVRDVTERSRLETQRRLAERMTSVGTLAAGVAHEINNPLSYVTSNLAYLWERVAQPVLPVPTEQLEELRQVVAEALEGAGRVRSIVRDLRTFSRTEEEQHGPVDVRRAVENAVKLMRDELQHRACMACDLEPVAAVHGNEGRLAQVVTGLLTNALQAFGDRAPEENLLKLRVRPGREGHVLIEVEDNGHGMPAAVRQRIFDPFFTTRSPKGGTGLGLSICLTLVHAMGGHIEVASEEGQGSLFRVELPALTLPPEAARPAQATPAVAEEPSQPVRATRDLRRLLLIDDEPAVGSAVSRLLRNLYEVHVIQDAREALKRLSHGEKFDAILCDLMMPGMSGMDFLVELERLAPELAPRTGLMTGGVNPQAREFLGRRARELLEKPFERDQLCTFVETLMQ
>CP034669.1|QAT86580.1|6368792_6369848_+|DnaJ-domain-containing-protein
MPPAMPPAVPSIASMPTPPPVARGPSAVPTMQPLSPAIPPVAPAARPPSVPTLAPAGARPPGPPVARPIPTVGPVTPPPVAPRPPTPPAISATPPPVLAVGHVVPPIAPATPAPPRPGNRPTTSLPALAPAGSPRPPTPPPVAPPRPPAASAPPPPAAAGGPALSPEQIMDLESRCAKLDQTDYFELLGLERTAAPGDIKKAFYKESRVYHPDRFFQLESKALKDQVNELYKRVTEAYYVLRDDTKRKKYLSDIAGPDRAQKLRFTDASESETKAAAKKEQEEQIGTHPKGRQFYTQAQKDLESGNPSAAERNLKMALTYEPSNARYKEALAEAQKQTADKSKGDSSFKIR
>CP034669.1|QAT86581.1|6369869_6370643_+|CvpA-family-protein
MVIDLILLGMVLFFGILGALSGAARQVANSVGLAAGYFVSRKLAPVIGPKLAVALGSPLLIGTLFGTVLLFVVTWLTVRYALGALLLRFLSGKDPDERGLDRTLGFVLGGGKMAALFWVCLSAMTFMEQHVIVAGKRLGVAPKDSVAFDLTRRFNLFELTQFAPLEDLVQVAQATHDPAKAKKLQEDPAYKALRKDPRFQLALSHRELKDALERGDTQALLRNDAILQLIQDPQAAARLGAAARASEKPTKPAPATR
>CP034669.1|QAT86582.1|6370632_6371709_-|ATP-dependent-protease-ATP-binding-subunit-ClpX
MESSARREEAAPLTPREIFERLDRYVIGQDAAKRAVAIAAHNHLKRIQARRMRRQSLIKKSNILLIGPTGSGKTHIARNLADILQVPFTTVDATEYTEAGYYGKDVEVMVSDLLFKANHSVEDTQRGIIFIDEVDKIARRTQGARNGAGSRDIGGEGVQQSLLKLLEGREVHVPMNVTQAWNKSDFVQVDTRDILFICAGTFSDLHDYGDDGGRAMGFGAEAAGGKRKEKRISTKQLVDFGMMAEFLGRMPVMVQLERLGEPDLLRVLTEPPDAITREFKELLSLDEIELEFPESGLREVVRYSIARGLGARGLRSILEHVMSDIMFEAPERKHRQVTVDAEFVKARLAALDDVELNA
>CP034669.1|QAT86583.1|6371946_6373953_+|arginine-decarboxylase
MAAPSPQHRWTLADAHELYGIRNWGSPYFGINDKGHVCVHPDGPAAPSMDLKELVDEVRRRGIGLPLLLRFTDVLRHRVVHLNNAFKKAIADQGYKGLYRGVYPIKVNQHRYVVETIIEAGKEHTYGLEAGSKPELLAVMALLDSEDALVICNGYKDEEYIETALFYSRLGRNVILVVEKPSELPLIAEVARRTGITPRLGMRVKLSTRGAGKWEASGGDRSKFGLSSSELMNCISFMKDAGLLASFELLHFHLGSQISNIRNVKNALREVGCFYVEVARQGAPLKYLDVGGGLGVDYDGSQTNFASSMNYTTEEYANDVVFGVMEACDRAGVPHPTLVSESGRAVVAHHAVLVVDVLGTSEFDPSQTPDKVDEKAPSVVRNLYSTFREVTNKNVIEAFHDAQDAKEESLQLFSLGHLSLEQRVAAENLYWAICHKILRVAREAGEIPEELEALEKQLSDTYFCNFSVFQSLPDSWAIDQLFPMMPIHRLAEKPTRRATLADITCDSDGKIEHFIDKREVKDALELHALNSDDYYLGIFLVGAYQEILGDLHNLFGDTHTVQVSLAPGGGYLIDHVVAGDTVTEVLNYVSYNKDDLVAKLRKFTELALRQGRITLDESRNLLRVYEDGLSGYTYLEREVDATFTSASQLRLLPGPENGARAPVTPSGT
>CP034669.1|QAT86584.1|6373966_6374494_-|hypothetical-protein
MNLKRLGIYLNDHLLGSTVGVDLAKRTERENRSNPVGQYLSTLIPLMEQDRATLLAVMSAVDARVDPLKVGGAWLTEKFSRLKLNGSWLRYSPLSRLVELEGLCVGSHGRVSMWRSLAKVAAKEPRLARFDFAFLAERAEGQLETLQMLRLRATEAAFSDTSVETGEQAPVPTEA
>CP034669.1|QAT86585.1|6374586_6375015_-|OsmC/Ohr-family-protein
MSQQPATGVVMSLVSAPQLKTQVTHGPSGATLPTEAPKDNGGTGGSFSPTDLVATALASCVVTTMHLVAGKEGFTLGEVRATVEKRMTPPPRKIGELVLSILMPSGLVPEQRAMLEKIAHECPVARSLHPEVKVTASFGYPD
>CP034669.1|QAT86586.1|6375060_6376284_-|deoxyhypusine-synthase
MAKTQTPKKSTLRAAYANARKADPRPITGKEKPAELLAHAFSAYVGRQERTAFELMQQSVQQDASIFLTLSGAMTPAGLHQSCLIPLVEKGIISAITTTGANLYHDAHRIIGHGIREVNPNAGDLQYRLARIIRIYDLGFWEEALLDTDRLFSAILRQPQFQRKMTTPEFHYLLGKAIHGIEKQLGVKQPSLLSTCYKHGVPIWVGAVQDGSIFLNVVKLKRLLGDEFKFELDINDDVYSMAAMQHYCRHNGSGKLAIWILGGGVPKNYTLQGEPLLDQILNVPTSGFDIDVQFCVDPVDNGALSSCPAGEGHTWGKVSVEAVETGSMYVHCDVTAVFPWLTHALFSEPKNKRKPMRLMDKMDDAVKFLDADVKKRSKSLMKTLDWSVDDAEPSSKKDAKAHDSFVR
>CP034669.1|QAT86587.1|6376478_6377309_+|5'-3'-exoribonuclease
MIDLHSHTTASDGQYPPSELVARAAAAGVTVLAVTDHDTVAGLHEAKAAAAAHGLELVPGIELSAFVYGKEAHILGHFLRPEDPDLARFADRLRDERTHRMEAMVARLRELGFPVRMEQVRKVAGDAQLGRPHLARVLVDQGWCMDVKAAFDRFLGTGRAAWVERFKLDGAEAIRLIRNAGGTATLAHPGSSKMERPEIQALAKAGLSGLEILSVDHNPSVRQKYLALAAEFDLVPTFGSDFHGEAVAPDHRLGVAAMSPELFQKLRARAPSSRPV
>CP034669.1|QAT86588.1|6377310_6378858_-|methyl-accepting-chemotaxis-protein
MWGRLTLRMQVAIAVLLPCLAVVFFTGVYFPARQRAAGLEVLAGRATTLGTLVVRHPSLALPETAPDARARRDELFNQVESGGFTLTFQELSRPAARTVVALRGQVPDGTPEPKEPTPGTCTVAQGTEQVVVRCESDGLVYRAGFGTHEVKAALAATEGYSLMGYLGAAVLGLGLAVIISRAIADPVSRVTQVAREVARGDVFRGELDVSAAGEVRQMATSFNEMLGTLRTTVMELVTRTEQLSSASRGLMGASADQEHVISQQAAYAQQIAATFEELSRTAEQISSSTEVVESSARRTHDAVAEAMAVVAQVVGGINDIRTESKGVADAIVGLNKDLQQVSKIAQVINQVAERSDLLALNAALEGTKAGDVGRGFSLVAAEMRKLAENVSVSARDIARIVEKVQDSGEEAASKARVGMATSDRGVEVAEQASAVFLRIVELARGTSEAARQITIATRQQRQSSEQAVQGARNVADLVKQGVDATGRTTRIAQDLQAVAEGLTAVTSRFKAQPRS
>CP034669.1|QAT86589.1|6379117_6379486_+|putative-NADH-dehydrogenase-I-subunit-A
MTTPLAPYLPMAVVLLLAGVMGMIIPQVTTRLGPKRPSSTKSAPFEAGSESSGPARQRFAVKFYVIALLFIVFDVEAVFLYPWAVNFQALGWFGYVEMLVFASTLVVGLIYVWKKGALDWES

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP034669_23

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP034669_23

6603053-6603222

Orphan

Consensus_repeat	Method
TCCAAACCTGTCGGACAGTCGGACAGGTTTC	PILER-CR

2 spacers

The CRISPR arrays of CP034669_23

>merge|CP034669|23|6603053-6603222|PILER-CR
AAACCTGTCCGACTGTCCGACAGGTTTGGACACGCGCAACAGGGAGCCCCCGCACCGGCCGAGCCGAGGAAACCTGTCCGACTGTCGGACAAGTTGGAGAGACACGACCGAGGGGGGCGCTCCCTTCGTCCGCCGGGCAGAAACCTGTCCGACTGTCCGACAGGTTTGGA

>CP034669|23|4|6603053-6603222|PILER-CR
AAACCTGTCCGACTGTCCGACAGGTTTGGAC	ACGCGCAACAGGGAGCCCCCGCACCGGCCGAGCCGAGG
AAACCTGTCCGACTGTCGGACAAGTTGGAGA	GACACGACCGAGGGGGGCGCTCCCTTCGTCCGCCGGGCAGAAAC
CTGTCCGACTGTCCGACAGGTTTGGA

Protein	Signature genes	Signature genes Name	Protein_function
CP034669.1\|QAT86770.1\|6595713_6597501_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377577
CP034669.1\|QAT86784.1\|6612194_6612593_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|380395
CP034669.1\|QAT86771.1\|6597718_6599440_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225186
CP034669.1\|QAT86777.1\|6603332_6603704_-\|PemK-family-protein	unknown	unknown	gnl\|CDD\|367091
CP034669.1\|QAT86778.1\|6603805_6604708_+\|abortive-infection-protein	unknown	unknown	gnl\|CDD\|376806
CP034669.1\|QAT86785.1\|6612759_6613809_+\|ribonuclease	unknown	unknown	gnl\|CDD\|238513
CP034669.1\|QAT86779.1\|6605035_6605932_-\|chemotaxis-protein-CheR	unknown	unknown	gnl\|CDD\|214534
CP034669.1\|QAT86774.1\|6600857_6601766_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176163
CP034669.1\|QAT86768.1\|6594182_6594509_+\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT86780.1\|6605936_6606497_-\|CheW-protein	unknown	unknown	gnl\|CDD\|238374
CP034669.1\|QAT86782.1\|6608226_6609945_-\|chemotaxis-protein-CheA	unknown	unknown	gnl\|CDD\|223716
CP034669.1\|QAT86769.1\|6594613_6595639_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|239801
CP034669.1\|QAT86773.1\|6600233_6600845_+\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT86781.1\|6606510_6608199_-\|methyl-accepting-chemotaxis-sensory-transducer	unknown	unknown	gnl\|CDD\|185001
CP034669.1\|QAT86776.1\|6602742_6603018_-\|HTH-type-transcriptional-regulator-AraB	unknown	unknown	gnl\|CDD\|176102
CP034669.1\|QAT86786.1\|6613810_6614824_-\|tRNA-dihydrouridine-synthase-A	unknown	unknown	gnl\|CDD\|236991
CP034669.1\|QAT86767.1\|6592944_6594144_+\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT86775.1\|6601860_6602739_+\|aldo/keto-reductase-family-oxidoreductase	unknown	unknown	gnl\|CDD\|236676
CP034669.1\|QAT86783.1\|6610395_6612183_+\|D-amino-acid-dehydrogenase	unknown	unknown	gnl\|CDD\|225885
CP034669.1\|QAT86772.1\|6599443_6600001_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378155

Protein	Function_ID	Function_description	E-value
CP034669.1\|QAT86770.1\|6595713_6597501_-\|hypothetical-protein	gnl\|CDD\|377577	pfam05960, DUF885, Bacterial protein of unknown function (DUF885). This family consists of several hypothetical bacterial proteins several of which are putative membrane proteins.	1.80249e-113
CP034669.1\|QAT86784.1\|6612194_6612593_-\|hypothetical-protein	gnl\|CDD\|380395	cd06990, cupin_DUF861, domain of unknown function DUF 861, cupin domain. This family contains proteins which seem to be specific to bacteria and some fungi. The function of this family is unknown but contains a cupin domain without a metal binding site. Cupins are a functionally diverse superfamily originally discovered based on the highly conserved motif found in germin and germin-like proteins. This conserved motif forms a beta-barrel fold found in all of the cupins, giving rise to the name cupin (cupa is the Latin term for small barrel).	1.06971e-52
CP034669.1\|QAT86771.1\|6597718_6599440_+\|hypothetical-protein	gnl\|CDD\|225186	COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism].	1.96073e-23
CP034669.1\|QAT86777.1\|6603332_6603704_-\|PemK-family-protein	gnl\|CDD\|367091	pfam02452, PemK_toxin, PemK-like, MazF-like toxin of type II toxin-antitoxin system. PemK is a growth inhibitor in E. coli known to bind to the promoter region of the Pem operon, auto-regulating synthesis. This family represents the toxin molecule of a typical bacterial toxin-antitoxin system pairing. The family includes a number of different toxins, such as MazF, Kid, PemK, ChpA, ChpB and ChpAK.	1.46283e-26
CP034669.1\|QAT86774.1\|6600857_6601766_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176163	cd08474, PBP2_CrgA_like_5, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 5. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.28189e-97
CP034669.1\|QAT86785.1\|6612759_6613809_+\|ribonuclease	gnl\|CDD\|238513	cd01062, RNase_T2_prok, Ribonuclease T2 (RNase T2) is a widespread family of secreted RNases found in every organism examined thus far. This family includes RNase Rh, RNase MC1, RNase LE, and self-incompatibility RNases (S-RNases). Plant T2 RNases are expressed during leaf senescence in order to scavenge phosphate from ribonucleotides. They are also expressed in response to wounding or pathogen invasion. S-RNases are thought to prevent self-fertilization by acting as selective cytotoxins of "self" pollen. Generally, RNases have two distinct binding sites: the primary site (B1 site) and the subsite (B2 site), for nucleotides located at the 5'- and 3'- terminal ends of the sessil bond, respectively. This CD includes the prokaryotic RNase T2 family members.	3.9283e-23
CP034669.1\|QAT86779.1\|6605035_6605932_-\|chemotaxis-protein-CheR	gnl\|CDD\|214534	smart00138, MeTrc, Methyltransferase, chemotaxis proteins. Methylates methyl-accepting chemotaxis proteins to form gamma-glutamyl methyl ester residues.	3.45397e-83
CP034669.1\|QAT86778.1\|6603805_6604708_+\|abortive-infection-protein	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	8.9582e-13
CP034669.1\|QAT86780.1\|6605936_6606497_-\|CheW-protein	gnl\|CDD\|238374	cd00732, CheW, CheW, a small regulator protein, unique to the chemotaxis signalling in prokaryotes and archea. CheW interacts with the histidine kinase CheA, most likely with the related regulatory domain of CheA. CheW is proposed to form signalling arrays together with CheA and the methyl-accepting chemotaxis proteins (MCPs), which are involved in response modulation.	3.16192e-43
CP034669.1\|QAT86782.1\|6608226_6609945_-\|chemotaxis-protein-CheA	gnl\|CDD\|223716	COG0643, CheA, Chemotaxis protein histidine kinase and related kinases [Cell motility and secretion / Signal transduction mechanisms].	6.11039e-146
CP034669.1\|QAT86786.1\|6613810_6614824_-\|tRNA-dihydrouridine-synthase-A	gnl\|CDD\|236991	PRK11815, PRK11815, tRNA dihydrouridine(20/20a) synthase DusA.	0
CP034669.1\|QAT86781.1\|6606510_6608199_-\|methyl-accepting-chemotaxis-sensory-transducer	gnl\|CDD\|185001	PRK15041, PRK15041, methyl-accepting chemotaxis protein.	2.60069e-61
CP034669.1\|QAT86776.1\|6602742_6603018_-\|HTH-type-transcriptional-regulator-AraB	gnl\|CDD\|176102	cd05466, PBP2_LTTR_substrate, The substrate binding domain of LysR-type transcriptional regulators (LTTRs), a member of the type 2 periplasmic binding fold protein superfamily. This model and hierarchy represent the the substrate-binding domain of the LysR-type transcriptional regulators that form the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor. The genes controlled by the LTTRs have diverse functional roles including amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, oxidative stress responses, nodule formation of nitrogen-fixing bacteria, synthesis of virulence factors, toxin production, attachment and secretion, to name a few. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the substrate-binding domains from ionotropic glutamate receptors, LysR-like transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	3.17523e-05
CP034669.1\|QAT86769.1\|6594613_6595639_+\|hypothetical-protein	gnl\|CDD\|239801	cd04273, ZnMc_ADAMTS_like, Zinc-dependent metalloprotease, ADAMTS_like subgroup. ADAMs (A Disintegrin And Metalloprotease) are glycoproteins, which play roles in cell signaling, cell fusion, and cell-cell interactions. This particular subfamily represents domain architectures that combine ADAM-like metalloproteinases with thrombospondin type-1 repeats. ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) proteinases are inhibited by TIMPs (tissue inhibitors of metalloproteinases), and they play roles in coagulation, angiogenesis, development and progression of arthritis. They hydrolyze the von Willebrand factor precursor and various components of the extracellular matrix.	0.00106988
CP034669.1\|QAT86775.1\|6601860_6602739_+\|aldo/keto-reductase-family-oxidoreductase	gnl\|CDD\|236676	PRK10376, PRK10376, putative oxidoreductase; Provisional.	0
CP034669.1\|QAT86783.1\|6610395_6612183_+\|D-amino-acid-dehydrogenase	gnl\|CDD\|225885	COG3349, COG3349, Uncharacterized conserved protein [Function unknown].	4.70945e-41
CP034669.1\|QAT86772.1\|6599443_6600001_-\|hypothetical-protein	gnl\|CDD\|378155	pfam09346, SMI1_KNR4, SMI1 / KNR4 family (SUKH-1). Proteins in this family are involved in the regulation of 1,3-beta-glucan synthase activity and cell-wall formation. Genome contextual information showed that SMI1 are primary immunity proteins in bacterial toxin systems.	0.00185795

>CP034669.1|QAT86776.1|6602742_6603018_-|HTH-type-transcriptional-regulator-AraB
MGHHFGRRHPHGYSTAHFEELEEVLEWVAQGHGVAVVPGFCIPKGRGLGVVSWGKPALTNTVHAVQRTQAPVRPAVAELLERLRGGRGAAP
>CP034669.1|QAT86775.1|6601860_6602739_+|aldo/keto-reductase-family-oxidoreductase
MPGIDSSSTFPLGGRPVKRLGYGAMQLAGPGVFGPPKDPDAARAVLREAVARGVNHIDTSDYYGPHVTNQLIREALAPYSDGLVIVTKIGARRGNDGSWLPAFSKEELTQAVHDNLRNLGRDVLDVVNLRFMFDTHGPAEGPIEEALTVLADLQRKGLVRHIGLSNVTAKQVADGRRIADIVCVQNHYNLAHRQDDALIDSLARDRIAYVPFFPLGGFSPLQSSTLSAVAARLNATPMQTALAWLLHRSPNILLIPGTSSVAHLKENLAAGELQLPEDVLKELDSVASAQPA
>CP034669.1|QAT86774.1|6600857_6601766_-|LysR-family-transcriptional-regulator
MKVDLGDLNAFVVVARARSFREGARLSGSSASSLSDAVRRLEERLGVRLLNRTTRSVVPTEAGEGLLERLAPVLTEMEAALDVVNGFRSRPAGVLRLNVPISASRLVLPRIVPPFLAAYPDIHLEVITEDSFVDVIAAGCDAGIRYDERLEQDMIAVPIGPRVQRHATAAAPAYLERHGRPEHPKDLLRHACLRGRFASGAMTLWEFERDGEVVTVEPSGPLIVRAGGGTDLAVDAAIAGTGIVHLFEDWLRPHLDSGALVPVLEPWWQPFPGPFLYYPGRRFVPAPLRAFIDFIKAPETGP
>CP034669.1|QAT86773.1|6600233_6600845_+|hypothetical-protein
MRRARPSVFERIPTAARTWASRLVLLMACASVVATSRARSEDVASPVHTGTPFRLTTETGRVTRTLVVRASAAKKLSDPVEGEVRIQARAKWTPGNPTPATKPSLVISYLHGDAFYEDLRSVLEPDVAVTVESVKYLDERCSEGRGCEWTVQAVFDVGVPSDADSGTVADPGTIDVEWTAQAFMRVLDESNVPKGFTVSLSEP
>CP034669.1|QAT86772.1|6599443_6600001_-|hypothetical-protein
MPGAIEAINALKERLSREQGLPLRAVSVTPVREEDVRLLEDALGPLLPNAYLQFITRHGLFAATDASGYERARMLSPSEVLERHEWYKEFVEEDSFGEEEDEREAALRELEVRRRLIPFQYIADSSVHDFYSFDTGLRRDEGMLILKAYHDDYDLAPWLLDAAPDTSGCTFDFDAHLNQVIRALL
>CP034669.1|QAT86771.1|6597718_6599440_+|hypothetical-protein
MAANYKKFFAGSRNIPKGISLGYPVPGPQEASADQIAGQAFFATPNDWSSIQASAYDFIVIGTGPTGVAFIEQTLKHNPNARILVLERGGFWLPTHYQMLPLAFQAATGSPPTTYPWTRTTRMATTELEFFQAGYIPVLGGRSTYWSAWCPAPTPDLMRDWPQELIDVTLQPGFWDRARAFLHVTTMDRIHDGVYGSLQHQIDVNLRENFKRYVPSALSAFPAPIAVGQTPWKGVKFYKYSTVGTLLDLQQSQKALAAQGQGQALTIVDHCVVDRLVHDGHGTVTALETSRGPLAVSSAKVVLAMGTIPPATLLMNSFKESLPNIGKRYTGHFMSHITARVKRSAFKDLSALEIGATYLDGKAPNGLQYHVQTSAFASANPEADESTIAHEAPDAAAVASMAQLKGSEDYVVFVCATLGEVSEKNPDNWIRMNGGTDPATNITLQLQPGVEDHHLWDVLDEATYQSIDVMAGCAGCSAPEVEYWVDDASGNGGRWQQERPDRKEIRLNIIVHEASPLWMGRDPATSVVGLDYRPHGVHNVYVTGGALFPTSGSWNPTLTMCGLAQDLADRLRG
>CP034669.1|QAT86770.1|6595713_6597501_-|hypothetical-protein
MKALRTPSVLAALLLLSPGCTTSRPAERAEAQAAMPTESSAQVALRGFVDAYFEEHFRRSPMSATSAGMHTYDGELRGFRPEERAAHLAFLKERLAALPQAVDRASLPPGDRADYDILENHFRARILDLETVRSWERNPNAYLGFASNAVYQLINRDFAPLEERMRSAVKRMAVVPEVFAVAPANLKNPPKLWTQIALEQVKGTRSLYAQTLPQAFAPVQDAALQEDFKRAQARCLEAIDGYIRFLKDDLLARSNGEFAIGEQTYRQKLQYEEGVTESIDSLLAWGRAEMKRTQDQFREVAGRIAPGKAPMDVYRELGKEHPAGAELVATTTATLEDIRQFLIDRRIITVPSEVRAKVAETPVFSRALSFASMSTPGPFESKATEAYYYVTPPDPAWTAEQTTQHMSFYNRYALPIVSIHEAYPGHYVQFLWTNRIQSKVRRLLGSGSFSEGWGLYTEQMMLDEGYGGTGPQADKLRLNQLALYLQRLARYVAGLSLHTRGMTYDQAVSLFEQEAYMTRINAEREARRGTSDPTYLVYALGKKMLMELREDAKVKWGKDFTLQRFHDAVVSHGYPPVPIVRQLLLGEDTAPSASR
>CP034669.1|QAT86769.1|6594613_6595639_+|hypothetical-protein
MKRGLRGWILGLAACWLGCGASQDLVGMEQEATLEDCRQLAPPEGTDRVVAARQVTAQAVTSQVVPIVLIPAGSQALSTVELNTVRQALSNVRRWYERELPNRNVNWAPIQVMQGAQTASYYLTNNNVWNDIPGEIQGQFGWNPWAYTGGAHRIALVMGRDLLGWAGANGYTDGRGLAIVGLESLLEQSKCAGNWWCTQEFWHGTVAHELGHTFTLPHDTVADSIMSFHDAYTTRHFTATAATTVQANPATLPKKANWDYCSIDYECATLRCGGNWSGDRLWCLPTPAYPKQAQNIPATFTCREHSQCLTGICTFSPAAGAKVCASSASPNYVTPFFPDVP
>CP034669.1|QAT86768.1|6594182_6594509_+|hypothetical-protein
MGNWAVYPAATGVPYSHQAYSISLGGTYSTHRFQWSSTQVFFQALHGHQDGNANQMASWRFNPPDYVQRIPQNPLPVHMNFWLFQGRAPKNGQEAEIVIAEFKFIPAP
>CP034669.1|QAT86767.1|6592944_6594144_+|hypothetical-protein
MFSDGIRRALGPVLRTVANAAVEKGVAPPLQPAAKAVANFAVSSFERGTSPRVVLNPPPVVVQRPPVDLTPTPTPNVQGDQNMAPGEWLIVSSPENVYLRPGPSAESGQSVLFYKGTKLQVATPPDNGPAVRGDFVYVQDANRQQQGWVRMSHTAEMTEADTKTYRASRNQSDAADAYQGIYVNQFDAETQVGGDGRNANCGPTATLMAFLKQGLEIPSIPGITHNGTAGADVQAVRYWGNRLTDTNSDGVTTNPQGGTEYSLTTENSQYTGFQDVKNAVTAARGSWAKVDANSESIQKAIESGMSVVISGNFVEAPAQGSENTDPVVKSDTWAQGGGAQEHLVAVVGMTPEGNFIVCDPAAAVRTPLEVTPAELDAFMRGNAGAIGIYDPTPGPRSGA
>CP034669.1|QAT86777.1|6603332_6603704_-|PemK-family-protein
MSTGPKMIHRGDLFWCEPDEARGSVPPIAHPYLVIQDDVFNRSRIHTVIVCALTSNLRKASEPGNVLLEVGEGNLGKQSVVVVSQVSSVEKSRLGERIGALSDARVEQVLAGLRFQQASFFRD
>CP034669.1|QAT86778.1|6603805_6604708_+|abortive-infection-protein
MKAVFQDGEGHLRNGWKGAGFLVVSAVLAGILMWLQTLLPAAVRPFAPNPFFGFLGVLLVSLDFLYLEKQPVTLTSLGMSLDRRAGRDLGMGALAGVVLVGLVALCGWVAGGYHLERAANTPATAIVKAAWVMLGVGLFEEALFHGYLFQRAIRGLGTRWAQGVISLLFCLAHPFTPEMEVPTRVVAMAATFLAGWMLGLCYLRTRHLALPVGVHMGWNWFLGTLGFGVSGNEARGWWTPVFQGRPEWLTGGAYGLEASIFSVVVLGVAIIALTRWKGSAAPEPEALPHPGEAPALTTPR
>CP034669.1|QAT86779.1|6605035_6605932_-|chemotaxis-protein-CheR
MSGDAPWPPSALPPALSRSELESFQHLVEAEAGIHLSSAKNALVANRLSRRLRELGLTSYAAYHAYVTTRGNEAEKVRMLDSLCTHETSFFREPRHFDLLREHVLPEWAAQAAQGRRPRSIRVWSAGCSTGEEPYSLAMELLEAFPKGSGWSLEIVATDLSTWAVKRAEEGLWSLERARSIPQLLLRKYMLKGVRTQEGLMMAGPELRTFMRFARANLHAPATWPVGPFDIIFCRNVLIYFGAEARARVIQGLLSRLPETGYFFLGHAESLIGITAAARSVSANVYTPRPGPPFPSRE
>CP034669.1|QAT86780.1|6605936_6606497_-|CheW-protein
MSESTEPGGGRSSYLSFMLAGEEYAVGLLRVREIIEHRPVTRVPGMPAAVQGVINLRGSVVPVVDLAVKFGLPPRPITRWSCFVIVEVALDGQQTVLGLLTDTVREVLELGAADIEPPPAFGTRVRLEFLRGMGRHNDTFILLLDLDRLLSLDELLKLTAATDEAAAPAAPAAPAPAAAPEAPGNG
>CP034669.1|QAT86781.1|6606510_6608199_-|methyl-accepting-chemotaxis-sensory-transducer
MFNNLSITAKLTLAFSAMVAIIIALVVVVYTTILKVSVTAEGDTESHKVLIAVRTLEGDLADLETGQRGFLITGDDKFLEPYNLARLSLSQSLDHIRQLTQSDRRQQERQQEIRDLLQQWISQHLEPLIAQRREVAAGRGDLAQLIAVEQSARGKQTADRIRMQLTKLADDETALLQERTTRTAGMVVDLYNLIIMGGVLGVVLAALLSFFLTRSIVQPLTEAVQVTSQVTAGDLTANIVARGTDETGRMMGSMREMIQRLSGVISEVRGAAGSLSSASLQVASAAQGLSQGTSSQAASVEETTASLEQLNVSIRQNSENSREMEQTAVKGARDAEESGRAVKETVQAMNAIAERISIVEEIAYQTNLLALNAAVEAARAGEHGRGFSVVATEVRKLAERSQKAAKEIGGLATSSVKVAERSGQLLTELVPAIRRTSELVQQVANASREQSIGVSQMNRAMTQVDQVTQRNASAAEELSSTAEEMATQAESLLQMMTFFRLMEGFSYNAPSLPRAPAHRPQVSPVRGLQAAAQGALATPTNGALSRLQNGAEAPAPHDFQRF
>CP034669.1|QAT86782.1|6608226_6609945_-|chemotaxis-protein-CheA
MTTGPGDIPSETAAEWQKVLAVFADEAEGLVSSMEENLIALEVSPAEGLLPGILRGAHTLKGAAASLGFQAVTDYTHGVEDLLQALLDGRLALDETRVSLLLGAVDHLRELCQASLAGVDSLGAVHQAHLSRLREGIVAGAPTEALPIPAALPRMPEARSTARSRVRMDMERLDRIVTLTAELSVARGRMAQFLARAEDTGASWEDALTQQREMDPLFEALQEEVMKVRMVPVGPLFRQHLRTVRDLARSQQKLAQLELEGEDATLDTAVLDAMRDPLLHLLRNALDHGIETPDERRAAGKDPRGRLRLKAWHDAGSVVVELSDDGRGIQRERVRERAKQRGLVAAPERLRDDELLRLIFEPGFSTATEVTELSGRGVGMDVVRRDIEALRGSVSIQSQEGQGTTLTLRLPLTLAVIQGFAMGVGDQVYVVPIEGVQECMEVPSQERTAEASGVLSLRGQPLPYLRLRQVFSLGGSTPARENVVVLKHPDGVIGLAVDELQGEGQRVIRPLGRLFQGIPGISGSTILGDGRVGLLLDTPALVRRAILHASEAALSPPSPLATPSPANAPRAP
>CP034669.1|QAT86783.1|6610395_6612183_+|D-amino-acid-dehydrogenase
MPSVIVVGGGVAGLTAAHELVERGFEVHVFDTRTSWGGKARSQPVAGTGPQGRRDLPGEHGFRFYPRFYRHVIDMMQRTPAAPGAAAPTVEQHLKATTESAIALIDEDTWYRFSRRKLDKPYDVLEALELFFQKLDFDEADISLHGLKILQFLSSSEARRFGQYERMSWWDFAQGDLYSPKFQRQLRAVPRTMVAMDPRRGSARTIGAISMQLILDFAQSGVNNDRTMGGPTSQMWLDPWLAHLRGLGVQLHAGVRCTGLDVAGGRITSVRFANGESRAADHYVLAVPLEAAHALITPELAALDPALARLRAADVEQLVSWMVGIQFFLYEDVPLVRGHTFYPDSPWALTSISQPQFWRELGLFRRVFGDGQVGGLLSIDVSDWNTPGTFVPKRARDCTPEEIKTEVWGQLKAALNGLGPDEQVLTDELLHSFHLDADLDYGGGLPPRNSSGLLVHPPGSWDVRPEAASAIPNLCLAGDYVRTHTDLASMEGACEAGRRAVNAILERTQSQSRRAPIWPLEEPAWLEPWKRLDAALYQRGRPHLFELLGLRTAVQASDVLRRFAALTGLTEVDDWLDQLRVSRMVDALLERLGID
>CP034669.1|QAT86784.1|6612194_6612593_-|hypothetical-protein
MARAIIKKANEADERRPFVSHGEASVLNLGALSIGRGHFEPGWQWSKHVKPIAGTETCEVVHTLSVLSGRMHVQMNDGQELDLEPGDVAFIPSGHDAWVVGNEPCRVVDFTGAEDYAVAKAGKEEPEQPSLQ
>CP034669.1|QAT86785.1|6612759_6613809_+|ribonuclease
MRPMSRLALWACLVIAQGCRSHHEPPPAPPPTPPTATARPLQLAKPEALELEFGRAQATACNCFKADASAKEGGACATPRFGAYLLALTWAPTFCRSHPDKEECGHLEESFGATHLTIHGLWPQFNDEEAREFNCTYPAYCGGLCECRGSNAPAKCFPDPATIPPAMGTYGPGFVTDNFFLANHEWPKHGSCTGMDARTYFQSNIDALLSLPGDQGTPAAITDNVGGSVALENLRAAFGQADSVAFACDPKCNLVEVGVCFLADEQRRPAARMTCPKSVTGGNTNSCVGNGSQPRCPMVKIQAATSDIGPTPSCANPGQGPACTNDQLCQNQGWVRCARSGCCTTVPKR
>CP034669.1|QAT86786.1|6613810_6614824_-|tRNA-dihydrouridine-synthase-A
MGRAMTALAYPMPLCVAPMMDWTDRHCRYFFRLISRHTLLYTEMVTTGAVLHGKRDRLLDFTPAEHPVALQLGGSEPADLAASARIGEEWGYDEINLNVGCPSDRVQSGRFGACLMAEPDLVARGVAAMREAVRIPVTVKSRIAIDDLEEWPTLEDFVRRVSAAGCTRFIVHARKAWLQGLSPKENRDVPPLRYDLVHRLKAEYPHLDISLNGGIKTLDAAAEHLGRVDGVMMGRAPYESPYLLADADRRFFGGTQAPLTRHEVVDAMLPYIETQMSQGAPLGAITRHMLGLFQGLPGARAWRRHLSENAHKDGASPEVVRAAAAKVPRDTGLQAVA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP034669_24

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP034669_24

6663023-6663240

Orphan

Consensus_repeat	Method
CCTGTCGGACAGTCGGACAG	PILER-CR

3 spacers

The CRISPR arrays of CP034669_24

>merge|CP034669|24|6663023-6663240|PILER-CR
CTGTCCGACTGTCCGACAGGCCCGCCGCCCCATCCGGTCGGCAGAAAACCTGTCCGACTGTCGGACAGGTTTTGATTGCCCAGGGGCAAGAGGGCCGGCCAATCCATCCACACAGCGGAAACCTGTCCGACAAGGTCGGGAGAACCGAGGATGGGCCCCCGCGCCATCCGGACGGCGGAAACCTGTCCGACTGTCCGACTGTCCGACTGTCCGACAGG

>CP034669|24|5|6663023-6663240|PILER-CR
CTGTCCGACTGTCCGACAGG	CCCGCCGCCCCATCCGGTCGGCAGAAAAC
CTGTCCGACTGTCGGACAGG	TTTTGATTGCCCAGGGGCAAGAGGGCCGGCCAATCCATCCACACAGCGGAAAC
CTGTCCGACAAGGTCGGGAG	AACCGAGGATGGGCCCCCGCGCCATCCGGACGGCGGAAACCTGTCCGACTGTCCGACTGTCCGA
CTGTCCGACAGG

Protein	Signature genes	Signature genes Name	Protein_function
CP034669.1\|QAT86824.1\|6658046_6659189_+\|phosphoribosylaminoimidazole-carboxylase-ATPase-subunit	unknown	unknown	gnl\|CDD\|235674
CP034669.1\|QAT86829.1\|6663820_6664378_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376876
CP034669.1\|QAT86837.1\|6671522_6672860_-\|cyclic-nucleotide-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|237999
CP034669.1\|QAT86836.1\|6671029_6671521_-\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT86819.1\|6653347_6654229_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|275358
CP034669.1\|QAT86831.1\|6664864_6667168_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|276808
CP034669.1\|QAT86820.1\|6654225_6655110_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|275358
CP034669.1\|QAT86835.1\|6669425_6671033_+\|Beta-barrel-assembly-enhancing-protease	unknown	unknown	gnl\|CDD\|274350
CP034669.1\|QAT86833.1\|6667823_6668297_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379639
CP034669.1\|QAT86825.1\|6659194_6659671_+\|ybaK/ebsC-protein	unknown	unknown	gnl\|CDD\|237976
CP034669.1\|QAT86821.1\|6655325_6655832_+\|adventurous-gliding-motility-protein-AgmO	unknown	unknown	unknown
CP034669.1\|QAT86832.1\|6667222_6667750_+\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT86827.1\|6661112_6662891_+\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|225110
CP034669.1\|QAT86823.1\|6657546_6658050_+\|phosphoribosylaminoimidazole-carboxylase-catalytic-subunit	unknown	unknown	gnl\|CDD\|376377
CP034669.1\|QAT86822.1\|6655946_6657380_+\|von-Willebrand-factor-type-A-domain-containing-protein	unknown	unknown	gnl\|CDD\|238742
CP034669.1\|QAT86828.1\|6663377_6663578_-\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT86834.1\|6668312_6669281_-\|homoserine-kinase	unknown	unknown	gnl\|CDD\|270702
CP034669.1\|QAT86818.1\|6651307_6653341_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237030
CP034669.1\|QAT86830.1\|6664374_6664806_-\|response-regulator	unknown	unknown	gnl\|CDD\|274060
CP034669.1\|QAT86826.1\|6659740_6660973_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274008

Protein	Function_ID	Function_description	E-value
CP034669.1\|QAT86824.1\|6658046_6659189_+\|phosphoribosylaminoimidazole-carboxylase-ATPase-subunit	gnl\|CDD\|235674	PRK06019, PRK06019, phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed.	1.13284e-153
CP034669.1\|QAT86831.1\|6664864_6667168_+\|hypothetical-protein	gnl\|CDD\|276808	sd00008, TPR_YbbN, C-terminal Tetratricopeptide repeat (TPR) region of YbbN and similar motifs. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. YbbN is a thioredoxin-like protein containing two tandem TPR repeats at the C-terminus, separated by two alpha helices. Its N-terminal thioredoxin-like domain is not a functional oxidoreductase. It functions in heat stress response and DNA synthesis as a chaperone or co-chaperone.	0.000631035
CP034669.1\|QAT86837.1\|6671522_6672860_-\|cyclic-nucleotide-binding-domain-containing-protein	gnl\|CDD\|237999	cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor. In all cases binding of the effector leads to conformational changes and the ability to activate transcription. Cyclic nucleotide-binding domain similar to CAP are also present in cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) and vertebrate cyclic nucleotide-gated ion-channels. Cyclic nucleotide-monophosphate binding domain; proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues; the best studied is the prokaryotic catabolite gene activator, CAP, where such a domain is known to be composed of three alpha-helices and a distinctive eight-stranded, antiparallel beta-barrel structure; three conserved glycine residues are thought to be essential for maintenance of the structural integrity of the beta-barrel; CooA is a homodimeric transcription factor that belongs to CAP family; cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) contain two tandem copies of the cyclic nucleotide-binding domain; cAPK's are composed of two different subunits, a catalytic chain and a regulatory chain, which contains both copies of the domain; cGPK's are single chain enzymes that include the two copies of the domain in their N-terminal section; also found in vertebrate cyclic nucleotide-gated ion-channels.	4.06323e-25
CP034669.1\|QAT86819.1\|6653347_6654229_-\|hypothetical-protein	gnl\|CDD\|275358	TIGR04565, hypothetical_protein_N47_G32130, outer membrane beta-barrel protein. Members of this family are outer membrane beta-barrel proteins, as inferred by distant homologies to other families (e.g. pfam13505) and by the concentration of aromatic residues, especially Phe, in the OMP signal region, which is flush with the C-terminus in some members, but followed by a few residues in others. Members have variable insertions and deletions, affecting scores, so this model does not cleanly separate all members from all non-members. Members are common in the Myxococcales, with five occurring in Myxococcus xanthus DK 1622.	4.00186e-44
CP034669.1\|QAT86820.1\|6654225_6655110_-\|hypothetical-protein	gnl\|CDD\|275358	TIGR04565, hypothetical_protein_N47_G32130, outer membrane beta-barrel protein. Members of this family are outer membrane beta-barrel proteins, as inferred by distant homologies to other families (e.g. pfam13505) and by the concentration of aromatic residues, especially Phe, in the OMP signal region, which is flush with the C-terminus in some members, but followed by a few residues in others. Members have variable insertions and deletions, affecting scores, so this model does not cleanly separate all members from all non-members. Members are common in the Myxococcales, with five occurring in Myxococcus xanthus DK 1622.	4.48824e-36
CP034669.1\|QAT86835.1\|6669425_6671033_+\|Beta-barrel-assembly-enhancing-protease	gnl\|CDD\|274350	TIGR02917, TPR_domain_protein, putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.	3.08997e-07
CP034669.1\|QAT86833.1\|6667823_6668297_+\|hypothetical-protein	gnl\|CDD\|379639	pfam14534, DUF4440, Domain of unknown function (DUF4440).	9.50509e-09
CP034669.1\|QAT86825.1\|6659194_6659671_+\|ybaK/ebsC-protein	gnl\|CDD\|237976	cd00002, YbaK_deacylase, This CD includes cysteinyl-tRNA(Pro) deacylases from Haemophilus influenzae and Escherichia coli and other related bacterial proteins. These trans-acting, single-domain proteins are homologs of ProX and also the cis-acting prolyl-tRNA synthetase (ProRS) inserted (INS) editing domain. The bacterial amino acid trans-editing enzyme YbaK is a deacylase that hydrolyzes cysteinyl-tRNA(Pro)'s mischarged by prolyl-tRNA synthetase. YbaK also hydrolyzes glycyl-tRNA's, alanyl-tRNA's, seryl-tRNA's, and prolyl-tRNA's. YbaK is homologous to the INS domain of prolyl-tRNA synthetase (ProRS) as well as the trans-editing enzyme ProX of Aeropyrum pernix which hydrolyzes alanyl-tRNA's and glycyl-tRNA's.	3.09821e-68
CP034669.1\|QAT86827.1\|6661112_6662891_+\|EAL-domain-containing-protein	gnl\|CDD\|225110	COG2200, Rtn, c-di-GMP phosphodiesterase class I (EAL domain) [Signal transduction mechanisms].	4.03319e-62
CP034669.1\|QAT86823.1\|6657546_6658050_+\|phosphoribosylaminoimidazole-carboxylase-catalytic-subunit	gnl\|CDD\|376377	pfam00731, AIRC, AIR carboxylase. Members of this family catalyze the decarboxylation of 1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR). This family catalyze the sixth step of de novo purine biosynthesis. Some members of this family contain two copies of this domain.	8.69025e-81
CP034669.1\|QAT86822.1\|6655946_6657380_+\|von-Willebrand-factor-type-A-domain-containing-protein	gnl\|CDD\|238742	cd01465, vWA_subgroup, VWA subgroup: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF). Typically, the vWA domain is made up of approximately 200 amino acid residues folded into a classic a/b para-rossmann type of fold. The vWA domain, since its discovery, has drawn great interest because of its widespread occurrence and its involvement in a wide variety of important cellular functions. These include basal membrane formation, cell migration, cell differentiation, adhesion, haemostasis, signaling, chromosomal stability, malignant transformation and in immune defenses In integrins these domains form heterodimers while in vWF it forms multimers. There are different interaction surfaces of this domain as seen by the various molecules it complexes with. Ligand binding in most cases is mediated by the presence of a metal ion dependent adhesion site termed as the MIDAS motif that is a characteristic feature of most, if not all A domains. Not much is known about the function of the VWA domain in these proteins. The members do have a conserved MIDAS motif. The biochemical function however is not known.	2.47741e-40
CP034669.1\|QAT86834.1\|6668312_6669281_-\|homoserine-kinase	gnl\|CDD\|270702	cd05153, HomoserineK_II, Type II Homoserine Kinase. This subfamily is composed of unusual homoserine kinases, from a subset of bacteria, which have a Protein Kinase fold. These proteins do not bear any similarity to the GHMP family homoserine kinases present in most bacteria and eukaryotes. Homoserine kinase catalyzes the transfer of the gamma-phosphoryl group from ATP to L-homoserine producing L-homoserine phosphate, an intermediate in the production of the amino acids threonine, methionine, and isoleucine. The Type II homoserine kinase subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).	7.06211e-77
CP034669.1\|QAT86829.1\|6663820_6664378_-\|hypothetical-protein	gnl\|CDD\|376876	pfam02643, DUF192, Uncharacterized ACR, COG1430. Two structures have been solved for members of this large (>500 members) family of bacterial proteins present mostly in environmental bacteria and metagenomes (distant homologs are also present in several Plasmodium species). TOPSAN analysis for Structure 3pjy shows that there is much similarity with the other solved structure, Structure 3m7a, solved for UniProt:Q2GA55 (Saro_0823), a homolog of Thermotoga maritima TM1668, UniProt:Q9X1Z6., The homolog in Caulobacter crescentus (CC1388), UniProt:Q9A8G6, is associated with CspD, a cold shock protein (CC1387), UniProt:Q9A8G7. However, the genomic context of UniProt:Q2GA55 is most conserved with a putative xylose isomerase, suggesting a possible role in extracellular sugar processing. Saro_0821, UniProt:Q2GA57, is annotated as an AMP-dependent synthetase and ligase. Structure 3m7a structure corresponds to the C-terminal (27-165) fragment of the YP_496102 (Saro_0823) protein and it is structurally unique, as the best hits from Dali have a Z-score of 3.8 (1nt0, 2j1t, 3kq4) and it is thus a likely candidate for a new fold. Interestingly, many of the top Dali hits are involved in sugar metabolism. There are no obvious active site-like cavities on the protein surface of 3m7a (http://www.topsan.org/Proteins/JCSG/).	2.56422e-48
CP034669.1\|QAT86830.1\|6664374_6664806_-\|response-regulator	gnl\|CDD\|274060	TIGR02266, gmx_TIGR02266, Myxococcus xanthus paralogous domain TIGR02266. This domain is related to Type IV pilus assembly protein PilZ (pfam07238). It is found in at least 12 copies in Myxococcus xanthus DK 1622.	1.24701e-35
CP034669.1\|QAT86826.1\|6659740_6660973_+\|hypothetical-protein	gnl\|CDD\|274008	TIGR02168, Chromosome_partition_protein_Smc, chromosome segregation protein SMC, common bacterial type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].	1.02111e-05
CP034669.1\|QAT86818.1\|6651307_6653341_-\|hypothetical-protein	gnl\|CDD\|237030	PRK12270, kgd, multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.	0.000178506

>CP034669.1|QAT86827.1|6661112_6662891_+|EAL-domain-containing-protein
MSLPSPSKPAPPPPWLWNGDEPRVATVFQPIVDLLSGEVLGHEVLSRGLGPVESPNELFNRARVEGFTYELERACWTAAVRRIATLPEAQRRGPFFFNVSPDVLSDERFGGASTLELLRQHGLSPQQLVLEITERSTFEDTEQLRMLARRYAEQGFGIALDDFGAGHSGLVTLVHSAPDFIKLDQALVRDIHLHTYRQHLVKSLVAFAQRVDAVLIAEGVETWNELAVLLRLGIRHAQGYLLARPVSSPQRPGADFAERCREAIRALHHREHEDDETVGSMIIRPPCAPVTAQAVELDRLFRRTPGEDHVVLLDGEQPHAVVTRRNFYARFGGTAASTEAALPDAPREALMVVEDATAITALARMAMRRPPETVYDPVVVTDAKGHFLGTVTMKQLIARASDLEQHAATGAHPLTDLPGSRMIERWIRAALQGSAFTVIYADLDHFEAYNDRYGFLQGDRVIRYTASVLSECLHLLPEGSNLGHVGGDDFVLVCPDAVAPEVLRTLCQRFDAEKVPLYGPEDLRRGGFTAKDAAGNTVPVTLSLAAVDHQGLSANPHPAELSAVAASLRKRVKAVSAQTHTSTFLFQPGAVK
>CP034669.1|QAT86826.1|6659740_6660973_+|hypothetical-protein
MNAAVLQFHHREAFEHTVTRALAAGAGAGLLQWVSLRVGMPVPLTWVVPAAVVLACARGDRWDRGLLSGLGLLLVALPYGLGLSPAWTVATSGAAAGALLVRSRLNDLGEEGQVAEARPTLVHYGLGAVLGAGLTLAGGVVANILSVRLASVATPTLLAAAVVGGIVGLFVGLGAIAAHLGLTADPVEARAEELLPQLSGDFHTLSERALSLYRQCGQSLAKLPREPAREELARTLARITRGAVELASEWAGVEAQLEERAAAELQAERESLERSARASTDVVARRQLEAAAASLAEEVERLGDMRQRRERILARLRAEVALLERARVALLSLRSGQAQLKAAELASLARRFRALSTAQGEEGQAMDAVAAQVTLTQVAAANVAPVIPVDPSPAESEGAKVPELQRIQGE
>CP034669.1|QAT86825.1|6659194_6659671_+|ybaK/ebsC-protein
MKTNAARLLDSLGIAYSLRDYDVDPDDLSAETVAAKVGMPAEQVFKTLVARGDRTGVLMAVVPGNAELDLKALARLSGDRKVDTVPLKELQPLTGYIRGGVTALGGKKDYPVFVDETLELFDAVSVSAGVRGTQLVLAPADYLRVTKGKPGPISRPKA
>CP034669.1|QAT86824.1|6658046_6659189_+|phosphoribosylaminoimidazole-carboxylase-ATPase-subunit
MSGPMVLPGGTLGILGGGQLGRMMALAARTLGYQVQALDPDSACPSRSVVDRCLTASFTDTAAAEDLARQCDVVTLEIEKVSLATLNAVSRHAPMRPGASVLEVVQHRGRQKAWLAKGGFPLGPWREANSEAELSQAITALGGRCFIKSSEGGYDGRGQYEVKSASEAGVAWKELGERSVVVEAALDLKAELSVLVARGPDGQLAVYPPAFNHHEERILAWSLLPGPLPQAVLTQASQVARDITAGLKVEGLLVVEMFLLGDGSLLVNEVAPRPHNSFHSTEVACLTSQFEQAVRAVCNLPLGSVEVVRPAAIVNLLGDLWLQEGGPRFAQALAMPGVRLHLYGKRDARKGRKMGHLSAVGSTPEDALQRVKAAATALGM
>CP034669.1|QAT86823.1|6657546_6658050_+|phosphoribosylaminoimidazole-carboxylase-catalytic-subunit
MAASASTPWVGVIMGGKSDLEHLQPAIDILAELRIPHEVRIVSAHRTPDWMMEYASSAEGRGLSVIIAAAGGAAHLPGMVSSKTLLPVLGVPMPTTVLSGFDALLSIVQMPKGVPVGTQAIGKPGAANAALHAAAILALKYPELRERLAAWRKARTDEVLAQREVAG
>CP034669.1|QAT86822.1|6655946_6657380_+|von-Willebrand-factor-type-A-domain-containing-protein
MNRTVLFLALAGGLALTALVLGMPRGGGLSPTPPVVVTTPTPPPPVPPPGPRASTGSLQVTSRLSHPYVPVGPSETYVTVDLTGAEVPGAKRSPVNLAVVIDRSGSMSGYKLQQAKQAARHLVTLLRDEDRLAIVHYGSDVKSLPSLPATAGNRERMLQFIDGIWDDGGTNISAGLSVGRAQLASAMGGAPTVNRLILMSDGQPTEGVSDEEGLKNVVKEIRASGITVSSIGVGTDFNEDLMQAFAEYGAGAYGFLEDASKLSTLFQRDLQQATTAVARNVELSFELPPGTSLGEVLGYRAHQAGNTVRVALPDFSAGQVERVVARLHVTGTAPGQSVQVAGLKVAYTDLLVQKNVEDQSTLAAVATNIQEEVVQRQDKEATVYAARARSAQNLQKAAEAMSQGKKAEAKGYLSQNQALFMEAGAVAGAAAVAEDQAEQARAMQEYDDAESYEAQKAAVKNSKVKALKSFGRMGSTY
>CP034669.1|QAT86821.1|6655325_6655832_+|adventurous-gliding-motility-protein-AgmO
MFVRTALFLSAALLLGGCDVTTELGKPCQLVRRATAEEQAAQGRKFMEIQEKDIAVDQDFISFGSLDCEDLVCVRDDLSPRSDNPEAFALGYCSKECVQGTTTGCEITRTVGDVEEGLKERMTCRPLLLDQDTLDAIKIADEGFYRRTFGENNSPYFCAGAVSASQGN
>CP034669.1|QAT86820.1|6654225_6655110_-|hypothetical-protein
MSCCLPDGSTFPPPTERPDLNRPTLLLALSLMWPALAPAQNQPGMGLDLTEDAQATPPEENPAPPPDEEARPAAPPAATPAKDIPVEALMPLTDITQDDRVKSVQRKVYLKKNRLEISPFVSISVNDPFYSKFGGSLRAAWYLSDTLAISARGSLIQVIPSDDVSTAKRTFNSKIYNSVPNWSAMGDLEWAPLYGKVSFLNSILHFDGYLLGGMGVVSTETSALPGRGLNPAFDLGLGMRFVTKDYLAVNVALINTSYVDQPLGSSKGALQNVMTLNAGISIFLPLKSTGRESE
>CP034669.1|QAT86819.1|6653347_6654229_-|hypothetical-protein
MKPAFRLLLTLCAGAPALAAADQAPAPAAAAPATPAPAPAAPAPKPAANSNPPATSQEEEAGDVSEVDKDALGPLRERIRPVSGHMFLKKGRFELSPSASITIRDAFFKKYLFGGTVTYFPMETLGVGVRGGYALNSVAGSAQKCTFTPGEGGDTRGCSAPTREELDGYAPGQMTLMGGVDVQWAPIYGKLSLLAEKFVHFDMYGVVGATVVQYKGPAESLSDGTPVAGSKSYLTGGGNVGVGLRFFFNRWMTLRTELRDIIYVEKGREPTPSYLRNQILFELGLSFFFPSGS
>CP034669.1|QAT86818.1|6651307_6653341_-|hypothetical-protein
MRTHRFLRLAVLGLTLAYTAPTLAQSFEGLDLAGQSKKKKKGASSKASSKKKASAKRGKGKVTAPAEDVDASSTATSESAPAGNPATPPAALTPTPAPPATPAAPSAKPAAQGSPGLGLDLTGDNDKPPAPTMTFDAVDVSGKTADRQRLDAAISLFKNDEYEKAAMASHELLGDPKLQGLHVEARYVLAKSLYRMGLYHSSLGEFSKILAAGPSTKFFKTSLEWLFFISRKTQNETVILDEIARYANYDFPEKFRNEFRYLLARYHFVRGRALDQVGQTENADKSFEEVKRLALTIPRTDVFYPRAKYLEGLAFFRNGTRNKDAASKRGNTDVLASVEAMKEVVRLTRPIVGRTGEQAKLDKSLRELAFMQLARTHYGMQQNRFSIFYLNKVERGNTQWLEALFESSWANYRIGQYEQALGNLITLSSPFFREEYFPEALILKAVIYYENCRYRESNLILQDFERTYLPVHDELDGLVKKNMEASEYYTVLADVQKKNKDGLEKNGTDVILERILRLALTDQDLKKTNDSILELEGEMDLFSNKGDTFKYSELTKQLLEELKVQRTSLISKAGIMAKGKLETELGALKLLLANGLRIKFETTTKEKEFLEEQLKAGGRTAIVKKYKFSVAVADDQLYWPYEGEYWRDELGTYQYTMTKGCIERDTANRQVQSAEAM
>CP034669.1|QAT86828.1|6663377_6663578_-|hypothetical-protein
MTPLRERALQLDKAYLALMREQAFALGRDTLLAPPANVHRTVENGSTELEATGRLYTEGRLHLAWE
>CP034669.1|QAT86829.1|6663820_6664378_-|hypothetical-protein
MKTRTRLTFVLAALAFAGGACQEAPAAPPKPAAPAPARPKSKDVSAEDYVMSTLPRAHVRLKDAYGGVRRVEVEVAATGESRTRGLMWRKSLPAGQGMLFIFPDEEVRGFWMRNTLIPLDMLFITSEGRVVGIIENAEPRTLTNRTVGIPSQYVLEVPGGWCQKNGIVRGGTAEFEGVSTIPVTP
>CP034669.1|QAT86830.1|6664374_6664806_-|response-regulator
MASPILPGRMSEQKSGSELRTHGRAPIELKVDYKKLNSFFADYTKNISKGGTFIKTKKPLPIGTRFLFKLTVPHREAPFELLGEVVWSKADAEEPGMGIRFIYSSESQRVDFETLVERLMSDSLGSELTEKLLNKPLHPQHPS
>CP034669.1|QAT86831.1|6664864_6667168_+|hypothetical-protein
MLLLGGGGSALVLLPLFGVPGFELGLALSIAVGLLGGGTGIAAAAQERRILTGAAPLPARVEASALPGTAVGRALGASAVLNLGVLIPPFVCALLFARLRTACDPFELAGFYPLLTLPSALVASAAGVLVGFATARPRSAAGLYALLLLASLAVTVWPIVFGPQVFAFNIFLGHLPGPLYDEALQMTAALGWFRLETLLWVGVFAGLAISLLDVRTGRLALKGARVGGLLGLVLPCALGILWLEARAPQLGLRMSDAYLSEQLGGVRETEHFVLHYPRGKARQDVDRMARDLEFRFAQTSGFLGVAPTERVRVWLYRSEDEKQRLVGAGRTQFAKPWRTELHIQDKPFPHSTLHHELAHVMAGPAGSGFFRVTTRLGVWPLMGVIEGLAVAADDPVQGELTLHQWAAGMRRQGLAPDMRDLMGPKGFYQSAPARAYTVAGSFLRYLADTYGADRLRAVYAHADFNEAYGRPLDELVTEWERTLDALPLDASALARAFARFRTGSLFTRACAREVARLSDSARQSLASDPQDALERYQRAARLQPEEPSYQLGQAVALDALERGPDAAKVLAALAAQVKDRPALAAEVAVARADVALRLEDVEGSRAFLQAALALDPGPELTRTAQVKLAALETPSRRAPIEAYFRAPQEELRLLLLDRALLASPQDPWLHYLLGRRLHQVGAPALAGEQLQRALSDATLPEAIRREATRLRIEAAYLAGDCGAVRHEVGALPDYGAAFRAAASEWQARCDFEQTAYRGPLVPRQAFR
>CP034669.1|QAT86832.1|6667222_6667750_+|hypothetical-protein
MHFEKTQYIQGTVDEVERALLDERYFPYLLQHHGVLLELQPQEVRVDGDRVHRKVRYRPKPVISSVGPKKVSPEWFAFIETSTYDKRTRQLTFTNTPTSHTISKMLVNTGVLKLRDLGNGQTERKMEGELSLKVPFLLKPVAMIAEPLIKTEGLKILDGELPVLNRFIAEVIRAK
>CP034669.1|QAT86833.1|6667823_6668297_+|hypothetical-protein
MHNRFLALCAVFFLAACAPKRIPGTELEDTGDTRAILSVMEKYRAALEARDAKAIQALVSPKFRDDSGTPDDPADDLTASNLEAHLQALFQKVQNPKVDFNVRRVEFHEDEDIALAIYYWNASWRMPGLNARPQSDSELEQMVFQKVGGDWKIVSGI
>CP034669.1|QAT86834.1|6668312_6669281_-|homoserine-kinase
MAVYTTLPPEAFTQVADVWGLGAVRSITPIPQGSINTNHRLETDSGRVFVRHTTVRSPEDLRFEASLLEHLSRAHFPAPVLLVPPGPAPFLELHGGRISVFKWLAGEEYTRDRLTPEVLERLGAELGKLHRVTQSFGGTRANPYGPALVQDWLGGLSRRPEPELVSVAAELERYLARVEAERQGLEPRGVIHADLFLDNVKWLGDRVGAFFDFEMACVDAYALDVAVTLNAWCFEGTYQPERCQALLRGYQDARPLSDVEKRALYGHALYGAVRFTTSRIRDYHLSTLGADKLAPKDFRTYLSRARALDGMGPDGLRALVGA
>CP034669.1|QAT86835.1|6669425_6671033_+|Beta-barrel-assembly-enhancing-protease
METSGRGDWKRREGLGSALAQIGVVAVLLAAGVAWYVHRGQVRQEADAHLRTARSAVLKGNPSDLAMAQQNLEALFALAPDSRDARALAADLQAELWLTHHQPGADAKAREQLERAETLGSRSGERYGARALLLVGAGQTAEANKLLEELKSQGANSPRLTLAQARLLQKEGRLSEARQAFARAAEGAWKDPRFSSAYAEALLDEGMFSQAVEAFARATTANPDHLLSRVTSALAQLYAGRPPDGVAALLEEVRSRRKELTPALQARMAVAQAEVSLAKGAPDEALTHVDAALKAWPEEHYALFTRGRALAVKRAPEARQAFEAAVAKRPTAPLLTLEGARLLQAQGDGEGALAMLDAYEKTFREVKARTADGKELPALDKDDRYWLTRGGVMEAAGRQDDALAAYDKALAARGVGLARAQYAKGALLLARKDFDGAKSLLTAVAPETGAGSMPEAYAALGELHFAQGEFAAGCQQHYFSLVRARAQGAPVEQLATRANDIKQRLETSGQPAMAKAWLTEAGPLFNGDDPAAVTR
>CP034669.1|QAT86836.1|6671029_6671521_-|hypothetical-protein
MVLTRTRVLSGMAAVVAAALVLFFWPREEPGVKDAVTRRIIAMTSAAEEKDVGEVMEGVSERFKTKEGWSKQDVRGILTAQVLRGQWVRIFTTDIDVQEVSPTQGDFQARFIFGRSQADKLEDLARDSVLNAYSIEGTFEKEADGEWRVVKAKQRRLDPSELL
>CP034669.1|QAT86837.1|6671522_6672860_-|cyclic-nucleotide-binding-domain-containing-protein
MSESSLRELGMDLFEERQFERALAVFAEAVRRVPADHRSRMLASRCLAELGERERAVTAYHACAEGLLRRDYLLSAMAACKLALELSPNERRLKETLYRVHSRAARSAPGRAAVPPPLPPEHLYDGKVDTDLMGLVGEELSNRAIEVLAAPDTGGTADPQSRPPLPLFADLDRDAFFDLVGRMVWRTIKPEEVISREGEPDDHLHVIVAGKAEVTRRTDGEDRTLGFLGGGSIFGELALLTGAPPTASVTAVSDSEVFEIRREHLNAVAKSHPAVPQLLADFAQQRMMRNLMANSPLFQQLPESERGAFFQRFTFRALQPGEKVLVEGEYSQGLFLVLAGELTVQKEDPAGGMVTLGVLREGDVAGEISLLTGLRATATVSVTRKTAAGWLKREAFQELVKTFPNIRTYLEQLSDRRLKQIGEALRPLEIIDADDMMLEPETGAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP034669_27

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP034669_27

8794780-8795237

Orphan

Consensus_repeat	Method
CCGAGCCGNGGAAACCTGTCCGACTGTCGGACAGCTTTG	CRT

6 spacers

The CRISPR arrays of CP034669_27

>merge|CP034669|27|8794780-8795237|CRT
GCGCGCTGCCAAAACCTGTCGGACAGTCGGACAGCTTTGGCCCCCATGGCTGGCCGGAGCCTCCATTCCATCCGAGCCGAGGAAACCTGTCCGACTGTCGGACAGCCTTGTCCCCCATGGCTGGCCGGGGCCTCCATTCCATCCGAGCCGAGGAAACCTGTCCGACTGTCGGACCGCTTTGTCCCCCATGGCTGGCCGGGGCCTCCATTCCGTCCGAGCCGAGGAAACCTGTCCGACTGTCGGACAGCCTTGGGCTTCCCCCTGCCGGAGGCGGCACTCCATCCGACCAGCGAAAACCTGTCCGACTGTCGGACAGCTTGGGGCCGCCGCGACCGAGACCTCCGCCCCCGAGCCGAGGAAACCTGTCCGACTGTCGGACAGCTTTGGACCACCGTGGCTGGCCGGGGCCTCCGCTCCGTCCCATCCGCAGGAACCTGTCCGACTGTCCGACAGGTTCG

>CP034669|27|6|8794780-8795237|CRT
GCGCGCTGCCAAAACCTGTCGGACAGTCGGACAGCTTTG	GCCCCCATGGCTGGCCGGAGCCTCCATTCCAT
CCGAGCCGAGGAAACCTGTCCGACTGTCGGACAGCCTTG	TCCCCCATGGCTGGCCGGGGCCTCCATTCCAT
CCGAGCCGAGGAAACCTGTCCGACTGTCGGACCGCTTTG	TCCCCCATGGCTGGCCGGGGCCTCCATTCCGT
CCGAGCCGAGGAAACCTGTCCGACTGTCGGACAGCCTTG	GGCTTCCCCCTGCCGGAGGCGGCACTCCAT
CCGACCAGCGAAAACCTGTCCGACTGTCGGACAGCTTGG	GGCCGCCGCGACCGAGACCTCCGCCC
CCGAGCCGAGGAAACCTGTCCGACTGTCGGACAGCTTTG	GACCACCGTGGCTGGCCGGGGCCTCCGCTCCGT
CCCATCCGCAGGAACCTGTCCGACTGTCCGACAGGTTCG

Protein	Signature genes	Signature genes Name	Protein_function
CP034669.1\|QAT88554.1\|8797779_8799090_-\|cytochrome-c-peroxidase	unknown	unknown	gnl\|CDD\|224771
CP034669.1\|QAT88546.1\|8788148_8788460_-\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT88551.1\|8795611_8795767_+\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT88541.1\|8781486_8782884_-\|cyclic-nucleotide-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|237999
CP034669.1\|QAT88545.1\|8787256_8788084_-\|2,3,4,5-tetrahydropyridine-2,6-carboxylate-N-succinyltransferase	unknown	unknown	gnl\|CDD\|236996
CP034669.1\|QAT88549.1\|8791538_8794574_-\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT88550.1\|8795352_8795562_+\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT88547.1\|8788645_8790112_+\|decarboxylase,-group-II	unknown	unknown	gnl\|CDD\|99743
CP034669.1\|QAT88542.1\|8782939_8785198_-\|terpene-synthase-metal-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|173835
CP034669.1\|QAT88548.1\|8790168_8790888_+\|group-2-glycosyl-transferase	unknown	unknown	gnl\|CDD\|133022
CP034669.1\|QAT88553.1\|8796648_8797767_-\|metallophosphoesterase	unknown	unknown	gnl\|CDD\|277347
CP034669.1\|QAT88544.1\|8786541_8787174_-\|Anti-sigma-E-factor-ChrR	unknown	unknown	gnl\|CDD\|380435
CP034669.1\|QAT88558.1\|8802679_8803798_-\|hypothetical-protein	unknown	unknown	unknown
CP034669.1\|QAT88559.1\|8804218_8806774_+\|M1-family-peptidase	unknown	unknown	gnl\|CDD\|341064
CP034669.1\|QAT88555.1\|8799311_8800688_-\|Phosphatidylglycerol-lysyltransferase	unknown	unknown	gnl\|CDD\|378310
CP034669.1\|QAT88552.1\|8795806_8796625_-\|cytochrome-c-family-protein	unknown	unknown	gnl\|CDD\|275277
CP034669.1\|QAT88556.1\|8800936_8801827_-\|monofunctional-biosynthetic-peptidoglycan-transglycosylase	unknown	unknown	gnl\|CDD\|376415
CP034669.1\|QAT88543.1\|8785407_8786496_-\|succinyl-diaminopimelate-desuccinylase	unknown	unknown	gnl\|CDD\|237264
CP034669.1\|QAT88557.1\|8801840_8802542_-\|putative-lipoprotein	unknown	unknown	gnl\|CDD\|377495
CP034669.1\|QAT88540.1\|8780052_8781453_-\|cyclic-nucleotide-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|237999

Protein	Function_ID	Function_description	E-value
CP034669.1\|QAT88554.1\|8797779_8799090_-\|cytochrome-c-peroxidase	gnl\|CDD\|224771	COG1858, MauG, Cytochrome c peroxidase [Inorganic ion transport and metabolism].	4.44965e-85
CP034669.1\|QAT88552.1\|8795806_8796625_-\|cytochrome-c-family-protein	gnl\|CDD\|275277	TIGR04484, sulfur_oxidation_protein_SoxA, sulfur oxidation c-type cytochrome SoxA. Members of this family are SoxA, a c-type cytochrome with a CxxCH motif, part of a heterodimer with SoxX. SoxXA, SoxYZ, and SoxB contribute to thiosulfate oxidation to sulfate.	7.20509e-08
CP034669.1\|QAT88541.1\|8781486_8782884_-\|cyclic-nucleotide-binding-domain-containing-protein	gnl\|CDD\|237999	cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor. In all cases binding of the effector leads to conformational changes and the ability to activate transcription. Cyclic nucleotide-binding domain similar to CAP are also present in cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) and vertebrate cyclic nucleotide-gated ion-channels. Cyclic nucleotide-monophosphate binding domain; proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues; the best studied is the prokaryotic catabolite gene activator, CAP, where such a domain is known to be composed of three alpha-helices and a distinctive eight-stranded, antiparallel beta-barrel structure; three conserved glycine residues are thought to be essential for maintenance of the structural integrity of the beta-barrel; CooA is a homodimeric transcription factor that belongs to CAP family; cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) contain two tandem copies of the cyclic nucleotide-binding domain; cAPK's are composed of two different subunits, a catalytic chain and a regulatory chain, which contains both copies of the domain; cGPK's are single chain enzymes that include the two copies of the domain in their N-terminal section; also found in vertebrate cyclic nucleotide-gated ion-channels.	2.4989e-15
CP034669.1\|QAT88545.1\|8787256_8788084_-\|2,3,4,5-tetrahydropyridine-2,6-carboxylate-N-succinyltransferase	gnl\|CDD\|236996	PRK11830, dapD, 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional.	4.18732e-140
CP034669.1\|QAT88556.1\|8800936_8801827_-\|monofunctional-biosynthetic-peptidoglycan-transglycosylase	gnl\|CDD\|376415	pfam00912, Transgly, Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.	2.63245e-69
CP034669.1\|QAT88547.1\|8788645_8790112_+\|decarboxylase,-group-II	gnl\|CDD\|99743	cd06450, DOPA_deC_like, DOPA decarboxylase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to DOPA/tyrosine decarboxylase (DDC), histidine decarboxylase (HDC), and glutamate decarboxylase (GDC). DDC is active as a dimer and catalyzes the decarboxylation of tyrosine. GDC catalyzes the decarboxylation of glutamate and HDC catalyzes the decarboxylation of histidine.	4.28088e-69
CP034669.1\|QAT88542.1\|8782939_8785198_-\|terpene-synthase-metal-binding-domain-containing-protein	gnl\|CDD\|173835	cd00687, Terpene_cyclase_nonplant_C1, Non-plant Terpene Cyclases, Class 1. This CD includes terpenoid cyclases such as pentalenene synthase and aristolochene synthase which, using an all-trans pathway, catalyze the ionization of farnesyl diphosphate, followed by the formation of a macrocyclic intermediate by bond formation between C1 with either C10 (aristolochene synthase) or C11 (pentalenene synthase), resulting in production of tricyclic hydrocarbon pentalenene or bicyclic hydrocarbon aristolochene. As with other enzymes with the 'terpenoid synthase fold', they have two conserved metal binding motifs, proposed to coordinate Mg2+ ion-bridged binding of the diphosphate moiety of FPP to the enzymes. Metal-triggered substrate ionization initiates catalysis, and the alpha-barrel active site serves as a template to channel and stabilize the conformations of reactive carbocation intermediates through a complex cyclization cascade. These enzymes function in the monomeric form and are found in fungi, bacteria and Dictyostelium.	4.33296e-81
CP034669.1\|QAT88548.1\|8790168_8790888_+\|group-2-glycosyl-transferase	gnl\|CDD\|133022	cd04179, DPM_DPG-synthase_like, DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.	5.76476e-56
CP034669.1\|QAT88553.1\|8796648_8797767_-\|metallophosphoesterase	gnl\|CDD\|277347	cd07402, MPP_GpdQ, Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain. GpdQ (glycerophosphodiesterase Q, also known as Rv0805 in Mycobacterium tuberculosis) is a binuclear metallophosphoesterase from Enterobacter aerogenes that catalyzes the hydrolysis of mono-, di-, and triester substrates, including some organophosphate pesticides and products of the degradation of nerve agents. The GpdQ homolog, Rv0805, has 2',3'-cyclic nucleotide phosphodiesterase activity. GpdQ and Rv0805 belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	1.37208e-22
CP034669.1\|QAT88544.1\|8786541_8787174_-\|Anti-sigma-E-factor-ChrR	gnl\|CDD\|380435	cd20301, cupin_ChrR, anti-ECFsigma factor, ChrR , cupin domain. This family contains bacterial anti-sigma factor ChrR from the photosynthetic bacterium Rhodobacter sphaeroides (Rsp) and similar proteins. ChrR is a member of the ZAS (Zn2+ anti-sigma) subfamily of group IV anti-sigmas. It inhibits transcriptional activity by binding to the Rsp extra cytoplasmic function (ECF) sigma factor E (sigmaE), an essential factor to mount a transcriptional response to a singlet oxygen and for viability when carotenoids are limiting. ChrR comprises two structural and functional modules; the N-terminal anti-sigma domain (ASD) binds a Zn(2+) ion, contacts sigma(E), and is sufficient to inhibit sigma(E)-dependent transcription. The ChrR C-terminal domain adopts a cupin fold, can coordinate an additional Zn(2+), and is required for the transcriptional response to singlet oxygen, a potent oxidant that damages cellular biomolecules and can kill cells. Proteins in this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold.	2.69825e-18
CP034669.1\|QAT88559.1\|8804218_8806774_+\|M1-family-peptidase	gnl\|CDD\|341064	cd09601, M1_APN-Q_like, Peptidase M1 aminopeptidase N catalytic domain family which includes aminopeptidase N (APN), aminopeptidase Q (APQ), tricorn interacting factor F3, and endoplasmic reticulum aminopeptidase 1 (ERAP1). This M1 peptidase family includes eukaryotic and bacterial members: the catalytic domains of aminopeptidase N (APN), aminopeptidase Q (APQ, laeverin), endoplasmic reticulum aminopeptidase 1 (ERAP1) as well as tricorn interacting factor F3. Aminopeptidase N (APN; CD13; alanyl aminopeptidase; EC 3.4.11.2), a type II integral membrane protease, preferentially cleaves neutral amino acids from the N-terminus of oligopeptides and is present in a variety of human tissues and cell types (leukocyte, fibroblast, endothelial and epithelial cells). APN expression is dysregulated in inflammatory diseases such as chronic pain, rheumatoid arthritis, multiple sclerosis, systemic sclerosis, systemic lupus erythematosus, polymyositis/dermatomyosytis and pulmonary sarcoidosis, and is enhanced in tumor cells such as melanoma, renal, prostate, pancreas, colon, gastric and thyroid cancers. It is considered a marker of differentiation since it is predominantly expressed on stem cells and on cells of the granulocytic and monocytic lineages at distinct stages of differentiation. Thus, APN inhibition may lead to the development of anti-cancer and anti-inflammatory drugs. ERAP1, also known as endoplasmic reticulum aminopeptidase associated with antigen processing (ERAAP), adipocyte derived leucine aminopeptidase (A-LAP), or aminopeptidase regulating tumor necrosis factor receptor I (THFRI) shedding (ARTS-1), associates with the closely related ER aminopeptidase ERAP2, for the final trimming of peptides within the ER for presentation by MHC class I molecules. ERAP1 is associated with ankylosing spondylitis (AS), an inflammatory arthritis that predominantly affects the spine. ERAP1 also aids in the shedding of membrane-bound cytokine receptors. The tricorn interacting factor F3, together with factors F1 and F2, degrades the tricorn protease products, producing free amino acids, thus completing the proteasomal degradation pathway. F3 is homologous to F2, but not F1, and shows a strong preference for glutamate in the P1' position. APQ, also known as laeverin, is specifically expressed in human embryo-derived extravillous trophoblasts (EVTs) that invade the uterus during early placentation. It cleaves the N-terminal amino acid of various peptides such as angiotensin III, endokinin C, and kisspeptin-10, all expressed in the placenta in large quantities. APN is a receptor for coronaviruses, although the virus receptor interaction site seems to be distinct from the enzymatic site and aminopeptidase activity is not necessary for viral infection. APNs are also putative Cry toxin receptors. Cry1 proteins are pore-forming toxins that bind to the midgut epithelial cell membrane of susceptible insect larvae, causing extensive damage. Several different toxins, including Cry1Aa, Cry1Ab, Cry1Ac, Cry1Ba, Cry1Ca and Cry1Fa, have been shown to bind to APNs; however, a direct role of APN in cytotoxicity has been yet to be firmly established.	0
CP034669.1\|QAT88555.1\|8799311_8800688_-\|Phosphatidylglycerol-lysyltransferase	gnl\|CDD\|378310	pfam09924, DUF2156, Uncharacterized conserved protein (DUF2156). This domain, found in various hypothetical prokaryotic proteins, has no known function.	6.58319e-40
CP034669.1\|QAT88543.1\|8785407_8786496_-\|succinyl-diaminopimelate-desuccinylase	gnl\|CDD\|237264	PRK13007, PRK13007, succinyl-diaminopimelate desuccinylase; Reviewed.	1.34535e-156
CP034669.1\|QAT88557.1\|8801840_8802542_-\|putative-lipoprotein	gnl\|CDD\|377495	pfam05257, CHAP, CHAP domain. This domain corresponds to an amidase function. Many of these proteins are involved in cell wall metabolism of bacteria. This domain is found at the N-terminus of Escherichia coli gss, where it functions as a glutathionylspermidine amidase EC:3.5.1.78. This domain is found to be the catalytic domain of PlyCA. CHAP is the amidase domain of bifunctional Escherichia coli glutathionylspermidine synthetase/amidase, and it catalyzes the hydrolysis of Gsp (glutathionylspermidine) into glutathione and spermidine.	0.00854572
CP034669.1\|QAT88540.1\|8780052_8781453_-\|cyclic-nucleotide-binding-domain-containing-protein	gnl\|CDD\|237999	cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor. In all cases binding of the effector leads to conformational changes and the ability to activate transcription. Cyclic nucleotide-binding domain similar to CAP are also present in cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) and vertebrate cyclic nucleotide-gated ion-channels. Cyclic nucleotide-monophosphate binding domain; proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues; the best studied is the prokaryotic catabolite gene activator, CAP, where such a domain is known to be composed of three alpha-helices and a distinctive eight-stranded, antiparallel beta-barrel structure; three conserved glycine residues are thought to be essential for maintenance of the structural integrity of the beta-barrel; CooA is a homodimeric transcription factor that belongs to CAP family; cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) contain two tandem copies of the cyclic nucleotide-binding domain; cAPK's are composed of two different subunits, a catalytic chain and a regulatory chain, which contains both copies of the domain; cGPK's are single chain enzymes that include the two copies of the domain in their N-terminal section; also found in vertebrate cyclic nucleotide-gated ion-channels.	9.78272e-21

>CP034669.1|QAT88549.1|8791538_8794574_-|hypothetical-protein
MSLAPVTDPSGLLERAPRLAELLPDAALSEALARGDAWAVHAVLSRRLEHEPPGPTRALLAALVEDRGAFVIAARSPSASSVLGTGVRWKGSPPRGAAPNAPFVAERTVTVLGVPVWPLDGYLVREDGKAPLQVIGQVPPSRGRSRRRAVTLAGMALGLCGLAGLGAVWLEARGMRAVTVVNGLSRPVDVRIGGEHWVVAPGTQEQGRVKLGDDLLRAVTTWPGHEPVIEDVWLPTDGERILYNVKGAARLEAVPDDGATYSGPRSRSLPESAMVLQPGERLSVQAANWEAAARAFAEEGRWESAGRVASAVAQVEPGNAPAREMAARALLILDSQAPVNLPDALRWRNTRGYAAMLMHTWQEDPGAQALALSLLRLIGDGDAARARYTEHAQQHPDSPLAALYLQRASPPSLGSAEAVAAYQELAKRFPDSPDVGRAGLDARWRFELGDSRPWSDRERQDFVTETARLLKALEEKHPPDTLEALELDVRILLRAQLRDAATTRVRRYAEDARRRTWDFLVLAGRTAAAAGPEHTSYVMRDWIPPALARQPERMALLDLLTGLRSPKEAELAAVTSPVDRAVLRLTRDVLQDPKRALTQAVREPEAVLSRLDPEVAALLALELTRVGDARAKNLFNASLPVMLAREPLRNHVLSASRASGPELIRLAPGLRAAATLVHARRDAQEGYPLFVERLEGLARVDALGGLAVRAAGPWMRRAFDACMDTKVERSTPRGCSCEAPSWRSRPARRTTGTAAAPTARRASSGLRGCRCPGPPPRHRPETRTAPTPERGPAPSRCSGRGEPQPGWQTWRRMSKDSSALPAPITTADSGSSARNTGRPVSSRSSVSRFLSSAPPPASTMPLSAMSPASSGGVRSSVSFTASTMPLTGSASASRTSSLDTVSVRGTPATRSRPLISMVMTSSVGYAVPMPILMSSAVRSPMSRLYLRLTYWMIASSSLSPPMRTDLANTMPARLMTATSDVPPPMSTIMLPLGSVTGRPAPIAAAMGCSMR
>CP034669.1|QAT88548.1|8790168_8790888_+|group-2-glycosyl-transferase
MLVSLVIPVYNEIPTLAEILRRCIAVDFPKELVLVDDCSKDGSREFLRQLSEQGLDILGGTPRNRNEIRVLFQEKNQGKGAALRRGFAEATGDIILVQDADLEYDPRDIPRVIQPILDGDADVVFGSRFIGSPRRVLYYWHTVLNNLLTMLSNMTSGLNLTDMETCYKAFRAEVLRSVHVEEDRFGFEPEITAKVARGNWRVFEVPISYHGRTYEEGKKIGWKDGVRALYAIGKYALKR
>CP034669.1|QAT88547.1|8788645_8790112_+|decarboxylase,-group-II
MTTPVFPPLRAAYEPEAFRATAHALMDQLADYLKAALAGGAMPVLPWAPPAVNQERFATAFPEEPAPEVSQAFSALMARVLEDSHHLHHPRYVGHQVTAPVPLAALCDAVSSLLNNGMAVYEMGPVATAMEHHVLAWMAAKLGMPSSTRGVLTSGGSAGNLTALLAARQAKAGYDAWNGGAHAGPPLTVLVPRSAHYCLARAVRIMGWGEGGLTPVDVDDHFRVRPDALEDALARATRAGRKAIAVVASAGSTATGAFDPLEPVADFAQAHGLWFHVDGAHGAAASLSPKYRAQVKGIERADSVVWDAHKGLLMPALVTAVLFRDGARSFDAFSQEAHYLFHGDGDDARPYSDVGLRTLECTKEMMPLKVYACLSVLGTRVFEEAVTASYDQARRFAGMLTAAQDFELALEPDCNIVCFRHTPAHVPPEGWDALQVRLREALVSRGGFYLVQTRLPRGVYLRTTLIHPLTGDADLESLLDALRSAARP
>CP034669.1|QAT88546.1|8788148_8788460_-|hypothetical-protein
MAFDDTPSERRSIISGMRVRSADGALLGYVALIGQEHLYVRRSPFVRHRHWKEAPLSAVGRVLQGAVILKEGTGPLSHADPAFHGEIPTQTLPLVLGPEPSHA
>CP034669.1|QAT88545.1|8787256_8788084_-|2,3,4,5-tetrahydropyridine-2,6-carboxylate-N-succinyltransferase
MATSLEELSQRVSAAFADRAKLKDADTVAAVRETLARLDTGELRVAEKGPEGWRVNAWVKEAILLFFAVSEMRVMEVGPFEFYDKVPLKKGLEAAGVRVVPPGTVRYGAFVEKGAVVMPGYVNIGARVGAGTMVDTWATVGSCAQVGRNVHLSGGVGLGGVLEPPTASPVIIEDGAFLGSRSIVVEGVVVEEEAVLGANVVLTASTQIIDVTGPQEVIHKGRVPARSVVIPGMREKQFPAGKYMVPCALIIGQRKASTDQKTSLNAALRDFAVAV
>CP034669.1|QAT88544.1|8786541_8787174_-|Anti-sigma-E-factor-ChrR
MEHLDDILPEWLLGTLEPARRDAAARHLEGCERCRAELARLTPAVDALGALVEPVSPPASVLTRLMERMEGPGRFARWTGKVAAFLDVAEARARELLESMAEPAHWMPGPVEGVELMPVETGPAREGMMAAVVRLQPGARYPRHAHLGREWNLVLEGGFREDSGHEVWPGDELEKTDGSLHDFTALQGPACICVTVLDGVTSFEDLADGA
>CP034669.1|QAT88543.1|8785407_8786496_-|succinyl-diaminopimelate-desuccinylase
MASIELATRLAQTTLELCRIESPIGHEGPIADHVEGWALKHFRREEVFRVGHTLLLGSLEDPRPTVALIGHLDTVPMHPGDVGRAPRIEGERVHGLGASDMKGGVAVMMALAEDLKRDALPVNVAFLLYEREEGAYAESGLIPLYEQRPDLSRVKFGVAMEPTDGVVQVGCVGSMQVTVRFTGKSAHSARPWQGENAIHKAGPLLTELLGRERVEVNVAGFPFYEVISATLAKGGRARNVVPEAFELNLNYRFAPGKSVAQAKEDVLALVAGRAEVEFTDASPSGPVAAGNPLFQRLMSLTGLPAASKQAWTDVARFGEWGVDAVNFGPGETAQAHQLHESAPIPPLAVAYEKLAAFLKGAA
>CP034669.1|QAT88542.1|8782939_8785198_-|terpene-synthase-metal-binding-domain-containing-protein
MSKGKQKQPFQLPEFYVPWPARLNPNLEAARAHTKAWSYQMGILGPPRDGTDREVWSERRFDGMDYALLCAYTHPEAPGPELDLITDWYVWVFYFDDHFLEVFKYSRDVAGGQAYLDRLPLFMPLDMTPPPEPTNPVERALWDLWQRTVPSMSMDWRRRFFENTKHLLDESMWEIENISEARISNPIEYIEMRRKVGGAPWSSDLVEHAVSAEIPDRVVRSRPMRVFKDTFSDAVHLRNDLFSYERELEEGELSNGVLVVEEFLDCDTQRAADLVNDLLTSRLQQFETTFATELPWLFAEYGLNPVEQAQVLTYLRGLQDWQSGGHEWHMRSNRYMNQHSEERPALSIPVPSGLGTSALRIPLTPGGLGLGPRSRSLSHVPRQHVGPTKLPKFYMPYSTYQSPHLDRARKNSKEWARRVGMLEVVPVVGFYVWDDHKFDAADVALCGAYIHPDATPEQLDLTACWLVWGTYADDYFPMLYANTRDMAGAKMFTARLGQFMPDDVEAASAAVPTNPVELGLVDLWKRTAGPLSPRGRKLFRKAIQDMTDSWVWELNNQLLNRVPDPVDYMEMRRKTFGSDLTMSLSRLSKGDAVPEDVFNTRTLRGLENSAADYACFVNDLFSYQKEIQFEGELNNCVLVVQKFLGVDKDTAVLTVNELMTARMKQFQHLVAKELPVVIRTFDLDAKAQEKLNKYVEQLQQWMAGIPRWHAEVTRYTETELIHDAAPKLKAGNVSSLGMSAMRVAELFRAGKS
>CP034669.1|QAT88541.1|8781486_8782884_-|cyclic-nucleotide-binding-domain-containing-protein
MSNDIKKFDDNNQSLGTQAARQLATTTKSEPQMQGISSRWLLKLLPWVQVSGGTFRVNRRMTYAVGDGRVTFTSTGAKVQVIPQELGELPLLRGYEDVEALTALANRFVQKEYKAGEVITEAGKEADSIVLIAHGKVNRIGTGKYGEPLVLETLADGDHYSYQALLESQDYWQFTAKAVTPVIALILQQSAFEAVVAQVPSLQKHIENFKARSKKKQDTSGQKAIELAAGHHGEPVLPGTFVDYETHPREYELAVAQTVLQIHTRVADLFNDPMNQTQQQLRLTVEALKERKEHELINNREFGLLHNADLKQRIHTRSGAPTPDDMDELLATVWKEPSFFLAHPRAIAAFGQECNKRGIYPTSIDMNGNMVPAWRGIPIVSCNKLPISESRTTSIMLMRAGEKNQGVVGLHQAGIPDEIEPSLNVRFMGINEKAIMNYLVTAYFSAAVLTPDALGILESVELGRS
>CP034669.1|QAT88540.1|8780052_8781453_-|cyclic-nucleotide-binding-domain-containing-protein
MTTSQKDVAAHEGTTLSTAGARQLATTTKTQPVMQGISPRYLLNILPWVQVSGGTYRVNRRLTYTVGDDRLNFSNIGVKVEVIPQELLKLPLMRGFEDVDDLLIRTLAGRFTQQQFKPGENIVEAGKPAEHVFLLAHGKAQKLTAGKYGDPVVLDTLADGDHFGDQAVVESNDVWPFTVKAVTACTVMALPQDVFESLITQSPALKAHVERYRAKLKKPQDKAGQAAIALAAGHHGEPVLPGTFVDYELKPREYELSVAQTILRVHTRVSDIFNDPMNQTAEQLRLTIEALKERKEWELINNPEFGLLHNADLKQRINTRSGPPTPDDMDELVSRRRKTRYFLAHPRAIAAFGRECNKRGLYPTVVDVGGAKFQAWRGVPILPCDKLPISRENTTSIIAMRTGQDDQGVVGLHNAGIPDEVEPSLTVKRMAVNDQAMTNYLVSTYYSAAVLVPDALGVLENVALGG
>CP034669.1|QAT88550.1|8795352_8795562_+|hypothetical-protein
MGAFDLVIISVIVALGLGRFLVMRDQRRAPPPEAGPRKPTPQRIAGRVLLGYAYAMALFLLVRFFLGRM
>CP034669.1|QAT88551.1|8795611_8795767_+|hypothetical-protein
MSPALGLYLRRRDVRGPTKGVIHRHRPTLLQITYGLLHPFRVFYIALLQGP
>CP034669.1|QAT88552.1|8795806_8796625_-|cytochrome-c-family-protein
MNLRMKLLVVPCAALSFAGGVALATSPESKPEPLPQHVLPASKDGNLVLGLCDGETSLEVAGVKDGQKLTRAQAITATAQLMDDWRKKNPNANWDDVPGPVLAQASPPATKKSPAPAPQPNPGAKPSGNDVRQGGMGAETGAKAVPQQQKVHLQTGHTYGAYSERDEQVWADSVQAAVKDGHRVFHDADALGGTVGVSCDMCHPDAANTHPETYPKYQVQLGRVALLRDMINWCIENPVRGKPLADGDPKMRAMEAYIYAQRKGVKLEYGKH
>CP034669.1|QAT88553.1|8796648_8797767_-|metallophosphoesterase
MANKFQSIETKHYAERDAFFEGLRKLDRRAFMRVAGISAGIVAGMGKLTPNSFQLVNVAEAQGEKPKFSFAYISDTHLYENKLNDRFVRAILKAVDDVNALDPQPDFVLFGGDLAQLGQAGELKLGAQILKSVKAPIKMMVGEHDWFLDMGELWRDLFGAPNYSFDHKGVHFVVLNSILEKDFWTERKLSPMERMKIVAGLDNGIQSRFEVGAAQRQWLQNDLAKVAKTTPVIVFSHSPLYKYYKPWNFWTDDADEVQAILKPYEKVTVIHGHTHQLLSNRIGNISFHGMLSTAWPWPYAPEGLPSLTVPMNRADPFSQFDGCGDGRMDVLESGLVDKLYNLWQRDPITVRASYLGSGGKQSAPPKPKLPTY
>CP034669.1|QAT88554.1|8797779_8799090_-|cytochrome-c-peroxidase
MRLPSGVVTMLAVVLNSGVGLAASPPSQTANATPPRLPPGVSATLWRLAVPKGSEPTPERVALGEKLFREKRLSVDNTVACMTCHEPELGFTDGKPLSEGVKQQKVTRNSPTVLNALFNATQFWDGRSATLEDQAKLPILNPREMGMPDPDTVMKKVRGIPEYVTDFQKVFGREPNFDDLAVAIAAFERMQFSGDARFDKFIMGDAKALTASEKNGWALFNGKARCNSCHAGNAVSPLFSDQKFHNIGVAAHKQDFVTLARRGVQVVRTGDEKQIDELALNSEFSELGRFLVTKQENDVGSFKTPILRNVGITGPYMHDGSLTTLWDVMDHYNKGGVANPYLDGGMQRLGLTEPEIDDLVAFLFTLTDTKFDKLNKEQLAKQRARKNTRPERDTAIAMGKKGNLGDLAPNPDLKVKNPADLGIYGDVTPVTATKQR
>CP034669.1|QAT88555.1|8799311_8800688_-|Phosphatidylglycerol-lysyltransferase
MAHPHQDPAGDPRERVLALLKQHGWNATSFQVLQPGFEYWFAPEGDGCIAYVDTGGAWVAGGGPIAAQERVHDVVESFHQAARSAGKRVSFFATESRFSKLVPFEELPIGEQPVWDPAKWEAVVKGSRSLREQLRRARSHGVRVREVPAEVMETEGHPLRAAVEVLAEHWLASRRMATMGFLVGLAPGAFARERRAFVAEVEGRVVGFLSVTPVYARDGWFLQDLLREPTAPNGTAETLVDAAMRAAALNGRRYVTLGLAPLAGPVRPWLRFARSAGRPLFDFEGLRSFKAKFRPEAWVTLYLAHPKDEPAPWAIYDALRAFARGSLVKFGLVTLLRRPRLFVRALTALLVPWTVLLALPMSAHWFPSPWVQHGWVVFDVGLIVGLLLLLRRWRDGLATLLGRLTTADACLTLVQALAFNAARARGPWDWSIIIASVLAPATASAMLLRSRDLRVPEP
>CP034669.1|QAT88556.1|8800936_8801827_-|monofunctional-biosynthetic-peptidoglycan-transglycosylase
MSTVEGPSESPSPEPAGSIPPAPPEVQPAPPRKRRWARWVAVGVLVLGVGTAALTFAGLPDADSLAKENPKTTALIEQRAAEAREAGRKPRRRHQWVPLSAVSKPAVDAVLISEDASFYLHDGVDTVELARAVGQAVEKGELGRGASTLTQQLAKNLWLSTDRSLVRKLKELVLAHRLEEALTKQRILTLYLNVVEWGDGVYGIEAGAREHFGVSASRLSVAQGAVLAAMLPSPRKRSPSSGSRALWKHAHHVVDALKTYKRISAAQAEEAHAEVDRLLGRAPADGGGDDAEDDGS
>CP034669.1|QAT88557.1|8801840_8802542_-|putative-lipoprotein
MGRGVWVGALVSALVWGGAAQASNKATATKKARPAVQLADRALWRARSWVGMTTLAKMSSAVSDDCSGMTRLAFQQRRLDLLPDDVLPEENGVTAIHRKARALGMLTETPKPGALVFFKNTFDRNRDGLINDGLTHIGIVERVGTDGTVTFVHKSGGLVKRSRFNLAQPEARKDAKGRILNDWLRRKGKKTRGYLAGELVAGFASVDERWRSPETRLASAKLTVKGDARTARR
>CP034669.1|QAT88558.1|8802679_8803798_-|hypothetical-protein
MGSRLVHVLLVSGVTVLGLLVPWTQAEGWARLLETLLGSAAIWRLSAVEQGVVHRLAELAVFAVAGAMLGNAQSFALRRAGLQVPGWAGHTAMAVAVGLVGSQALAVALGLSPGTAFIGMGLAVGLTQGWLLRREVHGAAVWVAACAVGYGMAGPAADWKDSAWRAAVDVGATWRLSSIVITAQAMTWGALALCTAIGGAFILSSLRTQVLPAPGSRMPGAVGQFAVLGLALPLMVSLEAREMRPSPTEFPAPNPPRLIQPRPARTWGTERPDAPVDVFSPGCVSKGCAPAQAHGGEPSMPRLPPEGNITPYPRPRPAPVLHDEHLRTLFREERKRTPSPGRRWNNPASGAEQLPAGAAGRGEPAGSNLVVP
>CP034669.1|QAT88559.1|8804218_8806774_+|M1-family-peptidase
MAHPTDDKNFRLPTTLRPRRYQATVTLDLEGRTFTGEQRVELELSQPTTEIILHANALELGEVTLRAGNDVRKPASKRVAPVSETVVLTFDAPLPAGSATLDVLWTGHFSDGLRGLYAAGQVAATQFEAADARRLFPCFDEPAFKARWALTVRVPQGHAVLGNGRVVKDEKDGALRKVTFEETELLSSYLIALVVGPLVGTPEEKAEGIPVRTWALPEKAHLAKFGQDAALQVLPRLQDYFGLPYAFGKVDQVGIPDFEAGAMENAGLITYREVALLLDPATAPLSVQKRVAEVVTHELAHQWFGNWVTMVWWDDLWLNEAFATWMAFKIVDQWRPDWRMWLDFDAHRASALALDALKSTHPIHGEVRNAGEAGESFDAITYEKGGAVLRMIEGFLGEGPFREGIRLYMRKHARANAVKEDLWNALGEAAKQPVNELATKWIGQSGFPLVSVKVEGRKVTLSQRRYYSEPEVRSPETWPVPMVLRFEDAGGVREQRVLFRDAETTVTLEGGSGDVKWLCANGGSTGFYRVAYEKPALDALAANLGTLAPSERISLLADMFALVRSAQAPVADLLDLAARFRDEEDEAVLEELVGRLGYIENRLTEGEDQERFRRWVEQLLGGGLKKLGWQAAQGEPDRVRLRRAALVRAVGGLARSPQVLAEARPLVQRMLQGDKSALDANLLDTAVGMVARAGDPALFDDLLQRMPKEPDPATQRRYLMALTAFEDATLAERAQGLLFTETVKTQDVASFATGLLGNRTGRDAWWAHLQKNWKDLVARTGAAPMLLRRVVEGLGLLRTREQLEQMKALLQANPIPEAQQATAQTLERLTQDVALRERVAPEVSAWLKRRP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
CP034669_15	15.2\|4899196\|25\|CP034669\|CRISPRCasFinder	4899196-4899220	25	CP034669.1	4914040-4914064	0	1.0
CP034669_17	17.9\|6076276\|17\|CP034669\|CRISPRCasFinder	6076276-6076292	17	CP034669.1	8761941-8761957	0	1.0
CP034669_29	29.3\|8988540\|18\|CP034669\|CRISPRCasFinder	8988540-8988557	18	CP034669.1	1447742-1447759	0	1.0
CP034669_3	3.5\|1561327\|22\|CP034669\|CRT	1561327-1561348	22	CP034669.1	1560937-1560958	1	0.955
CP034669_8	8.5\|2221845\|18\|CP034669\|CRT	2221845-2221862	18	CP034669.1	165247-165264	1	0.944
CP034669_17	17.2\|6075961\|17\|CP034669\|CRISPRCasFinder	6075961-6075977	17	CP034669.1	9013003-9013019	1	0.941
CP034669_17	17.9\|6076276\|17\|CP034669\|CRISPRCasFinder	6076276-6076292	17	CP034669.1	42501-42517	1	0.941
CP034669_17	17.9\|6076276\|17\|CP034669\|CRISPRCasFinder	6076276-6076292	17	CP034669.1	614236-614252	1	0.941
CP034669_17	17.9\|6076276\|17\|CP034669\|CRISPRCasFinder	6076276-6076292	17	CP034669.1	1166293-1166309	1	0.941
CP034669_17	17.9\|6076276\|17\|CP034669\|CRISPRCasFinder	6076276-6076292	17	CP034669.1	1501859-1501875	1	0.941
CP034669_17	17.9\|6076276\|17\|CP034669\|CRISPRCasFinder	6076276-6076292	17	CP034669.1	1505718-1505734	1	0.941
CP034669_17	17.9\|6076276\|17\|CP034669\|CRISPRCasFinder	6076276-6076292	17	CP034669.1	1798155-1798171	1	0.941
CP034669_17	17.9\|6076276\|17\|CP034669\|CRISPRCasFinder	6076276-6076292	17	CP034669.1	4103519-4103535	1	0.941
CP034669_17	17.9\|6076276\|17\|CP034669\|CRISPRCasFinder	6076276-6076292	17	CP034669.1	5207075-5207091	1	0.941
CP034669_17	17.9\|6076276\|17\|CP034669\|CRISPRCasFinder	6076276-6076292	17	CP034669.1	6220385-6220401	1	0.941
CP034669_17	17.9\|6076276\|17\|CP034669\|CRISPRCasFinder	6076276-6076292	17	CP034669.1	7256921-7256937	1	0.941
CP034669_17	17.9\|6076276\|17\|CP034669\|CRISPRCasFinder	6076276-6076292	17	CP034669.1	8544986-8545002	1	0.941
CP034669_29	29.3\|8988540\|18\|CP034669\|CRISPRCasFinder	8988540-8988557	18	CP034669.1	1447718-1447735	1	0.944
CP034669_29	29.3\|8988540\|18\|CP034669\|CRISPRCasFinder	8988540-8988557	18	CP034669.1	2265123-2265140	1	0.944
CP034669_29	29.3\|8988540\|18\|CP034669\|CRISPRCasFinder	8988540-8988557	18	CP034669.1	2696723-2696740	1	0.944
CP034669_3	3.1\|1561159\|22\|CP034669\|CRT	1561159-1561180	22	CP034669.1	4018898-4018919	2	0.909
CP034669_3	3.1\|1561159\|22\|CP034669\|CRT	1561159-1561180	22	CP034669.1	4473346-4473367	2	0.909
CP034669_3	3.2\|1561201\|22\|CP034669\|CRT	1561201-1561222	22	CP034669.1	4018898-4018919	2	0.909
CP034669_3	3.2\|1561201\|22\|CP034669\|CRT	1561201-1561222	22	CP034669.1	4473346-4473367	2	0.909
CP034669_8	8.7\|2221929\|21\|CP034669\|CRT	2221929-2221949	21	CP034669.1	2221603-2221623	2	0.905
CP034669_18	18.2\|6079808\|21\|CP034669\|CRT	6079808-6079828	21	CP034669.1	7009585-7009605	2	0.905

1. spacer 15.2|4899196|25|CP034669|CRISPRCasFinder matches to position: 4914040-4914064, mismatch: 0, identity: 1.0

aggggaaccccacgacgatgaagcc	CRISPR spacer
aggggaaccccacgacgatgaagcc	Protospacer
*************************

2. spacer 17.9|6076276|17|CP034669|CRISPRCasFinder matches to position: 8761941-8761957, mismatch: 0, identity: 1.0

ccggcagcagcgcctgc	CRISPR spacer
ccggcagcagcgcctgc	Protospacer
*****************

3. spacer 29.3|8988540|18|CP034669|CRISPRCasFinder matches to position: 1447742-1447759, mismatch: 0, identity: 1.0

ggggacggatgcgggcac	CRISPR spacer
ggggacggatgcgggcac	Protospacer
******************

4. spacer 3.5|1561327|22|CP034669|CRT matches to position: 1560937-1560958, mismatch: 1, identity: 0.955

ccgcgcggagcaactgacgcag	CRISPR spacer
ccgcgtggagcaactgacgcag	Protospacer
*****.****************

5. spacer 8.5|2221845|18|CP034669|CRT matches to position: 165247-165264, mismatch: 1, identity: 0.944

cggagcggcggcgcgcgg	CRISPR spacer
cggagcggcggcgggcgg	Protospacer
************* ****

6. spacer 17.2|6075961|17|CP034669|CRISPRCasFinder matches to position: 9013003-9013019, mismatch: 1, identity: 0.941

ccgcccgtggcaccgtc	CRISPR spacer
ccgcccctggcaccgtc	Protospacer
****** **********

7. spacer 17.9|6076276|17|CP034669|CRISPRCasFinder matches to position: 42501-42517, mismatch: 1, identity: 0.941

ccggcagcagcgcctgc	CRISPR spacer
ccggcagcagcgccagc	Protospacer
************** **

8. spacer 17.9|6076276|17|CP034669|CRISPRCasFinder matches to position: 614236-614252, mismatch: 1, identity: 0.941

ccggcagcagcgcctgc	CRISPR spacer
ccgccagcagcgcctgc	Protospacer
*** *************

9. spacer 17.9|6076276|17|CP034669|CRISPRCasFinder matches to position: 1166293-1166309, mismatch: 1, identity: 0.941

ccggcagcagcgcctgc	CRISPR spacer
ccagcagcagcgcctgc	Protospacer
**.**************

10. spacer 17.9|6076276|17|CP034669|CRISPRCasFinder matches to position: 1501859-1501875, mismatch: 1, identity: 0.941

ccggcagcagcgcctgc	CRISPR spacer
ccagcagcagcgcctgc	Protospacer
**.**************

11. spacer 17.9|6076276|17|CP034669|CRISPRCasFinder matches to position: 1505718-1505734, mismatch: 1, identity: 0.941

ccggcagcagcgcctgc	CRISPR spacer
ccgccagcagcgcctgc	Protospacer
*** *************

12. spacer 17.9|6076276|17|CP034669|CRISPRCasFinder matches to position: 1798155-1798171, mismatch: 1, identity: 0.941

ccggcagcagcgcctgc	CRISPR spacer
ccagcagcagcgcctgc	Protospacer
**.**************

13. spacer 17.9|6076276|17|CP034669|CRISPRCasFinder matches to position: 4103519-4103535, mismatch: 1, identity: 0.941

ccggcagcagcgcctgc	CRISPR spacer
cccgcagcagcgcctgc	Protospacer
** **************

14. spacer 17.9|6076276|17|CP034669|CRISPRCasFinder matches to position: 5207075-5207091, mismatch: 1, identity: 0.941

ccggcagcagcgcctgc	CRISPR spacer
ccgccagcagcgcctgc	Protospacer
*** *************

15. spacer 17.9|6076276|17|CP034669|CRISPRCasFinder matches to position: 6220385-6220401, mismatch: 1, identity: 0.941

ccggcagcagcgcctgc	CRISPR spacer
ccgccagcagcgcctgc	Protospacer
*** *************

16. spacer 17.9|6076276|17|CP034669|CRISPRCasFinder matches to position: 7256921-7256937, mismatch: 1, identity: 0.941

ccggcagcagcgcctgc	CRISPR spacer
cccgcagcagcgcctgc	Protospacer
** **************

17. spacer 17.9|6076276|17|CP034669|CRISPRCasFinder matches to position: 8544986-8545002, mismatch: 1, identity: 0.941

ccggcagcagcgcctgc	CRISPR spacer
ccggcagcagagcctgc	Protospacer
********** ******

18. spacer 29.3|8988540|18|CP034669|CRISPRCasFinder matches to position: 1447718-1447735, mismatch: 1, identity: 0.944

ggggacggatgcgggcac	CRISPR spacer
gggcacggatgcgggcac	Protospacer
*** **************

19. spacer 29.3|8988540|18|CP034669|CRISPRCasFinder matches to position: 2265123-2265140, mismatch: 1, identity: 0.944

ggggacggatgcgggcac	CRISPR spacer
gggcacggatgcgggcac	Protospacer
*** **************

20. spacer 29.3|8988540|18|CP034669|CRISPRCasFinder matches to position: 2696723-2696740, mismatch: 1, identity: 0.944

ggggacggatgcgggcac	CRISPR spacer
ggggacggatgcggggac	Protospacer
*************** **

21. spacer 3.1|1561159|22|CP034669|CRT matches to position: 4018898-4018919, mismatch: 2, identity: 0.909

ccgcgcggaacagctcacgcag	CRISPR spacer
ccgcgcggaagcgctcacgcag	Protospacer
**********  **********

22. spacer 3.1|1561159|22|CP034669|CRT matches to position: 4473346-4473367, mismatch: 2, identity: 0.909

ccgcgcggaacagctcacgcag	CRISPR spacer
ccgcgcgcaccagctcacgcag	Protospacer
******* * ************

23. spacer 3.2|1561201|22|CP034669|CRT matches to position: 4018898-4018919, mismatch: 2, identity: 0.909

ccgcgcggaacagctcacgcag	CRISPR spacer
ccgcgcggaagcgctcacgcag	Protospacer
**********  **********

24. spacer 3.2|1561201|22|CP034669|CRT matches to position: 4473346-4473367, mismatch: 2, identity: 0.909

ccgcgcggaacagctcacgcag	CRISPR spacer
ccgcgcgcaccagctcacgcag	Protospacer
******* * ************

25. spacer 8.7|2221929|21|CP034669|CRT matches to position: 2221603-2221623, mismatch: 2, identity: 0.905

ggcggtgccgggcagcgggat	CRISPR spacer
ggcgttgcccggcagcgggat	Protospacer
**** **** ***********

26. spacer 18.2|6079808|21|CP034669|CRT matches to position: 7009585-7009605, mismatch: 2, identity: 0.905

ctgccggaagacgaaccgccc	CRISPR spacer
ctgccggaagccgaacggccc	Protospacer
********** ***** ****

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP034669_3	3.3\|1561243\|22\|CP034669\|CRT	1561243-1561264	22	NZ_CP054841	Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence	213042-213063	1	0.955
CP034669_8	8.7\|2221929\|21\|CP034669\|CRT	2221929-2221949	21	NZ_CP044425	Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence	367071-367091	1	0.952
CP034669_8	8.7\|2221929\|21\|CP034669\|CRT	2221929-2221949	21	NZ_CP026518	Deinococcus sp. NW-56 plasmid unnamed2, complete sequence	115364-115384	1	0.952
CP034669_18	18.2\|6079808\|21\|CP034669\|CRT	6079808-6079828	21	NC_017771	Deinococcus gobiensis I-0 plasmid P3, complete sequence	48052-48072	1	0.952
CP034669_3	3.3\|1561243\|22\|CP034669\|CRT	1561243-1561264	22	NC_010510	Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence	529653-529674	2	0.909
CP034669_3	3.3\|1561243\|22\|CP034669\|CRT	1561243-1561264	22	NC_016972	Streptomyces hygroscopicus subsp. jinggangensis 5008 plasmid pSHJG2, complete sequence	59787-59808	2	0.909
CP034669_3	3.3\|1561243\|22\|CP034669\|CRT	1561243-1561264	22	NZ_CP025513	Neorhizobium sp. SOG26 plasmid unnamed2, complete sequence	741434-741455	2	0.909
CP034669_3	3.3\|1561243\|22\|CP034669\|CRT	1561243-1561264	22	NC_020489	Rhodobacter phage RcapNL, complete genome	25862-25883	2	0.909
CP034669_3	3.3\|1561243\|22\|CP034669\|CRT	1561243-1561264	22	JF974309	Rhodobacter phage RcNL1, * SEQUENCING IN PROGRESS *, 5 unordered pieces	25836-25857	2	0.909
CP034669_3	3.4\|1561285\|22\|CP034669\|CRT	1561285-1561306	22	NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	476753-476774	2	0.909
CP034669_3	3.6\|1561369\|22\|CP034669\|CRT	1561369-1561390	22	NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	476753-476774	2	0.909
CP034669_3	3.8\|1561453\|22\|CP034669\|CRT	1561453-1561474	22	MK524524	Streptomyces phage Caelum, complete genome	14805-14826	2	0.909
CP034669_3	3.8\|1561453\|22\|CP034669\|CRT	1561453-1561474	22	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	133448-133469	2	0.909
CP034669_3	3.8\|1561453\|22\|CP034669\|CRT	1561453-1561474	22	NZ_CP011518	Pandoraea oxalativorans strain DSM 23570 plasmid pPO70-1, complete sequence	408024-408045	2	0.909
CP034669_3	3.8\|1561453\|22\|CP034669\|CRT	1561453-1561474	22	NC_020062	Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence	1442436-1442457	2	0.909
CP034669_3	3.9\|1561495\|22\|CP034669\|CRT	1561495-1561516	22	NZ_CP020952	Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence	652890-652911	2	0.909
CP034669_3	3.9\|1561495\|22\|CP034669\|CRT	1561495-1561516	22	NZ_CP018229	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence	602474-602495	2	0.909
CP034669_3	3.9\|1561495\|22\|CP034669\|CRT	1561495-1561516	22	NZ_CP054028	Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence	808062-808083	2	0.909
CP034669_3	3.9\|1561495\|22\|CP034669\|CRT	1561495-1561516	22	NZ_CP035000	Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence	467458-467479	2	0.909
CP034669_3	3.9\|1561495\|22\|CP034669\|CRT	1561495-1561516	22	NZ_CP050092	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence	464653-464674	2	0.909
CP034669_3	3.9\|1561495\|22\|CP034669\|CRT	1561495-1561516	22	NZ_CP021029	Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence	73775-73796	2	0.909
CP034669_3	3.9\|1561495\|22\|CP034669\|CRT	1561495-1561516	22	NZ_CP016287	Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence	287066-287087	2	0.909
CP034669_3	3.9\|1561495\|22\|CP034669\|CRT	1561495-1561516	22	NZ_CP013600	Rhizobium sp. N741 plasmid pRspN741e, complete sequence	69426-69447	2	0.909
CP034669_3	3.9\|1561495\|22\|CP034669\|CRT	1561495-1561516	22	NZ_CP013504	Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence	69426-69447	2	0.909
CP034669_3	3.9\|1561495\|22\|CP034669\|CRT	1561495-1561516	22	NZ_CP013510	Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence	69426-69447	2	0.909
CP034669_3	3.9\|1561495\|22\|CP034669\|CRT	1561495-1561516	22	NZ_CP013521	Rhizobium sp. N113 plasmid pRspN113d, complete sequence	69426-69447	2	0.909
CP034669_3	3.9\|1561495\|22\|CP034669\|CRT	1561495-1561516	22	NZ_CP013494	Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence	69426-69447	2	0.909
CP034669_3	3.9\|1561495\|22\|CP034669\|CRT	1561495-1561516	22	NZ_CP013515	Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence	73456-73477	2	0.909
CP034669_3	3.9\|1561495\|22\|CP034669\|CRT	1561495-1561516	22	NC_012848	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132501, complete sequence	140845-140866	2	0.909
CP034669_3	3.9\|1561495\|22\|CP034669\|CRT	1561495-1561516	22	NZ_CP013594	Rhizobium sp. N871 plasmid pRspN871d, complete sequence	69426-69447	2	0.909
CP034669_3	3.9\|1561495\|22\|CP034669\|CRT	1561495-1561516	22	NZ_CP013605	Rhizobium sp. N731 plasmid pRspN731d, complete sequence	73450-73471	2	0.909
CP034669_3	3.10\|1561537\|22\|CP034669\|CRT	1561537-1561558	22	NZ_CP049908	Hymenobacter sp. HDW8 plasmid p_unnamed1, complete sequence	38478-38499	2	0.909
CP034669_3	3.10\|1561537\|22\|CP034669\|CRT	1561537-1561558	22	NZ_CP037921	Hymenobacter sp. 17J36-26 plasmid unnamed1, complete sequence	138739-138760	2	0.909
CP034669_21	21.1\|6321660\|24\|CP034669\|CRISPRCasFinder	6321660-6321683	24	NZ_KX443401	Rhodococcus hoagii strain PAM1572 plasmid pVAPN1572, complete sequence	108722-108745	2	0.917
CP034669_21	21.1\|6321660\|24\|CP034669\|CRISPRCasFinder	6321660-6321683	24	NZ_CP023721	Rhodococcus sp. H-CA8f plasmid unnamed, complete sequence	159433-159456	2	0.917
CP034669_21	21.1\|6321660\|24\|CP034669\|CRISPRCasFinder	6321660-6321683	24	NC_011366	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence	197220-197243	2	0.917
CP034669_21	21.1\|6321660\|24\|CP034669\|CRISPRCasFinder	6321660-6321683	24	NZ_KF439868	Rhodococcus hoagii strain PAM1571 plasmid pVAPN1571, complete sequence	113081-113104	2	0.917
CP034669_21	21.1\|6321660\|24\|CP034669\|CRISPRCasFinder	6321660-6321683	24	NC_015721	Bdellovibrio phage phi1402, complete genome	6578-6601	2	0.917
CP034669_21	21.1\|6321660\|24\|CP034669\|CRISPRCasFinder	6321660-6321683	24	JF344709	Bdellovibrio phage phi1402, complete sequence	6578-6601	2	0.917
CP034669_3	3.3\|1561243\|22\|CP034669\|CRT	1561243-1561264	22	NZ_CP006993	Methylobacterium sp. AMS5 plasmid pAMS5a, complete sequence	69722-69743	3	0.864
CP034669_8	8.2\|2221702\|23\|CP034669\|CRT	2221702-2221724	23	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	734522-734544	3	0.87
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	255791-255817	3	0.889
CP034669_21	21.1\|6321660\|24\|CP034669\|CRISPRCasFinder	6321660-6321683	24	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	309853-309876	3	0.875
CP034669_21	21.1\|6321660\|24\|CP034669\|CRISPRCasFinder	6321660-6321683	24	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	119147-119170	3	0.875
CP034669_21	21.1\|6321660\|24\|CP034669\|CRISPRCasFinder	6321660-6321683	24	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	442024-442047	3	0.875
CP034669_21	21.1\|6321660\|24\|CP034669\|CRISPRCasFinder	6321660-6321683	24	NZ_CP022369	Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence	602-625	3	0.875
CP034669_21	21.1\|6321660\|24\|CP034669\|CRISPRCasFinder	6321660-6321683	24	NZ_CP022369	Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence	558509-558532	3	0.875
CP034669_21	21.1\|6321660\|24\|CP034669\|CRISPRCasFinder	6321660-6321683	24	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	353174-353197	3	0.875
CP034669_21	21.1\|6321660\|24\|CP034669\|CRISPRCasFinder	6321660-6321683	24	NZ_CP016289	Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence	3981-4004	3	0.875
CP034669_21	21.1\|6321660\|24\|CP034669\|CRISPRCasFinder	6321660-6321683	24	NZ_KX443399	Rhodococcus hoagii strain PAM1354 plasmid pVAPA1354, complete sequence	113941-113964	3	0.875
CP034669_21	21.1\|6321660\|24\|CP034669\|CRISPRCasFinder	6321660-6321683	24	NZ_KX443400	Rhodococcus hoagii strain PAM1557 plasmid pVAPN1557, complete sequence	113966-113989	3	0.875
CP034669_21	21.1\|6321660\|24\|CP034669\|CRISPRCasFinder	6321660-6321683	24	NZ_KX443398	Rhodococcus hoagii strain PAM1204 plasmid pVAPN1204, complete sequence	113936-113959	3	0.875
CP034669_21	21.1\|6321660\|24\|CP034669\|CRISPRCasFinder	6321660-6321683	24	NZ_KP851975	Rhodococcus hoagii strain PAM2012 plasmid pVAPN2012, complete sequence	114074-114097	3	0.875
CP034669_21	21.1\|6321660\|24\|CP034669\|CRISPRCasFinder	6321660-6321683	24	NZ_CP025014	Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence	388224-388247	3	0.875
CP034669_21	21.1\|6321660\|24\|CP034669\|CRISPRCasFinder	6321660-6321683	24	NZ_CP007796	Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence	234701-234724	3	0.875
CP034669_21	21.1\|6321660\|24\|CP034669\|CRISPRCasFinder	6321660-6321683	24	NZ_CP032342	Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence	74904-74927	3	0.875
CP034669_21	21.1\|6321660\|24\|CP034669\|CRISPRCasFinder	6321660-6321683	24	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	25030-25053	3	0.875
CP034669_21	21.1\|6321660\|24\|CP034669\|CRISPRCasFinder	6321660-6321683	24	NC_013190	Candidatus Accumulibacter phosphatis clade IIA str. UW-1 plasmid pAph02, complete sequence	36594-36617	3	0.875
CP034669_21	21.1\|6321660\|24\|CP034669\|CRISPRCasFinder	6321660-6321683	24	NC_013191	Candidatus Accumulibacter phosphatis clade IIA str. UW-1 plasmid pAph03, complete sequence	6116-6139	3	0.875
CP034669_21	21.1\|6321660\|24\|CP034669\|CRISPRCasFinder	6321660-6321683	24	NZ_CP033315	Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence	87872-87895	3	0.875
CP034669_21	21.1\|6321660\|24\|CP034669\|CRISPRCasFinder	6321660-6321683	24	NZ_CP032349	Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence	581291-581314	3	0.875
CP034669_22	22.3\|6368616\|25\|CP034669\|PILER-CR	6368616-6368640	25	NZ_CP015530	Rhodococcus sp. WB1 plasmid pWB1, complete sequence	216482-216506	3	0.88
CP034669_5	5.1\|1944127\|25\|CP034669\|CRISPRCasFinder	1944127-1944151	25	NZ_CP014802	Salipiger profundus strain JLT2016 plasmid pTPRO6, complete sequence	150704-150728	4	0.84
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MN234172	Mycobacterium phage ThulaThula, complete genome	31369-31395	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP026518	Deinococcus sp. NW-56 plasmid unnamed2, complete sequence	197783-197809	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4430145-4430171	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_008269	Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence	240573-240599	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP021355	Rhodococcus sp. S2-17 plasmid pRB98, complete sequence	45826-45852	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_019958	Mycobacterium sp. JS623 plasmid pMYCSM02, complete sequence	106546-106572	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MN586029	Mycobacterium phage Hannaconda, complete genome	31078-31104	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	KM597530	Mycobacterium phage Bipolar, complete genome	22110-22136	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MK016502	Mycobacterium phage Pat3, complete genome	25608-25634	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	KX610764	Mycobacterium phage Kersh, complete genome	22268-22294	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP040819	Paraoceanicella profunda strain D4M1 plasmid pD4M1A, complete sequence	213227-213253	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	90049-90075	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_020894	Streptomyces hygroscopicus subsp. jinggangensis TL01 plasmid pSHJGH1, complete sequence	30566-30592	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1398990-1399016	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_017766	Streptomyces hygroscopicus subsp. jinggangensis 5008 plasmid pSHJG1, complete sequence	30566-30592	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	1689970-1689996	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	295968-295994	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MH479919	Mycobacterium phage Moose, complete genome	28505-28531	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MG925342	Mycobacterium phage Forsytheast, complete genome	28505-28531	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MK112532	Mycobacterium phage Bones, complete genome	28168-28194	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MN585985	Mycobacterium phage Watermelon, complete genome	29158-29184	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MG925340	Mycobacterium phage Corvo, complete genome	29227-29253	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MF919508	Mycobacterium phage ILeeKay, complete genome	28442-28468	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	EU744251	Mycobacterium phage Jasper, complete genome	28119-28145	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MK524499	Mycobacterium phage Tripl3t, complete genome	29149-29175	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MK305893	Mycobacterium phage Beatrix, complete genome	29710-29736	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MN617845	Mycobacterium phage BaconJack, complete genome	28795-28821	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	JN398369	Mycobacterium phage RidgeCB, complete genome	28073-28099	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MH450133	Mycobacterium phage SwissCheese, complete genome	29005-29031	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MT639644	Mycobacterium phage MaryBeth, complete genome	28433-28459	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	JN660814	Mycobacterium phage Dreamboat, complete genome	28233-28259	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MH669011	Mycobacterium phage PherrisBueller, complete genome	28142-28168	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_023687	Mycobacterium phage Bruns, complete genome	28190-28216	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_023687	Mycobacterium phage Bruns, complete genome	28250-28276	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_023726	Mycobacterium phage Euphoria, complete genome	28266-28292	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_023726	Mycobacterium phage Euphoria, complete genome	28326-28352	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MK310142	Mycobacterium phage MetalQZJ, complete genome	28433-28459	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MK359316	Mycobacterium phage Cueylyss, complete genome	28401-28427	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_031041	Mycobacterium phage Papez, complete genome	29986-30012	4	0.852
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MH513971	Mycobacterium phage Hope4ever, complete genome	28678-28704	4	0.852
CP034669_21	21.1\|6321660\|24\|CP034669\|CRISPRCasFinder	6321660-6321683	24	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	356027-356050	4	0.833
CP034669_22	22.3\|6368616\|25\|CP034669\|PILER-CR	6368616-6368640	25	NZ_AP020327	Mycobacterium avium subsp. hominissuis strain JP-H-1 plasmid p1-JPH1	101462-101486	4	0.84
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	NZ_CP029358	Azospirillum sp. CFH 70021 plasmid unnamed3	82826-82852	4	0.852
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	MF668277	Mycobacterium phage MadamMonkfish, complete genome	26491-26517	4	0.852
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	NC_021305	Mycobacterium phage Murphy, complete genome	27052-27078	4	0.852
CP034669_27	27.5\|8795101\|26\|CP034669\|CRT	8795101-8795126	26	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	390064-390089	4	0.846
CP034669_27	27.5\|8795101\|26\|CP034669\|CRT	8795101-8795126	26	NZ_CP049358	Deinococcus wulumuqiensis R12 plasmid unnamed1, complete sequence	75368-75393	4	0.846
CP034669_27	27.5\|8795101\|26\|CP034669\|CRT	8795101-8795126	26	NZ_CP031159	Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdA, complete sequence	61525-61550	4	0.846
CP034669_27	27.5\|8795101\|26\|CP034669\|CRT	8795101-8795126	26	NZ_CP024895	Amycolatopsis sp. AA4 plasmid unnamed1, complete sequence	40604-40629	4	0.846
CP034669_27	27.5\|8795101\|26\|CP034669\|CRT	8795101-8795126	26	NZ_CP023551	Rhodobacter sp. CZR27 plasmid unnamed3, complete sequence	27400-27425	4	0.846
CP034669_28	28.3\|8916108\|30\|CP034669\|CRT	8916108-8916137	30	NC_008269	Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence	452903-452932	4	0.867
CP034669_28	28.5\|8916192\|30\|CP034669\|CRT	8916192-8916221	30	MK450426	Streptomyces phage Euratis, complete genome	18491-18520	4	0.867
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_019307	Streptomyces sp. W75 plasmid pCQ4, complete sequence	60482-60508	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP035092	Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence	548547-548573	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_008688	Paracoccus denitrificans PD1222 plasmid 1, complete sequence	142080-142106	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP032676	Rhodococcus rhodochrous strain ATCC BAA870 plasmid pNit, complete sequence	336602-336628	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	682810-682836	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	KR053197	Gordonia phage GRU3, complete genome	11358-11384	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_023722	Rhodococcus phage ReqiPine5, complete genome	52719-52745	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_LR134466	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 24, complete sequence	31139-31165	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP028348	Novosphingobium sp. THN1 plasmid pTHN, complete sequence	861858-861884	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP035418	Leisingera sp. NJS204 plasmid unnamed1, complete sequence	132133-132159	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_021295	Burkholderia insecticola plasmid p2, complete sequence	227790-227816	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_LR134468	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 26, complete sequence	2099-2125	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	222319-222345	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP006374	Aureimonas sp. AU20 plasmid pAU20g, complete sequence	22127-22153	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP030074	Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence	213104-213130	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP014310	Burkholderia sp. PAMC 26561 plasmid unnamed3, complete sequence	265600-265626	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP045548	Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence	272540-272566	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_012811	Methylorubrum extorquens AM1 megaplasmid, complete sequence	478198-478224	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP029357	Azospirillum sp. CFH 70021 plasmid unnamed2	190941-190967	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP020385	Rhodovulum sp. MB263 plasmid pRSMBA, complete sequence	63257-63283	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP039644	Azospirillum sp. TSA2s plasmid p2, complete sequence	236311-236337	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_003903	Streptomyces coelicolor A3(2) plasmid SCP1, complete sequence	269572-269598	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MG872843	Mycobacterium phage Sotrice96, complete genome	26846-26872	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MT723943	Mycobacterium phage Cactus, complete genome	26103-26129	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MG872836	Mycobacterium phage Fajezeel, complete genome	28534-28560	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MN585999	Mycobacterium phage Briton15, complete genome	28513-28539	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MT684586	Mycobacterium phage Gandalph, complete genome	24578-24604	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	AF271693	Mycobacterium virus Bxb1, complete genome	28326-28352	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_042326	Mycobacterium virus KSSJEB, complete genome	28019-28045	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MH513978	Mycobacterium phage Phaja, complete genome	27067-27093	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MH399778	Mycobacterium phage Icee, complete genome	26550-26576	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	KT626047	Mycobacterium phage Dynamix, complete genome	28265-28291	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_028828	Mycobacterium phage TheloniousMonk, complete genome	29890-29916	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MH513972	Mycobacterium phage IHOP, complete genome	27067-27093	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	AY500152	Mycobacteriophage U2, complete genome	28368-28394	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	KR080204	Mycobacterium phage Mindy, complete genome	26669-26695	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MH590596	Mycobacterium phage Mantra, complete genome	24578-24604	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	JF937096	Mycobacterium phage Henry, complete genome	26890-26916	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MH669001	Mycobacterium phage EleanorGeorge, complete genome	24656-24682	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MF476925	Klebsiella phage YMC16/01/N133_KPN_BP, complete genome	48863-48889	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_028906	Mycobacterium phage Toto, complete genome	26891-26917	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	KY319168	Mycobacterium phage CrystalP, complete genome	26891-26917	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MT114164	Mycobacterium phage Veteran, complete genome	24485-24511	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MF919526	Mycobacterium phage Phasih, complete genome	25022-25048	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	KP027201	Mycobacterium phage Sbash, complete genome	21606-21632	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_009877	Mycobacterium phage U2, complete genome	28368-28394	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_021301	Mycobacterium phage SiSi, complete genome	24471-24497	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_024136	Mycobacterium phage Seabiscuit, complete genome	28256-28282	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MK310141	Mycobacterium phage Fenn, complete genome	29852-29878	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MK524523	Mycobacterium phage Naira, complete genome	29899-29925	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_028785	Mycobacterium phage NelitzaMV, complete genome	26960-26986	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MN444869	Mycobacterium phage DreamCatcher, complete genome	29587-29613	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MG812495	Mycobacterium phage Pippin, complete genome	28593-28619	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MN585975	Mycobacterium phage Eish, complete genome	24617-24643	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MG812489	Mycobacterium phage Greg, complete genome	28534-28560	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	KR080195	Mycobacterium phage Phayonce, complete genome	22024-22050	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	KR080195	Mycobacterium phage Phayonce, complete genome	45021-45047	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	JN398368	Mycobacterium virus GUmbie, complete genome	24485-24511	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_002656	Mycobacterium phage Bxb1, complete genome	28326-28352	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MH020244	Mycobacterium phage Lopton, complete genome	29641-29667	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	JF937093	Mycobacterium virus DLane, complete genome	24470-24496	5	0.815
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	EU816591	Mycobacterium phage Kostya, complete genome	26890-26916	5	0.815
CP034669_18	18.3\|6079856\|27\|CP034669\|CRT	6079856-6079882	27	NZ_CP015867	Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence	351945-351971	5	0.815
CP034669_20	20.1\|6184104\|28\|CP034669\|CRISPRCasFinder	6184104-6184131	28	NZ_CP020568	Kitasatospora aureofaciens strain DM-1 plasmid unnamed1, complete sequence	243707-243734	5	0.821
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	1606336-1606362	5	0.815
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	1680812-1680838	5	0.815
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	1524550-1524576	5	0.815
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	1596462-1596488	5	0.815
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	1523572-1523598	5	0.815
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	1593051-1593077	5	0.815
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	1593052-1593078	5	0.815
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	1524542-1524568	5	0.815
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	1523900-1523926	5	0.815
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	1524532-1524558	5	0.815
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	1606505-1606531	5	0.815
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	1606488-1606514	5	0.815
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	1606467-1606493	5	0.815
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	NZ_CP028348	Novosphingobium sp. THN1 plasmid pTHN, complete sequence	549493-549519	5	0.815
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	NZ_CP012185	Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence	182267-182293	5	0.815
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	639754-639780	5	0.815
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1173322-1173348	5	0.815
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	NZ_CP012182	Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence	105622-105648	5	0.815
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	454964-454990	5	0.815
CP034669_27	27.5\|8795101\|26\|CP034669\|CRT	8795101-8795126	26	NZ_CP019940	Ketogulonicigenium robustum strain SPU_B003 plasmid unnamed3, complete sequence	1512-1537	5	0.808
CP034669_27	27.5\|8795101\|26\|CP034669\|CRT	8795101-8795126	26	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	341479-341504	5	0.808
CP034669_27	27.5\|8795101\|26\|CP034669\|CRT	8795101-8795126	26	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	716500-716525	5	0.808
CP034669_27	27.5\|8795101\|26\|CP034669\|CRT	8795101-8795126	26	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	1702435-1702460	5	0.808
CP034669_27	27.5\|8795101\|26\|CP034669\|CRT	8795101-8795126	26	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	604985-605010	5	0.808
CP034669_28	28.5\|8916192\|30\|CP034669\|CRT	8916192-8916221	30	MK450421	Streptomyces phage Vash, complete genome	18511-18540	5	0.833
CP034669_28	28.5\|8916192\|30\|CP034669\|CRT	8916192-8916221	30	AJ550940	Bacteriophage phi-BT1 complete genome	19210-19239	5	0.833
CP034669_28	28.5\|8916192\|30\|CP034669\|CRT	8916192-8916221	30	NC_004664	Streptomyces phage phiBT1, complete genome	19210-19239	5	0.833
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP012182	Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence	528070-528096	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_016585	Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence	815717-815743	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP013071	Sphingobium indicum B90A plasmid pSRL1, complete sequence	73387-73413	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP023152	Mycobacterium chimaera strain FLAC0070 plasmid pFLAC0070_1, complete sequence	164463-164489	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP012185	Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence	519327-519353	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_AP018921	Pseudonocardia autotrophica strain NBRC 12743 plasmid pPA12743CP, complete sequence	113786-113812	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	1659165-1659191	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_LR594669	Variovorax sp. SRS16 plasmid 4	278279-278305	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP039697	Novosphingobium sp. ABRDHK2 plasmid pABRDHK22, complete sequence	362507-362533	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_LR134455	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 13, complete sequence	237371-237397	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP007796	Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence	605773-605799	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	AP021850	Deinococcus grandis ATCC 43672 plasmid: pDEGR-1 DNA, complete genome	230983-231009	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_010373	Methylobacterium sp. 4-46 plasmid pM44601, complete sequence	46043-46069	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	1411608-1411634	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_013859	Azospirillum sp. B510 plasmid pAB510e, complete sequence	404419-404445	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	1571429-1571455	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	1571430-1571456	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_AP022320	Burkholderia sp. THE68 plasmid BTHE68_p2, complete sequence	220958-220984	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP022567	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK03, complete sequence	175229-175255	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_LR594673	Variovorax sp. PBL-E5 plasmid 3	257690-257716	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_014213	Meiothermus silvanus DSM 9946 plasmid pMESIL01, complete sequence	273963-273989	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	87897-87923	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_012520	Rhodococcus opacus B4 plasmid pROB01, complete sequence	546623-546649	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP020399	Burkholderia multivorans strain FDAARGOS_246 plasmid unnamed, complete sequence	34389-34415	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP045122	Rubrobacter sp. SCSIO 52915 plasmid unnamed1, complete sequence	125730-125756	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP021917	Sagittula sp. P11 plasmid unnamed4, complete sequence	61627-61653	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_023286	Streptomyces sp. F12 plasmid pFRL6, complete sequence	260442-260468	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP013739	Streptomyces globisporus C-1027 plasmid SGLP1, complete sequence	160120-160146	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_016624	Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence	58875-58901	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_013858	Azospirillum sp. B510 plasmid pAB510d, complete sequence	189906-189932	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP033582	Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence	139419-139445	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_017958	Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence	753577-753603	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP054617	Azospirillum oryzae strain KACC 14407 plasmid unnamed3, complete sequence	66329-66355	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MK962635	Achromobacter phage vB_AxyS_19-32_Axy18, complete genome	35940-35966	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MN694534	Marine virus AFVG_250M1013, complete genome	35117-35143	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_029033	Achromobacter phage phiAxp-1, complete genome	35488-35514	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	KT803877	Burkholderia phage PE067, complete genome	35897-35923	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	KC661275	Mycobacterium phage HINdeR, complete genome	5120-5146	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MK962637	Achromobacter phage vB_AxyS_19-32_Axy20, complete genome	36792-36818	6	0.778
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_048047	Caulobacter phage CcrBL9, complete genome	102801-102827	6	0.778
CP034669_17	17.10\|6076318\|35\|CP034669\|CRISPRCasFinder	6076318-6076352	35	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	463571-463605	6	0.829
CP034669_18	18.3\|6079856\|27\|CP034669\|CRT	6079856-6079882	27	NZ_CP011665	Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence	261230-261256	6	0.778
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	NZ_CP043960	Streptomyces tendae strain 139 plasmid unnamed1, complete sequence	147076-147102	6	0.778
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	MH825706	Streptomyces phage Microdon, complete genome	12645-12671	6	0.778
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	NC_024970	Streptomyces aureofaciens strain CCM3239 plasmid pSA3239, complete sequence	124260-124286	6	0.778
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	NZ_KJ396772	Streptomyces lavendulae subsp. lavendulae strain CCM3239 plasmid pSA3239, complete sequence	124260-124286	6	0.778
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	793173-793199	6	0.778
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	NZ_LR134451	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 9, complete sequence	225123-225149	6	0.778
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	NZ_LR134459	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 17, complete sequence	191605-191631	6	0.778
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	NC_008270	Rhodococcus jostii RHA1 plasmid pRHL2, complete sequence	264424-264450	6	0.778
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	718070-718096	6	0.778
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	793180-793206	6	0.778
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	NZ_CP024986	Streptomyces lavendulae subsp. lavendulae strain CCM 3239 plasmid pSA3239, complete sequence	116791-116817	6	0.778
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	907556-907582	6	0.778
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	598041-598067	6	0.778
CP034669_25	25.7\|7047160\|27\|CP034669\|CRT	7047160-7047186	27	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	809236-809262	6	0.778
CP034669_27	27.4\|8795032\|30\|CP034669\|CRT	8795032-8795061	30	NZ_CP012399	Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence	367982-368011	6	0.8
CP034669_27	27.5\|8795101\|26\|CP034669\|CRT	8795101-8795126	26	NZ_CP024895	Amycolatopsis sp. AA4 plasmid unnamed1, complete sequence	264052-264077	6	0.769
CP034669_27	27.5\|8795101\|26\|CP034669\|CRT	8795101-8795126	26	NZ_CP018064	Rhodococcus sp. 2G plasmid p1, complete sequence	130221-130246	6	0.769
CP034669_28	28.3\|8916108\|30\|CP034669\|CRT	8916108-8916137	30	NC_008269	Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence	453011-453040	6	0.8
CP034669_28	28.3\|8916108\|30\|CP034669\|CRT	8916108-8916137	30	NC_008269	Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence	452930-452959	6	0.8
CP034669_28	28.3\|8916108\|30\|CP034669\|CRT	8916108-8916137	30	NC_008269	Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence	452957-452986	6	0.8
CP034669_28	28.3\|8916108\|30\|CP034669\|CRT	8916108-8916137	30	NC_008269	Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence	452984-453013	6	0.8
CP034669_28	28.5\|8916192\|30\|CP034669\|CRT	8916192-8916221	30	NC_008269	Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence	453011-453040	6	0.8
CP034669_28	28.5\|8916192\|30\|CP034669\|CRT	8916192-8916221	30	NC_008269	Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence	452930-452959	6	0.8
CP034669_28	28.5\|8916192\|30\|CP034669\|CRT	8916192-8916221	30	NC_008269	Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence	452957-452986	6	0.8
CP034669_28	28.5\|8916192\|30\|CP034669\|CRT	8916192-8916221	30	NC_008269	Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence	452984-453013	6	0.8
CP034669_28	28.5\|8916192\|30\|CP034669\|CRT	8916192-8916221	30	MK450431	Streptomyces phage Lilbooboo, complete genome	18711-18740	6	0.8
CP034669_8	8.6\|2221881\|30\|CP034669\|CRT	2221881-2221910	30	MN703409	Arthrobacter phage LittleTokyo, complete genome	2694-2723	7	0.767
CP034669_8	8.14\|2222379\|33\|CP034669\|CRT	2222379-2222411	33	NC_011887	Methylobacterium nodulans ORS 2060 plasmid pMNOD02, complete sequence	347960-347992	7	0.788
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP021355	Rhodococcus sp. S2-17 plasmid pRB98, complete sequence	81185-81211	7	0.741
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_LT703506	Mycobacterium chimaera strain Mycobacterium chimaera MC045 isolate Mycobacterium chimaera plasmid 2	185365-185391	7	0.741
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP015419	Rhodovulum sulfidophilum DSM 1374 plasmid unnamed1, complete sequence	50449-50475	7	0.741
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP015422	Rhodovulum sulfidophilum strain SNK001 plasmid, complete sequence	50349-50375	7	0.741
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_AP014802	Rhodovulum sulfidophilum plasmid Plasmid2 DNA, complete genome, strain: DSM 2351	16137-16163	7	0.741
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP046575	Rhodococcus sp. WAY2 plasmid pRWAY03, complete sequence	94687-94713	7	0.741
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP039651	Azospirillum sp. TSA2s plasmid p1	2595-2621	7	0.741
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	624260-624286	7	0.741
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	246347-246373	7	0.741
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NC_012520	Rhodococcus opacus B4 plasmid pROB01, complete sequence	212088-212114	7	0.741
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP025550	Mycobacterium paragordonae strain 49061 plasmid unnamed4, complete sequence	2978-3004	7	0.741
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MT684597	Mycobacterium phage Mandlovu, complete genome	25124-25150	7	0.741
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MN586004	Mycobacterium phage Strokeseat, complete genome	25181-25207	7	0.741
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MT684601	Mycobacterium phage Hlubikazi, complete genome	25181-25207	7	0.741
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	MT657335	Gordonia phage Mariokart, complete genome	52382-52408	7	0.741
CP034669_18	18.3\|6079856\|27\|CP034669\|CRT	6079856-6079882	27	NZ_CP033582	Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence	424791-424817	7	0.741
CP034669_24	24.1\|6663043\|29\|CP034669\|PILER-CR	6663043-6663071	29	NZ_LR134452	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence	124683-124711	7	0.759
CP034669_24	24.1\|6663043\|29\|CP034669\|PILER-CR	6663043-6663071	29	NZ_CP006371	Aureimonas sp. AU20 plasmid pAU20d, complete sequence	4605-4633	7	0.759
CP034669_24	24.1\|6663043\|29\|CP034669\|PILER-CR	6663043-6663071	29	NZ_CP006372	Aureimonas sp. AU20 plasmid pAU20e, complete sequence	17061-17089	7	0.759
CP034669_24	24.1\|6663043\|29\|CP034669\|PILER-CR	6663043-6663071	29	NZ_CP054620	Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence	341296-341324	7	0.759
CP034669_25	25.5\|7047061\|27\|CP034669\|CRT	7047061-7047087	27	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1274654-1274680	7	0.741
CP034669_27	27.1\|8794819\|32\|CP034669\|CRT	8794819-8794850	32	NC_015951	Streptomyces violaceusniger Tu 4113 plasmid pSTRVI01, complete sequence	12100-12131	7	0.781
CP034669_27	27.4\|8795032\|30\|CP034669\|CRT	8795032-8795061	30	NC_022125	Rhodococcus erythropolis CCM2595 plasmid pRECF1, complete sequence	65193-65222	7	0.767
CP034669_27	27.4\|8795032\|30\|CP034669\|CRT	8795032-8795061	30	NZ_CP015203	Rhodococcus sp. 008 plasmid pR8L1, complete sequence	156848-156877	7	0.767
CP034669_27	27.4\|8795032\|30\|CP034669\|CRT	8795032-8795061	30	NZ_CP044283	Rhodococcus erythropolis strain X5 plasmid pRhX5, complete sequence	17320-17349	7	0.767
CP034669_27	27.4\|8795032\|30\|CP034669\|CRT	8795032-8795061	30	NZ_CP050125	Rhodococcus erythropolis strain KB1 plasmid plas1, complete sequence	16601-16630	7	0.767
CP034669_27	27.4\|8795032\|30\|CP034669\|CRT	8795032-8795061	30	NC_007491	Rhodococcus erythropolis PR4 plasmid pREL1, complete sequence	138679-138708	7	0.767
CP034669_27	27.4\|8795032\|30\|CP034669\|CRT	8795032-8795061	30	NZ_CP017303	Rhodococcus sp. YL-1 plasmid pYLL1 sequence	375785-375814	7	0.767
CP034669_27	27.4\|8795032\|30\|CP034669\|CRT	8795032-8795061	30	NZ_CP017304	Rhodococcus sp. YL-1 plasmid pYLL2 sequence	322195-322224	7	0.767
CP034669_27	27.4\|8795032\|30\|CP034669\|CRT	8795032-8795061	30	NC_005073	Rhodococcus erythropolis linear plasmid pBD2, complete sequence	126662-126691	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	290321-290350	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	295027-295056	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	310733-310762	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	293463-293492	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	354807-354836	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	446887-446916	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	2021302-2021331	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	295589-295618	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	905546-905575	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1284665-1284694	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	294722-294751	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	278424-278453	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	303836-303865	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	291495-291524	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	184417-184446	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	295027-295056	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	290578-290607	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	307534-307563	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	295039-295068	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	295060-295089	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	295026-295055	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	287777-287806	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	291737-291766	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	294739-294768	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	307534-307563	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	309200-309229	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	293505-293534	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	307533-307562	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	286360-286389	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	309200-309229	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	293505-293534	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	307534-307563	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	309200-309229	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	286363-286392	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	309200-309229	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	293505-293534	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	293505-293534	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	293505-293534	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	307534-307563	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	307534-307563	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	286363-286392	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	303819-303848	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	303789-303818	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	298340-298369	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	296469-296498	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	292016-292045	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	307534-307563	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	286363-286392	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	309200-309229	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	356280-356309	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	307528-307557	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	286363-286392	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	286363-286392	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	307534-307563	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	293505-293534	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	307534-307563	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	307534-307563	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	334441-334470	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	1781894-1781923	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	340917-340946	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	1647197-1647226	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	122393-122422	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	18851-18880	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	97005-97034	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	788218-788247	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	1803144-1803173	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	1785198-1785227	7	0.767
CP034669_28	28.2\|8916060\|30\|CP034669\|CRT	8916060-8916089	30	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	1785198-1785227	7	0.767
CP034669_28	28.3\|8916108\|30\|CP034669\|CRT	8916108-8916137	30	NZ_CP018230	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence	191266-191295	7	0.767
CP034669_28	28.3\|8916108\|30\|CP034669\|CRT	8916108-8916137	30	NZ_CP048282	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248d, complete sequence	232821-232850	7	0.767
CP034669_28	28.5\|8916192\|30\|CP034669\|CRT	8916192-8916221	30	NC_008269	Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence	452903-452932	7	0.767
CP034669_30	30.1\|9053557\|28\|CP034669\|CRISPRCasFinder	9053557-9053584	28	NZ_CP013345	Sphingopyxis macrogoltabida strain 203N plasmid unnamed1, complete sequence	386529-386556	7	0.75
CP034669_30	30.1\|9053557\|28\|CP034669\|CRISPRCasFinder	9053557-9053584	28	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4022894-4022921	7	0.75
CP034669_30	30.2\|9053608\|31\|CP034669\|CRISPRCasFinder	9053608-9053638	31	MK284521	Gordonia phage Kiko, complete genome	13022-13052	7	0.774
CP034669_8	8.6\|2221881\|30\|CP034669\|CRT	2221881-2221910	30	NZ_CP032318	Hymenobacter oligotrophus strain sh-6 plasmid unnamed1, complete sequence	17621-17650	8	0.733
CP034669_11	11.1\|2381556\|27\|CP034669\|CRISPRCasFinder	2381556-2381582	27	NZ_CP047899	Pseudarthrobacter sp. YJ56 plasmid unnamed1, complete sequence	4584-4610	8	0.704
CP034669_24	24.1\|6663043\|29\|CP034669\|PILER-CR	6663043-6663071	29	NZ_CP041205	Rhizobium sp. NIBRBAC000502774 plasmid pMK-2, complete sequence	433984-434012	8	0.724
CP034669_24	24.1\|6663043\|29\|CP034669\|PILER-CR	6663043-6663071	29	NZ_CP032349	Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence	243984-244012	8	0.724
CP034669_24	24.1\|6663043\|29\|CP034669\|PILER-CR	6663043-6663071	29	NZ_CP012918	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p4, complete sequence	47228-47256	8	0.724
CP034669_27	27.2\|8794890\|32\|CP034669\|CRT	8794890-8794921	32	NZ_CP028348	Novosphingobium sp. THN1 plasmid pTHN, complete sequence	294180-294211	8	0.75
CP034669_27	27.4\|8795032\|30\|CP034669\|CRT	8795032-8795061	30	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	1750831-1750860	8	0.733
CP034669_27	27.4\|8795032\|30\|CP034669\|CRT	8795032-8795061	30	NZ_CP053445	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eA, complete sequence	35858-35887	8	0.733
CP034669_27	27.4\|8795032\|30\|CP034669\|CRT	8795032-8795061	30	NZ_CP048428	Rhizobium daejeonense strain KACC 13094 plasmid unnamed4, complete sequence	67960-67989	8	0.733
CP034669_28	28.3\|8916108\|30\|CP034669\|CRT	8916108-8916137	30	MK450426	Streptomyces phage Euratis, complete genome	18491-18520	8	0.733
CP034669_28	28.5\|8916192\|30\|CP034669\|CRT	8916192-8916221	30	LN713927	Pseudomonas fluorescens SBW25 plasmid pQBR55, complete sequence	105421-105450	8	0.733
CP034669_30	30.2\|9053608\|31\|CP034669\|CRISPRCasFinder	9053608-9053638	31	NZ_CP018075	Streptomyces venezuelae strain NRRL B-65442 plasmid, complete sequence	35591-35621	8	0.742
CP034669_1	1.1\|31908\|34\|CP034669\|CRISPRCasFinder	31908-31941	34	NZ_CP022371	Bosea sp. AS-1 plasmid unnamed2, complete sequence	36692-36725	9	0.735
CP034669_8	8.14\|2222379\|33\|CP034669\|CRT	2222379-2222411	33	NC_048095	Arthrobacter phage Judy, complete genome	25435-25467	9	0.727
CP034669_13	13.1\|2617117\|34\|CP034669\|CRISPRCasFinder	2617117-2617150	34	NZ_CP009216	Corynebacterium ureicelerivorans strain IMMIB RIV-2301 plasmid unnamed, complete sequence	20140-20173	9	0.735
CP034669_24	24.1\|6663043\|29\|CP034669\|PILER-CR	6663043-6663071	29	NZ_CP016441	Bordetella pseudohinzii strain HI4681 plasmid unnamed1, complete sequence	23339-23367	9	0.69
CP034669_27	27.4\|8795032\|30\|CP034669\|CRT	8795032-8795061	30	NZ_CP016620	Microvirga ossetica strain V5/3m plasmid unnamed4, complete sequence	40003-40032	9	0.7
CP034669_8	8.14\|2222379\|33\|CP034669\|CRT	2222379-2222411	33	NZ_CP030129	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed3, complete sequence	263677-263709	10	0.697
CP034669_8	8.14\|2222379\|33\|CP034669\|CRT	2222379-2222411	33	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	1564946-1564978	10	0.697
CP034669_8	8.14\|2222379\|33\|CP034669\|CRT	2222379-2222411	33	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	482887-482919	10	0.697
CP034669_8	8.14\|2222379\|33\|CP034669\|CRT	2222379-2222411	33	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	380531-380563	10	0.697
CP034669_25	25.4\|7047007\|36\|CP034669\|CRT	7047007-7047042	36	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	158182-158217	10	0.722
CP034669_1	1.3\|32025\|37\|CP034669\|CRISPRCasFinder	32025-32061	37	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	76808-76844	11	0.703
CP034669_1	1.3\|32025\|37\|CP034669\|CRISPRCasFinder	32025-32061	37	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	1378585-1378621	11	0.703

1. spacer 3.3|1561243|22|CP034669|CRT matches to NZ_CP054841 (Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.955

ccgcgcggatcagctcgcgcgg	CRISPR spacer
ccgcgcggatcagctcgcgcag	Protospacer
********************.*

2. spacer 8.7|2221929|21|CP034669|CRT matches to NZ_CP044425 (Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence) position: , mismatch: 1, identity: 0.952

ggcggtgccgggcagcgggat	CRISPR spacer
ggaggtgccgggcagcgggat	Protospacer
** ******************

3. spacer 8.7|2221929|21|CP034669|CRT matches to NZ_CP026518 (Deinococcus sp. NW-56 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

ggcggtgccgggcagcgggat	CRISPR spacer
ggcggtgccgggcagggggat	Protospacer
*************** *****

4. spacer 18.2|6079808|21|CP034669|CRT matches to NC_017771 (Deinococcus gobiensis I-0 plasmid P3, complete sequence) position: , mismatch: 1, identity: 0.952

ctgccggaagacgaaccgccc	CRISPR spacer
ctgccggaagacgatccgccc	Protospacer
************** ******

5. spacer 3.3|1561243|22|CP034669|CRT matches to NC_010510 (Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence) position: , mismatch: 2, identity: 0.909

ccgcgcggatcagctcgcgcgg	CRISPR spacer
tcgcgcggatcagctcgcccgg	Protospacer
.***************** ***

6. spacer 3.3|1561243|22|CP034669|CRT matches to NC_016972 (Streptomyces hygroscopicus subsp. jinggangensis 5008 plasmid pSHJG2, complete sequence) position: , mismatch: 2, identity: 0.909

ccgcgcggatcagctcgcgcgg	CRISPR spacer
ccgcgcggatcatctcgcgcgc	Protospacer
************ ********

7. spacer 3.3|1561243|22|CP034669|CRT matches to NZ_CP025513 (Neorhizobium sp. SOG26 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.909

ccgcgcggatcagctcgcgcgg	CRISPR spacer
cggcgcggatcagctcgcgcgt	Protospacer
* *******************

8. spacer 3.3|1561243|22|CP034669|CRT matches to NC_020489 (Rhodobacter phage RcapNL, complete genome) position: , mismatch: 2, identity: 0.909

ccgcgcggatcagctcgcgcgg	CRISPR spacer
gcgcgcggaacagctcgcgcgg	Protospacer
 ******** ************

9. spacer 3.3|1561243|22|CP034669|CRT matches to JF974309 (Rhodobacter phage RcNL1, *** SEQUENCING IN PROGRESS ***, 5 unordered pieces) position: , mismatch: 2, identity: 0.909

ccgcgcggatcagctcgcgcgg	CRISPR spacer
gcgcgcggaacagctcgcgcgg	Protospacer
 ******** ************

10. spacer 3.4|1561285|22|CP034669|CRT matches to NC_006569 (Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence) position: , mismatch: 2, identity: 0.909

gcgcatcgaagaactcgcccgc	CRISPR spacer
gcgcatcgaagaactcggccga	Protospacer
***************** ***

11. spacer 3.6|1561369|22|CP034669|CRT matches to NC_006569 (Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence) position: , mismatch: 2, identity: 0.909

gcgcatcgaagaactcgcccgc	CRISPR spacer
gcgcatcgaagaactcggccga	Protospacer
***************** ***

12. spacer 3.8|1561453|22|CP034669|CRT matches to MK524524 (Streptomyces phage Caelum, complete genome) position: , mismatch: 2, identity: 0.909

gcgcatcgagcagctcacgcag	CRISPR spacer
gatcatcgagcagctcacgcag	Protospacer
*  *******************

13. spacer 3.8|1561453|22|CP034669|CRT matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 2, identity: 0.909

gcgcatcgagcagctcacgcag	CRISPR spacer
tcgcgtcgagcagctcacgcag	Protospacer
 ***.*****************

14. spacer 3.8|1561453|22|CP034669|CRT matches to NZ_CP011518 (Pandoraea oxalativorans strain DSM 23570 plasmid pPO70-1, complete sequence) position: , mismatch: 2, identity: 0.909

gcgcatcgagcagctcacgcag	CRISPR spacer
gcgcatcgatcagctcacgcat	Protospacer
********* ***********

15. spacer 3.8|1561453|22|CP034669|CRT matches to NC_020062 (Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence) position: , mismatch: 2, identity: 0.909

gcgcatcgagcagctcacgcag	CRISPR spacer
gcgcctcgagcagctcacgcac	Protospacer
**** ****************

16. spacer 3.9|1561495|22|CP034669|CRT matches to NZ_CP020952 (Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence) position: , mismatch: 2, identity: 0.909

ccgcgcggatcagcatgagcat	CRISPR spacer
ccgcgcggatcagcatcagcac	Protospacer
**************** ****.

17. spacer 3.9|1561495|22|CP034669|CRT matches to NZ_CP018229 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.909

ccgcgcggatcagcatgagcat	CRISPR spacer
ccgcgcggatcagcatcagcac	Protospacer
**************** ****.

18. spacer 3.9|1561495|22|CP034669|CRT matches to NZ_CP054028 (Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence) position: , mismatch: 2, identity: 0.909

ccgcgcggatcagcatgagcat	CRISPR spacer
ccgcgcggatcagcatcagcac	Protospacer
**************** ****.

19. spacer 3.9|1561495|22|CP034669|CRT matches to NZ_CP035000 (Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence) position: , mismatch: 2, identity: 0.909

ccgcgcggatcagcatgagcat	CRISPR spacer
ccgcgcggatcagcatcagcac	Protospacer
**************** ****.

20. spacer 3.9|1561495|22|CP034669|CRT matches to NZ_CP050092 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence) position: , mismatch: 2, identity: 0.909

ccgcgcggatcagcatgagcat	CRISPR spacer
ccgcgcggatcagcatcagcac	Protospacer
**************** ****.

21. spacer 3.9|1561495|22|CP034669|CRT matches to NZ_CP021029 (Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence) position: , mismatch: 2, identity: 0.909

ccgcgcggatcagcatgagcat	CRISPR spacer
ccgcgcggatcagcatcagcac	Protospacer
**************** ****.

22. spacer 3.9|1561495|22|CP034669|CRT matches to NZ_CP016287 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.909

ccgcgcggatcagcatgagcat	CRISPR spacer
ccgcgcggatcagcatcagcac	Protospacer
**************** ****.

23. spacer 3.9|1561495|22|CP034669|CRT matches to NZ_CP013600 (Rhizobium sp. N741 plasmid pRspN741e, complete sequence) position: , mismatch: 2, identity: 0.909

ccgcgcggatcagcatgagcat	CRISPR spacer
ccgcgcggatcagcatcagcac	Protospacer
**************** ****.

24. spacer 3.9|1561495|22|CP034669|CRT matches to NZ_CP013504 (Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence) position: , mismatch: 2, identity: 0.909

ccgcgcggatcagcatgagcat	CRISPR spacer
ccgcgcggatcagcatcagcac	Protospacer
**************** ****.

25. spacer 3.9|1561495|22|CP034669|CRT matches to NZ_CP013510 (Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence) position: , mismatch: 2, identity: 0.909

ccgcgcggatcagcatgagcat	CRISPR spacer
ccgcgcggatcagcatcagcac	Protospacer
**************** ****.

26. spacer 3.9|1561495|22|CP034669|CRT matches to NZ_CP013521 (Rhizobium sp. N113 plasmid pRspN113d, complete sequence) position: , mismatch: 2, identity: 0.909

ccgcgcggatcagcatgagcat	CRISPR spacer
ccgcgcggatcagcatcagcac	Protospacer
**************** ****.

27. spacer 3.9|1561495|22|CP034669|CRT matches to NZ_CP013494 (Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence) position: , mismatch: 2, identity: 0.909

ccgcgcggatcagcatgagcat	CRISPR spacer
ccgcgcggatcagcatcagcac	Protospacer
**************** ****.

28. spacer 3.9|1561495|22|CP034669|CRT matches to NZ_CP013515 (Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence) position: , mismatch: 2, identity: 0.909

ccgcgcggatcagcatgagcat	CRISPR spacer
ccgcgcggatcagcatcagcac	Protospacer
**************** ****.

29. spacer 3.9|1561495|22|CP034669|CRT matches to NC_012848 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132501, complete sequence) position: , mismatch: 2, identity: 0.909

ccgcgcggatcagcatgagcat	CRISPR spacer
ccgcgcggatcagcatcagcac	Protospacer
**************** ****.

30. spacer 3.9|1561495|22|CP034669|CRT matches to NZ_CP013594 (Rhizobium sp. N871 plasmid pRspN871d, complete sequence) position: , mismatch: 2, identity: 0.909

ccgcgcggatcagcatgagcat	CRISPR spacer
ccgcgcggatcagcatcagcac	Protospacer
**************** ****.

31. spacer 3.9|1561495|22|CP034669|CRT matches to NZ_CP013605 (Rhizobium sp. N731 plasmid pRspN731d, complete sequence) position: , mismatch: 2, identity: 0.909

ccgcgcggatcagcatgagcat	CRISPR spacer
ccgcgcggatcagcatcagcac	Protospacer
**************** ****.

32. spacer 3.10|1561537|22|CP034669|CRT matches to NZ_CP049908 (Hymenobacter sp. HDW8 plasmid p_unnamed1, complete sequence) position: , mismatch: 2, identity: 0.909

gcgcatcgaggaactcacgcag	CRISPR spacer
ccgcatcgaggaattcacgcag	Protospacer
 ************.********

33. spacer 3.10|1561537|22|CP034669|CRT matches to NZ_CP037921 (Hymenobacter sp. 17J36-26 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.909

gcgcatcgaggaactcacgcag	CRISPR spacer
ccgcatcgaggaattcacgcag	Protospacer
 ************.********

34. spacer 21.1|6321660|24|CP034669|CRISPRCasFinder matches to NZ_KX443401 (Rhodococcus hoagii strain PAM1572 plasmid pVAPN1572, complete sequence) position: , mismatch: 2, identity: 0.917

tccggcgaagcgaaggccggcgaa	CRISPR spacer
tccggcgaagcgaagcccggcgac	Protospacer
*************** *******

35. spacer 21.1|6321660|24|CP034669|CRISPRCasFinder matches to NZ_CP023721 (Rhodococcus sp. H-CA8f plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.917

tccggcgaagcgaaggccggcgaa	CRISPR spacer
tccggcgaagcgaaggccggagac	Protospacer
******************** **

36. spacer 21.1|6321660|24|CP034669|CRISPRCasFinder matches to NC_011366 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence) position: , mismatch: 2, identity: 0.917

tccggcgaagcgaaggccggcgaa	CRISPR spacer
tcgggcgaagcgcaggccggcgaa	Protospacer
** ********* ***********

37. spacer 21.1|6321660|24|CP034669|CRISPRCasFinder matches to NZ_KF439868 (Rhodococcus hoagii strain PAM1571 plasmid pVAPN1571, complete sequence) position: , mismatch: 2, identity: 0.917

tccggcgaagcgaaggccggcgaa	CRISPR spacer
tctggcgaagcgaagcccggcgaa	Protospacer
**.************ ********

38. spacer 21.1|6321660|24|CP034669|CRISPRCasFinder matches to NC_015721 (Bdellovibrio phage phi1402, complete genome) position: , mismatch: 2, identity: 0.917

tccggcgaagcgaaggccggcgaa	CRISPR spacer
tccggcgaagcaaaggccgtcgaa	Protospacer
***********.******* ****

39. spacer 21.1|6321660|24|CP034669|CRISPRCasFinder matches to JF344709 (Bdellovibrio phage phi1402, complete sequence) position: , mismatch: 2, identity: 0.917

tccggcgaagcgaaggccggcgaa	CRISPR spacer
tccggcgaagcaaaggccgtcgaa	Protospacer
***********.******* ****

40. spacer 3.3|1561243|22|CP034669|CRT matches to NZ_CP006993 (Methylobacterium sp. AMS5 plasmid pAMS5a, complete sequence) position: , mismatch: 3, identity: 0.864

ccgcgcggatcagctcgcgcgg	CRISPR spacer
ccgcgcggatcagctcgcggcc	Protospacer
*******************

41. spacer 8.2|2221702|23|CP034669|CRT matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 3, identity: 0.87

gcagcctggcccgggagcgggat	CRISPR spacer
gcagccgggcccgggagcgggcg	Protospacer
****** **************

42. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 3, identity: 0.889

accaccaccgcccgcgccgccgagcat	CRISPR spacer
accgccaccgcccgcgccgccgaggac	Protospacer
***.******************** *.

43. spacer 21.1|6321660|24|CP034669|CRISPRCasFinder matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 3, identity: 0.875

tccggcgaagcgaaggccggcgaa	CRISPR spacer
gccggcgaggcgaaggccggcgat	Protospacer
 *******.**************

44. spacer 21.1|6321660|24|CP034669|CRISPRCasFinder matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 3, identity: 0.875

tccggcgaagcgaaggccggcgaa	CRISPR spacer
gccggcgaggcgaaggccggcgat	Protospacer
 *******.**************

45. spacer 21.1|6321660|24|CP034669|CRISPRCasFinder matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 3, identity: 0.875

tccggcgaagcgaaggccggcgaa	CRISPR spacer
tccggcgaggcgaaggccgccgac	Protospacer
********.********** ***

46. spacer 21.1|6321660|24|CP034669|CRISPRCasFinder matches to NZ_CP022369 (Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence) position: , mismatch: 3, identity: 0.875

tccggcgaagcgaaggccggcgaa	CRISPR spacer
tccggcgaggcgaaggccgccgac	Protospacer
********.********** ***

47. spacer 21.1|6321660|24|CP034669|CRISPRCasFinder matches to NZ_CP022369 (Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence) position: , mismatch: 3, identity: 0.875

tccggcgaagcgaaggccggcgaa	CRISPR spacer
tccggcgaggcgaaggccgccgac	Protospacer
********.********** ***

48. spacer 21.1|6321660|24|CP034669|CRISPRCasFinder matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.875

tccggcgaagcgaaggccggcgaa	CRISPR spacer
gccggcgaagcgctggccggcgaa	Protospacer
 ***********  **********

49. spacer 21.1|6321660|24|CP034669|CRISPRCasFinder matches to NZ_CP016289 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.875

tccggcgaagcgaaggccggcgaa	CRISPR spacer
gccggcggcgcgaaggccggcgaa	Protospacer
 ******. ***************

50. spacer 21.1|6321660|24|CP034669|CRISPRCasFinder matches to NZ_KX443399 (Rhodococcus hoagii strain PAM1354 plasmid pVAPA1354, complete sequence) position: , mismatch: 3, identity: 0.875

tccggcgaagcgaaggccggcgaa	CRISPR spacer
tctggcgaagcgaagcccggcgac	Protospacer
**.************ *******

51. spacer 21.1|6321660|24|CP034669|CRISPRCasFinder matches to NZ_KX443400 (Rhodococcus hoagii strain PAM1557 plasmid pVAPN1557, complete sequence) position: , mismatch: 3, identity: 0.875

tccggcgaagcgaaggccggcgaa	CRISPR spacer
tctggcgaagcgaagcccggcgac	Protospacer
**.************ *******

52. spacer 21.1|6321660|24|CP034669|CRISPRCasFinder matches to NZ_KX443398 (Rhodococcus hoagii strain PAM1204 plasmid pVAPN1204, complete sequence) position: , mismatch: 3, identity: 0.875

tccggcgaagcgaaggccggcgaa	CRISPR spacer
tctggcgaagcgaagcccggcgac	Protospacer
**.************ *******

53. spacer 21.1|6321660|24|CP034669|CRISPRCasFinder matches to NZ_KP851975 (Rhodococcus hoagii strain PAM2012 plasmid pVAPN2012, complete sequence) position: , mismatch: 3, identity: 0.875

tccggcgaagcgaaggccggcgaa	CRISPR spacer
tctggcgaagcgaagcccggcgac	Protospacer
**.************ *******

54. spacer 21.1|6321660|24|CP034669|CRISPRCasFinder matches to NZ_CP025014 (Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence) position: , mismatch: 3, identity: 0.875

tccggcgaagcgaaggccggcgaa	CRISPR spacer
gccggcggcgcgaaggccggcgaa	Protospacer
 ******. ***************

55. spacer 21.1|6321660|24|CP034669|CRISPRCasFinder matches to NZ_CP007796 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence) position: , mismatch: 3, identity: 0.875

tccggcgaagcgaaggccggcgaa	CRISPR spacer
tccggcgaggcgaaggccgccgac	Protospacer
********.********** ***

56. spacer 21.1|6321660|24|CP034669|CRISPRCasFinder matches to NZ_CP032342 (Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence) position: , mismatch: 3, identity: 0.875

tccggcgaagcgaaggccggcgaa	CRISPR spacer
tccggcgaggcgaaggccgccgac	Protospacer
********.********** ***

57. spacer 21.1|6321660|24|CP034669|CRISPRCasFinder matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 3, identity: 0.875

tccggcgaagcgaaggccggcgaa	CRISPR spacer
tccggcgaggcgaaggccgccgac	Protospacer
********.********** ***

58. spacer 21.1|6321660|24|CP034669|CRISPRCasFinder matches to NC_013190 (Candidatus Accumulibacter phosphatis clade IIA str. UW-1 plasmid pAph02, complete sequence) position: , mismatch: 3, identity: 0.875

tccggcgaagcgaaggccggcgaa	CRISPR spacer
gccgccgaggcgaaggccggcgaa	Protospacer
 *** ***.***************

59. spacer 21.1|6321660|24|CP034669|CRISPRCasFinder matches to NC_013191 (Candidatus Accumulibacter phosphatis clade IIA str. UW-1 plasmid pAph03, complete sequence) position: , mismatch: 3, identity: 0.875

tccggcgaagcgaaggccggcgaa	CRISPR spacer
gccgccgaggcgaaggccggcgaa	Protospacer
 *** ***.***************

60. spacer 21.1|6321660|24|CP034669|CRISPRCasFinder matches to NZ_CP033315 (Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence) position: , mismatch: 3, identity: 0.875

tccggcgaagcgaaggccggcgaa	CRISPR spacer
tccggcgaggcgaaggccgccgac	Protospacer
********.********** ***

61. spacer 21.1|6321660|24|CP034669|CRISPRCasFinder matches to NZ_CP032349 (Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence) position: , mismatch: 3, identity: 0.875

tccggcgaagcgaaggccggcgaa	CRISPR spacer
tccggcgaggcgaaggccgccgac	Protospacer
********.********** ***

62. spacer 22.3|6368616|25|CP034669|PILER-CR matches to NZ_CP015530 (Rhodococcus sp. WB1 plasmid pWB1, complete sequence) position: , mismatch: 3, identity: 0.88

cgctgcgcgtcccaccaccacgacg	CRISPR spacer
cgctgcccggcccaccaccacgacc	Protospacer
****** ** **************

63. spacer 5.1|1944127|25|CP034669|CRISPRCasFinder matches to NZ_CP014802 (Salipiger profundus strain JLT2016 plasmid pTPRO6, complete sequence) position: , mismatch: 4, identity: 0.84

gcgtcgcttgcggcccggggccacg	CRISPR spacer
cagccgcttgcggcccgaggccacg	Protospacer
  *.*************.*******

64. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MN234172 (Mycobacterium phage ThulaThula, complete genome) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccgagcat	CRISPR spacer
atcaccaccgcccgcgccgccgaagaa	Protospacer
*.*********************. *

65. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP026518 (Deinococcus sp. NW-56 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccgagcat	CRISPR spacer
cccagcaccgcccgcgccgccgcgcac	Protospacer
 *** ***************** ***.

66. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccga-gcat	CRISPR spacer
gccaccaccgcccccgccgccgacgcg-	Protospacer
.************ ********* **.

67. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_008269 (Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccgagcat	CRISPR spacer
atcaccaccgccctcgacgccgagcag	Protospacer
*.*********** ** *********

68. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP021355 (Rhodococcus sp. S2-17 plasmid pRB98, complete sequence) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccgagcat	CRISPR spacer
atcaccaccgccctcgacgccgagcag	Protospacer
*.*********** ** *********

69. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_019958 (Mycobacterium sp. JS623 plasmid pMYCSM02, complete sequence) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccgagcat	CRISPR spacer
accaccgccgcccgcgccgccgtcctt	Protospacer
******.***************  * *

70. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MN586029 (Mycobacterium phage Hannaconda, complete genome) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccacccgcgcccgcgccgccgagcgt	Protospacer
.*****  *****************.*

71. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to KM597530 (Mycobacterium phage Bipolar, complete genome) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccacccgcgcccgcgccgccgagcgt	Protospacer
.*****  *****************.*

72. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MK016502 (Mycobacterium phage Pat3, complete genome) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccgagcat	CRISPR spacer
accgccgccgcccgcgccgccgagggt	Protospacer
***.**.***************** .*

73. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to KX610764 (Mycobacterium phage Kersh, complete genome) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccacccgcgcccgcgccgccgagcgt	Protospacer
.*****  *****************.*

74. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP040819 (Paraoceanicella profunda strain D4M1 plasmid pD4M1A, complete sequence) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccgagcat-	CRISPR spacer
agcaccaccgcccgcgccgcc-agcgcg	Protospacer
* ******************* ***..

75. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccgagcat-	CRISPR spacer
accaccccggcccgcgccgccga-cacg	Protospacer
****** * ************** **.

76. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_020894 (Streptomyces hygroscopicus subsp. jinggangensis TL01 plasmid pSHJGH1, complete sequence) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccgagcat-	CRISPR spacer
accaccaccgcccgccccgcc-accacc	Protospacer
*************** ***** * **.

77. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccgagcat-	CRISPR spacer
accaccccggcccgcgccgccga-cacg	Protospacer
****** * ************** **.

78. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_017766 (Streptomyces hygroscopicus subsp. jinggangensis 5008 plasmid pSHJG1, complete sequence) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccgagcat-	CRISPR spacer
accaccaccgcccgccccgcc-accacc	Protospacer
*************** ***** * **.

79. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccgagcat-	CRISPR spacer
accaccccggcccgcgccgccga-cacg	Protospacer
****** * ************** **.

80. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccgagcat-	CRISPR spacer
accaccccggcccgcgccgccga-cacg	Protospacer
****** * ************** **.

81. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MH479919 (Mycobacterium phage Moose, complete genome) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccg-agcat	CRISPR spacer
gccaccaccgcccccgccgccgtagcg-	Protospacer
.************ ******** ***.

82. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MG925342 (Mycobacterium phage Forsytheast, complete genome) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccg-agcat	CRISPR spacer
gccaccaccgcccccgccgccgtagcg-	Protospacer
.************ ******** ***.

83. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MK112532 (Mycobacterium phage Bones, complete genome) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccg-agcat	CRISPR spacer
gccaccaccgcccccgccgccgtagcg-	Protospacer
.************ ******** ***.

84. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MN585985 (Mycobacterium phage Watermelon, complete genome) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccg-agcat	CRISPR spacer
gccaccaccgcccccgccgccgtagcg-	Protospacer
.************ ******** ***.

85. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MG925340 (Mycobacterium phage Corvo, complete genome) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccg-agcat	CRISPR spacer
gccaccaccgcccccgccgccgtagcg-	Protospacer
.************ ******** ***.

86. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MF919508 (Mycobacterium phage ILeeKay, complete genome) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccg-agcat	CRISPR spacer
gccaccaccgcccccgccgccgtagcg-	Protospacer
.************ ******** ***.

87. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to EU744251 (Mycobacterium phage Jasper, complete genome) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccg-agcat	CRISPR spacer
gccaccaccgcccccgccgccgtagcg-	Protospacer
.************ ******** ***.

88. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MK524499 (Mycobacterium phage Tripl3t, complete genome) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccg-agcat	CRISPR spacer
gccaccaccgcccccgccgccgtagcg-	Protospacer
.************ ******** ***.

89. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MK305893 (Mycobacterium phage Beatrix, complete genome) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccg-agcat	CRISPR spacer
gccaccaccgcccccgccgccgtagcg-	Protospacer
.************ ******** ***.

90. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MN617845 (Mycobacterium phage BaconJack, complete genome) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccg-agcat	CRISPR spacer
gccaccaccgcccccgccgccgtagcg-	Protospacer
.************ ******** ***.

91. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to JN398369 (Mycobacterium phage RidgeCB, complete genome) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccg-agcat	CRISPR spacer
gccaccaccgcccccgccgccgtagcg-	Protospacer
.************ ******** ***.

92. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MH450133 (Mycobacterium phage SwissCheese, complete genome) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccg-agcat	CRISPR spacer
gccaccaccgcccccgccgccgtagcg-	Protospacer
.************ ******** ***.

93. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MT639644 (Mycobacterium phage MaryBeth, complete genome) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccg-agcat	CRISPR spacer
gccaccaccgcccccgccgccgtagcg-	Protospacer
.************ ******** ***.

94. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to JN660814 (Mycobacterium phage Dreamboat, complete genome) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccg-agcat	CRISPR spacer
gccaccaccgcccccgccgccgtagcg-	Protospacer
.************ ******** ***.

95. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MH669011 (Mycobacterium phage PherrisBueller, complete genome) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccg-agcat	CRISPR spacer
gccaccaccgcccccgccgccgtagcg-	Protospacer
.************ ******** ***.

96. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_023687 (Mycobacterium phage Bruns, complete genome) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccg-agcat	CRISPR spacer
gccaccaccgcccccgccgccgtagcg-	Protospacer
.************ ******** ***.

97. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_023687 (Mycobacterium phage Bruns, complete genome) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccg-agcat	CRISPR spacer
gccaccaccgcccccgccgccgtagcg-	Protospacer
.************ ******** ***.

98. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_023726 (Mycobacterium phage Euphoria, complete genome) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccg-agcat	CRISPR spacer
gccaccaccgcccccgccgccgtagcg-	Protospacer
.************ ******** ***.

99. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_023726 (Mycobacterium phage Euphoria, complete genome) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccg-agcat	CRISPR spacer
gccaccaccgcccccgccgccgtagcg-	Protospacer
.************ ******** ***.

100. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MK310142 (Mycobacterium phage MetalQZJ, complete genome) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccg-agcat	CRISPR spacer
gccaccaccgcccccgccgccgtagcg-	Protospacer
.************ ******** ***.

101. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MK359316 (Mycobacterium phage Cueylyss, complete genome) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccg-agcat	CRISPR spacer
gccaccaccgcccccgccgccgtagcg-	Protospacer
.************ ******** ***.

102. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_031041 (Mycobacterium phage Papez, complete genome) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccg-agcat	CRISPR spacer
gccaccaccgcccccgccgccgtagcg-	Protospacer
.************ ******** ***.

103. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MH513971 (Mycobacterium phage Hope4ever, complete genome) position: , mismatch: 4, identity: 0.852

accaccaccgcccgcgccgccg-agcat	CRISPR spacer
gccaccaccgcccccgccgccgtagcg-	Protospacer
.************ ******** ***.

104. spacer 21.1|6321660|24|CP034669|CRISPRCasFinder matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 4, identity: 0.833

tccggcgaagcgaaggccggcgaa	CRISPR spacer
gccggcgaagcgcaggccggcggc	Protospacer
 *********** *********.

105. spacer 22.3|6368616|25|CP034669|PILER-CR matches to NZ_AP020327 (Mycobacterium avium subsp. hominissuis strain JP-H-1 plasmid p1-JPH1) position: , mismatch: 4, identity: 0.84

cgctgcgcgtcccaccaccacgacg	CRISPR spacer
gtctgcgcttcccaccaccaggacg	Protospacer
  ****** *********** ****

106. spacer 25.7|7047160|27|CP034669|CRT matches to NZ_CP029358 (Azospirillum sp. CFH 70021 plasmid unnamed3) position: , mismatch: 4, identity: 0.852

cccccgtcggccccgccgc---gcccgtgt	CRISPR spacer
cccccgtcggccccgccgccggtcccg---	Protospacer
*******************    ****

107. spacer 25.7|7047160|27|CP034669|CRT matches to MF668277 (Mycobacterium phage MadamMonkfish, complete genome) position: , mismatch: 4, identity: 0.852

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
ccaccgtcggcgccgccgcgcccatct	Protospacer
** ******** ***********.* *

108. spacer 25.7|7047160|27|CP034669|CRT matches to NC_021305 (Mycobacterium phage Murphy, complete genome) position: , mismatch: 4, identity: 0.852

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
ccaccgtcggcgccgccgcgcccatct	Protospacer
** ******** ***********.* *

109. spacer 27.5|8795101|26|CP034669|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 4, identity: 0.846

ggccgccgcgaccgagacctccgccc	CRISPR spacer
cgccgccgcgacggaggcctccgcca	Protospacer
 *********** ***.********

110. spacer 27.5|8795101|26|CP034669|CRT matches to NZ_CP049358 (Deinococcus wulumuqiensis R12 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.846

ggccgccgcgaccgagacctccgccc	CRISPR spacer
cgccgccgcgaccgaggcgtccgccg	Protospacer
 ***************.* ******

111. spacer 27.5|8795101|26|CP034669|CRT matches to NZ_CP031159 (Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdA, complete sequence) position: , mismatch: 4, identity: 0.846

ggccgccgcgaccgagacctccgccc	CRISPR spacer
cgccgccgcgaccgaggcgtccgccg	Protospacer
 ***************.* ******

112. spacer 27.5|8795101|26|CP034669|CRT matches to NZ_CP024895 (Amycolatopsis sp. AA4 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.846

ggccgccgcgaccgagacctccgccc	CRISPR spacer
ggccgccggtaccgagacctccgggc	Protospacer
********  *************  *

113. spacer 27.5|8795101|26|CP034669|CRT matches to NZ_CP023551 (Rhodobacter sp. CZR27 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.846

ggccgccgcgaccgagacctccgccc	CRISPR spacer
cggcgccgcggccgagatctccgccc	Protospacer
 * *******.******.********

114. spacer 28.3|8916108|30|CP034669|CRT matches to NC_008269 (Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence) position: , mismatch: 4, identity: 0.867

ccttcgcagcgcccttcttcgcggtggcac--	CRISPR spacer
ccttcgcagcggccttcttcgc--cggcacct	Protospacer
*********** **********  .*****

115. spacer 28.5|8916192|30|CP034669|CRT matches to MK450426 (Streptomyces phage Euratis, complete genome) position: , mismatch: 4, identity: 0.867

ccttcgcagcggacttcttcgcggt-ggcgc	CRISPR spacer
tcttcgcagcggtcttcttcgcggcaggcg-	Protospacer
.*********** ***********. ****

116. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_019307 (Streptomyces sp. W75 plasmid pCQ4, complete sequence) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gcctccaccgcccgcgccgccgaggcc	Protospacer
.** ********************  .

117. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP035092 (Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccgccaccgcccgcgccgccgcgctg	Protospacer
.**.****************** **

118. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_008688 (Paracoccus denitrificans PD1222 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccgccaccgcccgcgccgccgcgctg	Protospacer
.**.****************** **

119. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP032676 (Rhodococcus rhodochrous strain ATCC BAA870 plasmid pNit, complete sequence) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
acccccaccgcccgcgccgccggcctg	Protospacer
*** ******************. *

120. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccaccgccgcccgagccgccgagccc	Protospacer
.*****.******* ********** .

121. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to KR053197 (Gordonia phage GRU3, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gtcacgatcgcccgcgccgccgagcaa	Protospacer
..*** *.******************

122. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_023722 (Rhodococcus phage ReqiPine5, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
accgccaccgcccgcgccgccgtcaag	Protospacer
***.******************   *

123. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_LR134466 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 24, complete sequence) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccaccgccgcccgcgccgccgcgcgc	Protospacer
.*****.*************** **..

124. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP028348 (Novosphingobium sp. THN1 plasmid pTHN, complete sequence) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
cgcaccaccgcccgcgccatcgagcag	Protospacer
  ****************..******

125. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP035418 (Leisingera sp. NJS204 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
agcaccaccgactgcgccgccgagccg	Protospacer
* ******** *.************

126. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_021295 (Burkholderia insecticola plasmid p2, complete sequence) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
atcaccaccgcccgccgcgccgagcgc	Protospacer
*.*************  ********..

127. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_LR134468 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 26, complete sequence) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
ggctccaccgccctcgccgccgagcgt	Protospacer
. * ********* ***********.*

128. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
agcaccaccgactgcgccgccgagccg	Protospacer
* ******** *.************

129. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP006374 (Aureimonas sp. AU20 plasmid pAU20g, complete sequence) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
accgccaccgctcgcgccgccgatcgc	Protospacer
***.*******.*********** *..

130. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP030074 (Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat-	CRISPR spacer
gccaccaccgcccgcgccg-cggtcacg	Protospacer
.****************** **. **.

131. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP014310 (Burkholderia sp. PAMC 26561 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
tgcgccagcggccgcgccgccgagcat	Protospacer
  *.*** ** ****************

132. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP045548 (Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccgccaccgcccccgccgccgaggtt	Protospacer
.**.********* **********  *

133. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_012811 (Methylorubrum extorquens AM1 megaplasmid, complete sequence) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
cccgccaccgcccccgccgccgaggac	Protospacer
 **.********* ********** *.

134. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP029357 (Azospirillum sp. CFH 70021 plasmid unnamed2) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
atcacctccacccgcgccgccgagccg	Protospacer
*.**** **.***************

135. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP020385 (Rhodovulum sp. MB263 plasmid pRSMBA, complete sequence) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccg-agcat	CRISPR spacer
gccgccaccgcccgcgccgccgtcgcg-	Protospacer
.**.******************  **.

136. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP039644 (Azospirillum sp. TSA2s plasmid p2, complete sequence) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccgccaccgcccgcgccgccgtggac	Protospacer
.**.****************** * *.

137. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_003903 (Streptomyces coelicolor A3(2) plasmid SCP1, complete sequence) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
accaccaccgcccgcgccggctacgag	Protospacer
******************* * *  *

138. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MG872843 (Mycobacterium phage Sotrice96, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccgccgccgcccgcgccgccgagggt	Protospacer
.**.**.***************** .*

139. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MT723943 (Mycobacterium phage Cactus, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccgccgccgcccgcgccgccgagggt	Protospacer
.**.**.***************** .*

140. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MG872836 (Mycobacterium phage Fajezeel, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccacctccgcccgcaccgccgagggt	Protospacer
.***** ********.******** .*

141. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MN585999 (Mycobacterium phage Briton15, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccaccgccgcccgcaccgccgagtgt	Protospacer
.*****.********.********..*

142. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MT684586 (Mycobacterium phage Gandalph, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccaccgccgcccgcgccgccaagggt	Protospacer
.*****.**************.** .*

143. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to AF271693 (Mycobacterium virus Bxb1, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccaccgccgcccgcaccgccgagggt	Protospacer
.*****.********.******** .*

144. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_042326 (Mycobacterium virus KSSJEB, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccaccgccgcccgcaccgccgagtgt	Protospacer
.*****.********.********..*

145. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MH513978 (Mycobacterium phage Phaja, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccgccgccgcccgcgccgccgagggt	Protospacer
.**.**.***************** .*

146. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MH399778 (Mycobacterium phage Icee, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccgccgccgcccgcgccgccgagggt	Protospacer
.**.**.***************** .*

147. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to KT626047 (Mycobacterium phage Dynamix, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccaccgccgcccgcaccgccgagggt	Protospacer
.*****.********.******** .*

148. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_028828 (Mycobacterium phage TheloniousMonk, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccacctccgcccgcaccgccgagggt	Protospacer
.***** ********.******** .*

149. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MH513972 (Mycobacterium phage IHOP, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccgccgccgcccgcgccgccgagggt	Protospacer
.**.**.***************** .*

150. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to AY500152 (Mycobacteriophage U2, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccaccgccgcccgcaccgccgagggt	Protospacer
.*****.********.******** .*

151. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to KR080204 (Mycobacterium phage Mindy, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccgccgccgcccgcgccgccgagggt	Protospacer
.**.**.***************** .*

152. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MH590596 (Mycobacterium phage Mantra, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccaccgccgcccgcgccgccaagggt	Protospacer
.*****.**************.** .*

153. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to JF937096 (Mycobacterium phage Henry, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccgccgccgcccgcgccgccgagggt	Protospacer
.**.**.***************** .*

154. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MH669001 (Mycobacterium phage EleanorGeorge, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gcgaccaccgcccccgccgccgaccag	Protospacer
.* ********** ********* **

155. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MF476925 (Klebsiella phage YMC16/01/N133_KPN_BP, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
accaccagcgcccccgccgccgatagt	Protospacer
******* ***** *********  .*

156. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_028906 (Mycobacterium phage Toto, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccgccgccgcccgcgccgccgagggt	Protospacer
.**.**.***************** .*

157. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to KY319168 (Mycobacterium phage CrystalP, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccgccgccgcccgcgccgccgagggt	Protospacer
.**.**.***************** .*

158. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MT114164 (Mycobacterium phage Veteran, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccaccgccgcccgcgccgccaagggt	Protospacer
.*****.**************.** .*

159. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MF919526 (Mycobacterium phage Phasih, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccaccgccgcccgcgccgccaagggt	Protospacer
.*****.**************.** .*

160. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to KP027201 (Mycobacterium phage Sbash, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gcgaccaccgccaccgccgccgagcag	Protospacer
.* *********  ************

161. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_009877 (Mycobacterium phage U2, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccaccgccgcccgcaccgccgagggt	Protospacer
.*****.********.******** .*

162. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_021301 (Mycobacterium phage SiSi, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccaccgccgcccgcgccgccaagggt	Protospacer
.*****.**************.** .*

163. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_024136 (Mycobacterium phage Seabiscuit, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccaccgccgcccgcaccgccgagtgt	Protospacer
.*****.********.********..*

164. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MK310141 (Mycobacterium phage Fenn, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccaccgccgcccgcaccgccgagtgt	Protospacer
.*****.********.********..*

165. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MK524523 (Mycobacterium phage Naira, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccaccgccgcccgcaccgccgagtgt	Protospacer
.*****.********.********..*

166. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_028785 (Mycobacterium phage NelitzaMV, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccgccgccgcccgcgccgccgagggt	Protospacer
.**.**.***************** .*

167. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MN444869 (Mycobacterium phage DreamCatcher, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccaccgccgcccgcaccgccgagtgt	Protospacer
.*****.********.********..*

168. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MG812495 (Mycobacterium phage Pippin, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccacctccgcccgcaccgccgagggt	Protospacer
.***** ********.******** .*

169. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MN585975 (Mycobacterium phage Eish, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccaccgccgcccgcgccgccaagggt	Protospacer
.*****.**************.** .*

170. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MG812489 (Mycobacterium phage Greg, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccacctccgcccgcaccgccgagggt	Protospacer
.***** ********.******** .*

171. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to KR080195 (Mycobacterium phage Phayonce, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gcgaccaccgccaccgccgccgagcag	Protospacer
.* *********  ************

172. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to KR080195 (Mycobacterium phage Phayonce, complete genome) position: , mismatch: 5, identity: 0.815

accac-caccgcccgcgccgccgagcat	CRISPR spacer
-cggcgcaccgcccgcgccgccgcgcag	Protospacer
 * .* ***************** ***

173. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to JN398368 (Mycobacterium virus GUmbie, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccaccgccgcccgcgccgccaagggt	Protospacer
.*****.**************.** .*

174. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_002656 (Mycobacterium phage Bxb1, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccaccgccgcccgcaccgccgagggt	Protospacer
.*****.********.******** .*

175. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MH020244 (Mycobacterium phage Lopton, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccaccgccgcccgcaccgccgagtgt	Protospacer
.*****.********.********..*

176. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to JF937093 (Mycobacterium virus DLane, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccaccgccgcccgcgccgccaagggt	Protospacer
.*****.**************.** .*

177. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to EU816591 (Mycobacterium phage Kostya, complete genome) position: , mismatch: 5, identity: 0.815

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccgccgccgcccgcgccgccgagggt	Protospacer
.**.**.***************** .*

178. spacer 18.3|6079856|27|CP034669|CRT matches to NZ_CP015867 (Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence) position: , mismatch: 5, identity: 0.815

acctccctctccgaggacgaggagcgg	CRISPR spacer
gcacccctcgccgaggtcgaggagcgg	Protospacer
.* .***** ****** **********

179. spacer 20.1|6184104|28|CP034669|CRISPRCasFinder matches to NZ_CP020568 (Kitasatospora aureofaciens strain DM-1 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

ggttttggagttcctggaccggcggggt	CRISPR spacer
ggcgctggagttcctggacctgcggggc	Protospacer
**. .*************** ******.

180. spacer 25.7|7047160|27|CP034669|CRT matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
cggccgtcggcgccgccgcgcccgtca	Protospacer
*  ******** *************

181. spacer 25.7|7047160|27|CP034669|CRT matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 5, identity: 0.815

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
cggccgtcggcgccgccgcgcccgtca	Protospacer
*  ******** *************

182. spacer 25.7|7047160|27|CP034669|CRT matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
cggccgtcggcgccgccgcgcccgtca	Protospacer
*  ******** *************

183. spacer 25.7|7047160|27|CP034669|CRT matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
cggccgtcggcgccgccgcgcccgtca	Protospacer
*  ******** *************

184. spacer 25.7|7047160|27|CP034669|CRT matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
cggccgtcggcgccgccgcgcccgtca	Protospacer
*  ******** *************

185. spacer 25.7|7047160|27|CP034669|CRT matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
cggccgtcggcgccgccgcgcccgtca	Protospacer
*  ******** *************

186. spacer 25.7|7047160|27|CP034669|CRT matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
cggccgtcggcgccgccgcgcccgtca	Protospacer
*  ******** *************

187. spacer 25.7|7047160|27|CP034669|CRT matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
cggccgtcggcgccgccgcgcccgtca	Protospacer
*  ******** *************

188. spacer 25.7|7047160|27|CP034669|CRT matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
cggccgtcggcgccgccgcgcccgtca	Protospacer
*  ******** *************

189. spacer 25.7|7047160|27|CP034669|CRT matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
cggccgtcggcgccgccgcgcccgtca	Protospacer
*  ******** *************

190. spacer 25.7|7047160|27|CP034669|CRT matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
cggccgtcggcgccgccgcgcccgtca	Protospacer
*  ******** *************

191. spacer 25.7|7047160|27|CP034669|CRT matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
cggccgtcggcgccgccgcgcccgtca	Protospacer
*  ******** *************

192. spacer 25.7|7047160|27|CP034669|CRT matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
cggccgtcggcgccgccgcgcccgtca	Protospacer
*  ******** *************

193. spacer 25.7|7047160|27|CP034669|CRT matches to NZ_CP028348 (Novosphingobium sp. THN1 plasmid pTHN, complete sequence) position: , mismatch: 5, identity: 0.815

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
tcatcgtcggcaccgccgcgcccttgt	Protospacer
.* .******* *********** ***

194. spacer 25.7|7047160|27|CP034669|CRT matches to NZ_CP012185 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence) position: , mismatch: 5, identity: 0.815

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
gccccgtcggccccgccgtgccggcgg	Protospacer
 *****************.*** *.*

195. spacer 25.7|7047160|27|CP034669|CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 5, identity: 0.815

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
accccgtcggccgtgccgcgcccggct	Protospacer
 *********** .**********  *

196. spacer 25.7|7047160|27|CP034669|CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 5, identity: 0.815

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
accccgtcggccgtgccgcgcccggct	Protospacer
 *********** .**********  *

197. spacer 25.7|7047160|27|CP034669|CRT matches to NZ_CP012182 (Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence) position: , mismatch: 5, identity: 0.815

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
gccccgtcggccccgccgtgccggcgg	Protospacer
 *****************.*** *.*

198. spacer 25.7|7047160|27|CP034669|CRT matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 5, identity: 0.815

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
cccccgcccgccccgccgcgcccacga	Protospacer
******.* **************..*

199. spacer 27.5|8795101|26|CP034669|CRT matches to NZ_CP019940 (Ketogulonicigenium robustum strain SPU_B003 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.808

ggccgccgcgaccgagacctccgccc	CRISPR spacer
ggccgccgcgaccgaggccgccggaa	Protospacer
****************.** ***

200. spacer 27.5|8795101|26|CP034669|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.808

ggccgccgcgaccgagacctccgccc	CRISPR spacer
ttcggccgcgaccgagacctccgact	Protospacer
  * ******************* *.

201. spacer 27.5|8795101|26|CP034669|CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 5, identity: 0.808

ggccgccgcgaccgagacctccgccc	CRISPR spacer
cgccgccgcgacccaggcctccgcgg	Protospacer
 ************ **.*******

202. spacer 27.5|8795101|26|CP034669|CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 5, identity: 0.808

ggccgccgcgaccgagacctccgccc	CRISPR spacer
caacgtcgcgaccgagccctccgccc	Protospacer
 . **.********** *********

203. spacer 27.5|8795101|26|CP034669|CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 5, identity: 0.808

ggccgccgcgaccgagacctccgccc	CRISPR spacer
cagcgccccggccgagacctccgccc	Protospacer
 . **** **.***************

204. spacer 28.5|8916192|30|CP034669|CRT matches to MK450421 (Streptomyces phage Vash, complete genome) position: , mismatch: 5, identity: 0.833

ccttcgcagcggacttcttcgcggtggcgc	CRISPR spacer
tcttcgcagcggtcttcttcgcggcggcag	Protospacer
.*********** ***********.***.

205. spacer 28.5|8916192|30|CP034669|CRT matches to AJ550940 (Bacteriophage phi-BT1 complete genome) position: , mismatch: 5, identity: 0.833

ccttcgcagcggacttcttcgcggtggcgc	CRISPR spacer
tcttcgcagcggtcttcttcgccgtgttgc	Protospacer
.*********** ********* *** .**

206. spacer 28.5|8916192|30|CP034669|CRT matches to NC_004664 (Streptomyces phage phiBT1, complete genome) position: , mismatch: 5, identity: 0.833

ccttcgcagcggacttcttcgcggtggcgc	CRISPR spacer
tcttcgcagcggtcttcttcgccgtgttgc	Protospacer
.*********** ********* *** .**

207. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP012182 (Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gtcgccaccgcccgcgccgccgaggca	Protospacer
..*.********************

208. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_016585 (Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
accaccaccgccagcgccgccgccagc	Protospacer
************ *********   ..

209. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP013071 (Sphingobium indicum B90A plasmid pSRL1, complete sequence) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
tatgccgccgcccgcgccgccgagcag	Protospacer
  ..**.*******************

210. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP023152 (Mycobacterium chimaera strain FLAC0070 plasmid pFLAC0070_1, complete sequence) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
accaccaccgccggcgccgccgtcacc	Protospacer
************ *********    .

211. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP012185 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gtcgccaccgcccgcgccgccgaggca	Protospacer
..*.********************

212. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_AP018921 (Pseudonocardia autotrophica strain NBRC 12743 plasmid pPA12743CP, complete sequence) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
accaccagcgcccgcgccgccggaggc	Protospacer
******* **************.. ..

213. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
ggaaccaccgcccgcgccgccgccctt	Protospacer
.  *******************  * *

214. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_LR594669 (Variovorax sp. SRS16 plasmid 4) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gcctccaccggccgcgccgccgaggcc	Protospacer
.** ****** *************  .

215. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP039697 (Novosphingobium sp. ABRDHK2 plasmid pABRDHK22, complete sequence) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
tccagcaccgcccgcgccgccgcgtcg	Protospacer
 *** ***************** *.

216. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_LR134455 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 13, complete sequence) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gagaccaccgcccgcgtcggcgagcac	Protospacer
.  *************.** ******.

217. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP007796 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gacgccaccgcccgcgccgccgcgctg	Protospacer
. *.****************** **

218. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to AP021850 (Deinococcus grandis ATCC 43672 plasmid: pDEGR-1 DNA, complete genome) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
accaccaccgccagcgccgccagcctc	Protospacer
************ ********.. * .

219. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_010373 (Methylobacterium sp. 4-46 plasmid pM44601, complete sequence) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
accaccgccgcccgcgccgcctcggtc	Protospacer
******.**************  *  .

220. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
cgcaccaccgccctcgccgccgggctg	Protospacer
  *********** ********.**

221. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_013859 (Azospirillum sp. B510 plasmid pAB510e, complete sequence) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
cgcgccaccgccagcgccgccgagctg	Protospacer
  *.******** ************

222. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
ggaaccaccgcccgcgccgccgccctt	Protospacer
.  *******************  * *

223. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
ggaaccaccgcccgcgccgccgccctt	Protospacer
.  *******************  * *

224. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_AP022320 (Burkholderia sp. THE68 plasmid BTHE68_p2, complete sequence) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
ctcgccaccgcctgcgccgccgagccc	Protospacer
 .*.********.************ .

225. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP022567 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK03, complete sequence) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gcctccaccgcccgtgccgccgagacg	Protospacer
.** **********.*********

226. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_LR594673 (Variovorax sp. PBL-E5 plasmid 3) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gcctccaccggccgcgccgccgaggcc	Protospacer
.** ****** *************  .

227. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_014213 (Meiothermus silvanus DSM 9946 plasmid pMESIL01, complete sequence) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
tccaccaccgcccgtaccgccgaggtc	Protospacer
 *************..********  .

228. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gacgccaccgcccgcgccgccgcgctg	Protospacer
. *.****************** **

229. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_012520 (Rhodococcus opacus B4 plasmid pROB01, complete sequence) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccaccaccgccctcgccgccgccgct	Protospacer
.************ ********    *

230. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP020399 (Burkholderia multivorans strain FDAARGOS_246 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gcctgcaccgcccgcgccgccgagttc	Protospacer
.**  *******************. .

231. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP045122 (Rubrobacter sp. SCSIO 52915 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
ctcaccaccgcccgcgccgaggagctc	Protospacer
 .*****************  **** .

232. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP021917 (Sagittula sp. P11 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
ggcaccaccgcccgcaccggcgagctg	Protospacer
. *************.*** *****

233. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_023286 (Streptomyces sp. F12 plasmid pFRL6, complete sequence) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
accaccaccgcctgcgccgcctggtcg	Protospacer
************.******** .*.

234. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP013739 (Streptomyces globisporus C-1027 plasmid SGLP1, complete sequence) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
aacaccaccgcccgcgccgccatctac	Protospacer
* *******************.  .*.

235. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_016624 (Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
cgcgccaccgccagcgccgccgagctg	Protospacer
  *.******** ************

236. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_013858 (Azospirillum sp. B510 plasmid pAB510d, complete sequence) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
ggcaccaccgaccgcgccgccgtgcgc	Protospacer
. ******** *********** **..

237. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP033582 (Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
taccccaccgcccccgccgccgagccc	Protospacer
  * ********* *********** .

238. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_017958 (Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccgccaccgcccgcgccgccgccgag	Protospacer
.**.******************   *

239. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP054617 (Azospirillum oryzae strain KACC 14407 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
ggcaccaccgaccgcgccgccgtgcgc	Protospacer
. ******** *********** **..

240. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MK962635 (Achromobacter phage vB_AxyS_19-32_Axy18, complete genome) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccaccaccgcccgcgcaaccgagttg	Protospacer
.**************** .*****.

241. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MN694534 (Marine virus AFVG_250M1013, complete genome) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
accaccaccgcccccgccaccgatacc	Protospacer
************* ****.****   .

242. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_029033 (Achromobacter phage phiAxp-1, complete genome) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccaccaccgcccgcgcaaccgagttg	Protospacer
.**************** .*****.

243. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to KT803877 (Burkholderia phage PE067, complete genome) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
accaccaccgaacgcgccgccgacttc	Protospacer
**********  *********** . .

244. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to KC661275 (Mycobacterium phage HINdeR, complete genome) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccaccaccgcctgcgccgccgtcgag	Protospacer
.***********.*********   *

245. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MK962637 (Achromobacter phage vB_AxyS_19-32_Axy20, complete genome) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccaccaccgcccgcgcaaccgagttg	Protospacer
.**************** .*****.

246. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_048047 (Caulobacter phage CcrBL9, complete genome) position: , mismatch: 6, identity: 0.778

accaccaccgcccgcgccgccgagcat	CRISPR spacer
catgccaccgcctccgccgccgagcat	Protospacer
  ..********. *************

247. spacer 17.10|6076318|35|CP034669|CRISPRCasFinder matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.829

gcgcgcgcggcacctccagatacgga--gacgccacg	CRISPR spacer
gcgcgcccggcacctccagatccgggttgacgccg--	Protospacer
****** ************** ***.  ******.

248. spacer 18.3|6079856|27|CP034669|CRT matches to NZ_CP011665 (Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence) position: , mismatch: 6, identity: 0.778

acctccctctccgaggacgaggagcgg	CRISPR spacer
tcctccctctccgagaacgaggtcgag	Protospacer
 **************.******   .*

249. spacer 25.7|7047160|27|CP034669|CRT matches to NZ_CP043960 (Streptomyces tendae strain 139 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
atgccgtcgtccccgccgcgcccgttc	Protospacer
 . ****** *************** .

250. spacer 25.7|7047160|27|CP034669|CRT matches to MH825706 (Streptomyces phage Microdon, complete genome) position: , mismatch: 6, identity: 0.778

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
tgagcgtcggcgccgccgcgcccgtgg	Protospacer
.   ******* **************

251. spacer 25.7|7047160|27|CP034669|CRT matches to NC_024970 (Streptomyces aureofaciens strain CCM3239 plasmid pSA3239, complete sequence) position: , mismatch: 6, identity: 0.778

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
tccccgccggccccgccgcccccgccc	Protospacer
.*****.************ ****. .

252. spacer 25.7|7047160|27|CP034669|CRT matches to NZ_KJ396772 (Streptomyces lavendulae subsp. lavendulae strain CCM3239 plasmid pSA3239, complete sequence) position: , mismatch: 6, identity: 0.778

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
tccccgccggccccgccgcccccgccc	Protospacer
.*****.************ ****. .

253. spacer 25.7|7047160|27|CP034669|CRT matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
gccccgtcggccgcgcggcgcccggcc	Protospacer
 *********** *** *******  .

254. spacer 25.7|7047160|27|CP034669|CRT matches to NZ_LR134451 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 9, complete sequence) position: , mismatch: 6, identity: 0.778

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
gccccgtcggccccgtcgggcccgacc	Protospacer
 **************.** *****  .

255. spacer 25.7|7047160|27|CP034669|CRT matches to NZ_LR134459 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 17, complete sequence) position: , mismatch: 6, identity: 0.778

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
aggccgtcggcgccgccgcgccggtgc	Protospacer
   ******** ********** ***.

256. spacer 25.7|7047160|27|CP034669|CRT matches to NC_008270 (Rhodococcus jostii RHA1 plasmid pRHL2, complete sequence) position: , mismatch: 6, identity: 0.778

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
ggcccgtcggcccggctgcgcccgtcg	Protospacer
  *********** **.********

257. spacer 25.7|7047160|27|CP034669|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.778

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
agcaggtcggccacgccgcgcccgtgg	Protospacer
  *  ******* *************

258. spacer 25.7|7047160|27|CP034669|CRT matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
gccccgtcggccgcgcggcgcccggcc	Protospacer
 *********** *** *******  .

259. spacer 25.7|7047160|27|CP034669|CRT matches to NZ_CP024986 (Streptomyces lavendulae subsp. lavendulae strain CCM 3239 plasmid pSA3239, complete sequence) position: , mismatch: 6, identity: 0.778

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
tccccgccggccccgccgcccccgccc	Protospacer
.*****.************ ****. .

260. spacer 25.7|7047160|27|CP034669|CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 6, identity: 0.778

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
cggaggtcggccccgccgagcccgtgc	Protospacer
*    ************* *******.

261. spacer 25.7|7047160|27|CP034669|CRT matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 6, identity: 0.778

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
gccccgtcggccccgccgcctccggcc	Protospacer
 ****************** .***  .

262. spacer 25.7|7047160|27|CP034669|CRT matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

cccccgtcggccccgccgcgcccgtgt	CRISPR spacer
gccccgtcggccgcgcggcgcccggcc	Protospacer
 *********** *** *******  .

263. spacer 27.4|8795032|30|CP034669|CRT matches to NZ_CP012399 (Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence) position: , mismatch: 6, identity: 0.8

ggcttccccctgccggaggcggcactccat	CRISPR spacer
cggctcgacctgccggaggaggcactccat	Protospacer
 * .**  *********** **********

264. spacer 27.5|8795101|26|CP034669|CRT matches to NZ_CP024895 (Amycolatopsis sp. AA4 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.769

ggccgccgcgaccgagacctccgccc	CRISPR spacer
ggtcgccgcgaccgagacctcgaagt	Protospacer
**.****************** .  .

265. spacer 27.5|8795101|26|CP034669|CRT matches to NZ_CP018064 (Rhodococcus sp. 2G plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.769

ggccgccgcgaccgagacctccgccc	CRISPR spacer
cagatccgcgaccgcgacctccgccc	Protospacer
 .   ********* ***********

266. spacer 28.3|8916108|30|CP034669|CRT matches to NC_008269 (Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence) position: , mismatch: 6, identity: 0.8

ccttcgcagcgcccttcttcgcggtggcac	CRISPR spacer
ccttcgcagcggccttcttcgcggtttttg	Protospacer
*********** *************  .

267. spacer 28.3|8916108|30|CP034669|CRT matches to NC_008269 (Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence) position: , mismatch: 6, identity: 0.8

ccttcgcagcgcccttcttcgcggtggcac	CRISPR spacer
ccttcgcagcggccttcttcgcgggcacct	Protospacer
*********** ************  .* .

268. spacer 28.3|8916108|30|CP034669|CRT matches to NC_008269 (Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence) position: , mismatch: 6, identity: 0.8

ccttcgcagcgcccttcttcgcggtggcac	CRISPR spacer
ccttcgcagcggccttcttcgcgggcacct	Protospacer
*********** ************  .* .

269. spacer 28.3|8916108|30|CP034669|CRT matches to NC_008269 (Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence) position: , mismatch: 6, identity: 0.8

ccttcgcagcgcccttcttcgcggtggcac	CRISPR spacer
ccttcgcagcggccttcttcgcgggcacct	Protospacer
*********** ************  .* .

270. spacer 28.5|8916192|30|CP034669|CRT matches to NC_008269 (Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence) position: , mismatch: 6, identity: 0.8

ccttcgcagcggacttcttcgcggtggcgc	CRISPR spacer
ccttcgcagcggccttcttcgcggtttttg	Protospacer
************ ************  .

271. spacer 28.5|8916192|30|CP034669|CRT matches to NC_008269 (Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence) position: , mismatch: 6, identity: 0.8

ccttcgcagcggacttcttcgcggtggcgc	CRISPR spacer
ccttcgcagcggccttcttcgcgggcacct	Protospacer
************ ***********  .* .

272. spacer 28.5|8916192|30|CP034669|CRT matches to NC_008269 (Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence) position: , mismatch: 6, identity: 0.8

ccttcgcagcggacttcttcgcggtggcgc	CRISPR spacer
ccttcgcagcggccttcttcgcgggcacct	Protospacer
************ ***********  .* .

273. spacer 28.5|8916192|30|CP034669|CRT matches to NC_008269 (Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence) position: , mismatch: 6, identity: 0.8

ccttcgcagcggacttcttcgcggtggcgc	CRISPR spacer
ccttcgcagcggccttcttcgcgggcacct	Protospacer
************ ***********  .* .

274. spacer 28.5|8916192|30|CP034669|CRT matches to MK450431 (Streptomyces phage Lilbooboo, complete genome) position: , mismatch: 6, identity: 0.8

ccttcgcagcggacttcttcgcggtggcgc	CRISPR spacer
tcttcgcagcggtcttcttcgcggcagcag	Protospacer
.*********** ***********..**.

275. spacer 8.6|2221881|30|CP034669|CRT matches to MN703409 (Arthrobacter phage LittleTokyo, complete genome) position: , mismatch: 7, identity: 0.767

cgggatggccgggcccgcgcccatggggat	CRISPR spacer
ggggctggccgggcccgcgtccatgccgcg	Protospacer
 *** **************.*****  *

276. spacer 8.14|2222379|33|CP034669|CRT matches to NC_011887 (Methylobacterium nodulans ORS 2060 plasmid pMNOD02, complete sequence) position: , mismatch: 7, identity: 0.788

ggcactgcccggcagcgggatggcggcgggctg--	CRISPR spacer
gctcctgcccggcaccggggtggcggc--gctgac	Protospacer
* . ********** ****.*******  ****

277. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP021355 (Rhodococcus sp. S2-17 plasmid pRB98, complete sequence) position: , mismatch: 7, identity: 0.741

accaccaccgcccgcgccgccgagcat	CRISPR spacer
ctcacctccgcccgcgccgccgacttc	Protospacer
 .**** **************** . .

278. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_LT703506 (Mycobacterium chimaera strain Mycobacterium chimaera MC045 isolate Mycobacterium chimaera plasmid 2) position: , mismatch: 7, identity: 0.741

accaccaccgcccgcgccgccgagcat	CRISPR spacer
caaaccaccgcccgcgccgcccagtgc	Protospacer
   ****************** **...

279. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP015419 (Rhodovulum sulfidophilum DSM 1374 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.741

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccgccaccgcccgcgccgccgtcgcc	Protospacer
.**.******************    .

280. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP015422 (Rhodovulum sulfidophilum strain SNK001 plasmid, complete sequence) position: , mismatch: 7, identity: 0.741

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccgccaccgcccgcgccgccgtcgcc	Protospacer
.**.******************    .

281. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_AP014802 (Rhodovulum sulfidophilum plasmid Plasmid2 DNA, complete genome, strain: DSM 2351) position: , mismatch: 7, identity: 0.741

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gccgccaccgcccgcgccgccgtcgcc	Protospacer
.**.******************    .

282. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP046575 (Rhodococcus sp. WAY2 plasmid pRWAY03, complete sequence) position: , mismatch: 7, identity: 0.741

accaccaccgcccgcgccgccgagcat	CRISPR spacer
cgcgggcccgcccgcgccgccgagcag	Protospacer
  *.   *******************

283. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP039651 (Azospirillum sp. TSA2s plasmid p1) position: , mismatch: 7, identity: 0.741

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gtgtccaccgcccgcgacgccgagcgg	Protospacer
..  ************ ********.

284. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.741

accaccaccgcccgcgccgccgagcat	CRISPR spacer
cccaccaccgcacgcgccgccggagcc	Protospacer
 ********** **********..  .

285. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 7, identity: 0.741

accaccaccgcccgcgccgccgagcat	CRISPR spacer
accaccaccgcccgagccgccaccgga	Protospacer
************** ******.   .

286. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NC_012520 (Rhodococcus opacus B4 plasmid pROB01, complete sequence) position: , mismatch: 7, identity: 0.741

accaccaccgcccgcgccgccgagcat	CRISPR spacer
cgcgggcccgcccgcgccgccgagcag	Protospacer
  *.   *******************

287. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP025550 (Mycobacterium paragordonae strain 49061 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.741

accaccaccgcccgcgccgccgagcat	CRISPR spacer
taggccaacgcccgcgccgccgagcga	Protospacer
   .*** *****************.

288. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MT684597 (Mycobacterium phage Mandlovu, complete genome) position: , mismatch: 7, identity: 0.741

accaccaccgcccgcgccgccgagcat	CRISPR spacer
accaccaccgcccgcgccgggattccc	Protospacer
*******************  .  * .

289. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MN586004 (Mycobacterium phage Strokeseat, complete genome) position: , mismatch: 7, identity: 0.741

accaccaccgcccgcgccgccgagcat	CRISPR spacer
accaccaccgcccgcgccgggattccc	Protospacer
*******************  .  * .

290. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MT684601 (Mycobacterium phage Hlubikazi, complete genome) position: , mismatch: 7, identity: 0.741

accaccaccgcccgcgccgccgagcat	CRISPR spacer
accaccaccgcccgcgccgggattccc	Protospacer
*******************  .  * .

291. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to MT657335 (Gordonia phage Mariokart, complete genome) position: , mismatch: 7, identity: 0.741

accaccaccgcccgcgccgccgagcat	CRISPR spacer
tccaccaccgccctcgccgccgccagc	Protospacer
 ************ ********   ..

292. spacer 18.3|6079856|27|CP034669|CRT matches to NZ_CP033582 (Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence) position: , mismatch: 7, identity: 0.741

acctccctctccgaggacgaggagcgg	CRISPR spacer
tcctccctctccgagaacgaggtcgaa	Protospacer
 **************.******   ..

293. spacer 24.1|6663043|29|CP034669|PILER-CR matches to NZ_LR134452 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence) position: , mismatch: 7, identity: 0.759

cccgccgccccatccggtcggcagaaaac	CRISPR spacer
gccgccgcccgaaccggtcggcagccgat	Protospacer
 ********* * ***********  .*.

294. spacer 24.1|6663043|29|CP034669|PILER-CR matches to NZ_CP006371 (Aureimonas sp. AU20 plasmid pAU20d, complete sequence) position: , mismatch: 7, identity: 0.759

cccgccgccccatccggtcggcagaaaac	CRISPR spacer
aacggcgtcccatccggtcggcagatcgc	Protospacer
  ** **.*****************  .*

295. spacer 24.1|6663043|29|CP034669|PILER-CR matches to NZ_CP006372 (Aureimonas sp. AU20 plasmid pAU20e, complete sequence) position: , mismatch: 7, identity: 0.759

cccgccgccccatccggtcggcagaaaac	CRISPR spacer
aacggcgtcccatccggtcggcagatcgc	Protospacer
  ** **.*****************  .*

296. spacer 24.1|6663043|29|CP034669|PILER-CR matches to NZ_CP054620 (Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.759

cccgccgccccatccggtcggcagaaaac	CRISPR spacer
tccgccgccccacccggtcggcgatatag	Protospacer
.***********.*********.. * *

297. spacer 25.5|7047061|27|CP034669|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.741

gaccggtggctcccaccgtgcccggat	CRISPR spacer
cgccggtggctccctccgtgccctcga	Protospacer
 .************ ********  .

298. spacer 27.1|8794819|32|CP034669|CRT matches to NC_015951 (Streptomyces violaceusniger Tu 4113 plasmid pSTRVI01, complete sequence) position: , mismatch: 7, identity: 0.781

gcccccatggctggccggagcctccattccat	CRISPR spacer
cacaccatggcttgccggagcctccgttcaag	Protospacer
  * ******** ************.*** *

299. spacer 27.4|8795032|30|CP034669|CRT matches to NC_022125 (Rhodococcus erythropolis CCM2595 plasmid pRECF1, complete sequence) position: , mismatch: 7, identity: 0.767

ggcttccccctgccggaggcggcactccat	CRISPR spacer
gggttccccctgccggaggcgataccgact	Protospacer
** ******************..**.   *

300. spacer 27.4|8795032|30|CP034669|CRT matches to NZ_CP015203 (Rhodococcus sp. 008 plasmid pR8L1, complete sequence) position: , mismatch: 7, identity: 0.767

ggcttccccctgccggaggcggcactccat	CRISPR spacer
gggttccccctgccggaggcgataccgact	Protospacer
** ******************..**.   *

301. spacer 27.4|8795032|30|CP034669|CRT matches to NZ_CP044283 (Rhodococcus erythropolis strain X5 plasmid pRhX5, complete sequence) position: , mismatch: 7, identity: 0.767

ggcttccccctgccggaggcggcactccat	CRISPR spacer
gggttccccctgccggaggcgataccgact	Protospacer
** ******************..**.   *

302. spacer 27.4|8795032|30|CP034669|CRT matches to NZ_CP050125 (Rhodococcus erythropolis strain KB1 plasmid plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ggcttccccctgccggaggcggcactccat	CRISPR spacer
gggttccccctgccggaggcgataccgact	Protospacer
** ******************..**.   *

303. spacer 27.4|8795032|30|CP034669|CRT matches to NC_007491 (Rhodococcus erythropolis PR4 plasmid pREL1, complete sequence) position: , mismatch: 7, identity: 0.767

ggcttccccctgccggaggcggcactccat	CRISPR spacer
gggttccccctgccggaggcgataccgact	Protospacer
** ******************..**.   *

304. spacer 27.4|8795032|30|CP034669|CRT matches to NZ_CP017303 (Rhodococcus sp. YL-1 plasmid pYLL1 sequence) position: , mismatch: 7, identity: 0.767

ggcttccccctgccggaggcggcactccat	CRISPR spacer
gggttccccctgccggaggcgataccgact	Protospacer
** ******************..**.   *

305. spacer 27.4|8795032|30|CP034669|CRT matches to NZ_CP017304 (Rhodococcus sp. YL-1 plasmid pYLL2 sequence) position: , mismatch: 7, identity: 0.767

ggcttccccctgccggaggcggcactccat	CRISPR spacer
gggttccccctgccggaggcgataccgact	Protospacer
** ******************..**.   *

306. spacer 27.4|8795032|30|CP034669|CRT matches to NC_005073 (Rhodococcus erythropolis linear plasmid pBD2, complete sequence) position: , mismatch: 7, identity: 0.767

ggcttccccctgccggaggcggcactccat	CRISPR spacer
gggttccccctgccggaggcgataccgact	Protospacer
** ******************..**.   *

307. spacer 28.2|8916060|30|CP034669|CRT matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

308. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

309. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

310. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

311. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

312. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

313. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

314. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

315. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

316. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

317. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

318. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

319. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

320. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

321. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

322. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

323. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

324. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

325. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

326. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

327. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

328. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

329. spacer 28.2|8916060|30|CP034669|CRT matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

330. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

331. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

332. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

333. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

334. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

335. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

336. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

337. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

338. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

339. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

340. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

341. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

342. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

343. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

344. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

345. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

346. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

347. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

348. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

349. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

350. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

351. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

352. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

353. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

354. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

355. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

356. spacer 28.2|8916060|30|CP034669|CRT matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

357. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

358. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

359. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

360. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

361. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

362. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

363. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

364. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

365. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

366. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

367. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

368. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

369. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

370. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

371. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

372. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

373. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

374. spacer 28.2|8916060|30|CP034669|CRT matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcctggcggtggcacccttcgcagcgc	CRISPR spacer
acatgttggcggtggcgcccttcggagcga	Protospacer
 * * .**********.******* ****

375. spacer 28.3|8916108|30|CP034669|CRT matches to NZ_CP018230 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcgcagcgcccttcttcgcggtggcac	CRISPR spacer
gcgtcgcagcggccttcttcgcggaagcgg	Protospacer
 * ******** ************ .**.

376. spacer 28.3|8916108|30|CP034669|CRT matches to NZ_CP048282 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248d, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcgcagcgcccttcttcgcggtggcac	CRISPR spacer
gcgtcgcagcggccttcttcgcggaagcgg	Protospacer
 * ******** ************ .**.

377. spacer 28.5|8916192|30|CP034669|CRT matches to NC_008269 (Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence) position: , mismatch: 7, identity: 0.767

ccttcgcagcggacttcttcgcggtggcgc	CRISPR spacer
ccttcgcagcggccttcttcgccggcacct	Protospacer
************ ********* *  .* .

378. spacer 30.1|9053557|28|CP034669|CRISPRCasFinder matches to NZ_CP013345 (Sphingopyxis macrogoltabida strain 203N plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.75

gccagagccaccgtcggtcggcgaaccc	CRISPR spacer
gaagccgccaccgtcggtcgacgaaccg	Protospacer
*  .  **************.******

379. spacer 30.1|9053557|28|CP034669|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.75

gccagagccaccgtcggtcggcgaaccc	CRISPR spacer
cgacgagccaccctcgatcggcgaacca	Protospacer
    ******** ***.**********

380. spacer 30.2|9053608|31|CP034669|CRISPRCasFinder matches to MK284521 (Gordonia phage Kiko, complete genome) position: , mismatch: 7, identity: 0.774

ggtcgtggtgccagcgtcggtcgtggtgcca	CRISPR spacer
cgccgtggtgccagcgccggtcgcggcggcg	Protospacer
 *.*************.******.**.* *.

381. spacer 8.6|2221881|30|CP034669|CRT matches to NZ_CP032318 (Hymenobacter oligotrophus strain sh-6 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

cgggatggccgggcccgcgcccatggggat	CRISPR spacer
gttcacggccaggcccgcgcccatggggcg	Protospacer
    *.****.*****************

382. spacer 11.1|2381556|27|CP034669|CRISPRCasFinder matches to NZ_CP047899 (Pseudarthrobacter sp. YJ56 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.704

accaccaccgcccgcgccgccgagcat	CRISPR spacer
gaagacaccgcccgcgccgccgagaca	Protospacer
.  . *******************

383. spacer 24.1|6663043|29|CP034669|PILER-CR matches to NZ_CP041205 (Rhizobium sp. NIBRBAC000502774 plasmid pMK-2, complete sequence) position: , mismatch: 8, identity: 0.724

cccgccgccccatccggtcggcagaaaac	CRISPR spacer
cccgccgccccatgcggtcagcatttcgt	Protospacer
************* *****.***    ..

384. spacer 24.1|6663043|29|CP034669|PILER-CR matches to NZ_CP032349 (Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.724

cccgccgccccatccggtcggcagaaaac	CRISPR spacer
ggcgccgcccgatccggtcggcaagcatg	Protospacer
  ******** ************.. *

385. spacer 24.1|6663043|29|CP034669|PILER-CR matches to NZ_CP012918 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p4, complete sequence) position: , mismatch: 8, identity: 0.724

cccgccgccccatccggtcggcagaaaac	CRISPR spacer
ggcgccgcccgatccggtcggcaagcatg	Protospacer
  ******** ************.. *

386. spacer 27.2|8794890|32|CP034669|CRT matches to NZ_CP028348 (Novosphingobium sp. THN1 plasmid pTHN, complete sequence) position: , mismatch: 8, identity: 0.75

tcccccatggctggccggggcctccattccat	CRISPR spacer
gccgtcgctgctggcagggacctccattccat	Protospacer
 ** .*.. ****** ***.************

387. spacer 27.4|8795032|30|CP034669|CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 8, identity: 0.733

ggcttccccctgccggaggcggcactccat	CRISPR spacer
cgcttccccctgccggtgccggcaccggca	Protospacer
 *************** * ******.

388. spacer 27.4|8795032|30|CP034669|CRT matches to NZ_CP053445 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eA, complete sequence) position: , mismatch: 8, identity: 0.733

ggcttccccctgccggaggcggcactccat	CRISPR spacer
gacatccccctgcaggaggcggcacaggca	Protospacer
*.* ********* ***********

389. spacer 27.4|8795032|30|CP034669|CRT matches to NZ_CP048428 (Rhizobium daejeonense strain KACC 13094 plasmid unnamed4, complete sequence) position: , mismatch: 8, identity: 0.733

ggcttccccctgccggaggcggcactccat	CRISPR spacer
ggcttctccgtgccggaggcggcctggcgg	Protospacer
******.** ************* .  *.

390. spacer 28.3|8916108|30|CP034669|CRT matches to MK450426 (Streptomyces phage Euratis, complete genome) position: , mismatch: 8, identity: 0.733

ccttcgcagcgcccttcttcgcggtggcac	CRISPR spacer
tcttcgcagcggtcttcttcgcggcaggcg	Protospacer
.********** .***********..*

391. spacer 28.5|8916192|30|CP034669|CRT matches to LN713927 (Pseudomonas fluorescens SBW25 plasmid pQBR55, complete sequence) position: , mismatch: 8, identity: 0.733

ccttcgcagcggacttcttcgcggtggcgc	CRISPR spacer
gtttcgccgcgaacttcttcgcggtgttct	Protospacer
 .***** ***.************** . .

392. spacer 30.2|9053608|31|CP034669|CRISPRCasFinder matches to NZ_CP018075 (Streptomyces venezuelae strain NRRL B-65442 plasmid, complete sequence) position: , mismatch: 8, identity: 0.742

ggtcgtggtgccagcgtcggtcgtggtgcca	CRISPR spacer
aatgtaggtgccagcgtcggtggtggttccg	Protospacer
..*   *************** ***** **.

393. spacer 1.1|31908|34|CP034669|CRISPRCasFinder matches to NZ_CP022371 (Bosea sp. AS-1 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.735

--gctgcgtcgcgcggccgctgagggtgatttcgga	CRISPR spacer
tggtcccg--acgcggccgatgagggtgaattcggc	Protospacer
  *.. **  .******** ********* *****

394. spacer 8.14|2222379|33|CP034669|CRT matches to NC_048095 (Arthrobacter phage Judy, complete genome) position: , mismatch: 9, identity: 0.727

ggcactgcccggcagcgggatggcggcgggctg	CRISPR spacer
gacgggcaccgggagcgggatggtggcgggctt	Protospacer
*.*.    **** **********.********

395. spacer 13.1|2617117|34|CP034669|CRISPRCasFinder matches to NZ_CP009216 (Corynebacterium ureicelerivorans strain IMMIB RIV-2301 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.735

ggcgcggacgcgttccccttcccgggcactccgg	CRISPR spacer
gccccggacgagttcccctacccgggcatggcca	Protospacer
* * ****** ******** ********.  * .

396. spacer 24.1|6663043|29|CP034669|PILER-CR matches to NZ_CP016441 (Bordetella pseudohinzii strain HI4681 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.69

cccgccgccccatccggtcggcagaaaac	CRISPR spacer
gccggcgccccatccggtcggccacggcg	Protospacer
 *** ***************** . ..

397. spacer 27.4|8795032|30|CP034669|CRT matches to NZ_CP016620 (Microvirga ossetica strain V5/3m plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.7

ggcttccccctgccggaggcggcactccat	CRISPR spacer
ggattccccctgccggcggcggcgaaggcg	Protospacer
** ************* ******.

398. spacer 8.14|2222379|33|CP034669|CRT matches to NZ_CP030129 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed3, complete sequence) position: , mismatch: 10, identity: 0.697

ggcactgcccggcagcgggatggcggcgggctg	CRISPR spacer
cttggcgcccggcagcggcacggcggcgggcct	Protospacer
  .. .************ *.**********.

399. spacer 8.14|2222379|33|CP034669|CRT matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 10, identity: 0.697

ggcactgcccggcagcgggatggcggcgggctg	CRISPR spacer
ctccatgcccggcagcgggttggaggcggttcc	Protospacer
  *  ************** *** ***** ..

400. spacer 8.14|2222379|33|CP034669|CRT matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 10, identity: 0.697

ggcactgcccggcagcgggatggcggcgggctg	CRISPR spacer
ctccatgcccggcagcgggttggaggcggttcc	Protospacer
  *  ************** *** ***** ..

401. spacer 8.14|2222379|33|CP034669|CRT matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 10, identity: 0.697

ggcactgcccggcagcgggatggcggcgggctg	CRISPR spacer
ctccatgcccggcagcgggttggaggcggttcc	Protospacer
  *  ************** *** ***** ..

402. spacer 25.4|7047007|36|CP034669|CRT matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.722

cacccttcggacctgccgcgcccgtggcgcccgtgt	CRISPR spacer
gcaccgccggaccggccgcgcccgcggcgcccggcc	Protospacer
   ** .****** **********.********  .

403. spacer 1.3|32025|37|CP034669|CRISPRCasFinder matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 11, identity: 0.703

actcatcggacgcggtgacgtccgcgttcatgtggct	CRISPR spacer
ccgggcgcgacgcggtgacgtccgccgtcatgtgccc	Protospacer
 *  ..  *****************  ******* *.

404. spacer 1.3|32025|37|CP034669|CRISPRCasFinder matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 11, identity: 0.703

actcatcggacgcggtgacgtccgcgttcatgtggct	CRISPR spacer
ccgggcgcgacgcggtgacgtccgccgtcatgtgccc	Protospacer
 *  ..  *****************  ******* *.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2105269 : 2166631

Bacillus_phage(20.0%)

plate,transposase,tail

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAT83383.1\|2105269_2107237_+\|tail	putative phage tail sheath protein	A0A1B2LRR3	Wolbachia_phage	2.3e-06	27.3
QAT83384.1\|2107261_2107771_+\|tail	phage tail region protein	NA	NA	NA	NA
QAT83385.1\|2107770_2108571_+	hypothetical protein	NA	NA	NA	NA
QAT83386.1\|2108590_2109622_+	hypothetical protein	NA	NA	NA	NA
QAT83387.1\|2109623_2110658_+	hypothetical protein	NA	NA	NA	NA
QAT83388.1\|2110654_2111977_+	ATPase	K9MCS8	Sulfolobus_virus	6.2e-08	35.2
QAT83389.1\|2111970_2112243_+	hypothetical protein	NA	NA	NA	NA
QAT83390.1\|2112236_2112884_+	hypothetical protein	NA	NA	NA	NA
QAT83391.1\|2112883_2113174_+	hypothetical protein	NA	NA	NA	NA
QAT83392.1\|2113178_2114309_+	hypothetical protein	NA	NA	NA	NA
QAT83393.1\|2114305_2115127_+	Rhs element Vgr family protein	A0A292GCA1	Xanthomonas_phage	3.6e-06	33.3
QAT83394.1\|2115143_2115554_+\|plate	baseplate assembly protein W	NA	NA	NA	NA
QAT83395.1\|2115546_2116740_+	hypothetical protein	NA	NA	NA	NA
QAT83396.1\|2116736_2119628_+	hypothetical protein	NA	NA	NA	NA
QAT83397.1\|2119624_2121241_+	hypothetical protein	NA	NA	NA	NA
QAT83398.1\|2121273_2123103_+	hypothetical protein	NA	NA	NA	NA
QAT83399.1\|2123112_2124141_-	DNA primase	A7KV10	Bacillus_phage	7.2e-12	24.1
QAT83400.1\|2124801_2125938_+	beta-lactamase	NA	NA	NA	NA
QAT83401.1\|2126255_2128145_+	5'-nucleotidase	NA	NA	NA	NA
QAT83402.1\|2128729_2129632_-	LysR family transcriptional regulator	NA	NA	NA	NA
QAT83403.1\|2129718_2130024_+	hypothetical protein	NA	NA	NA	NA
QAT83404.1\|2130065_2130812_+	short chain dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	2.4e-12	28.2
QAT83405.1\|2131703_2132708_-	hypothetical protein	NA	NA	NA	NA
QAT83406.1\|2133367_2133571_+	hypothetical protein	NA	NA	NA	NA
QAT83407.1\|2133577_2133991_+	hypothetical protein	NA	NA	NA	NA
QAT83408.1\|2134178_2134811_+	hypothetical protein	NA	NA	NA	NA
QAT83409.1\|2134817_2135006_+	hypothetical protein	NA	NA	NA	NA
QAT83410.1\|2135407_2135629_+	hypothetical protein	NA	NA	NA	NA
QAT83411.1\|2135695_2136907_+	hypothetical protein	NA	NA	NA	NA
QAT83412.1\|2137530_2138535_-\|transposase	IS5 family transposase orfB	U5P429	Shigella_phage	3.2e-12	26.0
QAT83413.1\|2138534_2138942_-	hypothetical protein	NA	NA	NA	NA
QAT83414.1\|2139220_2139496_-	hypothetical protein	NA	NA	NA	NA
QAT83415.1\|2140243_2141314_+	hypothetical protein	NA	NA	NA	NA
QAT83416.1\|2141892_2142669_+	Signal transduction protein	NA	NA	NA	NA
QAT83417.1\|2142646_2143858_-	hypothetical protein	NA	NA	NA	NA
QAT83418.1\|2145756_2146113_-	hypothetical protein	NA	NA	NA	NA
QAT83419.1\|2146123_2147602_-	hypothetical protein	NA	NA	NA	NA
QAT83420.1\|2147647_2148037_-	hypothetical protein	NA	NA	NA	NA
QAT83421.1\|2148033_2148192_-	hypothetical protein	NA	NA	NA	NA
QAT83422.1\|2148474_2150064_+	hypothetical protein	NA	NA	NA	NA
QAT83423.1\|2150050_2150818_+	Insertion sequence IS5376 putative ATP-binding protein	A0A2L1IVB6	Escherichia_phage	5.0e-42	37.4
QAT83424.1\|2151882_2152191_+	HNH endonuclease domain-containing protein	NA	NA	NA	NA
QAT83425.1\|2152723_2153104_-	hypothetical protein	NA	NA	NA	NA
QAT83426.1\|2153111_2153267_-	hypothetical protein	NA	NA	NA	NA
QAT83427.1\|2153467_2154229_-	Insertion sequence IS5376 putative ATP-binding protein	NA	NA	NA	NA
QAT83428.1\|2154225_2155731_-	hypothetical protein	A0A2L1IVA1	Escherichia_phage	7.8e-31	32.9
QAT83429.1\|2156474_2156984_-	hypothetical protein	NA	NA	NA	NA
QAT83430.1\|2156992_2157571_-	Rhs element Vgr family protein	NA	NA	NA	NA
QAT83431.1\|2157582_2158866_-	hypothetical protein	NA	NA	NA	NA
QAT83432.1\|2158862_2159204_-	hypothetical protein	NA	NA	NA	NA
QAT83433.1\|2159203_2159716_-	hypothetical protein	NA	NA	NA	NA
QAT83434.1\|2159730_2162415_-	hypothetical protein	A0A2H4J055	uncultured_Caudovirales_phage	2.8e-23	30.1
QAT83435.1\|2162606_2163380_-	hypothetical protein	NA	NA	NA	NA
QAT83436.1\|2163464_2163938_+	hypothetical protein	NA	NA	NA	NA
QAT83437.1\|2163941_2164403_-\|tail	phage tail region protein	NA	NA	NA	NA
QAT83438.1\|2164414_2166631_-\|tail	putative phage tail sheath protein	J9PVC2	Bacillus_phage	9.7e-38	31.2

DBSCAN-SWA_2

3058981 : 3066218

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAT84104.1\|3058981_3059731_+	3-oxoacyl-(acyl-carrier-protein) reductase	Q06VL0	Trichoplusia_ni_ascovirus	1.1e-22	35.4
QAT84105.1\|3059837_3060086_+	acyl carrier protein	M4QDG5	Prochlorococcus_phage	4.0e-09	55.7
QAT84106.1\|3060173_3061430_+	beta-ketoacyl-acyl carrier protein synthase	NA	NA	NA	NA
QAT84107.1\|3061533_3061980_+	ribose 5-phosphate isomerase B	NA	NA	NA	NA
QAT84108.1\|3062040_3063297_+	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	2.1e-93	50.5
QAT84109.1\|3063306_3063810_+	transcriptional regulator NrdR	NA	NA	NA	NA
QAT84110.1\|3063820_3064984_+	riboflavin biosynthesis protein RibD	A0A1V0SE20	Indivirus	1.0e-46	32.8
QAT84111.1\|3065024_3065690_+	riboflavin synthase subunit alpha	A0A2H4PQS5	Staphylococcus_phage	1.3e-25	35.9
QAT84112.1\|3065717_3066218_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.2e-25	42.4

DBSCAN-SWA_3

7240582 : 7251261

Pandoravirus(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAT87277.1\|7240582_7242394_+	putative serine/threonine protein kinase	S4W2F5	Pandoravirus	2.2e-11	30.4
QAT87278.1\|7242414_7242954_-	hypothetical protein	NA	NA	NA	NA
QAT87279.1\|7242990_7243476_-	SsrA-binding protein	W5RAM5	Staphylococcus_phage	4.3e-31	46.0
QAT87280.1\|7243493_7244348_-	pantoate--beta-alanine ligase	NA	NA	NA	NA
QAT87281.1\|7244350_7245259_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0P0BXC9	Ostreococcus_lucimarinus_virus	4.1e-51	40.9
QAT87282.1\|7245428_7246070_-	deoxynucleoside kinase	A0A291I9G8	Lactobacillus_phage	1.6e-17	30.4
QAT87283.1\|7246251_7246539_+	hypothetical protein	NA	NA	NA	NA
QAT87284.1\|7246558_7247425_-	dimethyladenosine transferase	E4ZFQ0	Streptococcus_phage	7.2e-13	31.5
QAT87285.1\|7247435_7248434_-	putative DNA-binding/iron metalloprotein/AP endonuclease	A0A0R6PI74	Moraxella_phage	3.2e-73	45.7
QAT87286.1\|7248486_7251261_-	response regulator	Q56AR1	Bacillus_thuringiensis_phage	5.0e-07	30.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP034669

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection