CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP029684	Oenococcus sicerae strain UCMA 15228 chromosome, complete genome	2 crisprs	cas2,cas1,cas9,cas3,csa3,DEDDh,cas6e,cas5,cas7,cse2gr11,cas8e	8	61	5	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP029684_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP029684_1

52051-53604

TypeII

Consensus_repeat	Method
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	CRISPRCasFinder
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	CRT
GGGTGTCACCCCATTAATCTGACATACAACTGAAGCG	PILER-CR
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	PILER-CR

23 spacers

csn2,cas2,cas1,cas9

The CRISPR arrays of CP029684_1

>merge|CP029684|1|52051-53604|CRISPRCasFinder,CRT,PILER-CR,PILER-CR
GGGGGTGTCGCCATTAATCTGACATACAACTGAAGCAGAAATTTTGGAATTTATATAATCACAAAGGGGTGTCACCCCATTAATCTGACATACAACTGAAGCGCGGTTCAAAGACTGCGATCAGTTTAATTCGGGTGTCACCCCATTAATCTGACATACAACTGAAGCGCGGTTCAAAGACTGCGATCAGTTTAATTCGGGTGTCACCCCATTAATCTGACATACAACTGAAGCGGACTGCGAAGACAATCGGCAAGAAATCACGGGTGTCACCCCATTAATCTGACATACAACTGAAGCGTATCGGTGTCTTCATCAAAGTCTGGTTCGGGGTGTCACCCCATTAATCTGACATACAACTGAAGCGCGGTCTAAGTCGTATTGAAGCCAGTGGCAGGGTGTCACCCCATTAATCTGACATACAACTGAAGCGCGGTCTAAGTCGTATTGAAGCCAGTGGCAGGGTGTCACCCCATTAATCTGACATACAACTGAAGCTAATAATACCAGCTGCGGGAATATTTAGTTGGGTGTCACCCCATTAATCTGACATACAACTGAAGCGCGATTGATGCGCTCCACCTCGCTGGTGTTGGGTGTCACCCCATTAATCTGACATACAACTGAAGCAGTATCAGCGAGCTTATACCGCTCTGTCATGGGTGTCACCCCATTAATCTGACATACAACTGAAGCATCAATGAAAACATGAAAACCCCTTACACTGGGTGTCACCCCATTAATCTGACATACAACTGAAGCCCATTCTGTGACTCCTTTTTAGCTTTTCTTGGGGTGTCACCCCATTAATCTGACATACAACTGAAGCGAACTCGGACTTGCTAAATCTTTTTTGTAAGGGTGTCACCCCATTAATCTGACATACAACTGAAGCTGGACGTCGAAAATGCACGCTGGCGTATCAGGGTGTCACCCCATTAATCTGACATACAACTGAAGCATGGTTACGATAACTTGTTGGCTGCCTTAGGGGTGTCACCCCATTAATCTGACATACAACTGAAGCGAATATCCGAGCTTCTCTATCACACTTGCGGGGTGTCACCCCATTAATCTGACATACAACTGAAGCATTTCAAACGAAGCCATCGCAGAATTGACAGGGTGTCACCCCATTAATCTGACATACAACTGAAGCGAGGGAGCTATTGGTAACTTGCAAGCCAACGGGTGTCACCCCATTAATCTGACATACAACTGAAGCATGGAATCAACGAAGAGCAAGCCCAAGAGGGGTGTCACCCCATTAATCTGACATACAACTGAAGCTTCATATCATCTATTAAATCACTATATAAAGGGTGTCACCCCATTAATCTGACATACAACTGAAGCTATCTGACGCTGTTGGTATACAAGTCACAAGGGTGTCACCCCATTAATCTGACATACAACTGAAGCCCAACTAATTGCTTTATTGATATTAGCAATGGGTGTCACCCCATTAATCTGACATACAACTGAAGCTGAAAGACGACTACGTTTACGGACAATTGGGGGTGTCACCCCATTAATCTGACATACAACTGAAGC

>CP029684|1|1|52051-53604|CRISPRCasFinder
GGGGGTGTCGCCATTAATCTGACATACAACTGAAGC	AGAAATTTTGGAATTTATATAATCACAAAG
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	GCGGTTCAAAGACTGCGATCAGTTTAATTC
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	GCGGTTCAAAGACTGCGATCAGTTTAATTC
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	GGACTGCGAAGACAATCGGCAAGAAATCAC
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	GTATCGGTGTCTTCATCAAAGTCTGGTTCG
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	GCGGTCTAAGTCGTATTGAAGCCAGTGGCA
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	GCGGTCTAAGTCGTATTGAAGCCAGTGGCA
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	TAATAATACCAGCTGCGGGAATATTTAGTT
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	GCGATTGATGCGCTCCACCTCGCTGGTGTT
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	AGTATCAGCGAGCTTATACCGCTCTGTCAT
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	ATCAATGAAAACATGAAAACCCCTTACACT
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	CCATTCTGTGACTCCTTTTTAGCTTTTCTTG
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	GAACTCGGACTTGCTAAATCTTTTTTGTAA
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	TGGACGTCGAAAATGCACGCTGGCGTATCA
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	ATGGTTACGATAACTTGTTGGCTGCCTTAG
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	GAATATCCGAGCTTCTCTATCACACTTGCG
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	ATTTCAAACGAAGCCATCGCAGAATTGACA
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	GAGGGAGCTATTGGTAACTTGCAAGCCAAC
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	ATGGAATCAACGAAGAGCAAGCCCAAGAG
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	TTCATATCATCTATTAAATCACTATATAAA
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	TATCTGACGCTGTTGGTATACAAGTCACAA
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	CCAACTAATTGCTTTATTGATATTAGCAAT
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	TGAAAGACGACTACGTTTACGGACAATTGG
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC

>CP029684|1|1|52051-53604|CRT
GGGGGTGTCGCCATTAATCTGACATACAACTGAAGC	AGAAATTTTGGAATTTATATAATCACAAAG
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	GCGGTTCAAAGACTGCGATCAGTTTAATTC
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	GCGGTTCAAAGACTGCGATCAGTTTAATTC
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	GGACTGCGAAGACAATCGGCAAGAAATCAC
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	GTATCGGTGTCTTCATCAAAGTCTGGTTCG
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	GCGGTCTAAGTCGTATTGAAGCCAGTGGCA
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	GCGGTCTAAGTCGTATTGAAGCCAGTGGCA
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	TAATAATACCAGCTGCGGGAATATTTAGTT
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	GCGATTGATGCGCTCCACCTCGCTGGTGTT
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	AGTATCAGCGAGCTTATACCGCTCTGTCAT
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	ATCAATGAAAACATGAAAACCCCTTACACT
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	CCATTCTGTGACTCCTTTTTAGCTTTTCTTG
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	GAACTCGGACTTGCTAAATCTTTTTTGTAA
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	TGGACGTCGAAAATGCACGCTGGCGTATCA
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	ATGGTTACGATAACTTGTTGGCTGCCTTAG
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	GAATATCCGAGCTTCTCTATCACACTTGCG
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	ATTTCAAACGAAGCCATCGCAGAATTGACA
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	GAGGGAGCTATTGGTAACTTGCAAGCCAAC
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	ATGGAATCAACGAAGAGCAAGCCCAAGAG
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	TTCATATCATCTATTAAATCACTATATAAA
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	TATCTGACGCTGTTGGTATACAAGTCACAA
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	CCAACTAATTGCTTTATTGATATTAGCAAT
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	TGAAAGACGACTACGTTTACGGACAATTGG
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC

>CP029684|1|1|52249-52483|PILER-CR
GGGTGTCACCCCATTAATCTGACATACAACTGAAGCG	GACTGCGAAGACAATCGGCAAGAAATCAC
GGGTGTCACCCCATTAATCTGACATACAACTGAAGCG	TATCGGTGTCTTCATCAAAGTCTGGTTCG
GGGTGTCACCCCATTAATCTGACATACAACTGAAGCG	CGGTCTAAGTCGTATTGAAGCCAGTGGCA
GGGTGTCACCCCATTAATCTGACATACAACTGAAGCGCGGTCTAAGTCGTATTGAAGCCAGTGGCAGGGTGTCACCCCATTAATCTGACATACAACTGAAGCTAATAATACCAGCTGCGGGAATATTTAGTTGGGTGTCACCCCATTAATCTGACATACAACTGAAGC	GCGATTGATGCGCTCCACCTCGCTGGTGTT
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	AGTATCAGCGAGCTTATACCGCTCTGTCAT
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	ATCAATGAAAACATGAAAACCCCTTACACT
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	CCATTCTGTGACTCCTTTTTAGCTTTTCTTG
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	GAACTCGGACTTGCTAAATCTTTTTTGTAA
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	TGGACGTCGAAAATGCACGCTGGCGTATCA
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	ATGGTTACGATAACTTGTTGGCTGCCTTAG
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	GAATATCCGAGCTTCTCTATCACACTTGCG
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	ATTTCAAACGAAGCCATCGCAGAATTGACA
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	GAGGGAGCTATTGGTAACTTGCAAGCCAAC
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	ATGGAATCAACGAAGAGCAAGCCCAAGAG
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	TTCATATCATCTATTAAATCACTATATAAA
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	TATCTGACGCTGTTGGTATACAAGTCACAA
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	CCAACTAATTGCTTTATTGATATTAGCAAT
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	TGAAAGACGACTACGTTTACGGACAATTGG


>CP029684|1|2|52579-53604|PILER-CR
	GACTGCGAAGACAATCGGCAAGAAATCAC
GGGTGTCACCCCATTAATCTGACATACAACTGAAGCG	TATCGGTGTCTTCATCAAAGTCTGGTTCG
GGGTGTCACCCCATTAATCTGACATACAACTGAAGCG	CGGTCTAAGTCGTATTGAAGCCAGTGGCA
GGGTGTCACCCCATTAATCTGACATACAACTGAAGCGCGGTCTAAGTCGTATTGAAGCCAGTGGCAGGGTGTCACCCCATTAATCTGACATACAACTGAAGCTAATAATACCAGCTGCGGGAATATTTAGTTGGGTGTCACCCCATTAATCTGACATACAACTGAAGC	GCGATTGATGCGCTCCACCTCGCTGGTGTT
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	AGTATCAGCGAGCTTATACCGCTCTGTCAT
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	ATCAATGAAAACATGAAAACCCCTTACACT
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	CCATTCTGTGACTCCTTTTTAGCTTTTCTTG
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	GAACTCGGACTTGCTAAATCTTTTTTGTAA
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	TGGACGTCGAAAATGCACGCTGGCGTATCA
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	ATGGTTACGATAACTTGTTGGCTGCCTTAG
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	GAATATCCGAGCTTCTCTATCACACTTGCG
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	ATTTCAAACGAAGCCATCGCAGAATTGACA
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	GAGGGAGCTATTGGTAACTTGCAAGCCAAC
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	ATGGAATCAACGAAGAGCAAGCCCAAGAG
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	TTCATATCATCTATTAAATCACTATATAAA
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	TATCTGACGCTGTTGGTATACAAGTCACAA
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	CCAACTAATTGCTTTATTGATATTAGCAAT
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC	TGAAAGACGACTACGTTTACGGACAATTGG
GGGTGTCACCCCATTAATCTGACATACAACTGAAGC

Protein	Signature genes	Signature genes Name	Protein_function
CP029684.1\|QAS69076.1\|49197_49869_-\|hemin-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224059
CP029684.1\|QAS69084.1\|59507_60326_+\|alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176258
CP029684.1\|QAS69075.1\|48281_49124_+\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381314
CP029684.1\|QAS69081.1\|54620_55487_-\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|187851
CP029684.1\|QAS70579.1\|51367_51715_+\|cell-division-protein	unknown	unknown	gnl\|CDD\|367091
CP029684.1\|QAS69088.1\|62398_63784_-\|6-phospho-beta-glucosidase	unknown	unknown	gnl\|CDD\|225343
CP029684.1\|QAS69086.1\|60711_61020_-\|PTS-sugar-transporter-subunit-IIB	unknown	unknown	gnl\|CDD\|224357
CP029684.1\|QAS69074.1\|46784_48125_-\|glutathione-reductase	unknown	unknown	gnl\|CDD\|224169
CP029684.1\|QAS69071.1\|44778_45222_+\|transcriptional-repressor	unknown	unknown	gnl\|CDD\|133478
CP029684.1\|QAS69087.1\|61046_62381_-\|PTS-cellobiose-transporter-subunit-IIC	unknown	unknown	gnl\|CDD\|224372
CP029684.1\|QAS69083.1\|56437_59578_-\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	cas9	mkCas0193_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|374653
CP029684.1\|QAS69072.1\|45225_46098_+\|N-acetylmuramoyl-L-alanine-amidase	unknown	unknown	gnl\|CDD\|119407
CP029684.1\|QAS69078.1\|51114_51366_+\|antitoxin-of-toxin-antitoxin-stability-system	unknown	unknown	unknown
CP029684.1\|QAS69073.1\|46123_46690_-\|deaminase	unknown	unknown	gnl\|CDD\|223340
CP029684.1\|QAS69085.1\|60380_60701_-\|PTS-cellobiose-transporter-subunit-IIA	unknown	unknown	gnl\|CDD\|376749
CP029684.1\|QAS69082.1\|55674_56487_-\|hypothetical-protein	cas9	mkCas0193_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|374655
CP029684.1\|QAS69077.1\|49883_50939_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223650
CP029684.1\|QAS69070.1\|43711_44635_-\|metal-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238502
CP029684.1\|QAS69079.1\|53636_54302_-\|type-II-A-CRISPR-associated-protein-Csn2	csn2	cd12218_csn2_CAS-II-A	gnl\|CDD\|213411
CP029684.1\|QAS69080.1\|54298_54619_-\|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0206_cas2_CAS-I:CAS-II:CAS-III	gnl\|CDD\|226043

Protein	Function_ID	Function_description	E-value
CP029684.1\|QAS69076.1\|49197_49869_-\|hemin-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224059	COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms].	1.64696e-89
CP029684.1\|QAS69084.1\|59507_60326_+\|alcohol-dehydrogenase	gnl\|CDD\|176258	cd08298, CAD2, Cinnamyl alcohol dehydrogenases (CAD). These alcohol dehydrogenases are related to the cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Cinnamyl alcohol dehydrogenases (CAD) reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	1.23771e-134
CP029684.1\|QAS69075.1\|48281_49124_+\|aldo/keto-reductase	gnl\|CDD\|381314	cd19088, AKR_AKR13B1, AKR13B family of aldo-keto reductase (AKR). Xylella fastidiosa phenylacetaldehyde dehydrogenase is a founding member of aldo-keto reductase family 13 member B1 (AKR13B1). phenylacetaldehyde dehydrogenase (EC 1.2.1.39) catalyzes the NAD+-dependent oxidation of phenylactealdehyde to phenylacetic acid.	3.814e-132
CP029684.1\|QAS69081.1\|54620_55487_-\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|187851	cd09720, Cas1_II, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer intergration. Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	1.14892e-95
CP029684.1\|QAS70579.1\|51367_51715_+\|cell-division-protein	gnl\|CDD\|367091	pfam02452, PemK_toxin, PemK-like, MazF-like toxin of type II toxin-antitoxin system. PemK is a growth inhibitor in E. coli known to bind to the promoter region of the Pem operon, auto-regulating synthesis. This family represents the toxin molecule of a typical bacterial toxin-antitoxin system pairing. The family includes a number of different toxins, such as MazF, Kid, PemK, ChpA, ChpB and ChpAK.	4.76502e-15
CP029684.1\|QAS69088.1\|62398_63784_-\|6-phospho-beta-glucosidase	gnl\|CDD\|225343	COG2723, BglB, Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].	2.6032e-159
CP029684.1\|QAS69086.1\|60711_61020_-\|PTS-sugar-transporter-subunit-IIB	gnl\|CDD\|224357	COG1440, CelA, Phosphotransferase system cellobiose-specific component IIB [Carbohydrate transport and metabolism].	7.77182e-38
CP029684.1\|QAS69074.1\|46784_48125_-\|glutathione-reductase	gnl\|CDD\|224169	COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion].	4.64911e-112
CP029684.1\|QAS69071.1\|44778_45222_+\|transcriptional-repressor	gnl\|CDD\|133478	cd07153, Fur_like, Ferric uptake regulator(Fur) and related metalloregulatory proteins; typically iron-dependent, DNA-binding repressors and activators. Ferric uptake regulator (Fur) and related metalloregulatory proteins are iron-dependent, DNA-binding repressors and activators mainly involved in iron metabolism. A general model for Fur repression under iron-rich conditions is that activated Fur (a dimer having one Fe2+ coordinated per monomer) binds to specific DNA sequences (Fur boxes) in the promoter region of iron-responsive genes, hindering access of RNA polymerase, and repressing transcription. Positive regulation by Fur can be direct or indirect, as in the Fur repression of an anti-sense regulatory small RNA. Some members sense metal ions other than Fe2+. For example, the zinc uptake regulator (Zur) responds to Zn2+, the manganese uptake regulator (Mur) responds to Mn2+, and the nickel uptake regulator (Nur) responds to Ni2+. Other members sense signals other than metal ions. For example, PerR, a metal-dependent sensor of hydrogen peroxide. PerR regulates DNA-binding activity through metal-based protein oxidation, and co-ordinates Mn2+ or Fe2+ at its regulatory site. Fur family proteins contain an N-terminal winged-helix DNA-binding domain followed by a dimerization domain; this CD spans both those domains.	1.40521e-27
CP029684.1\|QAS69087.1\|61046_62381_-\|PTS-cellobiose-transporter-subunit-IIC	gnl\|CDD\|224372	COG1455, CelB, Phosphotransferase system cellobiose-specific component IIC [Carbohydrate transport and metabolism].	1.37965e-116
CP029684.1\|QAS69083.1\|56437_59578_-\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	gnl\|CDD\|374653	pfam16592, Cas9_REC, REC lobe of CRISPR-associated endonuclease Cas9. The REC lobe of Cas9 - the CRISPR-associated endonuclease Cas9 - includes the REC1 and REC2 domains. REC1 forms an elongated, alpha-helical structure consisting of 25 alpha helices and two beta-sheets, whereas REC2 inserted within REC1 adopts a six-helix bundle structure. The REC lobe and the NUC lobe of Cas9 fold to present a positively charged groove at their interface which accommodates the negatively charged sgRNA:target DNA heteroduplex. CRISPR (clustered regularly interspaced short palindromic repeat)-Cas system occurs naturally in bacteria as a defense against invasion by phages or other mobile genetic elements. Cas9 is targeted to specific genomic locations by sgRNAs or single guide RNAs, in order to complex with invading DNA in order to cleave it and render it inactive.	4.62116e-117
CP029684.1\|QAS69072.1\|45225_46098_+\|N-acetylmuramoyl-L-alanine-amidase	gnl\|CDD\|119407	cd02696, MurNAc-LAA, N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA (also known as peptidoglycan aminohydrolase, NAMLA amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC 3.5.1.28) is an autolysin that hydrolyzes the amide bond between N-acetylmuramoyl and L-amino acids in certain cell wall glycopeptides. These proteins are Zn-dependent peptidases with highly conserved residues involved in cation co-ordination. MurNAc-LAA in this family is one of several peptidoglycan hydrolases (PGHs) found in bacterial and bacteriophage or prophage genomes that are involved in the degradation of the peptidoglycan. In Escherichia coli, there are five MurNAc-LAAs present: AmiA, AmiB, AmiC and AmiD that are periplasmic, and AmpD that is cytoplasmic. Three of these (AmiA, AmiB and AmiC) belong to this family, the other two (AmiD and AmpD) do not. E. coli AmiA, AmiB and AmiC play an important role in cleaving the septum to release daughter cells after cell division. In general, bacterial MurNAc-LAAs are members of the bacterial autolytic system and carry a signal peptide in their N-termini that allows their transport across the cytoplasmic membrane. However, the bacteriophage MurNAc-LAAs are endolysins since these phage-encoded enzymes break down bacterial peptidoglycan at the terminal stage of the phage reproduction cycle. As opposed to autolysins, almost all endolysins have no signal peptides and their translocation through the cytoplasmic membrane is thought to proceed with the help of phage-encoded holin proteins. The amidase catalytic module is fused to another functional module (cell wall binding module or CWBM) either at the N- or C-terminus, which is responsible for high affinity binding of the protein to the cell wall.	1.26871e-58
CP029684.1\|QAS69080.1\|54298_54619_-\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	1.96643e-27
CP029684.1\|QAS69073.1\|46123_46690_-\|deaminase	gnl\|CDD\|223340	COG0262, FolA, Dihydrofolate reductase [Coenzyme metabolism].	3.05353e-18
CP029684.1\|QAS69085.1\|60380_60701_-\|PTS-cellobiose-transporter-subunit-IIA	gnl\|CDD\|376749	pfam02255, PTS_IIA, PTS system, Lactose/Cellobiose specific IIA subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. The lactose/cellobiose-specific family are one of four structurally and functionally distinct group IIA PTS system enzymes. This family of proteins normally function as a homotrimer, stabilized by a centrally located metal ion. Separation into subunits is thought to occur after phosphorylation.	7.32028e-40
CP029684.1\|QAS69082.1\|55674_56487_-\|hypothetical-protein	gnl\|CDD\|374655	pfam16595, Cas9_PI, PAM-interacting domain of CRISPR-associated endonuclease Cas9. Cas9_PI is a family found at the C-terminal of bacterial type II CRISPR system Cas9 endonuclease. This domain adopts a novel protein fold that is unique to the Cas9 family. It is positioned in the structure-DNA-complex to recognize the PAM sequence on the non-complementary DNA strand of the crRNA. PAM sequence is protospacer-adjacent motifs on DNA. See family CRISPR-DR2, Rfam:RF01315. Cas9 carries two nuclease domains, HNH and RuvC, which cleave the DNA strands that are complementary and non-complementary to the 20 nucleotide guide sequence in crRNAs, respectively.	5.59804e-24
CP029684.1\|QAS69077.1\|49883_50939_-\|ABC-transporter-permease	gnl\|CDD\|223650	COG0577, SalY, ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms].	9.83825e-05
CP029684.1\|QAS69070.1\|43711_44635_-\|metal-ABC-transporter-substrate-binding-protein	gnl\|CDD\|238502	cd01020, TroA_b, Metal binding protein TroA_b. These proteins are predicted to function as initial receptors in ABC transport of metal ions. They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains. In addition, these proteins sometimes have a low complexity region containing a metal-binding histidine-rich motif (repetitive HDH sequence).	1.90615e-119
CP029684.1\|QAS69079.1\|53636_54302_-\|type-II-A-CRISPR-associated-protein-Csn2	gnl\|CDD\|213411	cd12218, Csn2, CRISPR/Cas system-associated protein Csn2. Csn2 is a Nmeni subtype-specific Cas protein, which may function in the adaptation process which mediates the incorporation of foreign nucleic acids into the microbial host genome. Csn 2 may interact directly with double-stranded DNA. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Csn2 has been predicted to be a functional analog of Cas4 based on anti-correlated phyletic patterns; also known as SPy1049 family.	7.9924e-46

>CP029684.1|QAS70579.1|51367_51715_+|cell-division-protein
MVFDPTYIPDQQDLIIIDFDPSRGREIQKRRPALVISNAGYSQVTGLVAVCPITHAQANHLHEYFVLVNTDRVDGYINPFQFFTFDFRQRQAVKVDLLATPTFIQVKQVILDVLA
>CP029684.1|QAS69078.1|51114_51366_+|antitoxin-of-toxin-antitoxin-stability-system
MVDTIIGAAVKIRKSGNSNILTVPKEIKPRAQTYQVFQGRDGMIVYVPTHQNPFKDKNWVAAHHNMIQPEEIGGPLLGTELSD
>CP029684.1|QAS69077.1|49883_50939_-|ABC-transporter-permease
MYLAIKEMLHERLRYSLLTGILALIALVVFVLSGLAMGLSQGNRLAIDDWQASEVYLNKNANKVLAASQLSTSDLKKVQARSKAAVAVYAAVLQSKTTKINVSVLATSNKSTIMPRVLHGKQITAVDQVLVSQNLLAQGVKIGQHILLGPDKIATKIVGSYGKSTYSIVPTVYTNLSTMSRIKGQNTNPSNLINGIVATKSHFSTTQHQGLQKLSIADFINNLPGYTAQQSTLNGMIYFLFFIALAIVGIFMFILTLQKRKLFAVMKVQGISNREILTSILFQAALMSAIAVVISLILTIIMAVSLPSQVPFYFQTSQLLIDSLSLFLAAVIGGLASWPSVKNIDPVISIG
>CP029684.1|QAS69076.1|49197_49869_-|hemin-ABC-transporter-ATP-binding-protein
MTAVLELDHVFKKFGQGHTLVTALNDVTFQAARGEFVAVIGPSGSGKSTFLTIAAGLQQATSGRVLLNGQQLDQQSENQRLSYRFQQVGFILQSSNLMPFLTVQEQFILVDKLAHRAFRKERYEQFLTDLDLDHLSASFPNQLSGGERQRVAIARALYNDPSVILADEPTASLDTERSLDVVQRLADEAHKRQKAIVMVTHDTRLIKKCDSVYEIIDGNMQKN
>CP029684.1|QAS69075.1|48281_49124_+|aldo/keto-reductase
MQKTFQFDDDLTVNRLGYGTMQLPGKGVWGPAADPAAAVKVIDTAIDHGVNFIDTADAYGPLFANLYVKEALKQRPDAKVIVATKVGFTRQGPDQWTVVGRPAYLRQQVEENLYTLGLDHIDLLQLHRIDPEVDLADQINVLKDMQREGKIKHIGLSQVSVKQIKAVRKIVPIVSVQNRYNLVDRHDEDVLEYAEKHHIAFIPWFPLATGKLLDNKKLVKLTEKYHASPAQLALAWLLKRSEVILPIPGSANSEHVINNIAAQDIDLTDEDFKSLNKLGK
>CP029684.1|QAS69074.1|46784_48125_-|glutathione-reductase
MSTKQYDYDVLYIGSGHGTFDGAIPLAAKGFKVAIVESGLIGGTCPNRGCNAKITLDAPVVLQRQFEDLKGIVDGSLSINWQKNVAHKDEVIGGLPDFISGLLKSVGIDVLSGHGSFQDAHTVLVDGQAKTADKIVLATGLHPHRLNIPGSELAHDSSEFMNLATLPKRLAIIGSGYIALEFATIANAAGAEVTVVTHGDRALRKFDKSFVQIVVDDLQDRGVQFAFNTAVTSFEKADDAFVVKAADGFELASDWVLDATGRIPNIENIGLDKVDVAYNAHGIIVNDHLQTNIDNIYASGDVIDKTQPKLTPTAIFESTYLKQLFAGETTAAIKYPAIPSVVFTSPRLAEVGVSPETAAADPEHYTIESHHIPDDWYRQVGKEKLGDNRLIFDKEHHLVGATEVSAQADDVINTLLPAVEFKFGPAELGRLVYLFPSISSSAFGQL
>CP029684.1|QAS69073.1|46123_46690_-|deaminase
MAKLIYAINMSLDGYIEDAQGNLDWSISDDELFAFWTDFQRSINTCLYGRRMYESMVYWETARAESSGHKAAATRKFAQLWQQSRKIVYSRTLQTVSSARTHVERQFDGDVIKKLKASSEADMSIGGAKLAGQAMHAGLVDELHLLVDPIILGGGKAALPSQLEFKLDLLNERRLQSGVVDLHYRMLV
>CP029684.1|QAS69072.1|45225_46098_+|N-acetylmuramoyl-L-alanine-amidase
MKKISSFVINHIKKSRPRQLIAGILTLIVIGLAIFKIGSFFTESKITAQSINLCSSPSPKSSIVSRLNQGKRIKVISKNKNTSWWYVASGNQKGWVASWLIDQSSYNAKTDGRLAETTIVLDPGHGGIDSGTLAANGAMEKSYTLLTALKTYRLLKAEKVNVIMTRKSNKTVSLAHRVDLSNRVKANLYISFHFNSAGVQNAAQGYEVFKYHHNADKFAISLDKRFNNLPLYDRGVAYGNFEVLRDNTRPAILIEMGFMDNDDDFAYIQKASYQEKIARDILQNAKSYFN
>CP029684.1|QAS69071.1|44778_45222_+|transcriptional-repressor
MKKELKTALKLVKKAGMKVTNQRQDIISYLIDHQDHYVSITDIDKHMRQKYANMSYQTVYRNLQEFEDAHLVEQRPLAGGKFVKYQCDFNNLDHYHFICQICGRVIELKEMSADYFQDQVTGCKILKQQVEITGICDGCLAKQALVN
>CP029684.1|QAS69070.1|43711_44635_-|metal-ABC-transporter-substrate-binding-protein
MSSKNNYRKIGAVILAIFAITVFLFMNIGGKNNSAQGRAKSSKIKVVASVDFYGEVAKAVLGNKGTVTSVIKNPNIDPHDYQPTSQVAKTVSQADFVLYNGIGYDTWMTKLADNSSKTAKIRVGEDLLNKKNGDNPHLWYQSKTMPKLANYLADRFSKAQPKNKAYFKKNAAKFIKSIKPIQTKLTQLSKNSHNKLVDVSEPVFDYALAELGYKENNTHFAKSVEDSTDPAPKDIKTMQHDMTSGKVAFFVENTQASDKIVKNIVKLAKAHNVPVLKVTETMPRGKNYKQWMLDQLAALAKIQKTSK
>CP029684.1|QAS69079.1|53636_54302_-|type-II-A-CRISPR-associated-protein-Csn2
MTINLTFYPFDPFELGKGLTVIATDSIQFFWKFEQMLKNQDDNLVLSSDFKPLSLEKEIIFAGDIAGGFEANSFFAKKIQSLFLSYLSDETTKQLFDLDRQIKQQLNKIIFSNDLPIKISDEWSTAMLVKSQNLSLDTGEASSAYDKIDDIVNVMSELHDTRLLVLTNLHLYLKKEQIDYLSTFLNAKGVKVLSVELSEERVLLSDESSKSYFIDKDFVQF
>CP029684.1|QAS69080.1|54298_54619_-|CRISPR-associated-endonuclease-Cas2
MRYRVVRLMLFFDLPTLTSNDRRNYRQFRKELIKEGFLMIQESVYVRIVTNKLTAEFMEKRLSSIAPEEGIIQTLIVTEKQYASMKFLAGEQIDDVRNSDDKVVVI
>CP029684.1|QAS69081.1|54620_55487_-|type-II-CRISPR-associated-endonuclease-Cas1
MAWRSILVTQQAKISFKMNQIIVQTLDDIKQIPIDDIEILIVGTTRVAITSYAIMMCIKSNVKIIFTDEHSSPIGEIDPYYSNHDRNRHILSQISWSSTKKNLLWQQITICKIRNQANLLNKLALDGESIYKLSNQVENGDSDNREAVAARMYFPRLFGDGFTRRNSEDDINGILNYGYSVLLSSMNREINAAGYFTNLGIHHKGIENQFNLASDLIEVFRPFVDEIAYKHAIEMLNQNIKIELIDVLNHSFILNDKETLVSNAMTEIVRDSVSFLDESTPHLLAWKF
>CP029684.1|QAS69082.1|55674_56487_-|hypothetical-protein
MMVNCTTRLSIKSVLHDKTKRKLVPYKGDKDPQYYGGFSSTTSAYSALVRVNKKDDHSNVVVKIPLAIANQIERKSTTVYDYISSLKIKGFETVILDSIKLGQLVRESDGSLFFLASSEYKHNAKELWVPNDIYQTVGKDLVTTSPNKDALAKIFNTLTSLAVEKRFNFYAKDVVHLRSLKNNFLQLDLSDQQKLLSDLIYILGNNAGYRDPIKKYFKTEKAWTSLQTKGNGQGGIKLSDGAEFIFQSPTGLFTRTISVTDLYKNKKTKE
>CP029684.1|QAS69083.1|56437_59578_-|type-II-CRISPR-RNA-guided-endonuclease-Cas9
MGLLNEIFTPTLSDMDENFIRRLKYSWVNPNDEANSSHFYGGYLFGSKEKDQQFHLDYPTIYHLRQKLVIDDSKHDLREIYLAIHHIVKYRGNFLNPAEKINTENAFNAKHFSDGLDNYISYVSDDNFAVSITDLIEFEKAVTNLKLKNNSQRIDAAKAAMSFDSKNNRVRVESILKAILGNQADLSKIFNKEIENKDDLKKWKIFFSDETIDDEIEGLRGELTEEENEFLDNLKEAYDGLTLKSILGDENSISAAMVRSYDNYHRDWETIKTQVRNSSNSKEIKRAYALIISPDEDIIKKGREAFKKIISESSVADSVKNDLLNKIENDTFLVKQRTKRNGVLPNQLHVQELEQIINKQSKFYPFLADTFTQEGKTQFKLVALAKFRVPYYVGPLVEKDKVTGDGTNHWMIRKDETGVITPWNFSEKVDKDASGGQFIKRLTGTDTYLIGEETLAENSLCYQKFNVLQELNNIRIDNNGRYSRLSVVDKQNIYEHIFKQQRNVSAADISNYLESQYGKRVMITGLSSNEKKFNSSLKSFHDLKKNFTDDFLNDPVNNKVLEDIIELQTVFEDKQVLHHNLSKIAILTQEQIDKLSNTHYTGWGRLSSKLLNTRMVSIQLTNDLENQKHSILESLYDSDKNLMEIITDDTLGAKQWIEKENNAQAKDSSIGDLINDLAGAPDIKRGIRQSFAILDDLEKAIGNKPDRVYLEFARENHGSAQKNSRLSAVQKLYKTIQKSGVLAEISRELENETKEHLQDDQLFLYYLQQGKDMYTGKSIDLDKISANYDIDHIIPQAYIKDDSLDNRVLVNKESNARKTDSPFYLQDVQEKQRAFWQSLAQQGFMSKEKLRRLTRRGTDFSENEKEHFIARQLVETRQIIKNVASLIDTYYKGEVKAVAIRSAQTSDMRRYLHVNKNRDINDFHHGFDALMISTVGKYIERRNPKSDKVFLYNDFDHYSKEWLKKSRVDHKDDSARVNTFGYIVGSMRSASNLNRINKETGELVWNETDKQYLLRVLNYKNINVTRMSGIHDGKLYNETIYKKCFA
>CP029684.1|QAS69084.1|59507_60326_+|alcohol-dehydrogenase
MRRRIKFSSISDKVGVKISFNKPNRQWLRWTCGVCAFCRSGRENLCPNSIYTGWDHDGGYAEYATVPEAFAYRIPAAFKSNTAAPLLCAGIIGYRAYKQAQLPAGGRLGLYGFGGSAHLTAELAIAQGIEVHVFTRGKDAQNLALALGAASVQDTYDPSPVKLDSSIIFAPVGNAVPMALESLAPTGRLVIAGIHLTDIPSLSYDSHIFHEKVLTSVESNTRKDGEEFLTLASRLKIHPKITEYPLDQADKALIDLSHGDVQGANVLRVSEG
>CP029684.1|QAS69085.1|60380_60701_-|PTS-cellobiose-transporter-subunit-IIA
MIEDFENQDVIMGLIISGGNSKGASFEAIKAAKTGDFTKADAKLKEADQFLTEAHNSQTQMLTNEANGIHAKMSLLMVHAQDHVMNAITFRDLAGEIVDLYRSTRK
>CP029684.1|QAS69086.1|60711_61020_-|PTS-sugar-transporter-subunit-IIB
MTTKKIMLVCSAGMSTSLLVKKMQESAVAIGEEVSIFATSASDAQNKLDSEHPNILMLGPQVKYLLSDFQRRLTIPVEVINMQDYGLMNGKNVLTQALKDIG
>CP029684.1|QAS69087.1|61046_62381_-|PTS-cellobiose-transporter-subunit-IIC
MDNSEKKSTGKKVLDKFSDFSARVGNEVHLRSLRDSFAMIMPLFILAGVAVLINNVIFPLIASGNSLVNLQFWGNMVTNGTLNIAGLVLAPVIGYTLARNKGFENALLPAVIALSSLVIVMPFTLNVIPVGATKTVNVSGILSFSNLGTTGMFAGIIIGLVATEIFMRLSKIKHLKINIGGNVPPSVSASFSDMIPVIITLSFMALLSALLLVLGKTNLIALITNLIQEPLRRFNTSLPGMLFIYSCGNFLFTLGIHQTVINGTLLDPVLLINMNKNMAAYAAHKAIPYILTNTFRDTFGMIGGTGSTLCLLIAIFIFSKQRASKNVASLAGAPGIFNINEPVIFGYPIVFNIPMMIPFVLQPVIGILIAYFFTSIGWMSRVVVLIPWTTPPLLSAYLATAGDWRAVLVQLLIIIFGVAFYLPFMKISERVVARETALASKKTV
>CP029684.1|QAS69088.1|62398_63784_-|6-phospho-beta-glucosidase
MEIFRVGKLKKDFFWGNSTSSMQTEGAWNEGGKGLSIYDIKPSTENSSDWKIAIDEYHRYPEDIKIMKDLGMNFYRFQISWSRIQPDGEGEFNQEGIDFYRRFISELLDAGIEPMICLYHFDMPLALAKKYNGFLNRRVVDLFFEYAKKMINIFGDQVKYWLTFNEQNCFSLSSAFASSGYLNGGKTVRELYQIQHNIILAHCRIANYVHDLKPDLLIGGMEAFQEVYPASALPADVEVVRKYKEFVDYNLLRIFTEGKYSSEVVCFMEKNHIEDILKVSDLAEISRNRSDFISFSYYTTTTLTSSEIPIASVPNYYGEAGYKKNPYLLSNEWNWQIDPQGFYGILMDLFNRTHLPIFPIENGIGVRENWDGKHQINDDYRIYYHRVHIQALEKAVSDGVDVIGYLGWGLIDIPSSRGDVDKRYGVVYVNRTNHELLDLKRVPKKSYYWLQKVIKSNGTEL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP029684_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP029684_2

1634226-1640480

TypeI-E

I-E

Consensus_repeat	Method
AGGATCACCCCCGCTTGTGCGGGGAATAC	CRISPRCasFinder
NNAGGATCACCCCCGCTTGTGCGGGGAATAC	CRT
AGGATCACCCCCGCTTGTGCGGGGAATAC	PILER-CR

102 spacers

DEDDh,cas1,cas6e,cas5,cas7,cse2gr11,cas8e,cas3

The CRISPR arrays of CP029684_2

>merge|CP029684|2|1634226-1640480|CRISPRCasFinder,CRT,PILER-CR
AGGATCACCCCCGCTTGTGCGGGGAATACCTTATAACCAATGACAAAGAAAGCAATGTTATAGGATCACCCCCCCGCTTGTGCGGGGAATACTTATTTTTCAAGGCAAAGATGATGGCCGTTGTAGGATCACCCCCGCTTGTGCGGGGAATACGCACCGAGTTCGTTCGCCGTTTCGTTTATTTTAGGATCACCCCCGCTTGTGCGGGGAATACTTTTTGATTTCGTCATCGATATTTTTAATTGGAGGATCACCCCCGCTTGTGCGGGGAATACCGATTGACATTGTCGTTCGGCATGATCCGACTAGGATCACCCCCGCTTGTGCGGGGAATACTGCTTTTCAAACCGTTTACCCAATTTTCTACCAGGATCACCCCCGCTTGTGCGGGGAATACTGTGCTGCTCATGGCTTTCGTCATGACTTTACCAGGATCACCCCCGCTTGTGCGGGGAATACTTCATCAAACAGCCCTAATTTTCCATTTGTCCAGGATCACCCCCGCTTGTGCGGGGAATACAATCGTAATATGCGTCGAGCAATCAACTTGCAAGGATCACCCCCGCTTGTGCGGGGAATACTTTTAAGTATGCCAGCAGGAACATTGGAGCGACGGATCACCCCCGCTTGTGCGGGGAATACTTATAAGCACCCTCTTCATTATGCAGGCGGGCAGGATCACCCCCGCTTGTGCGGGGAATACCAAAATGCTTCTCGAGGCGTGAATGATGGAATAGGATCACCCCCGCTTGTGCGGGGAATACACCCTTTCATGTTTATCTTAACTTTCGGCCACAGGATCACCCCCGCTTGTGCGGGGAATACTGGCTATTTTGGCATCTGCCTGGGCTTTTTCTAGGATCACCCCCGCTTGTGCGGGGAATACCCGCTGATTTACCAGATGATCTAAGTGATAAAAGGATCACCCCCGCTTGTGCGGGGAATACACAACGTTGATGAAAAATACGTTGATTGGACTAGGATCACCCCCGCTTGTGCGGGGAATACTGTGCTGCTCATGGCTTTCGTCATGACTTTACCGGATCACCCCCGCTTGTGCGGGGAATACTTCATCAAACAGCCCTAATTTTCCATTTGTCCAGGATCACCCCCGCTTGTGCGGGGAATACCTCTTTTTGCGCTTGCGGTTGACCCTCCCACCAGGATCACCCCCGCTTGTGCGGGGAATACGCAGAGGTTAAGGAAACTTTGAAGTTATCATGAGGATCACCCCCGCTTGTGCGGGGAATACTACATAAATATCAGTATTGCAAGTTTAAACGTAGGATCACCCCCGCTTGTGCGGGGAATACTTCCATCAGATGAAGTTTTGCCGTTCTAAGCGAGGATCACCCCCGCTTGTGCGGGGAATACTACACGACAATGACCAGAACTATGAATTATTGAGGATCACCCCCGCTTGTGCGGGGAATACTGGAACGGTATTATCGTTGTGGCCACGGCCGTAGGATCACCCCCGCTTGTGCGGGGAATACTCGCCTTTTAAGGTTTTAACGGCGTACTTGCTAGGATCACCCCCGCTTGTGCGGGGAATACTGGTTGATGCAGCCAAAAATCTGCGCTTAAGCGGGATCACCCCCGCTTGTGCGGGGAATACATTTCGGCAATATTTTCAATTCATGAATTTTCAGGATCACCCCCGCTTGTGCGGGGAATACCCACCTTTGACAGCGGTTACTGAAGACTGGCTGGGATCACCCCCGCTTGTGCGGGGAATACAAGAAAGCCTAACCGAAAAATACCAAAATTATAGGATCACCCCCGCTTGTGCGGGGAATACAATGTGCTTGATTCAAGCTATGGCAATGACTCAGGATCACCCCCGCTTGTGCGGGGAATACTGATTTGCAAATCATCGAGGAGGAAAAAAATGAGGATCACCCCCGCTTGTGCGGGGAATACTTTCATTTAAATATGCATGCTGATGATGACGGAGGATCACCCCCGCTTGTGCGGGGAATACACGGTCACATTATCGCCAACATACGATCAGGAAGGATCACCCCCGCTTGTGCGGGGAATACTCCCATGGGGTTCAGGCCTGAAAAGTGTTGCTAGGATCACCCCCGCTTGTGCGGGGAATACCTTTTCCTGCCGTTTCTGCCATTGCTTGCTCCAGGATCACCCCCGCTTGTGCGGGGAATACCCCACCAGCTGTCTGGCATTGAGATAGTTCGTAGGATCACCCCCGCTTGTGCGGGGAATACGTAGTCATGGACAATTCAGCACAGATTCAATCAGGATCACCCCCGCTTGTGCGGGGAATACGATTCAAAAAATTAGTTTTAATCGTCGTATCAAGGATCACCCCCGCTTGTGCGGGGAATACGTCATCTAACAAGCTTACAATTTGGTCCCTTAAGGATCACCCCCGCTTGTGCGGGGAATACTTAATGGTTACTCACAGGGCGAAGCTACATTTGGGATCACCCCCGCTTGTGCAGGGAATACTTGCACGTTGGCTATGAATAGCACATATAGCCAGGATCACCCCCGCTTGTGCGGGGAATACCATCATCAGGATCTTCCCGTTCAATTTTGGTTAGGATCACCCCCGCTTGTGCGGGGAATACATTAAAACGTAAATATAACATTCTAAAAGCAGAGGATCACCCCCGCTTGTGCGGGGAATACATGGCCTAACCATACGAATGGGTGGGAAGCCCAGGATCACCCCCGCTTGTGCGGGGAATACGAATTCAGGTTATGAACCAGAATCTTTGCCATAGGATCACCCCCGCTTGTGCGGGGAATACGATCCGTTGCATGATTCTTATGCAGCTGCCTTAGGATCACCCCCGCTTGTGCGGGGAATACCAAGTTTGATAAGTTAGTTATGTTTAGTGGCAGGGATCACCCCCGCTTGTGCGGGGAATACCAGGAATTTTCCAGAGAACCAGACCTATACCAAGGATCACCCCCGCTTGTGCGGGGAATACACGGTACGATTCCGCTCTATCAGTCAACGATTAGGATCACCCCCGCTTGTGCGGGGAATACATCAGGTGGGCGTTTCTGACGCTATGAACATTAGGATCACCCCCGCTTGTGCGGGGAATACTGACATGCACTGGTCGGAGATGTTTTTTGATGAGGATCACCCCCGCTTGTGCGGGGAATACAAATTCACAGCACCGACCATGTGCGGTCTGATAGGATCACCCCCGCTTGTGCGGGGAATACTCAGCTTCTCGAGACAAAGGTGCAATCTGATAAGGATCACCCCCGCTTGTGCGGGGAATACAAAAATTAATAATTTTTGCGCCAGATTCAGCAGGGATCACCCCCGCTTGTGCGGGGAATACATTGAGACGGCCCTACATAAAATTTTGAAGAGAGGATCACCCCCGCTTGTGCGGGGAATACACGGTACGATTCCGCTCTATCAGTCAACGATTAGGATCACCCCCGCTTGTGCGGGGAATACATCGTGTTAATGAAGCCTTATCAGAAGTTACAAGGATCACCCCCGCTTGTGCGGGGAATACTCAGCTTTGTGATGGCTAACAAGGACTGGCTTAGGATCACCCCCGCTTGTGCGGGGAATACTAGCTCACGACGAAGGCTTGACAGAGTTTGCCAGGATCACCCCCGCTTGTGCGGGGAATACTTGCAAGAGGCTTTGGGACAATATTTTGATAAAGGATCACCCCCGCTTGTGCGGGGAATACATTGAGACGGCCCTACATAAAATTTTGAAGAGAGGATCACCCCCGCTTGTGCGGGGAATACACGGTACGATTCCGCTCTATCAGTCAACGATTAGGATCACCCCCGCTTGTGCGGGGAATACATCAGGTGGGCGTTTCTGACGCTATGAACATTAGGATCACCCCCGCTTGTGCGGGGAATACTGACATGCACTGGTCGGAGATGTTTTTTGATGAGGATCACCCCCGCTTGTGCGGGGAATACAAATTCACAGCACCGACCATGTGCGGTCTGATAGGATCACCCCCGCTTGTGCGGGGAATACTCAGCTTCTCGAGACAAAGGTGCAATCTGATAAGGATCACCCCCGCTTGTGCGGGGAATACAAAAATTAATAATTTTTGCGCCAGATTCAGCAGGGATCACCCCCGCTTGTGCGGGGAATACATTACGTCAATGATTTCATTGATTGAAGCATTAGGATCACCCCCGCTTGTGCGGGGAATACTAGCAGCGGCACTAAAAATAGATCCTTGGGAGAGGATCACCCCCGCTTGTGCGGGGAATACGGTTACTTCAAGGAACAGCTTTTGTGCTGCTAAGGATCACCCCCGCTTGTGCGGGGAATACCCTCAGCTTTTGCTTTCCGCTGGGCTGCTTCGAGGATCACCCCCGCTTGTGCGGGGAATACCGTGAGCTGCTGCAGCAAATGTACGGAAAATCAGGATCACCCCCGCTTGTGCGGGGAATACAAATGACCAAAAAACTTTTTGCGAATCTGGGCAGGATCACCCCCGCTTGTGCGGGGAATACTGCAATCTTGGAGCAATCAGCAGGTAAAGGGTAGGATCACCCCCGCTTGTGCGGGGAATACCCGTTAGTTTGACTAATTGGGACTTTAGTTGAAGGATCACCCCCGCTTGTGCGGGGAATACCTACAATTAGATTCTATTTCTAGTTATCAAACAGGATCACCCCCGCTTGTGCGGGGAATACTCCCATGGGGAATAAATCTGAAAAGTGTTGCTAGGATCACCCCCGCTTGTGCGGGGAATACAACAACCTAACAGAATTAATCGGTGGCCTGTTAGGATCACCCCCGCTTGTGCGGGGAATACCTAATTTTATTTGTCATTTTTGTACCTCTTTAAGGATCACCCCCGCTTGTGCGGGGAATACAAGCTAGACGAAACACCACTATTGACACTGGCAGGATCACCCCCGCTTGTGCGGGGAATACTTGTCTCGATGAATACGGTCATATTCAGTTTGAGGATCACCCCCGCTTGTGCGGGGAATACTATCAGAGTCGACGCTCCCGCTGTAACCGCCGAGGATCACCCCCGCTTGTGCGGGGAATACTGTGCCTCAAGCCATGAAAAGTTATTTGTTTAAGGATCACCCCCGCTTGTGCGGGGAATACGGTTTCCTGTCCAGTTTCAAAGAAAAACTGTCAGGATCACCCCCGCTTGTGCGGGGAATACTCAGCCCAGTTCGTCGAAATGAACTGCGAAATAGGATCACCCCCGCTTGTGCGGGGAATACATTTATTAGGACGAGGGACTCCGATGGTGAACAGGATCACCCCCGCTTGTGCGGGGAATACACCATCGTTTGATAAGTCGAGCTCTCAACTTTAGGATCACCCCCGCTTGTGCGGGGAATACGACTAGCAACAAATCGACAACAAAAGATCCTTGGGATCACCCCCGCTTGTGCGGGGAATACTTTCTAGTTCTGATAACTAAGTCAGAATTACCGGGATCACCCCCGCTTGTGCGGGGAATACGAACGGTTAAATTAACACTTAATGGAGTAGTAAGGATCACCCCCGCTTGTGCGGGGAATACTTCAACAAGACGCTGACAATGCCAAACTAGATAGGATCACCCCCGCTTGTGCGGGGAATACTTCAAAAAGGGAACGTTAACCCTGCCACAGATAGGATCACCCCCGCTTGTGCGGGGAATACAAGCACGTATTTCCGGTTCGCCAGCCATCACGAGGATCACCCCCGCTTGTGCGGGGAATACTTTGTTTTGGGCTTGTCTATGGGCGTACTGATAGGATCACCCCCGCTTGTGCGGGGAATACCTCAGTCATTTCGACCGTGTATCGCTTGTTATAGGATCACCCCCGCTTGTGCGGGGAATACAGCCCTATTTTATCTTTTCCCCGTCAATATATAGGATCACCCCCGCTTGTGCGGGGAATACTTTTTTATCAGTCAGCCCAAACAATTCCCGATAGGATCACCCCCGCTTGTGCGGGGAATACCAAGAAGTTCCACTAATCACTGTCGTCGCAGCAGGATCACCCCCGCTTGTGCGGGGAATACTTGATTTGCTGCAATGGCTTGTGTTGGCTTAGAGGATCACCCCCGCTTGTGCGGGGAATACGTTGGCGTGGCAATACTTGCCGTGCCGGTACCAGGATCACCCCCGCTTGTGCGGGGAATACATCCTGTTATGTGATTCATTGTACAGCACACAAGGATCACCCCCGCTTGTGCGGGGAATACCAAAGCCTTGGGCCATAAAACCCAAGCCTTCCCAGGATCACCCCCGCTTGTGCGGGGAATAC

>CP029684|2|2|1634226-1640480|CRISPRCasFinder
AGGATCACCCCCGCTTGTGCGGGGAATAC	CTTATAACCAATGACAAAGAAAGCAATGTTATAG
GATCACCCCCCCGCTTGTGCGGGGAATAC	TTATTTTTCAAGGCAAAGATGATGGCCGTTGT
AGGATCACCCCCGCTTGTGCGGGGAATAC	GCACCGAGTTCGTTCGCCGTTTCGTTTATTTT
AGGATCACCCCCGCTTGTGCGGGGAATAC	TTTTTGATTTCGTCATCGATATTTTTAATTGG
AGGATCACCCCCGCTTGTGCGGGGAATAC	CGATTGACATTGTCGTTCGGCATGATCCGACT
AGGATCACCCCCGCTTGTGCGGGGAATAC	TGCTTTTCAAACCGTTTACCCAATTTTCTACC
AGGATCACCCCCGCTTGTGCGGGGAATAC	TGTGCTGCTCATGGCTTTCGTCATGACTTTACC
AGGATCACCCCCGCTTGTGCGGGGAATAC	TTCATCAAACAGCCCTAATTTTCCATTTGTCC
AGGATCACCCCCGCTTGTGCGGGGAATAC	AATCGTAATATGCGTCGAGCAATCAACTTGCA
AGGATCACCCCCGCTTGTGCGGGGAATAC	TTTTAAGTATGCCAGCAGGAACATTGGAGCGA
CGGATCACCCCCGCTTGTGCGGGGAATAC	TTATAAGCACCCTCTTCATTATGCAGGCGGGC
AGGATCACCCCCGCTTGTGCGGGGAATAC	CAAAATGCTTCTCGAGGCGTGAATGATGGAAT
AGGATCACCCCCGCTTGTGCGGGGAATAC	ACCCTTTCATGTTTATCTTAACTTTCGGCCAC
AGGATCACCCCCGCTTGTGCGGGGAATAC	TGGCTATTTTGGCATCTGCCTGGGCTTTTTCT
AGGATCACCCCCGCTTGTGCGGGGAATAC	CCGCTGATTTACCAGATGATCTAAGTGATAAA
AGGATCACCCCCGCTTGTGCGGGGAATAC	ACAACGTTGATGAAAAATACGTTGATTGGACT
AGGATCACCCCCGCTTGTGCGGGGAATAC	TGTGCTGCTCATGGCTTTCGTCATGACTTTAC
CGGATCACCCCCGCTTGTGCGGGGAATAC	TTCATCAAACAGCCCTAATTTTCCATTTGTCC
AGGATCACCCCCGCTTGTGCGGGGAATAC	CTCTTTTTGCGCTTGCGGTTGACCCTCCCACC
AGGATCACCCCCGCTTGTGCGGGGAATAC	GCAGAGGTTAAGGAAACTTTGAAGTTATCATG
AGGATCACCCCCGCTTGTGCGGGGAATAC	TACATAAATATCAGTATTGCAAGTTTAAACGT
AGGATCACCCCCGCTTGTGCGGGGAATAC	TTCCATCAGATGAAGTTTTGCCGTTCTAAGCG
AGGATCACCCCCGCTTGTGCGGGGAATAC	TACACGACAATGACCAGAACTATGAATTATTG
AGGATCACCCCCGCTTGTGCGGGGAATAC	TGGAACGGTATTATCGTTGTGGCCACGGCCGT
AGGATCACCCCCGCTTGTGCGGGGAATAC	TCGCCTTTTAAGGTTTTAACGGCGTACTTGCT
AGGATCACCCCCGCTTGTGCGGGGAATAC	TGGTTGATGCAGCCAAAAATCTGCGCTTAAGC
GGGATCACCCCCGCTTGTGCGGGGAATAC	ATTTCGGCAATATTTTCAATTCATGAATTTTC
AGGATCACCCCCGCTTGTGCGGGGAATAC	CCACCTTTGACAGCGGTTACTGAAGACTGGCT
GGGATCACCCCCGCTTGTGCGGGGAATAC	AAGAAAGCCTAACCGAAAAATACCAAAATTAT
AGGATCACCCCCGCTTGTGCGGGGAATAC	AATGTGCTTGATTCAAGCTATGGCAATGACTC
AGGATCACCCCCGCTTGTGCGGGGAATAC	TGATTTGCAAATCATCGAGGAGGAAAAAAATG
AGGATCACCCCCGCTTGTGCGGGGAATAC	TTTCATTTAAATATGCATGCTGATGATGACGG
AGGATCACCCCCGCTTGTGCGGGGAATAC	ACGGTCACATTATCGCCAACATACGATCAGGA
AGGATCACCCCCGCTTGTGCGGGGAATAC	TCCCATGGGGTTCAGGCCTGAAAAGTGTTGCT
AGGATCACCCCCGCTTGTGCGGGGAATAC	CTTTTCCTGCCGTTTCTGCCATTGCTTGCTCC
AGGATCACCCCCGCTTGTGCGGGGAATAC	CCCACCAGCTGTCTGGCATTGAGATAGTTCGT
AGGATCACCCCCGCTTGTGCGGGGAATAC	GTAGTCATGGACAATTCAGCACAGATTCAATC
AGGATCACCCCCGCTTGTGCGGGGAATAC	GATTCAAAAAATTAGTTTTAATCGTCGTATCA
AGGATCACCCCCGCTTGTGCGGGGAATAC	GTCATCTAACAAGCTTACAATTTGGTCCCTTA
AGGATCACCCCCGCTTGTGCGGGGAATAC	TTAATGGTTACTCACAGGGCGAAGCTACATTT
GGGATCACCCCCGCTTGTGCAGGGAATAC	TTGCACGTTGGCTATGAATAGCACATATAGCC
AGGATCACCCCCGCTTGTGCGGGGAATAC	CATCATCAGGATCTTCCCGTTCAATTTTGGTT
AGGATCACCCCCGCTTGTGCGGGGAATAC	ATTAAAACGTAAATATAACATTCTAAAAGCAG
AGGATCACCCCCGCTTGTGCGGGGAATAC	ATGGCCTAACCATACGAATGGGTGGGAAGCCC
AGGATCACCCCCGCTTGTGCGGGGAATAC	GAATTCAGGTTATGAACCAGAATCTTTGCCAT
AGGATCACCCCCGCTTGTGCGGGGAATAC	GATCCGTTGCATGATTCTTATGCAGCTGCCTT
AGGATCACCCCCGCTTGTGCGGGGAATAC	CAAGTTTGATAAGTTAGTTATGTTTAGTGGCA
GGGATCACCCCCGCTTGTGCGGGGAATAC	CAGGAATTTTCCAGAGAACCAGACCTATACCA
AGGATCACCCCCGCTTGTGCGGGGAATAC	ACGGTACGATTCCGCTCTATCAGTCAACGATT
AGGATCACCCCCGCTTGTGCGGGGAATAC	ATCAGGTGGGCGTTTCTGACGCTATGAACATT
AGGATCACCCCCGCTTGTGCGGGGAATAC	TGACATGCACTGGTCGGAGATGTTTTTTGATG
AGGATCACCCCCGCTTGTGCGGGGAATAC	AAATTCACAGCACCGACCATGTGCGGTCTGAT
AGGATCACCCCCGCTTGTGCGGGGAATAC	TCAGCTTCTCGAGACAAAGGTGCAATCTGATA
AGGATCACCCCCGCTTGTGCGGGGAATAC	AAAAATTAATAATTTTTGCGCCAGATTCAGCA
GGGATCACCCCCGCTTGTGCGGGGAATAC	ATTGAGACGGCCCTACATAAAATTTTGAAGAG
AGGATCACCCCCGCTTGTGCGGGGAATAC	ACGGTACGATTCCGCTCTATCAGTCAACGATT
AGGATCACCCCCGCTTGTGCGGGGAATAC	ATCGTGTTAATGAAGCCTTATCAGAAGTTACA
AGGATCACCCCCGCTTGTGCGGGGAATAC	TCAGCTTTGTGATGGCTAACAAGGACTGGCTT
AGGATCACCCCCGCTTGTGCGGGGAATAC	TAGCTCACGACGAAGGCTTGACAGAGTTTGCC
AGGATCACCCCCGCTTGTGCGGGGAATAC	TTGCAAGAGGCTTTGGGACAATATTTTGATAA
AGGATCACCCCCGCTTGTGCGGGGAATAC	ATTGAGACGGCCCTACATAAAATTTTGAAGAG
AGGATCACCCCCGCTTGTGCGGGGAATAC	ACGGTACGATTCCGCTCTATCAGTCAACGATT
AGGATCACCCCCGCTTGTGCGGGGAATAC	ATCAGGTGGGCGTTTCTGACGCTATGAACATT
AGGATCACCCCCGCTTGTGCGGGGAATAC	TGACATGCACTGGTCGGAGATGTTTTTTGATG
AGGATCACCCCCGCTTGTGCGGGGAATAC	AAATTCACAGCACCGACCATGTGCGGTCTGAT
AGGATCACCCCCGCTTGTGCGGGGAATAC	TCAGCTTCTCGAGACAAAGGTGCAATCTGATA
AGGATCACCCCCGCTTGTGCGGGGAATAC	AAAAATTAATAATTTTTGCGCCAGATTCAGCA
GGGATCACCCCCGCTTGTGCGGGGAATAC	ATTACGTCAATGATTTCATTGATTGAAGCATT
AGGATCACCCCCGCTTGTGCGGGGAATAC	TAGCAGCGGCACTAAAAATAGATCCTTGGGAG
AGGATCACCCCCGCTTGTGCGGGGAATAC	GGTTACTTCAAGGAACAGCTTTTGTGCTGCTA
AGGATCACCCCCGCTTGTGCGGGGAATAC	CCTCAGCTTTTGCTTTCCGCTGGGCTGCTTCG
AGGATCACCCCCGCTTGTGCGGGGAATAC	CGTGAGCTGCTGCAGCAAATGTACGGAAAATC
AGGATCACCCCCGCTTGTGCGGGGAATAC	AAATGACCAAAAAACTTTTTGCGAATCTGGGC
AGGATCACCCCCGCTTGTGCGGGGAATAC	TGCAATCTTGGAGCAATCAGCAGGTAAAGGGT
AGGATCACCCCCGCTTGTGCGGGGAATAC	CCGTTAGTTTGACTAATTGGGACTTTAGTTGA
AGGATCACCCCCGCTTGTGCGGGGAATAC	CTACAATTAGATTCTATTTCTAGTTATCAAAC
AGGATCACCCCCGCTTGTGCGGGGAATAC	TCCCATGGGGAATAAATCTGAAAAGTGTTGCT
AGGATCACCCCCGCTTGTGCGGGGAATAC	AACAACCTAACAGAATTAATCGGTGGCCTGTT
AGGATCACCCCCGCTTGTGCGGGGAATAC	CTAATTTTATTTGTCATTTTTGTACCTCTTTA
AGGATCACCCCCGCTTGTGCGGGGAATAC	AAGCTAGACGAAACACCACTATTGACACTGGC
AGGATCACCCCCGCTTGTGCGGGGAATAC	TTGTCTCGATGAATACGGTCATATTCAGTTTG
AGGATCACCCCCGCTTGTGCGGGGAATAC	TATCAGAGTCGACGCTCCCGCTGTAACCGCCG
AGGATCACCCCCGCTTGTGCGGGGAATAC	TGTGCCTCAAGCCATGAAAAGTTATTTGTTTA
AGGATCACCCCCGCTTGTGCGGGGAATAC	GGTTTCCTGTCCAGTTTCAAAGAAAAACTGTC
AGGATCACCCCCGCTTGTGCGGGGAATAC	TCAGCCCAGTTCGTCGAAATGAACTGCGAAAT
AGGATCACCCCCGCTTGTGCGGGGAATAC	ATTTATTAGGACGAGGGACTCCGATGGTGAAC
AGGATCACCCCCGCTTGTGCGGGGAATAC	ACCATCGTTTGATAAGTCGAGCTCTCAACTTT
AGGATCACCCCCGCTTGTGCGGGGAATAC	GACTAGCAACAAATCGACAACAAAAGATCCTT
GGGATCACCCCCGCTTGTGCGGGGAATAC	TTTCTAGTTCTGATAACTAAGTCAGAATTACC
GGGATCACCCCCGCTTGTGCGGGGAATAC	GAACGGTTAAATTAACACTTAATGGAGTAGTA
AGGATCACCCCCGCTTGTGCGGGGAATAC	TTCAACAAGACGCTGACAATGCCAAACTAGAT
AGGATCACCCCCGCTTGTGCGGGGAATAC	TTCAAAAAGGGAACGTTAACCCTGCCACAGAT
AGGATCACCCCCGCTTGTGCGGGGAATAC	AAGCACGTATTTCCGGTTCGCCAGCCATCACG
AGGATCACCCCCGCTTGTGCGGGGAATAC	TTTGTTTTGGGCTTGTCTATGGGCGTACTGAT
AGGATCACCCCCGCTTGTGCGGGGAATAC	CTCAGTCATTTCGACCGTGTATCGCTTGTTAT
AGGATCACCCCCGCTTGTGCGGGGAATAC	AGCCCTATTTTATCTTTTCCCCGTCAATATAT
AGGATCACCCCCGCTTGTGCGGGGAATAC	TTTTTTATCAGTCAGCCCAAACAATTCCCGAT
AGGATCACCCCCGCTTGTGCGGGGAATAC	CAAGAAGTTCCACTAATCACTGTCGTCGCAGC
AGGATCACCCCCGCTTGTGCGGGGAATAC	TTGATTTGCTGCAATGGCTTGTGTTGGCTTAG
AGGATCACCCCCGCTTGTGCGGGGAATAC	GTTGGCGTGGCAATACTTGCCGTGCCGGTACC
AGGATCACCCCCGCTTGTGCGGGGAATAC	ATCCTGTTATGTGATTCATTGTACAGCACACA
AGGATCACCCCCGCTTGTGCGGGGAATAC	CAAAGCCTTGGGCCATAAAACCCAAGCCTTCCC
AGGATCACCCCCGCTTGTGCGGGGAATAC

>CP029684|2|2|1634226-1640480|CRT
AGGATCACCCCCGCTTGTGCGGGGAATAC	CTTATAACCAATGACAAAGAAAGCAATGTTAT
AGGATCACCCCCCCGCTTGTGCGGGGAAT	ACTTATTTTTCAAGGCAAAGATGATGGCCGTTGT
AGGATCACCCCCGCTTGTGCGGGGAATAC	GCACCGAGTTCGTTCGCCGTTTCGTTTATTTT
AGGATCACCCCCGCTTGTGCGGGGAATAC	TTTTTGATTTCGTCATCGATATTTTTAATTGG
AGGATCACCCCCGCTTGTGCGGGGAATAC	CGATTGACATTGTCGTTCGGCATGATCCGACT
AGGATCACCCCCGCTTGTGCGGGGAATAC	TGCTTTTCAAACCGTTTACCCAATTTTCTACC
AGGATCACCCCCGCTTGTGCGGGGAATAC	TGTGCTGCTCATGGCTTTCGTCATGACTTTACC
AGGATCACCCCCGCTTGTGCGGGGAATAC	TTCATCAAACAGCCCTAATTTTCCATTTGTCC
AGGATCACCCCCGCTTGTGCGGGGAATAC	AATCGTAATATGCGTCGAGCAATCAACTTGCA
AGGATCACCCCCGCTTGTGCGGGGAATAC	TTTTAAGTATGCCAGCAGGAACATTGGAGCGA
CGGATCACCCCCGCTTGTGCGGGGAATAC	TTATAAGCACCCTCTTCATTATGCAGGCGGGC
AGGATCACCCCCGCTTGTGCGGGGAATAC	CAAAATGCTTCTCGAGGCGTGAATGATGGAAT
AGGATCACCCCCGCTTGTGCGGGGAATAC	ACCCTTTCATGTTTATCTTAACTTTCGGCCAC
AGGATCACCCCCGCTTGTGCGGGGAATAC	TGGCTATTTTGGCATCTGCCTGGGCTTTTTCT
AGGATCACCCCCGCTTGTGCGGGGAATAC	CCGCTGATTTACCAGATGATCTAAGTGATAAA
AGGATCACCCCCGCTTGTGCGGGGAATAC	ACAACGTTGATGAAAAATACGTTGATTGGACT
AGGATCACCCCCGCTTGTGCGGGGAATAC	TGTGCTGCTCATGGCTTTCGTCATGACTTTAC
CGGATCACCCCCGCTTGTGCGGGGAATAC	TTCATCAAACAGCCCTAATTTTCCATTTGTCC
AGGATCACCCCCGCTTGTGCGGGGAATAC	CTCTTTTTGCGCTTGCGGTTGACCCTCCCACC
AGGATCACCCCCGCTTGTGCGGGGAATAC	GCAGAGGTTAAGGAAACTTTGAAGTTATCATG
AGGATCACCCCCGCTTGTGCGGGGAATAC	TACATAAATATCAGTATTGCAAGTTTAAACGT
AGGATCACCCCCGCTTGTGCGGGGAATAC	TTCCATCAGATGAAGTTTTGCCGTTCTAAGCG
AGGATCACCCCCGCTTGTGCGGGGAATAC	TACACGACAATGACCAGAACTATGAATTATTG
AGGATCACCCCCGCTTGTGCGGGGAATAC	TGGAACGGTATTATCGTTGTGGCCACGGCCGT
AGGATCACCCCCGCTTGTGCGGGGAATAC	TCGCCTTTTAAGGTTTTAACGGCGTACTTGCT
AGGATCACCCCCGCTTGTGCGGGGAATAC	TGGTTGATGCAGCCAAAAATCTGCGCTTAAGC
GGGATCACCCCCGCTTGTGCGGGGAATAC	ATTTCGGCAATATTTTCAATTCATGAATTTTC
AGGATCACCCCCGCTTGTGCGGGGAATAC	CCACCTTTGACAGCGGTTACTGAAGACTGGCT
GGGATCACCCCCGCTTGTGCGGGGAATAC	AAGAAAGCCTAACCGAAAAATACCAAAATTAT
AGGATCACCCCCGCTTGTGCGGGGAATAC	AATGTGCTTGATTCAAGCTATGGCAATGACTC
AGGATCACCCCCGCTTGTGCGGGGAATAC	TGATTTGCAAATCATCGAGGAGGAAAAAAATG
AGGATCACCCCCGCTTGTGCGGGGAATAC	TTTCATTTAAATATGCATGCTGATGATGACGG
AGGATCACCCCCGCTTGTGCGGGGAATAC	ACGGTCACATTATCGCCAACATACGATCAGGA
AGGATCACCCCCGCTTGTGCGGGGAATAC	TCCCATGGGGTTCAGGCCTGAAAAGTGTTGCT
AGGATCACCCCCGCTTGTGCGGGGAATAC	CTTTTCCTGCCGTTTCTGCCATTGCTTGCTCC
AGGATCACCCCCGCTTGTGCGGGGAATAC	CCCACCAGCTGTCTGGCATTGAGATAGTTCGT
AGGATCACCCCCGCTTGTGCGGGGAATAC	GTAGTCATGGACAATTCAGCACAGATTCAATC
AGGATCACCCCCGCTTGTGCGGGGAATAC	GATTCAAAAAATTAGTTTTAATCGTCGTATCA
AGGATCACCCCCGCTTGTGCGGGGAATAC	GTCATCTAACAAGCTTACAATTTGGTCCCTTA
AGGATCACCCCCGCTTGTGCGGGGAATAC	TTAATGGTTACTCACAGGGCGAAGCTACATTT
GGGATCACCCCCGCTTGTGCAGGGAATAC	TTGCACGTTGGCTATGAATAGCACATATAGCC
AGGATCACCCCCGCTTGTGCGGGGAATAC	CATCATCAGGATCTTCCCGTTCAATTTTGGTT
AGGATCACCCCCGCTTGTGCGGGGAATAC	ATTAAAACGTAAATATAACATTCTAAAAGCAG
AGGATCACCCCCGCTTGTGCGGGGAATAC	ATGGCCTAACCATACGAATGGGTGGGAAGCCC
AGGATCACCCCCGCTTGTGCGGGGAATAC	GAATTCAGGTTATGAACCAGAATCTTTGCCAT
AGGATCACCCCCGCTTGTGCGGGGAATAC	GATCCGTTGCATGATTCTTATGCAGCTGCCTT
AGGATCACCCCCGCTTGTGCGGGGAATAC	CAAGTTTGATAAGTTAGTTATGTTTAGTGGCA
GGGATCACCCCCGCTTGTGCGGGGAATAC	CAGGAATTTTCCAGAGAACCAGACCTATACCA
AGGATCACCCCCGCTTGTGCGGGGAATAC	ACGGTACGATTCCGCTCTATCAGTCAACGATT
AGGATCACCCCCGCTTGTGCGGGGAATAC	ATCAGGTGGGCGTTTCTGACGCTATGAACATT
AGGATCACCCCCGCTTGTGCGGGGAATAC	TGACATGCACTGGTCGGAGATGTTTTTTGATG
AGGATCACCCCCGCTTGTGCGGGGAATAC	AAATTCACAGCACCGACCATGTGCGGTCTGAT
AGGATCACCCCCGCTTGTGCGGGGAATAC	TCAGCTTCTCGAGACAAAGGTGCAATCTGATA
AGGATCACCCCCGCTTGTGCGGGGAATAC	AAAAATTAATAATTTTTGCGCCAGATTCAGCA
GGGATCACCCCCGCTTGTGCGGGGAATAC	ATTGAGACGGCCCTACATAAAATTTTGAAGAG
AGGATCACCCCCGCTTGTGCGGGGAATAC	ACGGTACGATTCCGCTCTATCAGTCAACGATT
AGGATCACCCCCGCTTGTGCGGGGAATAC	ATCGTGTTAATGAAGCCTTATCAGAAGTTACA
AGGATCACCCCCGCTTGTGCGGGGAATAC	TCAGCTTTGTGATGGCTAACAAGGACTGGCTT
AGGATCACCCCCGCTTGTGCGGGGAATAC	TAGCTCACGACGAAGGCTTGACAGAGTTTGCC
AGGATCACCCCCGCTTGTGCGGGGAATAC	TTGCAAGAGGCTTTGGGACAATATTTTGATAA
AGGATCACCCCCGCTTGTGCGGGGAATAC	ATTGAGACGGCCCTACATAAAATTTTGAAGAG
AGGATCACCCCCGCTTGTGCGGGGAATAC	ACGGTACGATTCCGCTCTATCAGTCAACGATT
AGGATCACCCCCGCTTGTGCGGGGAATAC	ATCAGGTGGGCGTTTCTGACGCTATGAACATT
AGGATCACCCCCGCTTGTGCGGGGAATAC	TGACATGCACTGGTCGGAGATGTTTTTTGATG
AGGATCACCCCCGCTTGTGCGGGGAATAC	AAATTCACAGCACCGACCATGTGCGGTCTGAT
AGGATCACCCCCGCTTGTGCGGGGAATAC	TCAGCTTCTCGAGACAAAGGTGCAATCTGATA
AGGATCACCCCCGCTTGTGCGGGGAATAC	AAAAATTAATAATTTTTGCGCCAGATTCAGCA
GGGATCACCCCCGCTTGTGCGGGGAATAC	ATTACGTCAATGATTTCATTGATTGAAGCATT
AGGATCACCCCCGCTTGTGCGGGGAATAC	TAGCAGCGGCACTAAAAATAGATCCTTGGGAG
AGGATCACCCCCGCTTGTGCGGGGAATAC	GGTTACTTCAAGGAACAGCTTTTGTGCTGCTA
AGGATCACCCCCGCTTGTGCGGGGAATAC	CCTCAGCTTTTGCTTTCCGCTGGGCTGCTTCG
AGGATCACCCCCGCTTGTGCGGGGAATAC	CGTGAGCTGCTGCAGCAAATGTACGGAAAATC
AGGATCACCCCCGCTTGTGCGGGGAATAC	AAATGACCAAAAAACTTTTTGCGAATCTGGGC
AGGATCACCCCCGCTTGTGCGGGGAATAC	TGCAATCTTGGAGCAATCAGCAGGTAAAGGGT
AGGATCACCCCCGCTTGTGCGGGGAATAC	CCGTTAGTTTGACTAATTGGGACTTTAGTTGA
AGGATCACCCCCGCTTGTGCGGGGAATAC	CTACAATTAGATTCTATTTCTAGTTATCAAAC
AGGATCACCCCCGCTTGTGCGGGGAATAC	TCCCATGGGGAATAAATCTGAAAAGTGTTGCT
AGGATCACCCCCGCTTGTGCGGGGAATAC	AACAACCTAACAGAATTAATCGGTGGCCTGTT
AGGATCACCCCCGCTTGTGCGGGGAATAC	CTAATTTTATTTGTCATTTTTGTACCTCTTTA
AGGATCACCCCCGCTTGTGCGGGGAATAC	AAGCTAGACGAAACACCACTATTGACACTGGC
AGGATCACCCCCGCTTGTGCGGGGAATAC	TTGTCTCGATGAATACGGTCATATTCAGTTTG
AGGATCACCCCCGCTTGTGCGGGGAATAC	TATCAGAGTCGACGCTCCCGCTGTAACCGCCG
AGGATCACCCCCGCTTGTGCGGGGAATAC	TGTGCCTCAAGCCATGAAAAGTTATTTGTTTA
AGGATCACCCCCGCTTGTGCGGGGAATAC	GGTTTCCTGTCCAGTTTCAAAGAAAAACTGTC
AGGATCACCCCCGCTTGTGCGGGGAATAC	TCAGCCCAGTTCGTCGAAATGAACTGCGAAAT
AGGATCACCCCCGCTTGTGCGGGGAATAC	ATTTATTAGGACGAGGGACTCCGATGGTGAAC
AGGATCACCCCCGCTTGTGCGGGGAATAC	ACCATCGTTTGATAAGTCGAGCTCTCAACTTT
AGGATCACCCCCGCTTGTGCGGGGAATAC	GACTAGCAACAAATCGACAACAAAAGATCCTT
GGGATCACCCCCGCTTGTGCGGGGAATAC	TTTCTAGTTCTGATAACTAAGTCAGAATTACC
GGGATCACCCCCGCTTGTGCGGGGAATAC	GAACGGTTAAATTAACACTTAATGGAGTAGTA
AGGATCACCCCCGCTTGTGCGGGGAATAC	TTCAACAAGACGCTGACAATGCCAAACTAGAT
AGGATCACCCCCGCTTGTGCGGGGAATAC	TTCAAAAAGGGAACGTTAACCCTGCCACAGAT
AGGATCACCCCCGCTTGTGCGGGGAATAC	AAGCACGTATTTCCGGTTCGCCAGCCATCACG
AGGATCACCCCCGCTTGTGCGGGGAATAC	TTTGTTTTGGGCTTGTCTATGGGCGTACTGAT
AGGATCACCCCCGCTTGTGCGGGGAATAC	CTCAGTCATTTCGACCGTGTATCGCTTGTTAT
AGGATCACCCCCGCTTGTGCGGGGAATAC	AGCCCTATTTTATCTTTTCCCCGTCAATATAT
AGGATCACCCCCGCTTGTGCGGGGAATAC	TTTTTTATCAGTCAGCCCAAACAATTCCCGAT
AGGATCACCCCCGCTTGTGCGGGGAATAC	CAAGAAGTTCCACTAATCACTGTCGTCGCAGC
AGGATCACCCCCGCTTGTGCGGGGAATAC	TTGATTTGCTGCAATGGCTTGTGTTGGCTTAG
AGGATCACCCCCGCTTGTGCGGGGAATAC	GTTGGCGTGGCAATACTTGCCGTGCCGGTACC
AGGATCACCCCCGCTTGTGCGGGGAATAC	ATCCTGTTATGTGATTCATTGTACAGCACACA
AGGATCACCCCCGCTTGTGCGGGGAATAC	CAAAGCCTTGGGCCATAAAACCCAAGCCTTCCC
AGGATCACCCCCGCTTGTGCGGGGAATAC

>CP029684|2|3|1638072-1640480|PILER-CR
AGGATCACCCCCGCTTGTGCGGGGAATAC	TGACATGCACTGGTCGGAGATGTTTTTTGATG
AGGATCACCCCCGCTTGTGCGGGGAATAC	AAATTCACAGCACCGACCATGTGCGGTCTGAT
AGGATCACCCCCGCTTGTGCGGGGAATAC	TCAGCTTCTCGAGACAAAGGTGCAATCTGATA
AGGATCACCCCCGCTTGTGCGGGGAATAC	AAAAATTAATAATTTTTGCGCCAGATTCAGCA
GGGATCACCCCCGCTTGTGCGGGGAATAC	ATTACGTCAATGATTTCATTGATTGAAGCATT
AGGATCACCCCCGCTTGTGCGGGGAATAC	TAGCAGCGGCACTAAAAATAGATCCTTGGGAG
AGGATCACCCCCGCTTGTGCGGGGAATAC	GGTTACTTCAAGGAACAGCTTTTGTGCTGCTA
AGGATCACCCCCGCTTGTGCGGGGAATAC	CCTCAGCTTTTGCTTTCCGCTGGGCTGCTTCG
AGGATCACCCCCGCTTGTGCGGGGAATAC	CGTGAGCTGCTGCAGCAAATGTACGGAAAATC
AGGATCACCCCCGCTTGTGCGGGGAATAC	AAATGACCAAAAAACTTTTTGCGAATCTGGGC
AGGATCACCCCCGCTTGTGCGGGGAATAC	TGCAATCTTGGAGCAATCAGCAGGTAAAGGGT
AGGATCACCCCCGCTTGTGCGGGGAATAC	CCGTTAGTTTGACTAATTGGGACTTTAGTTGA
AGGATCACCCCCGCTTGTGCGGGGAATAC	CTACAATTAGATTCTATTTCTAGTTATCAAAC
AGGATCACCCCCGCTTGTGCGGGGAATAC	TCCCATGGGGAATAAATCTGAAAAGTGTTGCT
AGGATCACCCCCGCTTGTGCGGGGAATAC	AACAACCTAACAGAATTAATCGGTGGCCTGTT
AGGATCACCCCCGCTTGTGCGGGGAATAC	CTAATTTTATTTGTCATTTTTGTACCTCTTTA
AGGATCACCCCCGCTTGTGCGGGGAATAC	AAGCTAGACGAAACACCACTATTGACACTGGC
AGGATCACCCCCGCTTGTGCGGGGAATAC	TTGTCTCGATGAATACGGTCATATTCAGTTTG
AGGATCACCCCCGCTTGTGCGGGGAATAC	TATCAGAGTCGACGCTCCCGCTGTAACCGCCG
AGGATCACCCCCGCTTGTGCGGGGAATAC	TGTGCCTCAAGCCATGAAAAGTTATTTGTTTA
AGGATCACCCCCGCTTGTGCGGGGAATAC	GGTTTCCTGTCCAGTTTCAAAGAAAAACTGTC
AGGATCACCCCCGCTTGTGCGGGGAATAC	TCAGCCCAGTTCGTCGAAATGAACTGCGAAAT
AGGATCACCCCCGCTTGTGCGGGGAATAC	ATTTATTAGGACGAGGGACTCCGATGGTGAAC
AGGATCACCCCCGCTTGTGCGGGGAATAC	ACCATCGTTTGATAAGTCGAGCTCTCAACTTT
AGGATCACCCCCGCTTGTGCGGGGAATAC	GACTAGCAACAAATCGACAACAAAAGATCCTT
GGGATCACCCCCGCTTGTGCGGGGAATAC	TTTCTAGTTCTGATAACTAAGTCAGAATTACC
GGGATCACCCCCGCTTGTGCGGGGAATAC	GAACGGTTAAATTAACACTTAATGGAGTAGTA
AGGATCACCCCCGCTTGTGCGGGGAATAC	TTCAACAAGACGCTGACAATGCCAAACTAGAT
AGGATCACCCCCGCTTGTGCGGGGAATAC	TTCAAAAAGGGAACGTTAACCCTGCCACAGAT
AGGATCACCCCCGCTTGTGCGGGGAATAC	AAGCACGTATTTCCGGTTCGCCAGCCATCACG
AGGATCACCCCCGCTTGTGCGGGGAATAC	TTTGTTTTGGGCTTGTCTATGGGCGTACTGAT
AGGATCACCCCCGCTTGTGCGGGGAATAC	CTCAGTCATTTCGACCGTGTATCGCTTGTTAT
AGGATCACCCCCGCTTGTGCGGGGAATAC	AGCCCTATTTTATCTTTTCCCCGTCAATATAT
AGGATCACCCCCGCTTGTGCGGGGAATAC	TTTTTTATCAGTCAGCCCAAACAATTCCCGAT
AGGATCACCCCCGCTTGTGCGGGGAATAC	CAAGAAGTTCCACTAATCACTGTCGTCGCAGC
AGGATCACCCCCGCTTGTGCGGGGAATAC	TTGATTTGCTGCAATGGCTTGTGTTGGCTTAG
AGGATCACCCCCGCTTGTGCGGGGAATAC	GTTGGCGTGGCAATACTTGCCGTGCCGGTACC
AGGATCACCCCCGCTTGTGCGGGGAATAC	ATCCTGTTATGTGATTCATTGTACAGCACACA
AGGATCACCCCCGCTTGTGCGGGGAATAC	CAAAGCCTTGGGCCATAAAACCCAAGCCTTCCC
AGGATCACCCCCGCTTGTGCGGGGAATAC

Protein	Signature genes	Signature genes Name	Protein_function
CP029684.1\|QAS70541.1\|1641396_1642353_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
CP029684.1\|QAS70544.1\|1643727_1644804_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
CP029684.1\|QAS70531.1\|1624698_1625055_+\|metal-sulfur-cluster-biosynthesis-protein	unknown	unknown	gnl\|CDD\|131990
CP029684.1\|QAS70535.1\|1628638_1631176_-\|peptidase	unknown	unknown	gnl\|CDD\|341064
CP029684.1\|QAS70547.1\|1647117_1649895_-\|CRISPR-associated-helicase/endonuclease-Cas3	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|182031
CP029684.1\|QAS70536.1\|1631272_1632169_-\|fructokinase/branched-chain-amino-acid--2-keto-4-methylthiobutyrate-aminotransferase	unknown	unknown	gnl\|CDD\|366120
CP029684.1\|QAS70548.1\|1650150_1650444_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|182377
CP029684.1\|QAS70534.1\|1627906_1628560_-\|histidine-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|366010
CP029684.1\|QAS70543.1\|1643036_1643747_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09645_cas5_CAS-I-E	gnl\|CDD\|187776
CP029684.1\|QAS70546.1\|1645417_1647121_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cd09729_cas8e_CAS-I-E	gnl\|CDD\|378189
CP029684.1\|QAS70538.1\|1632992_1633532_-\|dihydrofolate-reductase	unknown	unknown	gnl\|CDD\|223340
CP029684.1\|QAS70539.1\|1633838_1634075_-\|hypothetical-protein	unknown	unknown	unknown
CP029684.1\|QAS70532.1\|1625125_1626370_-\|arginine-deiminase	unknown	unknown	gnl\|CDD\|234949
CP029684.1\|QAS70545.1\|1644796_1645402_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	mkCas0194_cse2gr11_CAS-I-E	gnl\|CDD\|378191
CP029684.1\|QAS70530.1\|1622287_1624489_-\|anaerobic-ribonucleoside-triphosphate-reductase	unknown	unknown	gnl\|CDD\|236436
CP029684.1\|QAS70542.1\|1642355_1643024_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	pfam08798_cas6e_CAS-I-E:CAS-IV	gnl\|CDD\|378050
CP029684.1\|QAS70540.1\|1640509_1641400_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|176648
CP029684.1\|QAS70533.1\|1626473_1627895_-\|guanine-permease	unknown	unknown	gnl\|CDD\|225161
CP029684.1\|QAS70549.1\|1650851_1651439_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379228
CP029684.1\|QAS70537.1\|1632332_1632914_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP029684.1\|QAS70541.1\|1641396_1642353_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	1.8483e-132
CP029684.1\|QAS70531.1\|1624698_1625055_+\|metal-sulfur-cluster-biosynthesis-protein	gnl\|CDD\|131990	TIGR02945, SUF_assoc, FeS assembly SUF system protein. Members of this family belong to the broader pfam01883, or Domain of Unknown Function DUF59. Many members of DUF59 are candidate ring hydroxylating complex subunits. However, members of the narrower family defined here all are found in genomes that carry the FeS assembly SUF system. For 70 % of these species, the member of this protein family is found as part of the SUF locus, usually immediately downstream of the sufS gene. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	8.7726e-18
CP029684.1\|QAS70535.1\|1628638_1631176_-\|peptidase	gnl\|CDD\|341064	cd09601, M1_APN-Q_like, Peptidase M1 aminopeptidase N catalytic domain family which includes aminopeptidase N (APN), aminopeptidase Q (APQ), tricorn interacting factor F3, and endoplasmic reticulum aminopeptidase 1 (ERAP1). This M1 peptidase family includes eukaryotic and bacterial members: the catalytic domains of aminopeptidase N (APN), aminopeptidase Q (APQ, laeverin), endoplasmic reticulum aminopeptidase 1 (ERAP1) as well as tricorn interacting factor F3. Aminopeptidase N (APN; CD13; alanyl aminopeptidase; EC 3.4.11.2), a type II integral membrane protease, preferentially cleaves neutral amino acids from the N-terminus of oligopeptides and is present in a variety of human tissues and cell types (leukocyte, fibroblast, endothelial and epithelial cells). APN expression is dysregulated in inflammatory diseases such as chronic pain, rheumatoid arthritis, multiple sclerosis, systemic sclerosis, systemic lupus erythematosus, polymyositis/dermatomyosytis and pulmonary sarcoidosis, and is enhanced in tumor cells such as melanoma, renal, prostate, pancreas, colon, gastric and thyroid cancers. It is considered a marker of differentiation since it is predominantly expressed on stem cells and on cells of the granulocytic and monocytic lineages at distinct stages of differentiation. Thus, APN inhibition may lead to the development of anti-cancer and anti-inflammatory drugs. ERAP1, also known as endoplasmic reticulum aminopeptidase associated with antigen processing (ERAAP), adipocyte derived leucine aminopeptidase (A-LAP), or aminopeptidase regulating tumor necrosis factor receptor I (THFRI) shedding (ARTS-1), associates with the closely related ER aminopeptidase ERAP2, for the final trimming of peptides within the ER for presentation by MHC class I molecules. ERAP1 is associated with ankylosing spondylitis (AS), an inflammatory arthritis that predominantly affects the spine. ERAP1 also aids in the shedding of membrane-bound cytokine receptors. The tricorn interacting factor F3, together with factors F1 and F2, degrades the tricorn protease products, producing free amino acids, thus completing the proteasomal degradation pathway. F3 is homologous to F2, but not F1, and shows a strong preference for glutamate in the P1' position. APQ, also known as laeverin, is specifically expressed in human embryo-derived extravillous trophoblasts (EVTs) that invade the uterus during early placentation. It cleaves the N-terminal amino acid of various peptides such as angiotensin III, endokinin C, and kisspeptin-10, all expressed in the placenta in large quantities. APN is a receptor for coronaviruses, although the virus receptor interaction site seems to be distinct from the enzymatic site and aminopeptidase activity is not necessary for viral infection. APNs are also putative Cry toxin receptors. Cry1 proteins are pore-forming toxins that bind to the midgut epithelial cell membrane of susceptible insect larvae, causing extensive damage. Several different toxins, including Cry1Aa, Cry1Ab, Cry1Ac, Cry1Ba, Cry1Ca and Cry1Fa, have been shown to bind to APNs; however, a direct role of APN in cytotoxicity has been yet to be firmly established.	2.1748e-178
CP029684.1\|QAS70547.1\|1647117_1649895_-\|CRISPR-associated-helicase/endonuclease-Cas3	gnl\|CDD\|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	2.47381e-82
CP029684.1\|QAS70536.1\|1631272_1632169_-\|fructokinase/branched-chain-amino-acid--2-keto-4-methylthiobutyrate-aminotransferase	gnl\|CDD\|366120	pfam00480, ROK, ROK family.	3.26557e-73
CP029684.1\|QAS70548.1\|1650150_1650444_-\|hypothetical-protein	gnl\|CDD\|182377	PRK10323, PRK10323, cysteine/O-acetylserine transporter.	1.10874e-08
CP029684.1\|QAS70534.1\|1627906_1628560_-\|histidine-phosphatase-family-protein	gnl\|CDD\|366010	pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1). The histidine phosphatase superfamily is so named because catalysis centers on a conserved His residue that is transiently phosphorylated during the catalytic cycle. Other conserved residues contribute to a 'phosphate pocket' and interact with the phospho group of substrate before, during and after its transfer to the His residue. Structure and sequence analyses show that different families contribute different additional residues to the 'phosphate pocket' and, more surprisingly, differ in the position, in sequence and in three dimensions, of a catalytically essential acidic residue. The superfamily may be divided into two main branches. The larger branch 1 contains a wide variety of catalytic functions, the best known being fructose 2,6-bisphosphatase (found in a bifunctional protein with 2-phosphofructokinase) and cofactor-dependent phosphoglycerate mutase. The latter is an unusual example of a mutase activity in the superfamily: the vast majority of members appear to be phosphatases. The bacterial regulatory protein phosphatase SixA is also in branch 1 and has a minimal, and possible ancestral-like structure, lacking the large domain insertions that contribute to binding of small molecules in branch 1 members.	5.53235e-47
CP029684.1\|QAS70543.1\|1643036_1643747_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|187776	cd09645, Cas5_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas5. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas5 is a RAMP superfamily protein; Subunit of the Cascade complex.	1.60082e-50
CP029684.1\|QAS70538.1\|1632992_1633532_-\|dihydrofolate-reductase	gnl\|CDD\|223340	COG0262, FolA, Dihydrofolate reductase [Coenzyme metabolism].	1.68458e-23
CP029684.1\|QAS70546.1\|1645417_1647121_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|378189	pfam09481, CRISPR_Cse1, CRISPR-associated protein Cse1 (CRISPR_cse1). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry, represented by CT1972 from Chlorobaculum tepidum, is found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse1.	3.09892e-82
CP029684.1\|QAS70532.1\|1625125_1626370_-\|arginine-deiminase	gnl\|CDD\|234949	PRK01388, PRK01388, arginine deiminase; Provisional.	0
CP029684.1\|QAS70545.1\|1644796_1645402_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl\|CDD\|378191	pfam09485, CRISPR_Cse2, CRISPR-associated protein Cse2 (CRISPR_cse2). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family of proteins, represented by CT1973 from Chlorobaculum tepidum, is encoded by genes found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse2.	2.29081e-29
CP029684.1\|QAS70530.1\|1622287_1624489_-\|anaerobic-ribonucleoside-triphosphate-reductase	gnl\|CDD\|236436	PRK09263, PRK09263, anaerobic ribonucleoside triphosphate reductase; Provisional.	0
CP029684.1\|QAS70544.1\|1643727_1644804_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	1.54337e-154
CP029684.1\|QAS70540.1\|1640509_1641400_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|176648	cd06127, DEDDh, DEDDh 3'-5' exonuclease domain family. DEDDh exonucleases, part of the DnaQ-like (or DEDD) exonuclease superfamily, catalyze the excision of nucleoside monophosphates at the DNA or RNA termini in the 3'-5' direction. These proteins contain four invariant acidic residues in three conserved sequence motifs termed ExoI, ExoII and ExoIII. DEDDh exonucleases are classified as such because of the presence of specific Hx(4)D conserved pattern at the ExoIII motif. The four conserved acidic residues are clustered around the active site and serve as ligands for the two metal ions required for catalysis. Most DEDDh exonucleases are the proofreading subunits (epsilon) or domains of bacterial DNA polymerase III, the main replicating enzyme in bacteria, which functions as the chromosomal replicase. Other members include other DNA and RNA exonucleases such as RNase T, Oligoribonuclease, and RNA exonuclease (REX), among others.	6.33566e-42
CP029684.1\|QAS70533.1\|1626473_1627895_-\|guanine-permease	gnl\|CDD\|225161	COG2252, COG2252, Xanthine/uracil/vitamin C permease [Nucleotide transport and metabolism].	5.54269e-125
CP029684.1\|QAS70549.1\|1650851_1651439_-\|hypothetical-protein	gnl\|CDD\|379228	pfam13508, Acetyltransf_7, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	0.00697686
CP029684.1\|QAS70542.1\|1642355_1643024_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|378050	pfam08798, CRISPR_assoc, CRISPR associated protein. This domain forms an anti-parallel beta strand structure with flanking alpha helical regions.	8.29207e-67

>CP029684.1|QAS70539.1|1633838_1634075_-|hypothetical-protein
MIKTNAQFQKIYAQAEDFYEKKFGKTINTPSVFAGLVPGLSEHVAKTGIYDGQAADIIYEYIKKSDKPIPDEINNRIY
>CP029684.1|QAS70538.1|1632992_1633532_-|dihydrofolate-reductase
MTSKTMRKVYFYGAMSLDGFLARKDDSLQWLFDTELDPAYSIADFEAGIDTVVMGNTTYKETSKILGDKPMFSGKEKIVFSHSQIGSITDGGRYVSGDPTAIVRTLKSVKGKNIWIVGGGAIVTQLVRQDLIDEFWIQIAPVLIGWGKRLFEEAAYEKRLTLIGIKRIGELAEIHLKRL
>CP029684.1|QAS70537.1|1632332_1632914_-|hypothetical-protein
MNLLVRIVESILLLSVGYFLRDLPNLVREVIINKNKVSGQRTLQVESYFRQISGDDLNQLLKDWSAKIIYLNDKKQNDQEHDELEKYKDLMHRSLMYGSDKTVSLLAYFSQFQYRTYAEDSNVGKTDEQLKNAAIGIMYMSRIVASLKYDFTGYQIDPLDIMKLIINDLDSGDHWERMLAANKEIDNILAKQK
>CP029684.1|QAS70536.1|1631272_1632169_-|fructokinase/branched-chain-amino-acid--2-keto-4-methylthiobutyrate-aminotransferase
MVVEGKLLGSIEAGGTKFVCAIADANFNVIEQTKFKTTNPVDTMAKTTAFFQQFNVSAIGIGSFGPIGIKEGQDDYGFITKTPKVGWSDFDFVGSLKAAINVPVFFTTDVNASVYGEYEFGTVKKDQTLVYFTLGTGVGVGVIQGGSFVGGRSHPEIGHIILRKHPDDVNFAGVCRFHGDCLEGLASGPSLAARTGIAGENISDSDPVWDIIAYYIAQAAWSVTLSFRPDKIIFGGSVSGRPGLLSKARQQFAQMNNDYLPLPDLDNYIVHPKIENNGSATYGDLALALFALQKATVK
>CP029684.1|QAS70535.1|1628638_1631176_-|peptidase
MVDSTHFYRAFQPDHYDIFLTIDRQKKLFSGQTQISGQARLQAISIHAKFLTIKSVRSDDDQALPFELDSKNDAIRIHLAKTGAVTFKIDYEAKLTDSMMGIYPSYYELDGVKKQIIGTQFETTFARQAFPCVDEPEAKATFDLAIKFDEQAGETILANMPESRFENGVHYFQRTVRMSTYLIAFAFGDLQSKLTTTKSGVQIGVFATKAHKAKELDFALDIAKRSIEFYEDFYQTPYPLAHSWQLALPDFSAGAMENWGLVTYREAYLLLDPDNTALTRKQLVATVVAHELAHQWFGDLVTMKWWDDLWLNESFANMMEYVAVNALEPKWDIWQTFQASEVPAALQRDATDGVQSVHVNVEDPAEIDSLFDGAIVYAKGARMLVMVRAMIGDAALRKGLKAYFAAHKYANATGADLWSALGDASQIDVGSVMNSWLEQPGYPVVEASVIDGQLTISQQQFFIGVGKEIGRQWQIPLNANYAQAPSLLTEKSSQLGDYAQLRAENKLPFRLNVGNDSHFIVKYDETLLADILKDVTELDAISQLQILQDLRLLAEGQEISYAEIVPLLSRFSRSRFAVVNMALFVIANNLKKFVEPDSLEEKQLRQLFDHLSSSQVARLGWSSATDESIDDQLIRPYVLSASLFAKNPNTIKSAHDLFEKNRQQLSSLSADIRLFVLRNEIQNFSDPDLFKQLLQDYRQSSDGSYKADLTAALTATTDPVLIKLLIDKFEDADTIKPQDLRAWFRGVLANDKGQQAAWDWIRQDWQWLEETVGGDMEFTTFITVIAIIFKTAQRLSEFKAFFEPKINVAGLTREITMDTRVIENRVNLVEKEHAAVNQAVSQQIN
>CP029684.1|QAS70534.1|1627906_1628560_-|histidine-phosphatase-family-protein
MKRIFIVRHGRTEWNLEGRFQGANGDSPLLESSKQDCQDLAGFLDKFDFTTVYTSPIKRARRTAEITLADTANYAKTAIIDDKNFRELSFGDWEGLTREQVAKKYPQLFDELIRRQDDPRLTAFGVENFAKARQRFKDGIIKRSRQLNEDENLLIFSHGSIIQLGIKALTGDESLSSLKNTSTTILQTIDDEHFTIESYNEVAYLSNVNSKGNTTLI
>CP029684.1|QAS70533.1|1626473_1627895_-|guanine-permease
MFHLEKYQTTIKREIIAGLTTFVSMVYIFFLNPQILGQTGMPKQGIFLASIIVSTIGTLFMGLFANVPFALAPGIGMQAYFTYTIVFGCHFHWQQALAIVFLVGIFDLIITLSHGRRAIVKAIPEELKAAIAGGIGLFVAYIGLKNAGFINFIIGKEDIISGWGTSSMVGNGSVTPEMANFNQPAVILALIGLLILIVLVLRKIPGAFLISMIVTTLIGIPMGVTNTHIEWGASLSTTFSEFSKVFLASFSGQGMPTLFNNWHDFLLTLATVFAMGLTGLFDAIGTLLGIGEQTQIFTKEDQREFAENKSGFKTRMDRALLADTVTTTSAGLLGTSNTTTFIESASGIAAGGRTGLSNLVTAAAFLLTIFFAPFVSVIPNAATSPILILVGISMMSEFKKIEWGDMEVAIPAFFTSVFMALSYSISYGIAAGFIFYIFVKMVKGKFKEINPVVLVISLMFLVNFILIAFRFAN
>CP029684.1|QAS70532.1|1625125_1626370_-|arginine-deiminase
MTNETLPINVNSEIGQLKQVILHRPGHEVENLMPETMKSLLFDDIPFLPQAQKEHDAFAAILTKNATEVLYLEKLAAEALQTSPQVKRDFLKQLLSESAFKSGDTYDQLTDYLLDMPAQAMVNQIMAGIRRGKIQTSANSLSRFVNDQTRPFLIDPMPNLYFTRDPAAAIGHGLTISSMTFQARRRESLFMQLIVKHHPRFADQPIHIWRDRDQGTRLEGGDELVLSNHVLAIGISERTSSEAIQDLAKSLFSASAYDTIIAIQIPHAHAMMHLDTVFTMVNRDQFTVYPGIFNEQRKMPIFVLHQDRGNSIKVEHFDDLAAVLKRELGLSELDLILTADGDPVAAAREQWNDGSNTLAIAPGVVVTYDRNYVSNQVLRKHGVKVWEIPSSELSRGRGGPRCMSMPIYRVDLKA
>CP029684.1|QAS70531.1|1624698_1625055_+|metal-sulfur-cluster-biosynthesis-protein
MNENTLVENTQQSLTNREFKAVISALEQAIDPEMGISVEDLGLIYSLQATTQDDDRQLRIIMALTILGCPLSAELQTIVEQAVLANSSFKKVFVQIDPRIDWDPKRMSRVAKMTLGIL
>CP029684.1|QAS70530.1|1622287_1624489_-|anaerobic-ribonucleoside-triphosphate-reductase
MTNQNNNLTTTATAIKIQEVNGKISELKIDQLQQTLLQANQQLTDPIDEQSIKDLVDEILTQLPFFDDSSVSRQAVNETILAVLKERHDLKLVKAVDDLLMAKQVDASQATDISFMIQRLLDKDASIVNENANKDSQVFNTQRDLTAGTVAKAIGLKMLPPKVAAAHLSGDIHWHDLDYQPYSPMTNCCLIDFKEMLTNGFKIGNAEVESPNSIGTATAQMAQIIANVASSQYGGCSADRTDELLAPFAEKNYDKNLAEAKKWIDGEDKQNAFARQKTEKDIYDAMQGLEYEINTLYSSQGQTPFTTVGFGLGTSWIERAIQKAILQIRIQGLGKERRTAIFPKLVFTIKRGLNLKPGDPNYDIKQLAIECATKRMYPDVLMYDKIVELTGSFKAPMGCRSFLQGWHDENGQEVNSGRMNLGVVTVNLPRIAMESKQDQKKFWDIFEQRMDVCKQALLFKIARAKQANPDNAPILYEYGAFGKRLKRGDSIDQLFNKSRATVSLGYIGLYEVGTVFYGHAWEHDPQAKAFSVQIVKSLWEHCKAWEAEYGYHFSVYSTPSESLTDTFCRLDTKKFGIVKDITDKEYYTNSFHYDVRKKITPFEKIDFEKDYPKYTAGGFIHYCEYPNLKQNPKALEAVWDYAYDKIGYLGTNTPIDQCFECGFKGEFEATARGFKCPKCGNTDPATCDVVKRTCGYLGNPLQRPMIHGRHQEIVSRVKHMTLGNDATTSARQG
>CP029684.1|QAS70540.1|1640509_1641400_-|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MIVVALTKVPPSLRGDLTKWCQEIQTGIFVGKASARVRDKLWERIIRDIGNGQATMVFNTQNEFGYQFRTSRADRQVTDFDGIPFLMKLNDASTMIQPGFSDAAKFHRARLFAQAKVTHTQENKRKDFIVLDIETTGLDVMKDNIISIGAVKQYADGQTECFSTFIQIDKKIPEKIVNLTGITDEMLSEKATTLVNALDELKQFIGSSPLIGYNLSFDDKFISMSLRKNGREEFHNQMIDLLTKVKKSDKFLDNYRLATVLHKYGITNKKPHDALSDARSTLALTMKLIENKNLIF
>CP029684.1|QAS70541.1|1641396_1642353_-|type-I-E-CRISPR-associated-endonuclease-Cas1
MEAHAGAKKPELSELSRIRDRVSFLYLDHAKINRQDSAIVVTDSRGIVSIPSAMISVLMLGPGVDVTHRAMELIGDSGMSIVWVGERGVRQYAHGRALTHSSTLLEAQAKLVSNVRARVAVARKMYQMRFPDENVSALSMQELRGKEGVRVRKIYRELSRRTKVPWTGRQYNPEDFDSGSAINKALTAAHAALYGLSYSVIVALGASPGLGFVHTGHDLAFVYDFADLYKAEVTIPIAFKVVAKYGENADDISQKTRLAVRDAFVDGRLLIRMVADLKTLLGDSEPNSKTDIVNLWDDKLGLQKFGVSYREFERADQS
>CP029684.1|QAS70542.1|1642355_1643024_-|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MFLSRVEIDTKNRRKIKELTHLGAYHNWVEQSFPDEFRNPIRLRHLWRLDELGDKQYLLILSKNRPNIEGMERYGIPGSAQIKLYDKFLAQLETGQQVQFRLTANPTYAAYQAGERGRIYPHVTITQQLEWLIGRSELSGFHIPQLVLQGETNSITTRAFDIISRDHPILKKKNSKNIRVSRVTFEGKLEIQNLTNFKNALLEGIGREKAYGMGLMTVIPER
>CP029684.1|QAS70543.1|1643036_1643747_-|type-I-E-CRISPR-associated-protein-Cas5/CasD
MKTITIKLAGPLQSYGDEAHFSRRTTSDYPSKSAVIGFIAAAFGYRRDDERIAALNSLSFAVRIDQPGIKMTEFQTVEWKKDTRKLTYRDLLQDAIFIVALGSDENSLISKIKNALHHPQFQLYLGRRSNVPAGILKIEEFSDVDPVAALHQLDWQASDWYKKRHRRVETFNAEIFADSDLLSGKYSQLTKDEVESYSQEDRRFRFRSVSHGTIGLPNVFYQEKHFETNHDIFKFL
>CP029684.1|QAS70544.1|1643727_1644804_-|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MTNENIYLDIHVLQTVPSSNINRDDTGSPKTAFYGGVTRSRVSSQSWKRAMRVFFNSEGTETSGLRTKDVVKLLSQSIRRLDTGIKDEDAIAKSIGVLTACKIKIDKDNQTGALLLISRGQIQKIAQYVLDHETYDKKVLKEIFNGEQSLDLALFGRMVADNPELNVEGSAQVAHALSTHEVVPEFDYFTALDDLQPDDNAGASMLGTIEYNSSTLYRYANLNFRELEQNLGSDVAIKGALQYVKSFLLSMPTGKQNTFANKTLPSYVMVTIRNDTPVNLVSAFENPVKSNDGYVDTSIQRLESEYESTLQFVSKPLATVVLSKFDTQFGEKVTNLNVLLDAVSDNIAKVARNENDND
>CP029684.1|QAS70545.1|1644796_1645402_-|type-I-E-CRISPR-associated-protein-Cse2/CasB
MAYQIKNTTIRIIQELYNNENSNKAVLASLRGAANLTSLRAVLVWPILLANMDSEYLSKDGSPTHAEIAVFVSARLFAIHQQGKTHLVYGNASSKPVPEGLPVFTALSEMRNHQLANVALDRRVGQLLATTNLASVINSLTHLISIIKARNGDARIDYAALAEDLYWFQANFEQANQVRLRWGQAYYHSTIQQSERTEKND
>CP029684.1|QAS70546.1|1645417_1647121_-|type-I-E-CRISPR-associated-protein-Cse1/CasA
MSKRHFNLVAEPWIKVIYDSHGSMTEVSLIDLFKNAYQFKQLAGETRSQDFAVLRLLLAILETVYSRFDAENQAYDWLQTDDLMQVRAEVDDYNSDDLLETWKKLYQQGGFSDVVVTYLEKYKNSFDFFGDNPFYQVTQEQYDGLVPADKRVSTGKGTVSVKQINRSISESANSPALFAPKTEASKDQIALPELIRWIITYQNFTGATDKTKILTPNNFSIGAGWLYRLNPVFANGQNLFEALMLNLVLINKTSQNIYQVQKPVWEYANSITYIEERKKEFVPDNVAALYTSWSRALYLDWLNNDQPIIFSAGIPMFDPNNAFIEPFTVWRFDNKKKPAIYRPATKSNRSLSRAMWRNFGDYIDIYQDGNSGKQPGIVDWLHLLKERGLIARNTQLQLSSDTLISDGNATSQSPAAEISDTMSINADVLFDLDGSQYWPRRIEDAVDLAQLVERDYWQFIKTISKIRGFSSSNDTNFVNQETAKYYEQLNLPFKKWLADLTVEDDRDQKVNVWKQQLKLIVSSCVQVFMQSVSSRDIRGVVDEKSSAILNVFTAYNQLNRNVNRDLN
>CP029684.1|QAS70547.1|1647117_1649895_-|CRISPR-associated-helicase/endonuclease-Cas3
MSTVFSNLDRETRSLWAKKKTSDGQQQWLPLIAHLTDTAMVINLLYNHWLSENQRRILAKDSSEENARKLAKFVAFIHDIGKATPAFQLKPSYDGNRSLDHELLEQLISAGFAGMDTIKLSSPGKSPHAKAGEAILESFGVPDTVGAIVGGHHGRPLSFSPADEIQTYTANYWQSDKDKLVQDRWKRVQSQILNYSLRSAGFDEVSDIPSLDQTQAVILEGLLIMSDWLSSSEYLDNDVDKPLFPLIALDQPLESIDESVRVERAWNTWQVNDEWQPKKISMATDAYQQRWGFSARPVQRSVTKAISDMEDPGIVVVEAPMGLGKTEIALVAAEQLAYKSGSNGLFFGLPTQATSNAMFERVNTWLNFLSQTVESTLSIKLMHGKAQFNEDFQSIPNAANVDSDSSVVVNSWFSGKKSILDEFSVGTIDNLLLMALKQKHLALKHLGFSKKVVVIDEVHAYDTYMNQYLDRAIEWLGAYHVPTVILSATLPKDKRNQLVAKYFHGKYGKSIKRLGDFSSLMAGWEKNEAYPLVTILDGKELKQVSDFPGMTDQLPQRIQVQRVIDDDDKLIAHILASIEGGGVAGVIVNTVKRAQMLAKKIPDNVRILVLHSAFLAPERVKLERELQSTIGKNGDRPLKMVVIGTQVLEQSLDIDFDILYTDIAPMDLLLQRAGRLHRHQRARPSQLENPTMVLMGAQSLGKYSDANKAVYGQYLLLKTDYYLPNTLRLPTDISHLVQLVYDFEKDPSSIDGMKEAKTDFETQMKKEKAKASVFQISPPNLKNTATIHGWLDRAQMGVDTNDQQAAAAVRDINETLEIILVQDTKTGFYLLDGTKLEESMLADQAKMIAQQVVRLPTVFSYKIEKTITELEKITAKLFPMWQDNKWLRGSLVLPLDQDLSCVLLNYRLTYSQKYGLSYLEEESKK
>CP029684.1|QAS70548.1|1650150_1650444_-|hypothetical-protein
MFGFFPYSIIMAITPGPKYLMALQESRQRGFRGSMPFLYGLFVSFFILDFLAFFFTDFLKPISTTAILLMKIIGSLYLIYLIMDLFRTKSDTHGNRK
>CP029684.1|QAS70549.1|1650851_1651439_-|hypothetical-protein
MALGVLVLPQNDLKDSLEFNVINLLNFKDPSDSLGSFSCGNTEIDSFLKTKARTWSIVSNTFLLVNKQTDDIVAFYTLSNGITKLTKKYKKKHEFKFSEITDYPSINIVYFAVTESFQNKGFGKELMLSLLGNIYDHRLEFGGLSFVTVESLAESQSFYRKNFAFDNEESQNTSGNCALALTLKEIGQLLSNANQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
CP029684_1	1.9\|52615\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52615-52644	30	CP029684.1	656502-656531	0	1.0
CP029684_2	2.10\|1634807\|32\|CP029684\|CRISPRCasFinder,CRT	1634807-1634838	32	CP029684.1	1643336-1643367	0	1.0
CP029684_2	2.30\|1636027\|32\|CP029684\|CRISPRCasFinder,CRT	1636027-1636058	32	CP029684.1	1320393-1320424	0	1.0
CP029684_2	2.36\|1636393\|32\|CP029684\|CRISPRCasFinder,CRT	1636393-1636424	32	CP029684.1	1292071-1292102	0	1.0
CP029684_2	2.86\|1639443\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639443-1639474	32	CP029684.1	1325295-1325326	0	1.0
CP029684_2	2.87\|1639504\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639504-1639535	32	CP029684.1	1325887-1325918	0	1.0
CP029684_2	2.98\|1640175\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1640175-1640206	32	CP029684.1	1326826-1326857	0	1.0
CP029684_2	2.37\|1636454\|32\|CP029684\|CRISPRCasFinder,CRT	1636454-1636485	32	CP029684.1	1315930-1315961	1	0.969

1. spacer 1.9|52615|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to position: 656502-656531, mismatch: 0, identity: 1.0

gcgattgatgcgctccacctcgctggtgtt	CRISPR spacer
gcgattgatgcgctccacctcgctggtgtt	Protospacer
******************************

2. spacer 2.10|1634807|32|CP029684|CRISPRCasFinder,CRT matches to position: 1643336-1643367, mismatch: 0, identity: 1.0

ttttaagtatgccagcaggaacattggagcga	CRISPR spacer
ttttaagtatgccagcaggaacattggagcga	Protospacer
********************************

3. spacer 2.30|1636027|32|CP029684|CRISPRCasFinder,CRT matches to position: 1320393-1320424, mismatch: 0, identity: 1.0

aatgtgcttgattcaagctatggcaatgactc	CRISPR spacer
aatgtgcttgattcaagctatggcaatgactc	Protospacer
********************************

4. spacer 2.36|1636393|32|CP029684|CRISPRCasFinder,CRT matches to position: 1292071-1292102, mismatch: 0, identity: 1.0

cccaccagctgtctggcattgagatagttcgt	CRISPR spacer
cccaccagctgtctggcattgagatagttcgt	Protospacer
********************************

5. spacer 2.86|1639443|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to position: 1325295-1325326, mismatch: 0, identity: 1.0

atttattaggacgagggactccgatggtgaac	CRISPR spacer
atttattaggacgagggactccgatggtgaac	Protospacer
********************************

6. spacer 2.87|1639504|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to position: 1325887-1325918, mismatch: 0, identity: 1.0

accatcgtttgataagtcgagctctcaacttt	CRISPR spacer
accatcgtttgataagtcgagctctcaacttt	Protospacer
********************************

7. spacer 2.98|1640175|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to position: 1326826-1326857, mismatch: 0, identity: 1.0

caagaagttccactaatcactgtcgtcgcagc	CRISPR spacer
caagaagttccactaatcactgtcgtcgcagc	Protospacer
********************************

8. spacer 2.37|1636454|32|CP029684|CRISPRCasFinder,CRT matches to position: 1315930-1315961, mismatch: 1, identity: 0.969

gtagtcatggacaattcagcacagattcaatc	CRISPR spacer
gtagtcatggacaattcagcacaaattcaatc	Protospacer
***********************.********

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP029684_1	1.5\|52351\|30\|CP029684\|CRISPRCasFinder,CRT	52351-52380	30	GU071107	Cyanophage P-SSP2, complete genome	9799-9828	4	0.867
CP029684_1	1.5\|52351\|30\|CP029684\|CRISPRCasFinder,CRT	52351-52380	30	HQ332137	Prochlorococcus phage P-SSP3 genomic sequence	42832-42861	4	0.867
CP029684_1	1.13\|52880\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52880-52909	30	MF351863	Synechococcus phage Bellamy, complete genome	3893-3922	4	0.867
CP029684_2	2.79\|1639016\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639016-1639047	32	NZ_CP042005	Staphylococcus aureus strain B3-14B plasmid pSALNT16, complete sequence	9518-9549	4	0.875
CP029684_2	2.79\|1639016\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639016-1639047	32	MH791415	UNVERIFIED: Enterococcus phage EfsWh-1, complete genome	2960-2991	5	0.844
CP029684_2	2.79\|1639016\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639016-1639047	32	HE962497	Streptococcus phage SP-QS1 complete genome	50372-50403	5	0.844
CP029684_2	2.79\|1639016\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639016-1639047	32	MN871443	UNVERIFIED: Enterococcus phage EfsWh_1, complete genome	2960-2991	5	0.844
CP029684_1	1.4\|52285\|30\|CP029684\|CRISPRCasFinder,CRT	52285-52314	30	NC_017976	Bacillus phage PBC1, complete genome	24761-24790	6	0.8
CP029684_1	1.9\|52615\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52615-52644	30	NZ_CP018230	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence	171431-171460	6	0.8
CP029684_1	1.9\|52615\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52615-52644	30	MH229865	Streptomyces phage LazerLemon, complete genome	13342-13371	6	0.8
CP029684_1	1.9\|52615\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52615-52644	30	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	1291274-1291303	6	0.8
CP029684_1	1.9\|52615\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52615-52644	30	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	1345802-1345831	6	0.8
CP029684_1	1.9\|52615\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52615-52644	30	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	1216240-1216269	6	0.8
CP029684_1	1.9\|52615\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52615-52644	30	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	1275941-1275970	6	0.8
CP029684_1	1.9\|52615\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52615-52644	30	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	1215337-1215366	6	0.8
CP029684_1	1.9\|52615\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52615-52644	30	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	1248266-1248295	6	0.8
CP029684_1	1.9\|52615\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52615-52644	30	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	1248257-1248286	6	0.8
CP029684_1	1.9\|52615\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52615-52644	30	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	1216232-1216261	6	0.8
CP029684_1	1.9\|52615\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52615-52644	30	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	1215587-1215616	6	0.8
CP029684_1	1.9\|52615\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52615-52644	30	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	1216223-1216252	6	0.8
CP029684_1	1.9\|52615\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52615-52644	30	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	1291408-1291437	6	0.8
CP029684_1	1.9\|52615\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52615-52644	30	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	1291391-1291420	6	0.8
CP029684_1	1.9\|52615\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52615-52644	30	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	1291380-1291409	6	0.8
CP029684_1	1.9\|52615\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52615-52644	30	NC_007483	Nitrosococcus oceani ATCC 19707 plasmid A, complete sequence	31354-31383	6	0.8
CP029684_1	1.11\|52747\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52747-52776	30	NZ_CP031072	Bacillus mycoides strain BPN401 plasmid pl395, complete sequence	310988-311017	6	0.8
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	MN689516	Lactococcus phage CHPC148, complete genome	13930-13959	6	0.8
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	NC_004746	Lactococcus phage 4268, complete genome	27746-27775	6	0.8
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	MN534316	Lactococcus phage proPhi2, complete genome	27902-27931	6	0.8
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	AF323670	Bacteriophage bIL309, complete genome	28397-28426	6	0.8
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	AF323669	Bacteriophage bIL286, complete genome	30660-30689	6	0.8
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	AJ245616	Lactococcus lactis phage BK5-T complete genome	14075-14104	6	0.8
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	NC_002668	Lactococcus prophage bIL309, complete genome	28397-28426	6	0.8
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	AF176025	Lactococcus phage BK5-T, complete genome	14075-14104	6	0.8
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	AF489521	Lactococcus bacteriophage 4268, complete genome	27746-27775	6	0.8
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	MN534317	Lactococcus phage proPhi4, complete genome	27902-27931	6	0.8
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	NC_002667	Lactococcus prophage bIL286, complete genome	30660-30689	6	0.8
CP029684_1	1.25\|52352\|29\|CP029684\|PILER-CR	52352-52380	29	HQ332137	Prochlorococcus phage P-SSP3 genomic sequence	42833-42861	6	0.793
CP029684_1	1.25\|52352\|29\|CP029684\|PILER-CR	52352-52380	29	GU071107	Cyanophage P-SSP2, complete genome	9799-9827	6	0.793
CP029684_2	2.2\|1634318\|32\|CP029684\|CRISPRCasFinder	1634318-1634349	32	NC_013453	Staphylococcus aureus subsp. aureus ED98 plasmid pAVX, complete sequence	16043-16074	6	0.812
CP029684_2	2.2\|1634318\|32\|CP029684\|CRISPRCasFinder	1634318-1634349	32	NZ_CP046029	Staphylococcus chromogenes strain 1401 plasmid unnamed1	9239-9270	6	0.812
CP029684_2	2.2\|1634318\|32\|CP029684\|CRISPRCasFinder	1634318-1634349	32	NZ_CP042651	Staphylococcus aureus strain X22 plasmid unnamed, complete sequence	17684-17715	6	0.812
CP029684_2	2.2\|1634318\|32\|CP029684\|CRISPRCasFinder	1634318-1634349	32	NZ_CP042158	Staphylococcus aureus strain B3-17D plasmid pSALNC17, complete sequence	7600-7631	6	0.812
CP029684_2	2.2\|1634318\|32\|CP029684\|CRISPRCasFinder	1634318-1634349	32	NZ_CP009624	Staphylococcus agnetis strain 908 plasmid unamed, complete sequence	14311-14342	6	0.812
CP029684_2	2.2\|1634318\|32\|CP029684\|CRISPRCasFinder	1634318-1634349	32	NZ_CP042154	Staphylococcus aureus strain B4-59C plasmid pSALNC14, complete sequence	6546-6577	6	0.812
CP029684_2	2.2\|1634318\|32\|CP029684\|CRISPRCasFinder	1634318-1634349	32	NZ_CP042108	Staphylococcus aureus strain B8-13D plasmid pSALNCG17, complete sequence	7666-7697	6	0.812
CP029684_2	2.2\|1634318\|32\|CP029684\|CRISPRCasFinder	1634318-1634349	32	NZ_CP053077	Staphylococcus aureus strain SA01 plasmid pSA01-03, complete sequence	5448-5479	6	0.812
CP029684_2	2.2\|1634318\|32\|CP029684\|CRISPRCasFinder	1634318-1634349	32	NZ_MH785236	Staphylococcus aureus strain ph1 plasmid pPH1-1, complete sequence	23965-23996	6	0.812
CP029684_2	2.2\|1634318\|32\|CP029684\|CRISPRCasFinder	1634318-1634349	32	NZ_MH785251	Staphylococcus aureus strain ch8 plasmid pAvX, complete sequence	16044-16075	6	0.812
CP029684_2	2.2\|1634318\|32\|CP029684\|CRISPRCasFinder	1634318-1634349	32	NZ_MH785243	Staphylococcus aureus strain pa2 plasmid pAvX, complete sequence	16044-16075	6	0.812
CP029684_2	2.2\|1634318\|32\|CP029684\|CRISPRCasFinder	1634318-1634349	32	NC_020227	Staphylococcus aureus strain CH-91 plasmid pCH91, complete sequence	16302-16333	6	0.812
CP029684_2	2.2\|1634318\|32\|CP029684\|CRISPRCasFinder	1634318-1634349	32	NZ_CP042045	Staphylococcus aureus strain B2-15A plasmid pSALNCL17, complete sequence	7600-7631	6	0.812
CP029684_2	2.2\|1634318\|32\|CP029684\|CRISPRCasFinder	1634318-1634349	32	NZ_MK388402	Staphylococcus aureus strain ph2 plasmid pAvX, complete sequence	16007-16038	6	0.812
CP029684_2	2.2\|1634318\|32\|CP029684\|CRISPRCasFinder	1634318-1634349	32	NZ_MH785252	Staphylococcus aureus strain ch23 plasmid pAvX, complete sequence	16046-16077	6	0.812
CP029684_2	2.2\|1634318\|32\|CP029684\|CRISPRCasFinder	1634318-1634349	32	NZ_MH785235	Staphylococcus aureus strain ch10 plasmid pAvX, complete sequence	16044-16075	6	0.812
CP029684_2	2.2\|1634318\|32\|CP029684\|CRISPRCasFinder	1634318-1634349	32	NZ_MH785249	Staphylococcus aureus strain ch5 plasmid pAvX, complete sequence	16045-16076	6	0.812
CP029684_2	2.2\|1634318\|32\|CP029684\|CRISPRCasFinder	1634318-1634349	32	NZ_MH785229	Staphylococcus aureus strain pa3 plasmid pPA3, complete sequence	25755-25786	6	0.812
CP029684_2	2.2\|1634318\|32\|CP029684\|CRISPRCasFinder	1634318-1634349	32	NZ_MH785244	Staphylococcus aureus strain tu1 plasmid pAvX, complete sequence	16044-16075	6	0.812
CP029684_2	2.2\|1634318\|32\|CP029684\|CRISPRCasFinder	1634318-1634349	32	NZ_MH785248	Staphylococcus aureus strain ch9 plasmid pAvX, complete sequence	16046-16077	6	0.812
CP029684_2	2.14\|1635051\|32\|CP029684\|CRISPRCasFinder,CRT	1635051-1635082	32	MN694639	Marine virus AFVG_250M766, complete genome	5491-5522	6	0.812
CP029684_2	2.14\|1635051\|32\|CP029684\|CRISPRCasFinder,CRT	1635051-1635082	32	MN694396	Marine virus AFVG_250M754, complete genome	32547-32578	6	0.812
CP029684_2	2.16\|1635173\|32\|CP029684\|CRISPRCasFinder,CRT	1635173-1635204	32	KF669663	Bacillus phage Staley, complete genome	45034-45065	6	0.812
CP029684_2	2.16\|1635173\|32\|CP029684\|CRISPRCasFinder,CRT	1635173-1635204	32	NC_022774	Bacillus phage Slash, complete genome	43492-43523	6	0.812
CP029684_2	2.16\|1635173\|32\|CP029684\|CRISPRCasFinder,CRT	1635173-1635204	32	KP696447	Bacillus phage Stahl, complete genome	42585-42616	6	0.812
CP029684_2	2.16\|1635173\|32\|CP029684\|CRISPRCasFinder,CRT	1635173-1635204	32	MG428991	Klebsiella phage May, complete genome	68159-68190	6	0.812
CP029684_2	2.31\|1636088\|32\|CP029684\|CRISPRCasFinder,CRT	1636088-1636119	32	KX581091	Vibrio phage Cla, complete genome	4085-4116	6	0.812
CP029684_2	2.31\|1636088\|32\|CP029684\|CRISPRCasFinder,CRT	1636088-1636119	32	KX581096	Vibrio phage pVa-5, complete genome	4086-4117	6	0.812
CP029684_2	2.31\|1636088\|32\|CP029684\|CRISPRCasFinder,CRT	1636088-1636119	32	MK672804	Vibrio phage Va_178/90_p41, complete genome	39423-39454	6	0.812
CP029684_2	2.31\|1636088\|32\|CP029684\|CRISPRCasFinder,CRT	1636088-1636119	32	KY658673	Vibrio phage H2 PGK-2017, complete genome	4086-4117	6	0.812
CP029684_2	2.31\|1636088\|32\|CP029684\|CRISPRCasFinder,CRT	1636088-1636119	32	KX581093	Vibrio phage Pel, complete genome	4086-4117	6	0.812
CP029684_2	2.31\|1636088\|32\|CP029684\|CRISPRCasFinder,CRT	1636088-1636119	32	KX581097	Vibrio phage pVa-6, complete genome	4086-4117	6	0.812
CP029684_2	2.31\|1636088\|32\|CP029684\|CRISPRCasFinder,CRT	1636088-1636119	32	KY658677	Vibrio phage P3, complete genome	4086-4117	6	0.812
CP029684_2	2.31\|1636088\|32\|CP029684\|CRISPRCasFinder,CRT	1636088-1636119	32	KX581098	Vibrio phage VaK, complete genome	4094-4125	6	0.812
CP029684_2	2.31\|1636088\|32\|CP029684\|CRISPRCasFinder,CRT	1636088-1636119	32	KY658674	Vibrio phage H8, complete genome	4086-4117	6	0.812
CP029684_2	2.31\|1636088\|32\|CP029684\|CRISPRCasFinder,CRT	1636088-1636119	32	KY658676	Vibrio phage P2, complete genome	4086-4117	6	0.812
CP029684_2	2.31\|1636088\|32\|CP029684\|CRISPRCasFinder,CRT	1636088-1636119	32	KX581090	Vibrio phage Her, complete genome	4085-4116	6	0.812
CP029684_2	2.31\|1636088\|32\|CP029684\|CRISPRCasFinder,CRT	1636088-1636119	32	KY658678	Vibrio phage pVa-3, complete genome	4086-4117	6	0.812
CP029684_2	2.31\|1636088\|32\|CP029684\|CRISPRCasFinder,CRT	1636088-1636119	32	KY658679	Vibrio phage pVa-4, complete genome	4086-4117	6	0.812
CP029684_2	2.31\|1636088\|32\|CP029684\|CRISPRCasFinder,CRT	1636088-1636119	32	MK672800	Vibrio phage Va_90-11-287_p41_Ba35, complete genome	14098-14129	6	0.812
CP029684_2	2.31\|1636088\|32\|CP029684\|CRISPRCasFinder,CRT	1636088-1636119	32	MK672799	Vibrio phage Va_90-11-287_p41, complete genome	14098-14129	6	0.812
CP029684_2	2.31\|1636088\|32\|CP029684\|CRISPRCasFinder,CRT	1636088-1636119	32	KX581092	Vibrio phage Len, complete genome	4085-4116	6	0.812
CP029684_2	2.31\|1636088\|32\|CP029684\|CRISPRCasFinder,CRT	1636088-1636119	32	KX581094	Vibrio phage pVa-2, complete genome	4085-4116	6	0.812
CP029684_2	2.31\|1636088\|32\|CP029684\|CRISPRCasFinder,CRT	1636088-1636119	32	MK672803	Vibrio phage Va_91-7-154_p41, complete genome	49681-49712	6	0.812
CP029684_2	2.31\|1636088\|32\|CP029684\|CRISPRCasFinder,CRT	1636088-1636119	32	KY658680	Vibrio phage pVa-8, complete genome	4086-4117	6	0.812
CP029684_2	2.31\|1636088\|32\|CP029684\|CRISPRCasFinder,CRT	1636088-1636119	32	KY658675	Vibrio phage H20, complete genome	4086-4117	6	0.812
CP029684_2	2.31\|1636088\|32\|CP029684\|CRISPRCasFinder,CRT	1636088-1636119	32	KX581095	Vibrio phage pVa-1, complete genome	4086-4117	6	0.812
CP029684_2	2.31\|1636088\|32\|CP029684\|CRISPRCasFinder,CRT	1636088-1636119	32	KX581099	Vibrio phage Strym, complete genome	4085-4116	6	0.812
CP029684_2	2.31\|1636088\|32\|CP029684\|CRISPRCasFinder,CRT	1636088-1636119	32	MK672801	Vibrio phage Va_90-11-287_p41_T265, complete genome	14098-14129	6	0.812
CP029684_2	2.31\|1636088\|32\|CP029684\|CRISPRCasFinder,CRT	1636088-1636119	32	KX581100	Vibrio phage pVa-7, complete genome	4086-4117	6	0.812
CP029684_2	2.35\|1636332\|32\|CP029684\|CRISPRCasFinder,CRT	1636332-1636363	32	NZ_CP028348	Novosphingobium sp. THN1 plasmid pTHN, complete sequence	363269-363300	6	0.812
CP029684_2	2.38\|1636515\|32\|CP029684\|CRISPRCasFinder,CRT	1636515-1636546	32	NZ_CP009688	Clostridium aceticum strain DSM 1496 plasmid CACET_5p, complete sequence	3128-3159	6	0.812
CP029684_2	2.76\|1638833\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638833-1638864	32	NZ_CP046704	Nostoc sp. ATCC 53789 plasmid pNsp_a, complete sequence	248845-248876	6	0.812
CP029684_2	2.76\|1638833\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638833-1638864	32	NZ_CP024791	Nostoc flagelliforme CCNUN1 plasmid pNFSY06, complete sequence	53338-53369	6	0.812
CP029684_2	2.76\|1638833\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638833-1638864	32	NZ_CP024793	Nostoc flagelliforme CCNUN1 plasmid pNFSY08, complete sequence	264474-264505	6	0.812
CP029684_2	2.76\|1638833\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638833-1638864	32	NZ_CP026693	Nostoc sp. 'Lobaria pulmonaria (5183) cyanobiont' strain 5183 plasmid pNLP1, complete sequence	37485-37516	6	0.812
CP029684_2	2.76\|1638833\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638833-1638864	32	NC_010632	Nostoc punctiforme PCC 73102 plasmid pNPUN02, complete sequence	204221-204252	6	0.812
CP029684_2	2.100\|1640297\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1640297-1640328	32	AY848685	Enterobacteria phage PR3, complete genome	10655-10686	6	0.812
CP029684_2	2.100\|1640297\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1640297-1640328	32	AY848686	Enterobacteria phage PR4, complete genome	10678-10709	6	0.812
CP029684_2	2.100\|1640297\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1640297-1640328	32	AY848684	Enterobacteria phage L17, complete genome	10654-10685	6	0.812
CP029684_1	1.1\|52087\|30\|CP029684\|CRISPRCasFinder,CRT	52087-52116	30	NZ_CP031947	Ruegeria sp. AD91A plasmid unnamed1, complete sequence	32004-32033	7	0.767
CP029684_1	1.1\|52087\|30\|CP029684\|CRISPRCasFinder,CRT	52087-52116	30	NZ_CP024012	Acinetobacter sp. LoGeW2-3 plasmid unnamed1, complete sequence	102156-102185	7	0.767
CP029684_1	1.9\|52615\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52615-52644	30	NZ_CP012698	Microbacterium sp. No. 7 plasmid A, complete sequence	78244-78273	7	0.767
CP029684_1	1.9\|52615\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52615-52644	30	NZ_CP029357	Azospirillum sp. CFH 70021 plasmid unnamed2	399036-399065	7	0.767
CP029684_1	1.9\|52615\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52615-52644	30	NC_008010	Deinococcus geothermalis DSM 11300 plasmid pDGEO01, complete sequence	310525-310554	7	0.767
CP029684_1	1.9\|52615\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52615-52644	30	NZ_CP044082	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed4, complete sequence	183789-183818	7	0.767
CP029684_1	1.11\|52747\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52747-52776	30	JQ680349	Unidentified phage clone 1013_scaffold24 genomic sequence	25825-25854	7	0.767
CP029684_1	1.13\|52880\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52880-52909	30	NC_019431	Lactococcus lactis subsp. cremoris UC509.9 plasmid pCIS7, complete sequence	37533-37562	7	0.767
CP029684_1	1.13\|52880\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52880-52909	30	NZ_AP018500	Lactococcus lactis subsp. cremoris strain C4 plasmid pC41, complete sequence	41690-41719	7	0.767
CP029684_1	1.13\|52880\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52880-52909	30	NZ_CP051521	Lactococcus lactis subsp. cremoris strain F plasmid pScrF75, complete sequence	13094-13123	7	0.767
CP029684_1	1.13\|52880\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52880-52909	30	NZ_CP016685	Lactococcus lactis subsp. cremoris strain 158 plasmid p158A, complete sequence	59600-59629	7	0.767
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	MH937504	Streptococcus phage CHPC1091, complete genome	12713-12742	7	0.767
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	MH937501	Streptococcus phage CHPC1073, complete genome	12754-12783	7	0.767
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	MH937468	Streptococcus phage CHPC879, complete genome	12913-12942	7	0.767
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	MF580770	Streptococcus phage M19, complete genome	12752-12781	7	0.767
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	MH892360	Streptococcus phage SW11, complete genome	13720-13749	7	0.767
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	KY705270	Streptococcus phage P7573, complete genome	14226-14255	7	0.767
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	MH892361	Streptococcus phage SW12, complete genome	13768-13797	7	0.767
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	NC_000871	Streptococcus phage Sfi19, complete genome	14368-14397	7	0.767
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	MH937483	Streptococcus phage CHPC1005, complete genome	14188-14217	7	0.767
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	MG708275	Streptococcus phage vB_SthS_VA460, complete genome	35959-35988	7	0.767
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	MH937486	Streptococcus phage CHPC1027, complete genome	12738-12767	7	0.767
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	MH937500	Streptococcus phage CHPC1067, complete genome	12763-12792	7	0.767
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	MH937462	Streptococcus phage CHPC663, complete genome	12699-12728	7	0.767
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	KY705263	Streptococcus phage P7133, complete genome	12972-13001	7	0.767
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	MF580771	Streptococcus phage MM25, complete genome	13329-13358	7	0.767
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	MH937481	Streptococcus phage CHPC979, complete genome	12742-12771	7	0.767
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	MH892351	Streptococcus phage SW6, complete genome	13702-13731	7	0.767
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	MH892375	Streptococcus phage SW30, complete genome	13666-13695	7	0.767
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	AF115102	Streptococcus thermophilus bacteriophage Sfi19, complete genome	14368-14397	7	0.767
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	MH892354	Streptococcus phage SW3, complete genome	13382-13411	7	0.767
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	MH937488	Streptococcus phage CHPC1033, complete genome	13962-13991	7	0.767
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	MH937508	Streptococcus phage CHPC1156, complete genome	13216-13245	7	0.767
CP029684_1	1.15\|53012\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53012-53041	30	MH937470	Streptococcus phage CHPC925, complete genome	12819-12848	7	0.767
CP029684_1	1.17\|53144\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53144-53173	30	MN582112	Podoviridae sp. ctpVR23, complete genome	34336-34365	7	0.767
CP029684_1	1.17\|53144\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53144-53173	30	NZ_CP034226	Lactobacillus agilis strain La3 plasmid pLa3_1, complete sequence	3301-3330	7	0.767
CP029684_1	1.18\|53210\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53210-53239	30	KU234532	Nostoc phage N1, complete genome	8316-8345	7	0.767
CP029684_1	1.19\|53276\|29\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53276-53304	29	MG018928	Pseudomonas phage inbricus, complete genome	4212-4240	7	0.759
CP029684_1	1.19\|53276\|29\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53276-53304	29	MK962632	Achromobacter phage vB_AxyP_19-32_Axy13, complete genome	20518-20546	7	0.759
CP029684_1	1.20\|53341\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53341-53370	30	MK448761	Streptococcus phage Javan445, complete genome	39407-39436	7	0.767
CP029684_1	1.20\|53341\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53341-53370	30	MN692966	Marine virus AFVG_117M38, complete genome	18044-18073	7	0.767
CP029684_1	1.20\|53341\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53341-53370	30	MK448760	Streptococcus phage Javan443, complete genome	39407-39436	7	0.767
CP029684_1	1.22\|53473\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53473-53502	30	JQ340088	Halocynthia phage JM-2012, complete genome	30716-30745	7	0.767
CP029684_1	1.23\|53539\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53539-53568	30	NZ_CP049732	Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence	486354-486383	7	0.767
CP029684_1	1.23\|53539\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53539-53568	30	NZ_CP053208	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence	442748-442777	7	0.767
CP029684_1	1.26\|52418\|29\|CP029684\|PILER-CR	52418-52446	29	NZ_CP019063	Rahnella sp. ERMR1:05 plasmid unnamed1, complete sequence	159543-159571	7	0.759
CP029684_2	2.1\|1634255\|34\|CP029684\|CRISPRCasFinder	1634255-1634288	34	AP014318	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S32-C66, * SEQUENCING IN PROGRESS *	5254-5287	7	0.794
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	MK905543	Vibrio phage USC-1, complete genome	2794-2825	7	0.781
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	MK358448	Vibrio phage 5, complete genome	23922-23953	7	0.781
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_CP048757	Campylobacter jejuni strain ZS006 plasmid pCJ41K-01, complete sequence	32837-32868	7	0.781
CP029684_2	2.16\|1635173\|32\|CP029684\|CRISPRCasFinder,CRT	1635173-1635204	32	KP696448	Bacillus phage Stills, complete genome	42997-43028	7	0.781
CP029684_2	2.17\|1635234\|32\|CP029684\|CRISPRCasFinder,CRT	1635234-1635265	32	MH617008	Microviridae sp. isolate ctbe706, complete genome	3676-3707	7	0.781
CP029684_2	2.43\|1636820\|32\|CP029684\|CRISPRCasFinder,CRT	1636820-1636851	32	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	10220-10251	7	0.781
CP029684_2	2.54\|1637491\|32\|CP029684\|CRISPRCasFinder,CRT	1637491-1637522	32	NZ_CP044448	Acinetobacter indicus strain CMG3-2 plasmid pCMG3-2-3, complete sequence	9050-9081	7	0.781
CP029684_2	2.54\|1637491\|32\|CP029684\|CRISPRCasFinder,CRT	1637491-1637522	32	NZ_MH999418	Acinetobacter sp. SWBY1 plasmid unnamed, complete sequence	755-786	7	0.781
CP029684_2	2.54\|1637491\|32\|CP029684\|CRISPRCasFinder,CRT	1637491-1637522	32	NZ_CP028558	Acinetobacter sp. WCHA45 plasmid p3_010045, complete sequence	603-634	7	0.781
CP029684_2	2.54\|1637491\|32\|CP029684\|CRISPRCasFinder,CRT	1637491-1637522	32	NZ_CP033130	Acinetobacter wuhouensis strain WCHAW010062 plasmid pOXA23_010062, complete sequence	210198-210229	7	0.781
CP029684_2	2.54\|1637491\|32\|CP029684\|CRISPRCasFinder,CRT	1637491-1637522	32	NZ_CP033131	Acinetobacter wuhouensis strain WCHAW010062 plasmid pOXA58_010062, complete sequence	3504-3535	7	0.781
CP029684_2	2.54\|1637491\|32\|CP029684\|CRISPRCasFinder,CRT	1637491-1637522	32	NZ_CP032272	Acinetobacter sp. WCHAc010034 plasmid p4_010034, complete sequence	7977-8008	7	0.781
CP029684_2	2.54\|1637491\|32\|CP029684\|CRISPRCasFinder,CRT	1637491-1637522	32	NZ_CP042561	Acinetobacter baumannii strain E47 plasmid pE47_005, complete sequence	503-534	7	0.781
CP029684_2	2.54\|1637491\|32\|CP029684\|CRISPRCasFinder,CRT	1637491-1637522	32	NZ_CP029391	Acinetobacter defluvii strain WCHA30 plasmid p3_010030, complete sequence	4414-4445	7	0.781
CP029684_2	2.54\|1637491\|32\|CP029684\|CRISPRCasFinder,CRT	1637491-1637522	32	NC_025121	Acinetobacter sp. M131 plasmid pM131-4, complete sequence	6807-6838	7	0.781
CP029684_2	2.54\|1637491\|32\|CP029684\|CRISPRCasFinder,CRT	1637491-1637522	32	NZ_CP031712	Acinetobacter wuhouensis strain WCHA60 plasmid p4_010060, complete sequence	7613-7644	7	0.781
CP029684_2	2.54\|1637491\|32\|CP029684\|CRISPRCasFinder,CRT	1637491-1637522	32	NZ_CP010903	Acinetobacter nosocomialis strain 6411 plasmid p6411-66.409kb, complete sequence	55535-55566	7	0.781
CP029684_2	2.54\|1637491\|32\|CP029684\|CRISPRCasFinder,CRT	1637491-1637522	32	NZ_CP039153	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-10, complete sequence	2231-2262	7	0.781
CP029684_2	2.54\|1637491\|32\|CP029684\|CRISPRCasFinder,CRT	1637491-1637522	32	NZ_CP026413	Acinetobacter sp. ACNIH2 plasmid pACI-35f6, complete sequence	1120-1151	7	0.781
CP029684_2	2.54\|1637491\|32\|CP029684\|CRISPRCasFinder,CRT	1637491-1637522	32	NZ_CP044467	Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-4, complete sequence	2230-2261	7	0.781
CP029684_2	2.54\|1637491\|32\|CP029684\|CRISPRCasFinder,CRT	1637491-1637522	32	NZ_CP044471	Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-8, complete sequence	1465-1496	7	0.781
CP029684_2	2.67\|1638284\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638284-1638315	32	NZ_CP044448	Acinetobacter indicus strain CMG3-2 plasmid pCMG3-2-3, complete sequence	9050-9081	7	0.781
CP029684_2	2.67\|1638284\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638284-1638315	32	NZ_MH999418	Acinetobacter sp. SWBY1 plasmid unnamed, complete sequence	755-786	7	0.781
CP029684_2	2.67\|1638284\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638284-1638315	32	NZ_CP028558	Acinetobacter sp. WCHA45 plasmid p3_010045, complete sequence	603-634	7	0.781
CP029684_2	2.67\|1638284\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638284-1638315	32	NZ_CP033130	Acinetobacter wuhouensis strain WCHAW010062 plasmid pOXA23_010062, complete sequence	210198-210229	7	0.781
CP029684_2	2.67\|1638284\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638284-1638315	32	NZ_CP033131	Acinetobacter wuhouensis strain WCHAW010062 plasmid pOXA58_010062, complete sequence	3504-3535	7	0.781
CP029684_2	2.67\|1638284\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638284-1638315	32	NZ_CP032272	Acinetobacter sp. WCHAc010034 plasmid p4_010034, complete sequence	7977-8008	7	0.781
CP029684_2	2.67\|1638284\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638284-1638315	32	NZ_CP042561	Acinetobacter baumannii strain E47 plasmid pE47_005, complete sequence	503-534	7	0.781
CP029684_2	2.67\|1638284\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638284-1638315	32	NZ_CP029391	Acinetobacter defluvii strain WCHA30 plasmid p3_010030, complete sequence	4414-4445	7	0.781
CP029684_2	2.67\|1638284\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638284-1638315	32	NC_025121	Acinetobacter sp. M131 plasmid pM131-4, complete sequence	6807-6838	7	0.781
CP029684_2	2.67\|1638284\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638284-1638315	32	NZ_CP031712	Acinetobacter wuhouensis strain WCHA60 plasmid p4_010060, complete sequence	7613-7644	7	0.781
CP029684_2	2.67\|1638284\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638284-1638315	32	NZ_CP010903	Acinetobacter nosocomialis strain 6411 plasmid p6411-66.409kb, complete sequence	55535-55566	7	0.781
CP029684_2	2.67\|1638284\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638284-1638315	32	NZ_CP039153	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-10, complete sequence	2231-2262	7	0.781
CP029684_2	2.67\|1638284\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638284-1638315	32	NZ_CP026413	Acinetobacter sp. ACNIH2 plasmid pACI-35f6, complete sequence	1120-1151	7	0.781
CP029684_2	2.67\|1638284\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638284-1638315	32	NZ_CP044467	Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-4, complete sequence	2230-2261	7	0.781
CP029684_2	2.67\|1638284\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638284-1638315	32	NZ_CP044471	Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-8, complete sequence	1465-1496	7	0.781
CP029684_2	2.79\|1639016\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639016-1639047	32	NZ_AP019380	Buchnera aphidicola (Nipponaphis monzeni) strain Nmo isolate Tokyo2014 plasmid pLeu, complete sequence	9222-9253	7	0.781
CP029684_2	2.93\|1639870\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639870-1639901	32	NZ_CP018080	Sulfitobacter sp. AM1-D1 plasmid unnamed4, complete sequence	63714-63745	7	0.781
CP029684_2	2.100\|1640297\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1640297-1640328	32	AY848688	Enterobacteria phage PR772, complete genome	10663-10694	7	0.781
CP029684_2	2.100\|1640297\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1640297-1640328	32	AY848687	Enterobacteria phage PR5, complete genome	10662-10693	7	0.781
CP029684_2	2.100\|1640297\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1640297-1640328	32	NC_001421	Salmonella virus PRD1, complete genome	10662-10693	7	0.781
CP029684_2	2.100\|1640297\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1640297-1640328	32	AY848689	Enterobacteria phage PRD1, complete genome	10662-10693	7	0.781
CP029684_2	2.100\|1640297\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1640297-1640328	32	AY441783	Bacteriophage PR772, complete genome	10665-10696	7	0.781
CP029684_1	1.1\|52087\|30\|CP029684\|CRISPRCasFinder,CRT	52087-52116	30	NZ_CP020413	Leptospira interrogans serovar Copenhageni strain FDAARGOS_203 plasmid unnamed1, complete sequence	167820-167849	8	0.733
CP029684_1	1.1\|52087\|30\|CP029684\|CRISPRCasFinder,CRT	52087-52116	30	NZ_CP009619	Vibrio coralliilyticus strain RE98 plasmid p380, complete sequence	342061-342090	8	0.733
CP029684_1	1.1\|52087\|30\|CP029684\|CRISPRCasFinder,CRT	52087-52116	30	MN693772	Marine virus AFVG_250M408, complete genome	17635-17664	8	0.733
CP029684_1	1.6\|52417\|30\|CP029684\|CRISPRCasFinder,CRT	52417-52446	30	NZ_CP019063	Rahnella sp. ERMR1:05 plasmid unnamed1, complete sequence	159543-159572	8	0.733
CP029684_1	1.7\|52483\|30\|CP029684\|CRISPRCasFinder,CRT	52483-52512	30	NZ_CP019063	Rahnella sp. ERMR1:05 plasmid unnamed1, complete sequence	159543-159572	8	0.733
CP029684_1	1.8\|52549\|30\|CP029684\|CRISPRCasFinder,CRT	52549-52578	30	MH153807	Rhodococcus phage Peregrin, complete genome	55583-55612	8	0.733
CP029684_1	1.9\|52615\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52615-52644	30	NZ_CP021406	Celeribacter manganoxidans strain DY25 plasmid pDY25-B, complete sequence	77270-77299	8	0.733
CP029684_1	1.12\|52813\|31\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52813-52843	31	NZ_CP020521	Escherichia coli strain 190 plasmid unnamed4, complete sequence	779-809	8	0.742
CP029684_1	1.21\|53407\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53407-53436	30	MN693885	Marine virus AFVG_250M83, complete genome	18479-18508	8	0.733
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	768677-768708	8	0.75
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_CP009359	Vibrio tubiashii ATCC 19109 plasmid p48, complete sequence	18123-18154	8	0.75
CP029684_2	2.5\|1634501\|32\|CP029684\|CRISPRCasFinder,CRT	1634501-1634532	32	NZ_CP040048	Acinetobacter baumannii strain VB1190 plasmid unnamed1, complete sequence	557130-557161	8	0.75
CP029684_2	2.7\|1634623\|33\|CP029684\|CRISPRCasFinder,CRT	1634623-1634655	33	MH617008	Microviridae sp. isolate ctbe706, complete genome	3676-3708	8	0.758
CP029684_2	2.14\|1635051\|32\|CP029684\|CRISPRCasFinder,CRT	1635051-1635082	32	NZ_CP015007	Aminobacter aminovorans strain KCTC 2477 plasmid pAA02, complete sequence	194985-195016	8	0.75
CP029684_2	2.14\|1635051\|32\|CP029684\|CRISPRCasFinder,CRT	1635051-1635082	32	MN693834	Marine virus AFVG_250M755, complete genome	32547-32578	8	0.75
CP029684_2	2.14\|1635051\|32\|CP029684\|CRISPRCasFinder,CRT	1635051-1635082	32	MN694801	Marine virus AFVG_250M760, complete genome	31171-31202	8	0.75
CP029684_2	2.14\|1635051\|32\|CP029684\|CRISPRCasFinder,CRT	1635051-1635082	32	MN694618	Marine virus AFVG_250M753, complete genome	32305-32336	8	0.75
CP029684_2	2.15\|1635112\|32\|CP029684\|CRISPRCasFinder,CRT	1635112-1635143	32	MN855920	Bacteriophage sp. isolate 447, partial genome	2513-2544	8	0.75
CP029684_2	2.16\|1635173\|32\|CP029684\|CRISPRCasFinder,CRT	1635173-1635204	32	NZ_KY513280	Enterococcus faecalis strain 6742 plasmid p6742_1, complete sequence	898-929	8	0.75
CP029684_2	2.16\|1635173\|32\|CP029684\|CRISPRCasFinder,CRT	1635173-1635204	32	NZ_CP028725	Enterococcus faecalis strain CVM N60443F plasmid pN60443F-2, complete sequence	38912-38943	8	0.75
CP029684_2	2.16\|1635173\|32\|CP029684\|CRISPRCasFinder,CRT	1635173-1635204	32	NZ_CP010241	Escherichia coli strain C7 plasmid A, complete sequence	19099-19130	8	0.75
CP029684_2	2.16\|1635173\|32\|CP029684\|CRISPRCasFinder,CRT	1635173-1635204	32	NZ_CP010120	Escherichia coli strain C3 plasmid A, complete sequence	43244-43275	8	0.75
CP029684_2	2.16\|1635173\|32\|CP029684\|CRISPRCasFinder,CRT	1635173-1635204	32	MN831410	Enterococcus faecalis strain M17/0149 plasmid pM17/0149, complete sequence	459-490	8	0.75
CP029684_2	2.16\|1635173\|32\|CP029684\|CRISPRCasFinder,CRT	1635173-1635204	32	NZ_AP018547	Enterococcus faecalis strain KUB3007 plasmid pKUB3007-4, complete sequence	898-929	8	0.75
CP029684_2	2.16\|1635173\|32\|CP029684\|CRISPRCasFinder,CRT	1635173-1635204	32	NZ_CP028723	Enterococcus faecalis strain CVM N48037F plasmid pN48037F-3, complete sequence	3198-3229	8	0.75
CP029684_2	2.16\|1635173\|32\|CP029684\|CRISPRCasFinder,CRT	1635173-1635204	32	MT223178	Enterococcus faecalis strain EFs17-1 plasmid pEFs17-1, complete sequence	12513-12544	8	0.75
CP029684_2	2.22\|1635539\|32\|CP029684\|CRISPRCasFinder,CRT	1635539-1635570	32	NC_014628	Paenibacillus polymyxa SC2 plasmid pSC2, complete sequence	25226-25257	8	0.75
CP029684_2	2.27\|1635844\|32\|CP029684\|CRISPRCasFinder,CRT	1635844-1635875	32	NZ_LR215032	Mycoplasma gallopavonis strain NCTC10186 plasmid 2	406335-406366	8	0.75
CP029684_2	2.27\|1635844\|32\|CP029684\|CRISPRCasFinder,CRT	1635844-1635875	32	NZ_LR215033	Mycoplasma gallopavonis strain NCTC10186 plasmid 3	7726-7757	8	0.75
CP029684_2	2.27\|1635844\|32\|CP029684\|CRISPRCasFinder,CRT	1635844-1635875	32	NZ_LR215034	Mycoplasma gallopavonis strain NCTC10186 plasmid 4	8520-8551	8	0.75
CP029684_2	2.43\|1636820\|32\|CP029684\|CRISPRCasFinder,CRT	1636820-1636851	32	NZ_CP039286	Leptospira interrogans strain FMAS_AW1 plasmid pLiSL3, complete sequence	32180-32211	8	0.75
CP029684_2	2.43\|1636820\|32\|CP029684\|CRISPRCasFinder,CRT	1636820-1636851	32	NZ_CP039286	Leptospira interrogans strain FMAS_AW1 plasmid pLiSL3, complete sequence	48609-48640	8	0.75
CP029684_2	2.43\|1636820\|32\|CP029684\|CRISPRCasFinder,CRT	1636820-1636851	32	NZ_CP031072	Bacillus mycoides strain BPN401 plasmid pl395, complete sequence	121019-121050	8	0.75
CP029684_2	2.43\|1636820\|32\|CP029684\|CRISPRCasFinder,CRT	1636820-1636851	32	NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	162229-162260	8	0.75
CP029684_2	2.54\|1637491\|32\|CP029684\|CRISPRCasFinder,CRT	1637491-1637522	32	NZ_LR214986	Mycoplasma cynos strain NCTC10142 plasmid 13	431312-431343	8	0.75
CP029684_2	2.57\|1637674\|32\|CP029684\|CRISPRCasFinder,CRT	1637674-1637705	32	MK448722	Streptococcus phage Javan269, complete genome	23981-24012	8	0.75
CP029684_2	2.67\|1638284\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638284-1638315	32	NZ_LR214986	Mycoplasma cynos strain NCTC10142 plasmid 13	431312-431343	8	0.75
CP029684_2	2.74\|1638711\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638711-1638742	32	NZ_CP007144	Hymenobacter swuensis DY53 plasmid pHsw1, complete sequence	198889-198920	8	0.75
CP029684_2	2.76\|1638833\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638833-1638864	32	NC_003276	Nostoc sp. PCC 7120 = FACHB-418 plasmid pCC7120alpha, complete sequence	216540-216571	8	0.75
CP029684_2	2.76\|1638833\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638833-1638864	32	NC_007410	Trichormus variabilis ATCC 29413 plasmid A, complete sequence	28332-28363	8	0.75
CP029684_2	2.76\|1638833\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638833-1638864	32	NZ_CP047243	Trichormus variabilis 0441 plasmid unnamed1, complete sequence	38379-38410	8	0.75
CP029684_2	2.79\|1639016\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639016-1639047	32	KC170283	Uncultured bacterium plasmid pDS1, complete sequence	33178-33209	8	0.75
CP029684_2	2.81\|1639138\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639138-1639169	32	NZ_CP053192	Enterobacter hormaechei strain EGYMCRVIM plasmid pMS-37b, complete sequence	106158-106189	8	0.75
CP029684_2	2.91\|1639748\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639748-1639779	32	NZ_CP042416	Leuconostoc citreum strain CBA3624 plasmid unnamed3, complete sequence	19748-19779	8	0.75
CP029684_2	2.97\|1640114\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1640114-1640145	32	NZ_LR214994	Mycoplasma hyopneumoniae strain NCTC10127 plasmid 3	844-875	8	0.75
CP029684_2	2.97\|1640114\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1640114-1640145	32	NZ_LR214996	Mycoplasma hyopneumoniae strain NCTC10127 plasmid 5	3750-3781	8	0.75
CP029684_1	1.4\|52285\|30\|CP029684\|CRISPRCasFinder,CRT	52285-52314	30	NZ_CP024309	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3b, complete sequence	17801-17830	9	0.7
CP029684_1	1.8\|52549\|30\|CP029684\|CRISPRCasFinder,CRT	52549-52578	30	MH153812	Rhodococcus phage Grayson, complete genome	57216-57245	9	0.7
CP029684_1	1.9\|52615\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52615-52644	30	NC_011961	Thermomicrobium roseum DSM 5159 plasmid unnamed, complete sequence	383724-383753	9	0.7
CP029684_1	1.9\|52615\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52615-52644	30	NZ_CP015419	Rhodovulum sulfidophilum DSM 1374 plasmid unnamed1, complete sequence	66138-66167	9	0.7
CP029684_1	1.9\|52615\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52615-52644	30	NZ_CP015422	Rhodovulum sulfidophilum strain SNK001 plasmid, complete sequence	66038-66067	9	0.7
CP029684_1	1.9\|52615\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	52615-52644	30	NZ_CP020385	Rhodovulum sp. MB263 plasmid pRSMBA, complete sequence	47661-47690	9	0.7
CP029684_1	1.22\|53473\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53473-53502	30	MN694061	Marine virus AFVG_250M743, complete genome	11733-11762	9	0.7
CP029684_1	1.22\|53473\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53473-53502	30	MN694511	Marine virus AFVG_250M1047, complete genome	12054-12083	9	0.7
CP029684_1	1.22\|53473\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53473-53502	30	NZ_CP044461	Acinetobacter indicus strain B18 plasmid pB18-6, complete sequence	2582-2611	9	0.7
CP029684_1	1.22\|53473\|30\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	53473-53502	30	NC_031022	Shigella phage SHSML-45, complete genome	107329-107358	9	0.7
CP029684_1	1.24\|52286\|29\|CP029684\|PILER-CR	52286-52314	29	NZ_CP024309	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3b, complete sequence	17801-17829	9	0.69
CP029684_1	1.25\|52352\|29\|CP029684\|PILER-CR	52352-52380	29	NZ_CP025798	Vibrio owensii strain 051011B plasmid unnamed1	20003-20031	9	0.69
CP029684_2	2.3\|1634379\|32\|CP029684\|CRISPRCasFinder,CRT	1634379-1634410	32	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	1488352-1488383	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_CP026049	Raoultella planticola strain FDAARGOS_64 plasmid unnamed2, complete sequence	171459-171490	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_CP050860	Klebsiella pneumoniae strain SCH6109 plasmid pSCH6109-Vir, complete sequence	158434-158465	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	234613-234644	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_CP029739	Klebsiella pneumoniae strain AR_0087 plasmid unnamed1, complete sequence	159993-160024	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_CP037442	Klebsiella sp. PO552 plasmid p1, complete sequence	118436-118467	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_CP023417	Klebsiella pneumoniae strain 1050 plasmid pKp1050-1, complete sequence	198441-198472	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	MN543585	Klebsiella pneumoniae strain GH27TC plasmid pGH27TC_fusion, complete sequence	45250-45281	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_CP026276	Klebsiella oxytoca strain KONIH5 plasmid pKOR-ab4d, complete sequence	81220-81251	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	MN543571	Klebsiella pneumoniae strain GH27 plasmid pGH27_175, complete sequence	45249-45280	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_CP031563	Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence	94650-94681	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_CP035776	Klebsiella pneumoniae strain R46 plasmid pR46-270, complete sequence	117303-117334	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_CP031818	Klebsiella pneumoniae strain INF235-sc-2280127 plasmid unnamed1, complete sequence	107745-107776	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_CP024875	Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence	34460-34491	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_CP021958	Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u	49469-49500	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_CP026186	Klebsiella pneumoniae strain KPNIH49 plasmid pKPN-3967, complete sequence	315341-315372	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_CP028549	Klebsiella variicola strain WCHKP19 plasmid p1_020019, complete sequence	129606-129637	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_CP015026	Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence	57635-57666	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_CP030920	Escherichia coli strain KL53 plasmid pKL53-L, complete sequence	252344-252375	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_CP008842	Klebsiella michiganensis strain M1 plasmid pKOXM1A, complete sequence	21086-21117	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_CP026154	Klebsiella pneumoniae strain F10(AN) plasmid pF10AN_1, complete sequence	80357-80388	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_CP017451	Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence	51557-51588	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_CP045194	Klebsiella pneumoniae strain YML0508 plasmid pYML0508_1, complete sequence	77947-77978	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	CP027603	UNVERIFIED_ORG: Klebsiella pneumoniae strain AR_0080 plasmid unnamed, complete sequence	359936-359967	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_CP042546	Klebsiella michiganensis strain C52 plasmid pC52_001, complete sequence	115500-115531	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_CP046613	Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-1, complete sequence	112833-112864	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	MN824002	Klebsiella pneumoniae strain N201205880 plasmid p205880-2FIIK, complete sequence	73086-73117	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_CP024507	Klebsiella pneumoniae strain KSB2_1B plasmid unnamed1, complete sequence	117780-117811	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_CP031809	Klebsiella pneumoniae strain INF206-sc-2280074 plasmid unnamed, complete sequence	163495-163526	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_CP050827	Klebsiella pneumoniae strain Bckp212 plasmid pBckp212-1, complete sequence	22129-22160	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_CP021697	Klebsiella pneumoniae strain AR_0158 plasmid tig00000161, complete sequence	145407-145438	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_CP043934	Klebsiella pneumoniae strain 555 plasmid pSCKLB555-2, complete sequence	98699-98730	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	MK649826	Klebsiella pneumoniae strain 130411-38618 plasmid p130411-38618_1, complete sequence	87004-87035	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_CP014763	Klebsiella pneumoniae strain KPNIH39 plasmid pKPN-332, complete sequence	180752-180783	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_CP047634	Klebsiella pneumoniae strain K2606 plasmid unnamed1, complete sequence	39162-39193	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_MK773537	Klebsiella pneumoniae strain QDE2 plasmid pQDE2-C, complete sequence	65493-65524	9	0.719
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_CP028952	Klebsiella aerogenes strain AR_0161 plasmid unnamed, complete sequence	102796-102827	9	0.719
CP029684_2	2.10\|1634807\|32\|CP029684\|CRISPRCasFinder,CRT	1634807-1634838	32	NZ_CP019203	Salmonella enterica subsp. enterica serovar Infantis strain CFSAN003307 plasmid pCFSAN003307, complete sequence	64145-64176	9	0.719
CP029684_2	2.10\|1634807\|32\|CP029684\|CRISPRCasFinder,CRT	1634807-1634838	32	NZ_LN868945	Salmonella enterica subsp. enterica serovar Senftenberg strain NCTC10384 plasmid 3, complete sequence	61020-61051	9	0.719
CP029684_2	2.10\|1634807\|32\|CP029684\|CRISPRCasFinder,CRT	1634807-1634838	32	NZ_CP022659	Salmonella enterica subsp. enterica strain RM11060 plasmid pRM11060-1, complete sequence	25960-25991	9	0.719
CP029684_2	2.15\|1635112\|32\|CP029684\|CRISPRCasFinder,CRT	1635112-1635143	32	NZ_CP045225	Clostridioides difficile strain TW11 plasmid p_TW11, complete sequence	5674-5705	9	0.719
CP029684_2	2.16\|1635173\|32\|CP029684\|CRISPRCasFinder,CRT	1635173-1635204	32	MN693563	Marine virus AFVG_25M273, complete genome	7629-7660	9	0.719
CP029684_2	2.16\|1635173\|32\|CP029684\|CRISPRCasFinder,CRT	1635173-1635204	32	MN693168	Marine virus AFVG_25M530, complete genome	33017-33048	9	0.719
CP029684_2	2.16\|1635173\|32\|CP029684\|CRISPRCasFinder,CRT	1635173-1635204	32	MN693137	Marine virus AFVG_25M529, complete genome	33024-33055	9	0.719
CP029684_2	2.16\|1635173\|32\|CP029684\|CRISPRCasFinder,CRT	1635173-1635204	32	MN693236	Marine virus AFVG_25M528, complete genome	33021-33052	9	0.719
CP029684_2	2.16\|1635173\|32\|CP029684\|CRISPRCasFinder,CRT	1635173-1635204	32	MN693091	Marine virus AFVG_25M527, complete genome	7885-7916	9	0.719
CP029684_2	2.16\|1635173\|32\|CP029684\|CRISPRCasFinder,CRT	1635173-1635204	32	MN693526	Marine virus AFVG_25M251, complete genome	6843-6874	9	0.719
CP029684_2	2.16\|1635173\|32\|CP029684\|CRISPRCasFinder,CRT	1635173-1635204	32	MN693529	Marine virus AFVG_25M294, complete genome	7800-7831	9	0.719
CP029684_2	2.22\|1635539\|32\|CP029684\|CRISPRCasFinder,CRT	1635539-1635570	32	MN855637	Bacteriophage sp. isolate 32, complete genome	26826-26857	9	0.719
CP029684_2	2.27\|1635844\|32\|CP029684\|CRISPRCasFinder,CRT	1635844-1635875	32	MF595878	Caldibacillus phage CBP1, complete genome	30608-30639	9	0.719
CP029684_2	2.35\|1636332\|32\|CP029684\|CRISPRCasFinder,CRT	1636332-1636363	32	MN693652	Marine virus AFVG_250M189, complete genome	35327-35358	9	0.719
CP029684_2	2.35\|1636332\|32\|CP029684\|CRISPRCasFinder,CRT	1636332-1636363	32	MN304815	Burkholderiales phage 68_11, complete genome	12934-12965	9	0.719
CP029684_2	2.43\|1636820\|32\|CP029684\|CRISPRCasFinder,CRT	1636820-1636851	32	NC_018501	Bacillus thuringiensis HD-771 plasmid p02, complete sequence	11132-11163	9	0.719
CP029684_2	2.46\|1637003\|32\|CP029684\|CRISPRCasFinder,CRT	1637003-1637034	32	NC_049501	Salmonella phage allotria, complete genome	41265-41296	9	0.719
CP029684_2	2.46\|1637003\|32\|CP029684\|CRISPRCasFinder,CRT	1637003-1637034	32	JN126049	Salmonella phage PhiSH19, complete genome	87932-87963	9	0.719
CP029684_2	2.46\|1637003\|32\|CP029684\|CRISPRCasFinder,CRT	1637003-1637034	32	MT074474	Salmonella phage aagejoakim, complete genome	50242-50273	9	0.719
CP029684_2	2.46\|1637003\|32\|CP029684\|CRISPRCasFinder,CRT	1637003-1637034	32	NC_049508	Salmonella phage maane, complete genome	48343-48374	9	0.719
CP029684_2	2.54\|1637491\|32\|CP029684\|CRISPRCasFinder,CRT	1637491-1637522	32	NZ_LR134418	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 9	253554-253585	9	0.719
CP029684_2	2.67\|1638284\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638284-1638315	32	NZ_LR134418	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 9	253554-253585	9	0.719
CP029684_2	2.70\|1638467\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638467-1638498	32	NZ_MH674341	Escherichia coli strain EC07 plasmid pUR-EC07, complete sequence	27621-27652	9	0.719
CP029684_2	2.76\|1638833\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638833-1638864	32	NZ_CP046399	Bacillus sp. A260 plasmid unnamed11, complete sequence	75168-75199	9	0.719
CP029684_2	2.76\|1638833\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638833-1638864	32	NZ_CP031066	Bacillus sp. SH8-8 plasmid pl193, complete sequence	140520-140551	9	0.719
CP029684_2	2.76\|1638833\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638833-1638864	32	NZ_CP031063	Bacillus sp. AR4-2 plasmid pl192, complete sequence	140521-140552	9	0.719
CP029684_2	2.79\|1639016\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639016-1639047	32	AP013360	Uncultured Mediterranean phage uvMED DNA, complete genome, group G1, isolate: uvMED-CGR-U-MedDCM-OCT-S40-C16	23128-23159	9	0.719
CP029684_2	2.79\|1639016\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639016-1639047	32	NC_049398	Lactococcus phage 16802, complete genome	15713-15744	9	0.719
CP029684_2	2.79\|1639016\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639016-1639047	32	NC_049483	Lactococcus phage CHPC52, complete genome	15607-15638	9	0.719
CP029684_2	2.81\|1639138\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639138-1639169	32	NZ_CP041067	Bacillus megaterium strain KNU-01 plasmid pKNU_01_3, complete sequence	2636-2667	9	0.719
CP029684_2	2.85\|1639382\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639382-1639413	32	NZ_CP028348	Novosphingobium sp. THN1 plasmid pTHN, complete sequence	35468-35499	9	0.719
CP029684_2	2.89\|1639626\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639626-1639657	32	MN692970	Marine virus AFVG_117M24, complete genome	2429-2460	9	0.719
CP029684_2	2.96\|1640053\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1640053-1640084	32	NC_014633	Ilyobacter polytropus DSM 2926 plasmid pILYOP01, complete sequence	507349-507380	9	0.719
CP029684_2	2.103\|1634255\|32\|CP029684\|CRT	1634255-1634286	32	MN693637	Marine virus AFVG_250M988, complete genome	3019-3050	9	0.719
CP029684_2	2.103\|1634255\|32\|CP029684\|CRT	1634255-1634286	32	MN856091	Myoviridae sp. isolate 9, partial genome	17039-17070	9	0.719
CP029684_1	1.5\|52351\|30\|CP029684\|CRISPRCasFinder,CRT	52351-52380	30	NZ_CP025798	Vibrio owensii strain 051011B plasmid unnamed1	20003-20032	10	0.667
CP029684_2	2.1\|1634255\|34\|CP029684\|CRISPRCasFinder	1634255-1634288	34	MN693637	Marine virus AFVG_250M988, complete genome	3019-3052	10	0.706
CP029684_2	2.4\|1634440\|32\|CP029684\|CRISPRCasFinder,CRT	1634440-1634471	32	NZ_CP028980	Lactobacillus plantarum strain LQ80 plasmid pLQ803, complete sequence	7042-7073	10	0.688
CP029684_2	2.16\|1635173\|32\|CP029684\|CRISPRCasFinder,CRT	1635173-1635204	32	NZ_LN907829	Erwinia gerundensis isolate E_g_EM595 plasmid pEM02, complete sequence	4407-4438	10	0.688
CP029684_2	2.19\|1635356\|32\|CP029684\|CRISPRCasFinder,CRT	1635356-1635387	32	NZ_CP017589	Pantoea stewartii subsp. stewartii DC283 plasmid pDSJ08, complete sequence	14268-14299	10	0.688
CP029684_2	2.27\|1635844\|32\|CP029684\|CRISPRCasFinder,CRT	1635844-1635875	32	NZ_CP031953	Phaeobacter inhibens strain 2.10 plasmid unnamed1, complete sequence	65765-65796	10	0.688
CP029684_2	2.27\|1635844\|32\|CP029684\|CRISPRCasFinder,CRT	1635844-1635875	32	NC_018421	Phaeobacter inhibens 2.10 plasmid pPGA2_239, complete sequence	65672-65703	10	0.688
CP029684_2	2.27\|1635844\|32\|CP029684\|CRISPRCasFinder,CRT	1635844-1635875	32	NZ_CP019308	Phaeobacter inhibens strain DOK1-1 plasmid pDOK1-1-1, complete sequence	151767-151798	10	0.688
CP029684_2	2.29\|1635966\|32\|CP029684\|CRISPRCasFinder,CRT	1635966-1635997	32	AP018932	Escherichia phage KIT03 DNA, complete sequence	156063-156094	10	0.688
CP029684_2	2.42\|1636759\|32\|CP029684\|CRISPRCasFinder,CRT	1636759-1636790	32	NZ_CP044185	Salmonella enterica subsp. enterica strain AR-0403 plasmid pAR-0403	48904-48935	10	0.688
CP029684_2	2.42\|1636759\|32\|CP029684\|CRISPRCasFinder,CRT	1636759-1636790	32	KT264818	Gokushovirus WZ-2015a isolate 70Chd477, complete genome	234-265	10	0.688
CP029684_2	2.42\|1636759\|32\|CP029684\|CRISPRCasFinder,CRT	1636759-1636790	32	KX513874	Human gut gokushovirus isolate SH-CHD11, complete genome	2439-2470	10	0.688
CP029684_2	2.46\|1637003\|32\|CP029684\|CRISPRCasFinder,CRT	1637003-1637034	32	MT074478	Salmonella phage moki, complete genome	49039-49070	10	0.688
CP029684_2	2.46\|1637003\|32\|CP029684\|CRISPRCasFinder,CRT	1637003-1637034	32	NC_029042	Salmonella phage 38, complete genome	69991-70022	10	0.688
CP029684_2	2.57\|1637674\|32\|CP029684\|CRISPRCasFinder,CRT	1637674-1637705	32	AP013538	Uncultured phage_MedDCM-OCT-S45-C4 DNA, complete genome, group G7, isolate: uvMED-CGR-U-MedDCM-OCT-S45-C4	35867-35898	10	0.688
CP029684_2	2.57\|1637674\|32\|CP029684\|CRISPRCasFinder,CRT	1637674-1637705	32	NC_030920	Bacillus phage Eldridge, complete genome	53674-53705	10	0.688
CP029684_2	2.70\|1638467\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638467-1638498	32	NZ_CP029127	Klebsiella oxytoca strain AR380 plasmid unnamed1, complete sequence	16149-16180	10	0.688
CP029684_2	2.76\|1638833\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638833-1638864	32	NZ_CP018742	Bacillus cereus strain FORC_047 plasmid pFORC47_2, complete sequence	173676-173707	10	0.688
CP029684_2	2.77\|1638894\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638894-1638925	32	MG948468	Pantoea phage vB_PagS_Vid5, complete genome	1962-1993	10	0.688
CP029684_2	2.79\|1639016\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639016-1639047	32	NC_014628	Paenibacillus polymyxa SC2 plasmid pSC2, complete sequence	221012-221043	10	0.688
CP029684_2	2.79\|1639016\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639016-1639047	32	CP040041	Acinetobacter baumannii strain VB958 plasmid unnamed1, complete sequence	421469-421500	10	0.688
CP029684_2	2.81\|1639138\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639138-1639169	32	NZ_AP022377	Providencia stuartii strain BML2537 plasmid pBML2537, complete sequence	108790-108821	10	0.688
CP029684_2	2.81\|1639138\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639138-1639169	32	NZ_CP018877	Bacillus megaterium strain JX285 plasmid 4, complete sequence	127911-127942	10	0.688
CP029684_2	2.90\|1639687\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639687-1639718	32	NZ_CP040783	Bacillus thuringiensis strain HM-311 plasmid p1, complete sequence	337479-337510	10	0.688
CP029684_2	2.90\|1639687\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639687-1639718	32	NC_020394	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-233, complete sequence	62095-62126	10	0.688
CP029684_2	2.90\|1639687\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639687-1639718	32	NZ_CP014283	Bacillus thuringiensis strain Bt185 plasmid pBT1850636, complete sequence	81693-81724	10	0.688
CP029684_2	2.90\|1639687\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639687-1639718	32	NZ_CP016596	Bacillus cereus strain K8 plasmid pBCM301, complete sequence	95124-95155	10	0.688
CP029684_2	2.90\|1639687\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639687-1639718	32	NZ_CP010112	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-6, complete sequence	35836-35867	10	0.688
CP029684_2	2.90\|1639687\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639687-1639718	32	NZ_CP007513	Bacillus bombysepticus plasmid pBb, complete genome	488354-488385	10	0.688
CP029684_2	2.90\|1639687\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639687-1639718	32	NZ_AP014865	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK1, complete sequence	191265-191296	10	0.688
CP029684_2	2.90\|1639687\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639687-1639718	32	NZ_CP053952	Bacillus cereus strain FDAARGOS_798 plasmid unnamed1, complete sequence	73096-73127	10	0.688
CP029684_2	2.90\|1639687\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639687-1639718	32	CP046512	Bacillus cereus strain JHU plasmid p1, complete sequence	271422-271453	10	0.688
CP029684_2	2.90\|1639687\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639687-1639718	32	NZ_CP042875	Bacillus cereus strain 09 plasmid unnamed1, complete sequence	428953-428984	10	0.688
CP029684_2	2.90\|1639687\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639687-1639718	32	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	122951-122982	10	0.688
CP029684_2	2.90\|1639687\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639687-1639718	32	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	423933-423964	10	0.688
CP029684_2	2.90\|1639687\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639687-1639718	32	NZ_CP045607	Bacillus cereus strain SB1 plasmid p1, complete sequence	158163-158194	10	0.688
CP029684_2	2.90\|1639687\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639687-1639718	32	CP020755	Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence	291871-291902	10	0.688
CP029684_2	2.90\|1639687\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639687-1639718	32	NZ_CP015730	Bacillus cereus strain A1 plasmid pBCA1, complete sequence	275462-275493	10	0.688
CP029684_2	2.90\|1639687\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639687-1639718	32	NZ_CP050184	Bacillus thuringiensis strain HER1410 plasmid pLUSID1, complete sequence	25035-25066	10	0.688
CP029684_2	2.90\|1639687\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639687-1639718	32	NZ_CP010090	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence	33982-34013	10	0.688
CP029684_2	2.90\|1639687\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639687-1639718	32	NZ_CP021062	Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence	507332-507363	10	0.688
CP029684_2	2.90\|1639687\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639687-1639718	32	NZ_CP053949	Bacillus cereus strain FDAARGOS_799 plasmid unnamed1, complete sequence	203246-203277	10	0.688
CP029684_2	2.91\|1639748\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639748-1639779	32	NZ_CP028945	Vibrio sp. dhg plasmid unnamed1, complete sequence	35942-35973	10	0.688
CP029684_2	2.99\|1640236\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1640236-1640267	32	MT840189	Bacteriophage sp. Joined_contig_348 genomic sequence	35289-35320	10	0.688
CP029684_2	2.103\|1634255\|32\|CP029684\|CRT	1634255-1634286	32	MN035922	Leviviridae sp. isolate H1_Bulk_30_scaffold_182 RNA-dependent RNA polymerase (H1Bulk30182_000001), hypothetical protein (H1Bulk30182_000002), and hypothetical protein (H1Bulk30182_000003) genes, complete cds	3116-3147	10	0.688
CP029684_2	2.22\|1635539\|32\|CP029684\|CRISPRCasFinder,CRT	1635539-1635570	32	NZ_CP046704	Nostoc sp. ATCC 53789 plasmid pNsp_a, complete sequence	7706-7737	11	0.656
CP029684_2	2.35\|1636332\|32\|CP029684\|CRISPRCasFinder,CRT	1636332-1636363	32	NZ_KY940428	UNVERIFIED: Bacillus sp. (in: Bacteria) strain PUMK-07 plasmid pMK-07, complete sequence	124818-124849	11	0.656
CP029684_2	2.35\|1636332\|32\|CP029684\|CRISPRCasFinder,CRT	1636332-1636363	32	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	264927-264958	11	0.656
CP029684_2	2.35\|1636332\|32\|CP029684\|CRISPRCasFinder,CRT	1636332-1636363	32	NZ_CP047086	Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence	71054-71085	11	0.656
CP029684_2	2.35\|1636332\|32\|CP029684\|CRISPRCasFinder,CRT	1636332-1636363	32	NZ_CP041978	Bacillus pacificus strain NCCP 15909 plasmid unnamed1, complete sequence	29804-29835	11	0.656
CP029684_2	2.35\|1636332\|32\|CP029684\|CRISPRCasFinder,CRT	1636332-1636363	32	NC_011655	Bacillus cereus AH187 plasmid pAH187_270, complete sequence	100441-100472	11	0.656
CP029684_2	2.35\|1636332\|32\|CP029684\|CRISPRCasFinder,CRT	1636332-1636363	32	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	22103-22134	11	0.656
CP029684_2	2.35\|1636332\|32\|CP029684\|CRISPRCasFinder,CRT	1636332-1636363	32	NC_010924	Bacillus cereus strain AH187 plasmid pCER270, complete sequence	156850-156881	11	0.656
CP029684_2	2.35\|1636332\|32\|CP029684\|CRISPRCasFinder,CRT	1636332-1636363	32	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	111763-111794	11	0.656
CP029684_2	2.35\|1636332\|32\|CP029684\|CRISPRCasFinder,CRT	1636332-1636363	32	CP045776	Bacillus paranthracis strain CFSAN068816 plasmid p1CFSAN068816, complete sequence	146165-146196	11	0.656
CP029684_2	2.35\|1636332\|32\|CP029684\|CRISPRCasFinder,CRT	1636332-1636363	32	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	158917-158948	11	0.656
CP029684_2	2.35\|1636332\|32\|CP029684\|CRISPRCasFinder,CRT	1636332-1636363	32	NZ_CP042928	Bacillus cereus strain G1-1 plasmid unnamed, complete sequence	131131-131162	11	0.656
CP029684_2	2.35\|1636332\|32\|CP029684\|CRISPRCasFinder,CRT	1636332-1636363	32	NZ_CP022346	Bacillus thuringiensis strain c25 plasmid unnamed1, complete sequence	285456-285487	11	0.656
CP029684_2	2.35\|1636332\|32\|CP029684\|CRISPRCasFinder,CRT	1636332-1636363	32	CP041980	Bacillus paranthracis strain NCCP 15910 plasmid unnamed, complete sequence	14201-14232	11	0.656
CP029684_2	2.35\|1636332\|32\|CP029684\|CRISPRCasFinder,CRT	1636332-1636363	32	NC_016792	Bacillus cereus NC7401 plasmid pNCcld, complete sequence	155719-155750	11	0.656
CP029684_2	2.35\|1636332\|32\|CP029684\|CRISPRCasFinder,CRT	1636332-1636363	32	NZ_CP040343	Bacillus cereus strain DLOU-Weihai plasmid unnamed1, complete sequence	148131-148162	11	0.656
CP029684_2	2.35\|1636332\|32\|CP029684\|CRISPRCasFinder,CRT	1636332-1636363	32	NZ_CP040341	Bacillus cereus strain DLOU-Tangshan plasmid unnamed1, complete sequence	172118-172149	11	0.656
CP029684_2	2.35\|1636332\|32\|CP029684\|CRISPRCasFinder,CRT	1636332-1636363	32	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	18481-18512	11	0.656
CP029684_2	2.35\|1636332\|32\|CP029684\|CRISPRCasFinder,CRT	1636332-1636363	32	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	91010-91041	11	0.656
CP029684_2	2.70\|1638467\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638467-1638498	32	NZ_KU130396	Escherichia coli strain S68 plasmid pS68, complete sequence	62234-62265	11	0.656
CP029684_2	2.70\|1638467\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638467-1638498	32	NZ_CP019561	Escherichia coli strain KSC1031 plasmid pMRGN1031, complete sequence	45042-45073	11	0.656
CP029684_2	2.70\|1638467\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638467-1638498	32	NZ_CP020547	Escherichia coli strain ZJ3920 plasmid pZJ3920-2, complete sequence	112750-112781	11	0.656
CP029684_2	2.70\|1638467\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638467-1638498	32	NZ_CP021845	Escherichia coli strain EC1515 plasmid pEC1515-1, complete sequence	67799-67830	11	0.656
CP029684_2	2.70\|1638467\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638467-1638498	32	NZ_CP026237	Citrobacter freundii complex sp. CFNIH3 plasmid pCFR-9161, complete sequence	219931-219962	11	0.656
CP029684_2	2.70\|1638467\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638467-1638498	32	NZ_CP054369	Escherichia coli strain SCU-115 plasmid pSCU-115-1, complete sequence	61216-61247	11	0.656
CP029684_2	2.70\|1638467\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638467-1638498	32	NZ_CP024244	Escherichia coli O128:H27 strain 90-9281 plasmid unnamed, complete sequence	110786-110817	11	0.656
CP029684_2	2.70\|1638467\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638467-1638498	32	MN915010	Escherichia coli strain TJ-33 plasmid pNDM-TJ33, complete sequence	119836-119867	11	0.656
CP029684_2	2.70\|1638467\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638467-1638498	32	MN915012	Escherichia coli strain GD-33 plasmid pNDM33-2, complete sequence	9502-9533	11	0.656
CP029684_2	2.70\|1638467\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638467-1638498	32	MN915013	Escherichia coli strain TD-33 plasmid pNDM-TD33, complete sequence	47288-47319	11	0.656
CP029684_2	2.70\|1638467\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638467-1638498	32	NZ_CP021841	Escherichia coli strain EC974 plasmid pEC974-1, complete sequence	37732-37763	11	0.656
CP029684_2	2.70\|1638467\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638467-1638498	32	CP034251	Salmonella enterica subsp. enterica serovar Derby strain Sa64 plasmid pSa64T-188, complete sequence	25240-25271	11	0.656
CP029684_2	2.70\|1638467\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638467-1638498	32	CP034252	Salmonella enterica subsp. enterica serovar Derby strain Sa64 plasmid pSa64-96, complete sequence	27348-27379	11	0.656
CP029684_2	2.70\|1638467\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638467-1638498	32	NZ_CP041303	Escherichia coli strain MSHS 133 plasmid pCys-11, complete sequence	90862-90893	11	0.656
CP029684_2	2.70\|1638467\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638467-1638498	32	NZ_CP026206	Escherichia coli strain ECONIH5 plasmid pECO-cbb3, complete sequence	170866-170897	11	0.656
CP029684_2	2.70\|1638467\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638467-1638498	32	NZ_CP031615	Klebsiella pneumoniae strain ZYST1 plasmid pZYST1C2, complete sequence	101438-101469	11	0.656
CP029684_2	2.70\|1638467\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638467-1638498	32	NZ_CP024977	Escherichia coli strain CV839-15 plasmid pCV839-15-p3, complete sequence	14187-14218	11	0.656
CP029684_2	2.70\|1638467\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638467-1638498	32	NZ_CP036181	Escherichia coli strain WCHEC025970 plasmid p2_025970, complete sequence	22508-22539	11	0.656
CP029684_2	2.70\|1638467\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638467-1638498	32	NZ_CP030921	Escherichia coli strain KL53 plasmid pKL53-M, complete sequence	30430-30461	11	0.656
CP029684_2	2.70\|1638467\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638467-1638498	32	NC_019097	Escherichia coli plasmid Plm, complete sequence	14972-15003	11	0.656
CP029684_2	2.70\|1638467\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638467-1638498	32	NC_006671	Escherichia coli A2363 plasmid pAPEC-O2-R, complete sequence	62530-62561	11	0.656
CP029684_2	2.70\|1638467\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638467-1638498	32	NZ_CP039604	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014868 plasmid p12-6919.1, complete sequence	30978-31009	11	0.656
CP029684_2	2.70\|1638467\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638467-1638498	32	NC_019111	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSal8934a, complete sequence	77852-77883	11	0.656
CP029684_2	2.70\|1638467\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638467-1638498	32	NZ_CP025339	Salmonella enterica subsp. enterica serovar Typhimurium strain BL10 plasmid p113k, complete sequence	92338-92369	11	0.656
CP029684_2	2.70\|1638467\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638467-1638498	32	NZ_CP019220	Klebsiella pneumoniae strain 1756 plasmid pKp1756, complete sequence	66886-66917	11	0.656
CP029684_2	2.70\|1638467\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638467-1638498	32	NZ_CP041441	Escherichia coli strain YPE12 plasmid pYPE12-122k, complete sequence	41779-41810	11	0.656
CP029684_2	2.70\|1638467\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638467-1638498	32	NZ_CP041394	Escherichia coli strain ECOL-18-VL-LA-PA-Ryan-0026 plasmid p45407_2	100324-100355	11	0.656
CP029684_2	2.70\|1638467\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638467-1638498	32	MN124285	Escherichia coli strain RKI3099 plasmid pRKI3099a, complete sequence	34482-34513	11	0.656
CP029684_2	2.70\|1638467\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638467-1638498	32	NZ_MG825377	Escherichia coli strain 1108 plasmid p1108-emrB, complete sequence	25789-25820	11	0.656
CP029684_2	2.70\|1638467\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1638467-1638498	32	NZ_MF174860	Escherichia coli strain 6/14/6b plasmid pIncF-MU4, complete sequence	30681-30712	11	0.656
CP029684_2	2.85\|1639382\|32\|CP029684\|CRISPRCasFinder,CRT,PILER-CR	1639382-1639413	32	NZ_CP022567	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK03, complete sequence	293786-293817	11	0.656

1. spacer 1.5|52351|30|CP029684|CRISPRCasFinder,CRT matches to GU071107 (Cyanophage P-SSP2, complete genome) position: , mismatch: 4, identity: 0.867

-gtatcggtgtcttcatcaaagtctggttcg	CRISPR spacer
cgta-cagtgtcatcatcaaagtctggttca	Protospacer
 *** *.***** *****************.

2. spacer 1.5|52351|30|CP029684|CRISPRCasFinder,CRT matches to HQ332137 (Prochlorococcus phage P-SSP3 genomic sequence) position: , mismatch: 4, identity: 0.867

-gtatcggtgtcttcatcaaagtctggttcg	CRISPR spacer
cgta-cagtgtcatcatcaaagtctggttca	Protospacer
 *** *.***** *****************.

3. spacer 1.13|52880|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MF351863 (Synechococcus phage Bellamy, complete genome) position: , mismatch: 4, identity: 0.867

gaactcggacttgctaaatcttttttgtaa-	CRISPR spacer
gaactaggatttgctaaatc-tttttgcaac	Protospacer
***** ***.********** ******.**

4. spacer 2.79|1639016|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP042005 (Staphylococcus aureus strain B3-14B plasmid pSALNT16, complete sequence) position: , mismatch: 4, identity: 0.875

ctaattttatttgtcatttttgtacctcttta	CRISPR spacer
aaaattttattagtcatttttatacctcttta	Protospacer
  ********* *********.**********

5. spacer 2.79|1639016|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MH791415 (UNVERIFIED: Enterococcus phage EfsWh-1, complete genome) position: , mismatch: 5, identity: 0.844

ctaat--tttatttgtcatttttgtacctcttta	CRISPR spacer
--aattctttaattgtcatttttgcacctctttc	Protospacer
  ***  **** ************.********

6. spacer 2.79|1639016|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to HE962497 (Streptococcus phage SP-QS1 complete genome) position: , mismatch: 5, identity: 0.844

ctaat--tttatttgtcatttttgtacctcttta	CRISPR spacer
--aattctttaattgtcatttttgcacctctttc	Protospacer
  ***  **** ************.********

7. spacer 2.79|1639016|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MN871443 (UNVERIFIED: Enterococcus phage EfsWh_1, complete genome) position: , mismatch: 5, identity: 0.844

ctaat--tttatttgtcatttttgtacctcttta	CRISPR spacer
--aattctttaattgtcatttttgcacctctttc	Protospacer
  ***  **** ************.********

8. spacer 1.4|52285|30|CP029684|CRISPRCasFinder,CRT matches to NC_017976 (Bacillus phage PBC1, complete genome) position: , mismatch: 6, identity: 0.8

ggactgcgaagacaatcggcaagaaatcac	CRISPR spacer
ggattgcgaagccaatcggcaaggacgcaa	Protospacer
***.******* ***********.*  **

9. spacer 1.9|52615|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018230 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

gcgattgatgcgctccacctcgctggtgtt	CRISPR spacer
ccgcttgatgcgctccacctcgccggtcgg	Protospacer
 ** *******************.***

10. spacer 1.9|52615|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MH229865 (Streptomyces phage LazerLemon, complete genome) position: , mismatch: 6, identity: 0.8

gcgattgatgcgctccacctcgctggtgtt	CRISPR spacer
ggtcttgatgcgctccgcctcgcgggtgtc	Protospacer
*   ************.****** *****.

11. spacer 1.9|52615|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

-gcgattgatgcgctccacctcgctggtgtt	CRISPR spacer
catga-cgatgcgctcgacctcgctggtctt	Protospacer
 ..** .********* *********** **

12. spacer 1.9|52615|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 6, identity: 0.8

-gcgattgatgcgctccacctcgctggtgtt	CRISPR spacer
catga-cgatgcgctcgacctcgctggtctt	Protospacer
 ..** .********* *********** **

13. spacer 1.9|52615|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

-gcgattgatgcgctccacctcgctggtgtt	CRISPR spacer
catga-cgatgcgctcgacctcgctggtctt	Protospacer
 ..** .********* *********** **

14. spacer 1.9|52615|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

-gcgattgatgcgctccacctcgctggtgtt	CRISPR spacer
catga-cgatgcgctcgacctcgctggtctt	Protospacer
 ..** .********* *********** **

15. spacer 1.9|52615|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 6, identity: 0.8

-gcgattgatgcgctccacctcgctggtgtt	CRISPR spacer
catga-cgatgcgctcgacctcgctggtctt	Protospacer
 ..** .********* *********** **

16. spacer 1.9|52615|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

-gcgattgatgcgctccacctcgctggtgtt	CRISPR spacer
catga-cgatgcgctcgacctcgctggtctt	Protospacer
 ..** .********* *********** **

17. spacer 1.9|52615|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

-gcgattgatgcgctccacctcgctggtgtt	CRISPR spacer
catga-cgatgcgctcgacctcgctggtctt	Protospacer
 ..** .********* *********** **

18. spacer 1.9|52615|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

-gcgattgatgcgctccacctcgctggtgtt	CRISPR spacer
catga-cgatgcgctcgacctcgctggtctt	Protospacer
 ..** .********* *********** **

19. spacer 1.9|52615|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

-gcgattgatgcgctccacctcgctggtgtt	CRISPR spacer
catga-cgatgcgctcgacctcgctggtctt	Protospacer
 ..** .********* *********** **

20. spacer 1.9|52615|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

-gcgattgatgcgctccacctcgctggtgtt	CRISPR spacer
catga-cgatgcgctcgacctcgctggtctt	Protospacer
 ..** .********* *********** **

21. spacer 1.9|52615|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

-gcgattgatgcgctccacctcgctggtgtt	CRISPR spacer
catga-cgatgcgctcgacctcgctggtctt	Protospacer
 ..** .********* *********** **

22. spacer 1.9|52615|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

-gcgattgatgcgctccacctcgctggtgtt	CRISPR spacer
catga-cgatgcgctcgacctcgctggtctt	Protospacer
 ..** .********* *********** **

23. spacer 1.9|52615|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

-gcgattgatgcgctccacctcgctggtgtt	CRISPR spacer
catga-cgatgcgctcgacctcgctggtctt	Protospacer
 ..** .********* *********** **

24. spacer 1.9|52615|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NC_007483 (Nitrosococcus oceani ATCC 19707 plasmid A, complete sequence) position: , mismatch: 6, identity: 0.8

gcgattgatgcgctccacctcgctggtgtt	CRISPR spacer
gcggttgatgcggtccacctcgcgcttgta	Protospacer
***.******** **********   ***

25. spacer 1.11|52747|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP031072 (Bacillus mycoides strain BPN401 plasmid pl395, complete sequence) position: , mismatch: 6, identity: 0.8

atcaatgaaaacatgaaaaccccttacact	CRISPR spacer
acccaataaaacaggaaaacccctcacact	Protospacer
*.* *  ****** **********.*****

26. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MN689516 (Lactococcus phage CHPC148, complete genome) position: , mismatch: 6, identity: 0.8

atggttacgataacttgttggctgccttag	CRISPR spacer
atggttacgataacttattagctgctctta	Protospacer
****************.**.*****..* .

27. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NC_004746 (Lactococcus phage 4268, complete genome) position: , mismatch: 6, identity: 0.8

atggttacgataacttgttggctgccttag	CRISPR spacer
atggttacgataacttattagctgctctta	Protospacer
****************.**.*****..* .

28. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MN534316 (Lactococcus phage proPhi2, complete genome) position: , mismatch: 6, identity: 0.8

atggttacgataacttgttggctgccttag	CRISPR spacer
atggttacgataacttattagctgctctta	Protospacer
****************.**.*****..* .

29. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to AF323670 (Bacteriophage bIL309, complete genome) position: , mismatch: 6, identity: 0.8

atggttacgataacttgttggctgccttag	CRISPR spacer
atggttacgataacttattagctgctctta	Protospacer
****************.**.*****..* .

30. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to AF323669 (Bacteriophage bIL286, complete genome) position: , mismatch: 6, identity: 0.8

atggttacgataacttgttggctgccttag	CRISPR spacer
atggttacgataacttattagctgctctta	Protospacer
****************.**.*****..* .

31. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to AJ245616 (Lactococcus lactis phage BK5-T complete genome) position: , mismatch: 6, identity: 0.8

atggttacgataacttgttggctgccttag	CRISPR spacer
atggttacgataacttattagctgctctta	Protospacer
****************.**.*****..* .

32. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NC_002668 (Lactococcus prophage bIL309, complete genome) position: , mismatch: 6, identity: 0.8

atggttacgataacttgttggctgccttag	CRISPR spacer
atggttacgataacttattagctgctctta	Protospacer
****************.**.*****..* .

33. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to AF176025 (Lactococcus phage BK5-T, complete genome) position: , mismatch: 6, identity: 0.8

atggttacgataacttgttggctgccttag	CRISPR spacer
atggttacgataacttattagctgctctta	Protospacer
****************.**.*****..* .

34. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to AF489521 (Lactococcus bacteriophage 4268, complete genome) position: , mismatch: 6, identity: 0.8

atggttacgataacttgttggctgccttag	CRISPR spacer
atggttacgataacttattagctgctctta	Protospacer
****************.**.*****..* .

35. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MN534317 (Lactococcus phage proPhi4, complete genome) position: , mismatch: 6, identity: 0.8

atggttacgataacttgttggctgccttag	CRISPR spacer
atggttacgataacttattagctgctctta	Protospacer
****************.**.*****..* .

36. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NC_002667 (Lactococcus prophage bIL286, complete genome) position: , mismatch: 6, identity: 0.8

atggttacgataacttgttggctgccttag	CRISPR spacer
atggttacgataacttattagctgctctta	Protospacer
****************.**.*****..* .

37. spacer 1.25|52352|29|CP029684|PILER-CR matches to HQ332137 (Prochlorococcus phage P-SSP3 genomic sequence) position: , mismatch: 6, identity: 0.793

tatcggtgtcttcatcaaagtctggttcg	CRISPR spacer
gtacagtgtcatcatcaaagtctggttca	Protospacer
   *.***** *****************.

38. spacer 1.25|52352|29|CP029684|PILER-CR matches to GU071107 (Cyanophage P-SSP2, complete genome) position: , mismatch: 6, identity: 0.793

tatcggtgtcttcatcaaagtctggttcg	CRISPR spacer
gtacagtgtcatcatcaaagtctggttca	Protospacer
   *.***** *****************.

39. spacer 2.2|1634318|32|CP029684|CRISPRCasFinder matches to NC_013453 (Staphylococcus aureus subsp. aureus ED98 plasmid pAVX, complete sequence) position: , mismatch: 6, identity: 0.812

ttatttttcaaggcaaagatgatggccgttgt--	CRISPR spacer
taattttacatggcaaagatgatgg--gttggtt	Protospacer
* ***** ** **************  ****

40. spacer 2.2|1634318|32|CP029684|CRISPRCasFinder matches to NZ_CP046029 (Staphylococcus chromogenes strain 1401 plasmid unnamed1) position: , mismatch: 6, identity: 0.812

ttatttttcaaggcaaagatgatggccgttgt--	CRISPR spacer
taattttacatggcaaagatgatgg--gttggtt	Protospacer
* ***** ** **************  ****

41. spacer 2.2|1634318|32|CP029684|CRISPRCasFinder matches to NZ_CP042651 (Staphylococcus aureus strain X22 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

ttatttttcaaggcaaagatgatggccgttgt--	CRISPR spacer
taattttacatggcaaagatgatgg--gttggtt	Protospacer
* ***** ** **************  ****

42. spacer 2.2|1634318|32|CP029684|CRISPRCasFinder matches to NZ_CP042158 (Staphylococcus aureus strain B3-17D plasmid pSALNC17, complete sequence) position: , mismatch: 6, identity: 0.812

ttatttttcaaggcaaagatgatggccgttgt--	CRISPR spacer
taattttacatggcaaagatgatgg--gttggtt	Protospacer
* ***** ** **************  ****

43. spacer 2.2|1634318|32|CP029684|CRISPRCasFinder matches to NZ_CP009624 (Staphylococcus agnetis strain 908 plasmid unamed, complete sequence) position: , mismatch: 6, identity: 0.812

ttatttttcaaggcaaagatgatggccgttgt--	CRISPR spacer
taattttacatggcaaagatgatgg--gttggtt	Protospacer
* ***** ** **************  ****

44. spacer 2.2|1634318|32|CP029684|CRISPRCasFinder matches to NZ_CP042154 (Staphylococcus aureus strain B4-59C plasmid pSALNC14, complete sequence) position: , mismatch: 6, identity: 0.812

ttatttttcaaggcaaagatgatggccgttgt--	CRISPR spacer
taattttacatggcaaagatgatgg--gttggtt	Protospacer
* ***** ** **************  ****

45. spacer 2.2|1634318|32|CP029684|CRISPRCasFinder matches to NZ_CP042108 (Staphylococcus aureus strain B8-13D plasmid pSALNCG17, complete sequence) position: , mismatch: 6, identity: 0.812

ttatttttcaaggcaaagatgatggccgttgt--	CRISPR spacer
taattttacatggcaaagatgatgg--gttggtt	Protospacer
* ***** ** **************  ****

46. spacer 2.2|1634318|32|CP029684|CRISPRCasFinder matches to NZ_CP053077 (Staphylococcus aureus strain SA01 plasmid pSA01-03, complete sequence) position: , mismatch: 6, identity: 0.812

ttatttttcaaggcaaagatgatggccgttgt--	CRISPR spacer
taattttacatggcaaagatgatgg--gttggtt	Protospacer
* ***** ** **************  ****

47. spacer 2.2|1634318|32|CP029684|CRISPRCasFinder matches to NZ_MH785236 (Staphylococcus aureus strain ph1 plasmid pPH1-1, complete sequence) position: , mismatch: 6, identity: 0.812

ttatttttcaaggcaaagatgatggccgttgt--	CRISPR spacer
taattttacatggcaaagatgatgg--gttggtt	Protospacer
* ***** ** **************  ****

48. spacer 2.2|1634318|32|CP029684|CRISPRCasFinder matches to NZ_MH785251 (Staphylococcus aureus strain ch8 plasmid pAvX, complete sequence) position: , mismatch: 6, identity: 0.812

ttatttttcaaggcaaagatgatggccgttgt--	CRISPR spacer
taattttacatggcaaagatgatgg--gttggtt	Protospacer
* ***** ** **************  ****

49. spacer 2.2|1634318|32|CP029684|CRISPRCasFinder matches to NZ_MH785243 (Staphylococcus aureus strain pa2 plasmid pAvX, complete sequence) position: , mismatch: 6, identity: 0.812

ttatttttcaaggcaaagatgatggccgttgt--	CRISPR spacer
taattttacatggcaaagatgatgg--gttggtt	Protospacer
* ***** ** **************  ****

50. spacer 2.2|1634318|32|CP029684|CRISPRCasFinder matches to NC_020227 (Staphylococcus aureus strain CH-91 plasmid pCH91, complete sequence) position: , mismatch: 6, identity: 0.812

ttatttttcaaggcaaagatgatggccgttgt--	CRISPR spacer
taattttacatggcaaagatgatgg--gttggtt	Protospacer
* ***** ** **************  ****

51. spacer 2.2|1634318|32|CP029684|CRISPRCasFinder matches to NZ_CP042045 (Staphylococcus aureus strain B2-15A plasmid pSALNCL17, complete sequence) position: , mismatch: 6, identity: 0.812

ttatttttcaaggcaaagatgatggccgttgt--	CRISPR spacer
taattttacatggcaaagatgatgg--gttggtt	Protospacer
* ***** ** **************  ****

52. spacer 2.2|1634318|32|CP029684|CRISPRCasFinder matches to NZ_MK388402 (Staphylococcus aureus strain ph2 plasmid pAvX, complete sequence) position: , mismatch: 6, identity: 0.812

ttatttttcaaggcaaagatgatggccgttgt--	CRISPR spacer
taattttacatggcaaagatgatgg--gttggtt	Protospacer
* ***** ** **************  ****

53. spacer 2.2|1634318|32|CP029684|CRISPRCasFinder matches to NZ_MH785252 (Staphylococcus aureus strain ch23 plasmid pAvX, complete sequence) position: , mismatch: 6, identity: 0.812

ttatttttcaaggcaaagatgatggccgttgt--	CRISPR spacer
taattttacatggcaaagatgatgg--gttggtt	Protospacer
* ***** ** **************  ****

54. spacer 2.2|1634318|32|CP029684|CRISPRCasFinder matches to NZ_MH785235 (Staphylococcus aureus strain ch10 plasmid pAvX, complete sequence) position: , mismatch: 6, identity: 0.812

ttatttttcaaggcaaagatgatggccgttgt--	CRISPR spacer
taattttacatggcaaagatgatgg--gttggtt	Protospacer
* ***** ** **************  ****

55. spacer 2.2|1634318|32|CP029684|CRISPRCasFinder matches to NZ_MH785249 (Staphylococcus aureus strain ch5 plasmid pAvX, complete sequence) position: , mismatch: 6, identity: 0.812

ttatttttcaaggcaaagatgatggccgttgt--	CRISPR spacer
taattttacatggcaaagatgatgg--gttggtt	Protospacer
* ***** ** **************  ****

56. spacer 2.2|1634318|32|CP029684|CRISPRCasFinder matches to NZ_MH785229 (Staphylococcus aureus strain pa3 plasmid pPA3, complete sequence) position: , mismatch: 6, identity: 0.812

ttatttttcaaggcaaagatgatggccgttgt--	CRISPR spacer
taattttacatggcaaagatgatgg--gttggtt	Protospacer
* ***** ** **************  ****

57. spacer 2.2|1634318|32|CP029684|CRISPRCasFinder matches to NZ_MH785244 (Staphylococcus aureus strain tu1 plasmid pAvX, complete sequence) position: , mismatch: 6, identity: 0.812

ttatttttcaaggcaaagatgatggccgttgt--	CRISPR spacer
taattttacatggcaaagatgatgg--gttggtt	Protospacer
* ***** ** **************  ****

58. spacer 2.2|1634318|32|CP029684|CRISPRCasFinder matches to NZ_MH785248 (Staphylococcus aureus strain ch9 plasmid pAvX, complete sequence) position: , mismatch: 6, identity: 0.812

ttatttttcaaggcaaagatgatggccgttgt--	CRISPR spacer
taattttacatggcaaagatgatgg--gttggtt	Protospacer
* ***** ** **************  ****

59. spacer 2.14|1635051|32|CP029684|CRISPRCasFinder,CRT matches to MN694639 (Marine virus AFVG_250M766, complete genome) position: , mismatch: 6, identity: 0.812

tggctattttg-gcatctgcctgggctttttct	CRISPR spacer
-catcattttgtgcatctgcctgggctttttgt	Protospacer
  ...****** ******************* *

60. spacer 2.14|1635051|32|CP029684|CRISPRCasFinder,CRT matches to MN694396 (Marine virus AFVG_250M754, complete genome) position: , mismatch: 6, identity: 0.812

tggctattttg-gcatctgcctgggctttttct	CRISPR spacer
-catcattttgtgcatctgcctgggctttttgt	Protospacer
  ...****** ******************* *

61. spacer 2.16|1635173|32|CP029684|CRISPRCasFinder,CRT matches to KF669663 (Bacillus phage Staley, complete genome) position: , mismatch: 6, identity: 0.812

-acaacgttgatgaaaaatacgttgattggact	CRISPR spacer
tacga-actgatgaaaaagatgttgattggact	Protospacer
 **.* ..********** *.************

62. spacer 2.16|1635173|32|CP029684|CRISPRCasFinder,CRT matches to NC_022774 (Bacillus phage Slash, complete genome) position: , mismatch: 6, identity: 0.812

-acaacgttgatgaaaaatacgttgattggact	CRISPR spacer
tacga-actgatgaaaaagatgttgattggact	Protospacer
 **.* ..********** *.************

63. spacer 2.16|1635173|32|CP029684|CRISPRCasFinder,CRT matches to KP696447 (Bacillus phage Stahl, complete genome) position: , mismatch: 6, identity: 0.812

-acaacgttgatgaaaaatacgttgattggact	CRISPR spacer
tacga-actgatgaaaaagatgttgattggact	Protospacer
 **.* ..********** *.************

64. spacer 2.16|1635173|32|CP029684|CRISPRCasFinder,CRT matches to MG428991 (Klebsiella phage May, complete genome) position: , mismatch: 6, identity: 0.812

acaacgttgatgaaaaatacgtt-gattggact	CRISPR spacer
tcaccgttgatgataaatacgttggacttgac-	Protospacer
 ** ********* ********* **.* ***

65. spacer 2.31|1636088|32|CP029684|CRISPRCasFinder,CRT matches to KX581091 (Vibrio phage Cla, complete genome) position: , mismatch: 6, identity: 0.812

--tgatttgcaaatcatcgaggaggaaaaaaatg	CRISPR spacer
gttga--ggtaaatcatcgaggtggaacaaaatg	Protospacer
  ***   *.************ **** ******

66. spacer 2.31|1636088|32|CP029684|CRISPRCasFinder,CRT matches to KX581096 (Vibrio phage pVa-5, complete genome) position: , mismatch: 6, identity: 0.812

--tgatttgcaaatcatcgaggaggaaaaaaatg	CRISPR spacer
gttga--ggtaaatcatcgaggtggaacaaaatg	Protospacer
  ***   *.************ **** ******

67. spacer 2.31|1636088|32|CP029684|CRISPRCasFinder,CRT matches to MK672804 (Vibrio phage Va_178/90_p41, complete genome) position: , mismatch: 6, identity: 0.812

--tgatttgcaaatcatcgaggaggaaaaaaatg	CRISPR spacer
gttga--ggtaaatcatcgaggtggaacaaaatg	Protospacer
  ***   *.************ **** ******

68. spacer 2.31|1636088|32|CP029684|CRISPRCasFinder,CRT matches to KY658673 (Vibrio phage H2 PGK-2017, complete genome) position: , mismatch: 6, identity: 0.812

--tgatttgcaaatcatcgaggaggaaaaaaatg	CRISPR spacer
gttga--ggtaaatcatcgaggtggaacaaaatg	Protospacer
  ***   *.************ **** ******

69. spacer 2.31|1636088|32|CP029684|CRISPRCasFinder,CRT matches to KX581093 (Vibrio phage Pel, complete genome) position: , mismatch: 6, identity: 0.812

--tgatttgcaaatcatcgaggaggaaaaaaatg	CRISPR spacer
gttga--ggtaaatcatcgaggtggaacaaaatg	Protospacer
  ***   *.************ **** ******

70. spacer 2.31|1636088|32|CP029684|CRISPRCasFinder,CRT matches to KX581097 (Vibrio phage pVa-6, complete genome) position: , mismatch: 6, identity: 0.812

--tgatttgcaaatcatcgaggaggaaaaaaatg	CRISPR spacer
gttga--ggtaaatcatcgaggtggaacaaaatg	Protospacer
  ***   *.************ **** ******

71. spacer 2.31|1636088|32|CP029684|CRISPRCasFinder,CRT matches to KY658677 (Vibrio phage P3, complete genome) position: , mismatch: 6, identity: 0.812

--tgatttgcaaatcatcgaggaggaaaaaaatg	CRISPR spacer
gttga--ggtaaatcatcgaggtggaacaaaatg	Protospacer
  ***   *.************ **** ******

72. spacer 2.31|1636088|32|CP029684|CRISPRCasFinder,CRT matches to KX581098 (Vibrio phage VaK, complete genome) position: , mismatch: 6, identity: 0.812

--tgatttgcaaatcatcgaggaggaaaaaaatg	CRISPR spacer
gttga--ggtaaatcatcgaggtggaacaaaatg	Protospacer
  ***   *.************ **** ******

73. spacer 2.31|1636088|32|CP029684|CRISPRCasFinder,CRT matches to KY658674 (Vibrio phage H8, complete genome) position: , mismatch: 6, identity: 0.812

--tgatttgcaaatcatcgaggaggaaaaaaatg	CRISPR spacer
gttga--ggtaaatcatcgaggtggaacaaaatg	Protospacer
  ***   *.************ **** ******

74. spacer 2.31|1636088|32|CP029684|CRISPRCasFinder,CRT matches to KY658676 (Vibrio phage P2, complete genome) position: , mismatch: 6, identity: 0.812

--tgatttgcaaatcatcgaggaggaaaaaaatg	CRISPR spacer
gttga--ggtaaatcatcgaggtggaacaaaatg	Protospacer
  ***   *.************ **** ******

75. spacer 2.31|1636088|32|CP029684|CRISPRCasFinder,CRT matches to KX581090 (Vibrio phage Her, complete genome) position: , mismatch: 6, identity: 0.812

--tgatttgcaaatcatcgaggaggaaaaaaatg	CRISPR spacer
gttga--ggtaaatcatcgaggtggaacaaaatg	Protospacer
  ***   *.************ **** ******

76. spacer 2.31|1636088|32|CP029684|CRISPRCasFinder,CRT matches to KY658678 (Vibrio phage pVa-3, complete genome) position: , mismatch: 6, identity: 0.812

--tgatttgcaaatcatcgaggaggaaaaaaatg	CRISPR spacer
gttga--ggtaaatcatcgaggtggaacaaaatg	Protospacer
  ***   *.************ **** ******

77. spacer 2.31|1636088|32|CP029684|CRISPRCasFinder,CRT matches to KY658679 (Vibrio phage pVa-4, complete genome) position: , mismatch: 6, identity: 0.812

--tgatttgcaaatcatcgaggaggaaaaaaatg	CRISPR spacer
gttga--ggtaaatcatcgaggtggaacaaaatg	Protospacer
  ***   *.************ **** ******

78. spacer 2.31|1636088|32|CP029684|CRISPRCasFinder,CRT matches to MK672800 (Vibrio phage Va_90-11-287_p41_Ba35, complete genome) position: , mismatch: 6, identity: 0.812

--tgatttgcaaatcatcgaggaggaaaaaaatg	CRISPR spacer
gttga--ggtaaatcatcgaggtggaacaaaatg	Protospacer
  ***   *.************ **** ******

79. spacer 2.31|1636088|32|CP029684|CRISPRCasFinder,CRT matches to MK672799 (Vibrio phage Va_90-11-287_p41, complete genome) position: , mismatch: 6, identity: 0.812

--tgatttgcaaatcatcgaggaggaaaaaaatg	CRISPR spacer
gttga--ggtaaatcatcgaggtggaacaaaatg	Protospacer
  ***   *.************ **** ******

80. spacer 2.31|1636088|32|CP029684|CRISPRCasFinder,CRT matches to KX581092 (Vibrio phage Len, complete genome) position: , mismatch: 6, identity: 0.812

--tgatttgcaaatcatcgaggaggaaaaaaatg	CRISPR spacer
gttga--ggtaaatcatcgaggtggaacaaaatg	Protospacer
  ***   *.************ **** ******

81. spacer 2.31|1636088|32|CP029684|CRISPRCasFinder,CRT matches to KX581094 (Vibrio phage pVa-2, complete genome) position: , mismatch: 6, identity: 0.812

--tgatttgcaaatcatcgaggaggaaaaaaatg	CRISPR spacer
gttga--ggtaaatcatcgaggtggaacaaaatg	Protospacer
  ***   *.************ **** ******

82. spacer 2.31|1636088|32|CP029684|CRISPRCasFinder,CRT matches to MK672803 (Vibrio phage Va_91-7-154_p41, complete genome) position: , mismatch: 6, identity: 0.812

--tgatttgcaaatcatcgaggaggaaaaaaatg	CRISPR spacer
gttga--ggtaaatcatcgaggtggaacaaaatg	Protospacer
  ***   *.************ **** ******

83. spacer 2.31|1636088|32|CP029684|CRISPRCasFinder,CRT matches to KY658680 (Vibrio phage pVa-8, complete genome) position: , mismatch: 6, identity: 0.812

--tgatttgcaaatcatcgaggaggaaaaaaatg	CRISPR spacer
gttga--ggtaaatcatcgaggtggaacaaaatg	Protospacer
  ***   *.************ **** ******

84. spacer 2.31|1636088|32|CP029684|CRISPRCasFinder,CRT matches to KY658675 (Vibrio phage H20, complete genome) position: , mismatch: 6, identity: 0.812

--tgatttgcaaatcatcgaggaggaaaaaaatg	CRISPR spacer
gttga--ggtaaatcatcgaggtggaacaaaatg	Protospacer
  ***   *.************ **** ******

85. spacer 2.31|1636088|32|CP029684|CRISPRCasFinder,CRT matches to KX581095 (Vibrio phage pVa-1, complete genome) position: , mismatch: 6, identity: 0.812

--tgatttgcaaatcatcgaggaggaaaaaaatg	CRISPR spacer
gttga--ggtaaatcatcgaggtggaacaaaatg	Protospacer
  ***   *.************ **** ******

86. spacer 2.31|1636088|32|CP029684|CRISPRCasFinder,CRT matches to KX581099 (Vibrio phage Strym, complete genome) position: , mismatch: 6, identity: 0.812

--tgatttgcaaatcatcgaggaggaaaaaaatg	CRISPR spacer
gttga--ggtaaatcatcgaggtggaacaaaatg	Protospacer
  ***   *.************ **** ******

87. spacer 2.31|1636088|32|CP029684|CRISPRCasFinder,CRT matches to MK672801 (Vibrio phage Va_90-11-287_p41_T265, complete genome) position: , mismatch: 6, identity: 0.812

--tgatttgcaaatcatcgaggaggaaaaaaatg	CRISPR spacer
gttga--ggtaaatcatcgaggtggaacaaaatg	Protospacer
  ***   *.************ **** ******

88. spacer 2.31|1636088|32|CP029684|CRISPRCasFinder,CRT matches to KX581100 (Vibrio phage pVa-7, complete genome) position: , mismatch: 6, identity: 0.812

--tgatttgcaaatcatcgaggaggaaaaaaatg	CRISPR spacer
gttga--ggtaaatcatcgaggtggaacaaaatg	Protospacer
  ***   *.************ **** ******

89. spacer 2.35|1636332|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP028348 (Novosphingobium sp. THN1 plasmid pTHN, complete sequence) position: , mismatch: 6, identity: 0.812

cttttcctgccgtttctgccattgcttgctcc	CRISPR spacer
gtgttcctgccgttgctgccgttgcttgcggc	Protospacer
 * *********** *****.********  *

90. spacer 2.38|1636515|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP009688 (Clostridium aceticum strain DSM 1496 plasmid CACET_5p, complete sequence) position: , mismatch: 6, identity: 0.812

gattcaaaaaattagttttaatcgtcgtatca	CRISPR spacer
tagtcaaaaaattagttttaatagtggtatac	Protospacer
 * ******************* ** ****

91. spacer 2.76|1638833|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP046704 (Nostoc sp. ATCC 53789 plasmid pNsp_a, complete sequence) position: , mismatch: 6, identity: 0.812

ctacaattagattctatttctagtta---tcaaac	CRISPR spacer
atacaattagattctattgctagtaagagtca---	Protospacer
 ***************** ***** *   ***

92. spacer 2.76|1638833|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024791 (Nostoc flagelliforme CCNUN1 plasmid pNFSY06, complete sequence) position: , mismatch: 6, identity: 0.812

ctacaattagattctatttctagtta---tcaaac	CRISPR spacer
atacaattagattctattgctagtaagagtca---	Protospacer
 ***************** ***** *   ***

93. spacer 2.76|1638833|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024793 (Nostoc flagelliforme CCNUN1 plasmid pNFSY08, complete sequence) position: , mismatch: 6, identity: 0.812

ctacaattagattctatttctagtta---tcaaac	CRISPR spacer
atacaattagattctattgctagtaagagtca---	Protospacer
 ***************** ***** *   ***

94. spacer 2.76|1638833|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP026693 (Nostoc sp. 'Lobaria pulmonaria (5183) cyanobiont' strain 5183 plasmid pNLP1, complete sequence) position: , mismatch: 6, identity: 0.812

ctacaattagattctatttctagtta---tcaaac	CRISPR spacer
atacaattagattctattgctagtaagagtca---	Protospacer
 ***************** ***** *   ***

95. spacer 2.76|1638833|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NC_010632 (Nostoc punctiforme PCC 73102 plasmid pNPUN02, complete sequence) position: , mismatch: 6, identity: 0.812

ctacaattagattctatttctagtta---tcaaac	CRISPR spacer
atacaattagattctattgctagtaagagtca---	Protospacer
 ***************** ***** *   ***

96. spacer 2.100|1640297|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to AY848685 (Enterobacteria phage PR3, complete genome) position: , mismatch: 6, identity: 0.812

gttggcgtggcaatacttgccgtgccggtacc	CRISPR spacer
attggcgtggcaattcttgccgtgctggttag	Protospacer
.************* **********.***

97. spacer 2.100|1640297|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to AY848686 (Enterobacteria phage PR4, complete genome) position: , mismatch: 6, identity: 0.812

gttggcgtggcaatacttgccgtgccggtacc	CRISPR spacer
attggcgtggcaattcttgccgtgctggttag	Protospacer
.************* **********.***

98. spacer 2.100|1640297|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to AY848684 (Enterobacteria phage L17, complete genome) position: , mismatch: 6, identity: 0.812

gttggcgtggcaatacttgccgtgccggtacc	CRISPR spacer
attggcgtggcaattcttgccgtgctggttag	Protospacer
.************* **********.***

99. spacer 1.1|52087|30|CP029684|CRISPRCasFinder,CRT matches to NZ_CP031947 (Ruegeria sp. AD91A plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

agaaattttggaatttatataatcacaaag	CRISPR spacer
aaaaatattggaatttttataatcaccgga	Protospacer
*.**** ********* ********* ...

100. spacer 1.1|52087|30|CP029684|CRISPRCasFinder,CRT matches to NZ_CP024012 (Acinetobacter sp. LoGeW2-3 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

agaaattttggaatttatataatcacaaag	CRISPR spacer
caaaaatttggaatttaaataatcatcaaa	Protospacer
 .*** *********** *******. **.

101. spacer 1.9|52615|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012698 (Microbacterium sp. No. 7 plasmid A, complete sequence) position: , mismatch: 7, identity: 0.767

gcgattgatgcgctccacctcgctggtgtt	CRISPR spacer
agcagtgatgccctccgcctcgctggtgat	Protospacer
.  * ****** ****.*********** *

102. spacer 1.9|52615|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029357 (Azospirillum sp. CFH 70021 plasmid unnamed2) position: , mismatch: 7, identity: 0.767

gcgattgatgcgctccacctcgctggtgtt----	CRISPR spacer
gcgctcgatgcgctccacctcgc----gctccag	Protospacer
*** *.*****************    *.*

103. spacer 1.9|52615|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NC_008010 (Deinococcus geothermalis DSM 11300 plasmid pDGEO01, complete sequence) position: , mismatch: 7, identity: 0.767

gcgattgatgcgctccacctcgctggtgtt	CRISPR spacer
gcgatggatgcgctgcacctcgcggcggcg	Protospacer
***** ******** ******** *  *.

104. spacer 1.9|52615|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP044082 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.767

gcgattg--atgcgctccacctcgctggtgtt	CRISPR spacer
--gatcaccatgcgctgcacctcgctggtgcc	Protospacer
  ***..  ******* *************..

105. spacer 1.11|52747|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to JQ680349 (Unidentified phage clone 1013_scaffold24 genomic sequence) position: , mismatch: 7, identity: 0.767

atcaatgaaaacatgaaaaccccttacact	CRISPR spacer
aaagaggaaaacaagaaaaccacttacaca	Protospacer
*  .* ******* ******* *******

106. spacer 1.13|52880|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NC_019431 (Lactococcus lactis subsp. cremoris UC509.9 plasmid pCIS7, complete sequence) position: , mismatch: 7, identity: 0.767

gaactcggacttgctaaatcttttttgtaa	CRISPR spacer
ctggttgaactttctaaatcttttttgtaa	Protospacer
  . *.*.**** *****************

107. spacer 1.13|52880|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP018500 (Lactococcus lactis subsp. cremoris strain C4 plasmid pC41, complete sequence) position: , mismatch: 7, identity: 0.767

gaactcggacttgctaaatcttttttgtaa	CRISPR spacer
ctggttgaactttctaaatcttttttgtaa	Protospacer
  . *.*.**** *****************

108. spacer 1.13|52880|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP051521 (Lactococcus lactis subsp. cremoris strain F plasmid pScrF75, complete sequence) position: , mismatch: 7, identity: 0.767

gaactcggacttgctaaatcttttttgtaa	CRISPR spacer
ctggttgaactttctaaatcttttttgtaa	Protospacer
  . *.*.**** *****************

109. spacer 1.13|52880|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP016685 (Lactococcus lactis subsp. cremoris strain 158 plasmid p158A, complete sequence) position: , mismatch: 7, identity: 0.767

gaactcggacttgctaaatcttttttgtaa	CRISPR spacer
ctggttgaactttctaaatcttttttgtaa	Protospacer
  . *.*.**** *****************

110. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MH937504 (Streptococcus phage CHPC1091, complete genome) position: , mismatch: 7, identity: 0.767

atggttacgataacttgttggctgccttag	CRISPR spacer
acggttacgataacttgctcgctgcaatca	Protospacer
*.***************.* *****  * .

111. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MH937501 (Streptococcus phage CHPC1073, complete genome) position: , mismatch: 7, identity: 0.767

atggttacgataacttgttggctgccttag	CRISPR spacer
acggttacgataacttgctcgctgcaatca	Protospacer
*.***************.* *****  * .

112. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MH937468 (Streptococcus phage CHPC879, complete genome) position: , mismatch: 7, identity: 0.767

atggttacgataacttgttggctgccttag	CRISPR spacer
acggttacgataacttgctagctgcaatca	Protospacer
*.***************.*.*****  * .

113. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MF580770 (Streptococcus phage M19, complete genome) position: , mismatch: 7, identity: 0.767

atggttacgataacttgttggctgccttag	CRISPR spacer
acggttacgataacttgctcgctgcaatca	Protospacer
*.***************.* *****  * .

114. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MH892360 (Streptococcus phage SW11, complete genome) position: , mismatch: 7, identity: 0.767

atggttacgataacttgttggctgccttag	CRISPR spacer
acggttacgataacttgctcgctgcaatca	Protospacer
*.***************.* *****  * .

115. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to KY705270 (Streptococcus phage P7573, complete genome) position: , mismatch: 7, identity: 0.767

atggttacgataacttgttggctgccttag	CRISPR spacer
acggttacgataacttgctcgctgcaatca	Protospacer
*.***************.* *****  * .

116. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MH892361 (Streptococcus phage SW12, complete genome) position: , mismatch: 7, identity: 0.767

atggttacgataacttgttggctgccttag	CRISPR spacer
acggttacgataacttgctcgctgcaatca	Protospacer
*.***************.* *****  * .

117. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NC_000871 (Streptococcus phage Sfi19, complete genome) position: , mismatch: 7, identity: 0.767

atggttacgataacttgttggctgccttag	CRISPR spacer
acggttacgataacttgctcgctgcaatca	Protospacer
*.***************.* *****  * .

118. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MH937483 (Streptococcus phage CHPC1005, complete genome) position: , mismatch: 7, identity: 0.767

atggttacgataacttgttggctgccttag	CRISPR spacer
acggttacgataacttgctcgctgcaatca	Protospacer
*.***************.* *****  * .

119. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MG708275 (Streptococcus phage vB_SthS_VA460, complete genome) position: , mismatch: 7, identity: 0.767

atggttacgataacttgttggctgccttag	CRISPR spacer
acggttacgataacttgctcgctgcaatca	Protospacer
*.***************.* *****  * .

120. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MH937486 (Streptococcus phage CHPC1027, complete genome) position: , mismatch: 7, identity: 0.767

atggttacgataacttgttggctgccttag	CRISPR spacer
acggttacgataacttgctcgctgcaatca	Protospacer
*.***************.* *****  * .

121. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MH937500 (Streptococcus phage CHPC1067, complete genome) position: , mismatch: 7, identity: 0.767

atggttacgataacttgttggctgccttag	CRISPR spacer
acggttacgataacttgctcgctgcaatca	Protospacer
*.***************.* *****  * .

122. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MH937462 (Streptococcus phage CHPC663, complete genome) position: , mismatch: 7, identity: 0.767

atggttacgataacttgttggctgccttag	CRISPR spacer
acggttacgataacttgctcgctgcaatca	Protospacer
*.***************.* *****  * .

123. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to KY705263 (Streptococcus phage P7133, complete genome) position: , mismatch: 7, identity: 0.767

atggttacgataacttgttggctgccttag	CRISPR spacer
acggttacgataacttgctcgctgcaatca	Protospacer
*.***************.* *****  * .

124. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MF580771 (Streptococcus phage MM25, complete genome) position: , mismatch: 7, identity: 0.767

atggttacgataacttgttggctgccttag	CRISPR spacer
acggttacgataacttgctcgctgcaatca	Protospacer
*.***************.* *****  * .

125. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MH937481 (Streptococcus phage CHPC979, complete genome) position: , mismatch: 7, identity: 0.767

atggttacgataacttgttggctgccttag	CRISPR spacer
acggttacgataacttgctcgctgcaatca	Protospacer
*.***************.* *****  * .

126. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MH892351 (Streptococcus phage SW6, complete genome) position: , mismatch: 7, identity: 0.767

atggttacgataacttgttggctgccttag	CRISPR spacer
acggttacgataacttgctcgctgcaatca	Protospacer
*.***************.* *****  * .

127. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MH892375 (Streptococcus phage SW30, complete genome) position: , mismatch: 7, identity: 0.767

atggttacgataacttgttggctgccttag	CRISPR spacer
acggttacgataacttgctcgctgcaatca	Protospacer
*.***************.* *****  * .

128. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to AF115102 (Streptococcus thermophilus bacteriophage Sfi19, complete genome) position: , mismatch: 7, identity: 0.767

atggttacgataacttgttggctgccttag	CRISPR spacer
acggttacgataacttgctcgctgcaatca	Protospacer
*.***************.* *****  * .

129. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MH892354 (Streptococcus phage SW3, complete genome) position: , mismatch: 7, identity: 0.767

atggttacgataacttgttggctgccttag	CRISPR spacer
acggttacgataacttgctcgctgcaatca	Protospacer
*.***************.* *****  * .

130. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MH937488 (Streptococcus phage CHPC1033, complete genome) position: , mismatch: 7, identity: 0.767

atggttacgataacttgttggctgccttag	CRISPR spacer
acggttacgataacttgctcgctgcaatca	Protospacer
*.***************.* *****  * .

131. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MH937508 (Streptococcus phage CHPC1156, complete genome) position: , mismatch: 7, identity: 0.767

atggttacgataacttgttggctgccttag	CRISPR spacer
acggttacgataacttgctcgctgcaatca	Protospacer
*.***************.* *****  * .

132. spacer 1.15|53012|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MH937470 (Streptococcus phage CHPC925, complete genome) position: , mismatch: 7, identity: 0.767

atggttacgataacttgttggctgccttag	CRISPR spacer
acggttacgataacttgctagctgcaatca	Protospacer
*.***************.*.*****  * .

133. spacer 1.17|53144|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MN582112 (Podoviridae sp. ctpVR23, complete genome) position: , mismatch: 7, identity: 0.767

atttcaaacgaagccatcgcagaattgaca	CRISPR spacer
catataaatgaagccatcgcagaattggcg	Protospacer
  * .***.******************.*.

134. spacer 1.17|53144|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP034226 (Lactobacillus agilis strain La3 plasmid pLa3_1, complete sequence) position: , mismatch: 7, identity: 0.767

atttcaaacgaagccatcgcagaattgaca	CRISPR spacer
atttcaaacgaagccattgcacctaagaaa	Protospacer
*****************.***     ** *

135. spacer 1.18|53210|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to KU234532 (Nostoc phage N1, complete genome) position: , mismatch: 7, identity: 0.767

gagggagctattggtaacttgcaagccaac	CRISPR spacer
cagacagctattggtgacttacaagccact	Protospacer
 **. **********.****.******* .

136. spacer 1.19|53276|29|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MG018928 (Pseudomonas phage inbricus, complete genome) position: , mismatch: 7, identity: 0.759

atggaatcaacgaagagcaagcccaagag	CRISPR spacer
ctggaaccaaggaagagcaagccccggct	Protospacer
 *****.*** ************* .*

137. spacer 1.19|53276|29|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MK962632 (Achromobacter phage vB_AxyP_19-32_Axy13, complete genome) position: , mismatch: 7, identity: 0.759

atggaatcaacgaagagcaagcccaagag	CRISPR spacer
ctggaaccaaggaagagcaagccccggct	Protospacer
 *****.*** ************* .*

138. spacer 1.20|53341|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MK448761 (Streptococcus phage Javan445, complete genome) position: , mismatch: 7, identity: 0.767

ttcatatcatctattaaatcactatataaa	CRISPR spacer
tcgatatcatcttttaaatcactaacaaca	Protospacer
*. ********* ***********   * *

139. spacer 1.20|53341|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MN692966 (Marine virus AFVG_117M38, complete genome) position: , mismatch: 7, identity: 0.767

ttcatatcatctattaaatcactatataaa	CRISPR spacer
ttataatcatctactaaatcaccatatact	Protospacer
**   ********.********.*****

140. spacer 1.20|53341|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MK448760 (Streptococcus phage Javan443, complete genome) position: , mismatch: 7, identity: 0.767

ttcatatcatctattaaatcactatataaa	CRISPR spacer
tcgatatcatcttttaaatcactaacaaca	Protospacer
*. ********* ***********   * *

141. spacer 1.22|53473|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to JQ340088 (Halocynthia phage JM-2012, complete genome) position: , mismatch: 7, identity: 0.767

ccaactaattgctttattgatattagcaat	CRISPR spacer
acgattaatcgctttattaatattagcagc	Protospacer
 *.*.****.********.*********..

142. spacer 1.23|53539|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP049732 (Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence) position: , mismatch: 7, identity: 0.767

tgaaagacgactacgtttacggacaattgg	CRISPR spacer
gccgagacgacttcgtttacggacagttcg	Protospacer
   .******** ************.** *

143. spacer 1.23|53539|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP053208 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence) position: , mismatch: 7, identity: 0.767

tgaaagacgactacgtttacggacaattgg	CRISPR spacer
gccgagacgacttcgtttacggacagttcg	Protospacer
   .******** ************.** *

144. spacer 1.26|52418|29|CP029684|PILER-CR matches to NZ_CP019063 (Rahnella sp. ERMR1:05 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

cggtctaagtcgtattgaagccagtggca	CRISPR spacer
gtgaataagtcgtattgacgccaatggcc	Protospacer
  *  ************* ****.****

145. spacer 2.1|1634255|34|CP029684|CRISPRCasFinder matches to AP014318 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S32-C66, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 7, identity: 0.794

cttataaccaatgacaaagaaagcaatgttatag	CRISPR spacer
catatacattatgacaaagacggcaatgttatag	Protospacer
* ****  . ********** .************

146. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to MK905543 (Vibrio phage USC-1, complete genome) position: , mismatch: 7, identity: 0.781

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
tctttgatgtggtcatcgatatttttaaagac	Protospacer
*.****** * *****************  .

147. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to MK358448 (Vibrio phage 5, complete genome) position: , mismatch: 7, identity: 0.781

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
tctttgatgtggtcatcgatatttttaaagac	Protospacer
*.****** * *****************  .

148. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP048757 (Campylobacter jejuni strain ZS006 plasmid pCJ41K-01, complete sequence) position: , mismatch: 7, identity: 0.781

tttttgatttcgtcatcgatattttt--aattgg	CRISPR spacer
tctttgatttcttcatcgattttttctaaatc--	Protospacer
*.********* ******** ****.  ***.

149. spacer 2.16|1635173|32|CP029684|CRISPRCasFinder,CRT matches to KP696448 (Bacillus phage Stills, complete genome) position: , mismatch: 7, identity: 0.781

-acaacgttgatgaaaaatacgttgattggact	CRISPR spacer
tacga-acagatgaaaaagatgttgattggact	Protospacer
 **.* .. ********* *.************

150. spacer 2.17|1635234|32|CP029684|CRISPRCasFinder,CRT matches to MH617008 (Microviridae sp. isolate ctbe706, complete genome) position: , mismatch: 7, identity: 0.781

tgtgctgctcatggctttcgtcatgactttac---	CRISPR spacer
gctgctgctcgtggttttcgtcatga---tacgca	Protospacer
  ********.***.***********   ***

151. spacer 2.43|1636820|32|CP029684|CRISPRCasFinder,CRT matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

attaaaacgtaaatataacattc--taaaagcag	CRISPR spacer
atttaaacttaaatataacattcattataggt--	Protospacer
*** **** **************  ** *.*.

152. spacer 2.54|1637491|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP044448 (Acinetobacter indicus strain CMG3-2 plasmid pCMG3-2-3, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
ataaattaataattattacgccagatacgata	Protospacer
* ************ **.******** *...*

153. spacer 2.54|1637491|32|CP029684|CRISPRCasFinder,CRT matches to NZ_MH999418 (Acinetobacter sp. SWBY1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
ataaattaataattattacgccagatacgata	Protospacer
* ************ **.******** *...*

154. spacer 2.54|1637491|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP028558 (Acinetobacter sp. WCHA45 plasmid p3_010045, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
ataaattaataattattacgccagatacgata	Protospacer
* ************ **.******** *...*

155. spacer 2.54|1637491|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP033130 (Acinetobacter wuhouensis strain WCHAW010062 plasmid pOXA23_010062, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
ataaattaataattattacgccagatacgata	Protospacer
* ************ **.******** *...*

156. spacer 2.54|1637491|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP033131 (Acinetobacter wuhouensis strain WCHAW010062 plasmid pOXA58_010062, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
ataaattaataattattacgccagatacgata	Protospacer
* ************ **.******** *...*

157. spacer 2.54|1637491|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP032272 (Acinetobacter sp. WCHAc010034 plasmid p4_010034, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
ataaattaataattattacgccagatacgata	Protospacer
* ************ **.******** *...*

158. spacer 2.54|1637491|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP042561 (Acinetobacter baumannii strain E47 plasmid pE47_005, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
ataaattaataattattacgccagatacgata	Protospacer
* ************ **.******** *...*

159. spacer 2.54|1637491|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP029391 (Acinetobacter defluvii strain WCHA30 plasmid p3_010030, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
ataaattaataattattacgccagatacgata	Protospacer
* ************ **.******** *...*

160. spacer 2.54|1637491|32|CP029684|CRISPRCasFinder,CRT matches to NC_025121 (Acinetobacter sp. M131 plasmid pM131-4, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
ataaattaataattattacgccagatacgata	Protospacer
* ************ **.******** *...*

161. spacer 2.54|1637491|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP031712 (Acinetobacter wuhouensis strain WCHA60 plasmid p4_010060, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
ataaattaataattattacgccagatacgata	Protospacer
* ************ **.******** *...*

162. spacer 2.54|1637491|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP010903 (Acinetobacter nosocomialis strain 6411 plasmid p6411-66.409kb, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
ataaattaataattattacgccagatacgata	Protospacer
* ************ **.******** *...*

163. spacer 2.54|1637491|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP039153 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-10, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
ataaattaataattattacgccagatacgata	Protospacer
* ************ **.******** *...*

164. spacer 2.54|1637491|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP026413 (Acinetobacter sp. ACNIH2 plasmid pACI-35f6, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
ataaattaataattattacgccagatacgata	Protospacer
* ************ **.******** *...*

165. spacer 2.54|1637491|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP044467 (Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-4, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
ataaattaataattattacgccagatacgata	Protospacer
* ************ **.******** *...*

166. spacer 2.54|1637491|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP044471 (Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-8, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
ataaattaataattattacgccagatacgata	Protospacer
* ************ **.******** *...*

167. spacer 2.67|1638284|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP044448 (Acinetobacter indicus strain CMG3-2 plasmid pCMG3-2-3, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
ataaattaataattattacgccagatacgata	Protospacer
* ************ **.******** *...*

168. spacer 2.67|1638284|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MH999418 (Acinetobacter sp. SWBY1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
ataaattaataattattacgccagatacgata	Protospacer
* ************ **.******** *...*

169. spacer 2.67|1638284|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028558 (Acinetobacter sp. WCHA45 plasmid p3_010045, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
ataaattaataattattacgccagatacgata	Protospacer
* ************ **.******** *...*

170. spacer 2.67|1638284|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP033130 (Acinetobacter wuhouensis strain WCHAW010062 plasmid pOXA23_010062, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
ataaattaataattattacgccagatacgata	Protospacer
* ************ **.******** *...*

171. spacer 2.67|1638284|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP033131 (Acinetobacter wuhouensis strain WCHAW010062 plasmid pOXA58_010062, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
ataaattaataattattacgccagatacgata	Protospacer
* ************ **.******** *...*

172. spacer 2.67|1638284|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP032272 (Acinetobacter sp. WCHAc010034 plasmid p4_010034, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
ataaattaataattattacgccagatacgata	Protospacer
* ************ **.******** *...*

173. spacer 2.67|1638284|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP042561 (Acinetobacter baumannii strain E47 plasmid pE47_005, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
ataaattaataattattacgccagatacgata	Protospacer
* ************ **.******** *...*

174. spacer 2.67|1638284|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029391 (Acinetobacter defluvii strain WCHA30 plasmid p3_010030, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
ataaattaataattattacgccagatacgata	Protospacer
* ************ **.******** *...*

175. spacer 2.67|1638284|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NC_025121 (Acinetobacter sp. M131 plasmid pM131-4, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
ataaattaataattattacgccagatacgata	Protospacer
* ************ **.******** *...*

176. spacer 2.67|1638284|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP031712 (Acinetobacter wuhouensis strain WCHA60 plasmid p4_010060, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
ataaattaataattattacgccagatacgata	Protospacer
* ************ **.******** *...*

177. spacer 2.67|1638284|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP010903 (Acinetobacter nosocomialis strain 6411 plasmid p6411-66.409kb, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
ataaattaataattattacgccagatacgata	Protospacer
* ************ **.******** *...*

178. spacer 2.67|1638284|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP039153 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-10, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
ataaattaataattattacgccagatacgata	Protospacer
* ************ **.******** *...*

179. spacer 2.67|1638284|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP026413 (Acinetobacter sp. ACNIH2 plasmid pACI-35f6, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
ataaattaataattattacgccagatacgata	Protospacer
* ************ **.******** *...*

180. spacer 2.67|1638284|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP044467 (Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-4, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
ataaattaataattattacgccagatacgata	Protospacer
* ************ **.******** *...*

181. spacer 2.67|1638284|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP044471 (Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-8, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
ataaattaataattattacgccagatacgata	Protospacer
* ************ **.******** *...*

182. spacer 2.79|1639016|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP019380 (Buchnera aphidicola (Nipponaphis monzeni) strain Nmo isolate Tokyo2014 plasmid pLeu, complete sequence) position: , mismatch: 7, identity: 0.781

ctaattttatttgtcatttttgtacctcttta	CRISPR spacer
gtaattttatttataatttttgtacatttatt	Protospacer
 ***********.* ********** *.* *

183. spacer 2.93|1639870|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018080 (Sulfitobacter sp. AM1-D1 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.781

aagcacgtatttccggttcgccagccatcacg-	CRISPR spacer
cagcacgtatttccggatggccagac-ccatgc	Protospacer
 *************** * ***** * .**.*

184. spacer 2.100|1640297|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to AY848688 (Enterobacteria phage PR772, complete genome) position: , mismatch: 7, identity: 0.781

gttggcgtggcaatacttgccgtgccggtacc	CRISPR spacer
atcggcgtggcaattcttgccgtgctggttag	Protospacer
.*.*********** **********.***

185. spacer 2.100|1640297|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to AY848687 (Enterobacteria phage PR5, complete genome) position: , mismatch: 7, identity: 0.781

gttggcgtggcaatacttgccgtgccggtacc	CRISPR spacer
atcggcgtggcaattcttgccgtgctggttag	Protospacer
.*.*********** **********.***

186. spacer 2.100|1640297|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NC_001421 (Salmonella virus PRD1, complete genome) position: , mismatch: 7, identity: 0.781

gttggcgtggcaatacttgccgtgccggtacc	CRISPR spacer
atcggcgtggcaattcttgccgtgctggttag	Protospacer
.*.*********** **********.***

187. spacer 2.100|1640297|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to AY848689 (Enterobacteria phage PRD1, complete genome) position: , mismatch: 7, identity: 0.781

gttggcgtggcaatacttgccgtgccggtacc	CRISPR spacer
atcggcgtggcaattcttgccgtgctggttag	Protospacer
.*.*********** **********.***

188. spacer 2.100|1640297|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to AY441783 (Bacteriophage PR772, complete genome) position: , mismatch: 7, identity: 0.781

gttggcgtggcaatacttgccgtgccggtacc	CRISPR spacer
atcggcgtggcaattcttgccgtgctggttag	Protospacer
.*.*********** **********.***

189. spacer 1.1|52087|30|CP029684|CRISPRCasFinder,CRT matches to NZ_CP020413 (Leptospira interrogans serovar Copenhageni strain FDAARGOS_203 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

agaaattttggaatttatataatcacaaag	CRISPR spacer
tgaaattttggaatttatagaacccttaga	Protospacer
 ****************** **.* . *..

190. spacer 1.1|52087|30|CP029684|CRISPRCasFinder,CRT matches to NZ_CP009619 (Vibrio coralliilyticus strain RE98 plasmid p380, complete sequence) position: , mismatch: 8, identity: 0.733

agaaattttggaatttatataatcacaaag	CRISPR spacer
agaaattttggaattaataaaatggtgcaa	Protospacer
*************** *** *** ... *.

191. spacer 1.1|52087|30|CP029684|CRISPRCasFinder,CRT matches to MN693772 (Marine virus AFVG_250M408, complete genome) position: , mismatch: 8, identity: 0.733

agaaattttggaatttatataatcacaaag	CRISPR spacer
gaaaattttggaatttacataataaattat	Protospacer
..***************.***** *   *

192. spacer 1.6|52417|30|CP029684|CRISPRCasFinder,CRT matches to NZ_CP019063 (Rahnella sp. ERMR1:05 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

gcggtctaagtcgtattgaagccagtggca	CRISPR spacer
tgtgaataagtcgtattgacgccaatggcc	Protospacer
   *  ************* ****.****

193. spacer 1.7|52483|30|CP029684|CRISPRCasFinder,CRT matches to NZ_CP019063 (Rahnella sp. ERMR1:05 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

gcggtctaagtcgtattgaagccagtggca	CRISPR spacer
tgtgaataagtcgtattgacgccaatggcc	Protospacer
   *  ************* ****.****

194. spacer 1.8|52549|30|CP029684|CRISPRCasFinder,CRT matches to MH153807 (Rhodococcus phage Peregrin, complete genome) position: , mismatch: 8, identity: 0.733

taataataccagctgcgggaatatttagtt	CRISPR spacer
ccataataccacctgcggtaatattatcta	Protospacer
. ********* ****** ******   *

195. spacer 1.9|52615|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021406 (Celeribacter manganoxidans strain DY25 plasmid pDY25-B, complete sequence) position: , mismatch: 8, identity: 0.733

gcgattgatgcgctccacctcgctggtgtt	CRISPR spacer
ctccatgatgcggtcgacctcgctggtgat	Protospacer
 .   ******* ** ************ *

196. spacer 1.12|52813|31|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020521 (Escherichia coli strain 190 plasmid unnamed4, complete sequence) position: , mismatch: 8, identity: 0.742

ccattctgtgactcctttttagcttttcttg	CRISPR spacer
attatctgtgcctcgtttttagctttttgtg	Protospacer
 .  ****** *** ************. **

197. spacer 1.21|53407|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MN693885 (Marine virus AFVG_250M83, complete genome) position: , mismatch: 8, identity: 0.733

tatctgacgctgttggtatacaagtcacaa	CRISPR spacer
agtctgacgctgttggtacaaaagttgata	Protospacer
 .****************.* ****..  *

198. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.75

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ttttcgatttcgtcattgatattggtcatgct	Protospacer
****.***********.******  * **

199. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP009359 (Vibrio tubiashii ATCC 19109 plasmid p48, complete sequence) position: , mismatch: 8, identity: 0.75

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
tgttggatttcgtcaccgatattttggctttc	Protospacer
* ** **********.********* . **

200. spacer 2.5|1634501|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP040048 (Acinetobacter baumannii strain VB1190 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

cgattgacattgtcgttcggcatgatccgact	CRISPR spacer
cttttgacattgtcgatcgtcatgatttgtat	Protospacer
*  ************ *** ******..*  *

201. spacer 2.7|1634623|33|CP029684|CRISPRCasFinder,CRT matches to MH617008 (Microviridae sp. isolate ctbe706, complete genome) position: , mismatch: 8, identity: 0.758

tgtgctgctcatggctttcgtcatgactttacc---	CRISPR spacer
gctgctgctcgtggttttcgtcatga---tacgcag	Protospacer
  ********.***.***********   ***

202. spacer 2.14|1635051|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP015007 (Aminobacter aminovorans strain KCTC 2477 plasmid pAA02, complete sequence) position: , mismatch: 8, identity: 0.75

tggctattttggcatctgcctgggctttttct	CRISPR spacer
gctcgtttttgtcatctgcctgggcttttacg	Protospacer
   *  ***** ***************** *

203. spacer 2.14|1635051|32|CP029684|CRISPRCasFinder,CRT matches to MN693834 (Marine virus AFVG_250M755, complete genome) position: , mismatch: 8, identity: 0.75

tggctattttg-gcatctgcctgggctttttct	CRISPR spacer
-catcattttgtgcatctgcctgggcttttgtc	Protospacer
  ...****** ****************** ..

204. spacer 2.14|1635051|32|CP029684|CRISPRCasFinder,CRT matches to MN694801 (Marine virus AFVG_250M760, complete genome) position: , mismatch: 8, identity: 0.75

tggctattttg-gcatctgcctgggctttttct	CRISPR spacer
-catcattttgtgcatctgcctgggcttttgtc	Protospacer
  ...****** ****************** ..

205. spacer 2.14|1635051|32|CP029684|CRISPRCasFinder,CRT matches to MN694618 (Marine virus AFVG_250M753, complete genome) position: , mismatch: 8, identity: 0.75

tggctattttg-gcatctgcctgggctttttct	CRISPR spacer
-catcattttgtgcatctgcctgggcttttgtc	Protospacer
  ...****** ****************** ..

206. spacer 2.15|1635112|32|CP029684|CRISPRCasFinder,CRT matches to MN855920 (Bacteriophage sp. isolate 447, partial genome) position: , mismatch: 8, identity: 0.75

ccgctgatttaccagatgatctaagtgataaa	CRISPR spacer
cccatgatttaccagatgagcaaagtgcagca	Protospacer
**  *************** * *****  . *

207. spacer 2.16|1635173|32|CP029684|CRISPRCasFinder,CRT matches to NZ_KY513280 (Enterococcus faecalis strain 6742 plasmid p6742_1, complete sequence) position: , mismatch: 8, identity: 0.75

acaacgttgatgaaaaatacgttgattggact	CRISPR spacer
accattttgatggaaaatatgttgattgggta	Protospacer
** *. ******.******.*********..

208. spacer 2.16|1635173|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP028725 (Enterococcus faecalis strain CVM N60443F plasmid pN60443F-2, complete sequence) position: , mismatch: 8, identity: 0.75

acaacgttgatgaaaaatacgttgattggact	CRISPR spacer
accattttgatggaaaatatgttgattgggta	Protospacer
** *. ******.******.*********..

209. spacer 2.16|1635173|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP010241 (Escherichia coli strain C7 plasmid A, complete sequence) position: , mismatch: 8, identity: 0.75

acaacgttgatgaaaaatacgttgattggact	CRISPR spacer
attaaacttatgaaaaagacgttgattgcact	Protospacer
*. * ..* ******** ********** ***

210. spacer 2.16|1635173|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP010120 (Escherichia coli strain C3 plasmid A, complete sequence) position: , mismatch: 8, identity: 0.75

acaacgttgatgaaaaatacgttgattggact	CRISPR spacer
attaaacttatgaaaaagacgttgattgcact	Protospacer
*. * ..* ******** ********** ***

211. spacer 2.16|1635173|32|CP029684|CRISPRCasFinder,CRT matches to MN831410 (Enterococcus faecalis strain M17/0149 plasmid pM17/0149, complete sequence) position: , mismatch: 8, identity: 0.75

acaacgttgatgaaaaatacgttgattggact	CRISPR spacer
accattttgatggaaaatatgttgattgggta	Protospacer
** *. ******.******.*********..

212. spacer 2.16|1635173|32|CP029684|CRISPRCasFinder,CRT matches to NZ_AP018547 (Enterococcus faecalis strain KUB3007 plasmid pKUB3007-4, complete sequence) position: , mismatch: 8, identity: 0.75

acaacgttgatgaaaaatacgttgattggact	CRISPR spacer
accattttgatggaaaatatgttgattgggta	Protospacer
** *. ******.******.*********..

213. spacer 2.16|1635173|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP028723 (Enterococcus faecalis strain CVM N48037F plasmid pN48037F-3, complete sequence) position: , mismatch: 8, identity: 0.75

acaacgttgatgaaaaatacgttgattggact	CRISPR spacer
accattttgatggaaaatatgttgattgggta	Protospacer
** *. ******.******.*********..

214. spacer 2.16|1635173|32|CP029684|CRISPRCasFinder,CRT matches to MT223178 (Enterococcus faecalis strain EFs17-1 plasmid pEFs17-1, complete sequence) position: , mismatch: 8, identity: 0.75

acaacgttgatgaaaaatacgttgattggact	CRISPR spacer
accattttgatggaaaatatgttgattgggta	Protospacer
** *. ******.******.*********..

215. spacer 2.22|1635539|32|CP029684|CRISPRCasFinder,CRT matches to NC_014628 (Paenibacillus polymyxa SC2 plasmid pSC2, complete sequence) position: , mismatch: 8, identity: 0.75

ttccatcagatgaagttttgccgttctaagcg	CRISPR spacer
atatctcagatgatgatttgccgttctaaatg	Protospacer
 * . ******** * *************..*

216. spacer 2.27|1635844|32|CP029684|CRISPRCasFinder,CRT matches to NZ_LR215032 (Mycoplasma gallopavonis strain NCTC10186 plasmid 2) position: , mismatch: 8, identity: 0.75

-----atttcggcaatattttcaattcatgaattttc	CRISPR spacer
caacaatt-----aatctttttaattcatgaattttg	Protospacer
     ***     *** ****.**************

217. spacer 2.27|1635844|32|CP029684|CRISPRCasFinder,CRT matches to NZ_LR215033 (Mycoplasma gallopavonis strain NCTC10186 plasmid 3) position: , mismatch: 8, identity: 0.75

-----atttcggcaatattttcaattcatgaattttc	CRISPR spacer
caacaatt-----aatctttttaattcatgaattttg	Protospacer
     ***     *** ****.**************

218. spacer 2.27|1635844|32|CP029684|CRISPRCasFinder,CRT matches to NZ_LR215034 (Mycoplasma gallopavonis strain NCTC10186 plasmid 4) position: , mismatch: 8, identity: 0.75

-----atttcggcaatattttcaattcatgaattttc	CRISPR spacer
caacaatt-----aatctttttaattcatgaattttg	Protospacer
     ***     *** ****.**************

219. spacer 2.43|1636820|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP039286 (Leptospira interrogans strain FMAS_AW1 plasmid pLiSL3, complete sequence) position: , mismatch: 8, identity: 0.75

attaaaacgtaaatataacattctaaaagcag	CRISPR spacer
gaaataacggaaaaataacattctaaaagtaa	Protospacer
.  * **** *** ***************.*.

220. spacer 2.43|1636820|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP039286 (Leptospira interrogans strain FMAS_AW1 plasmid pLiSL3, complete sequence) position: , mismatch: 8, identity: 0.75

attaaaacgtaaatataacattctaaaagcag	CRISPR spacer
gaaataacggaaaaataacattctaaaagtaa	Protospacer
.  * **** *** ***************.*.

221. spacer 2.43|1636820|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP031072 (Bacillus mycoides strain BPN401 plasmid pl395, complete sequence) position: , mismatch: 8, identity: 0.75

attaaaacgtaaatataacattctaaaagcag	CRISPR spacer
aataacatgtaaatataacattctaatgaatg	Protospacer
* *** *.****************** ..  *

222. spacer 2.43|1636820|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP009691 (Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence) position: , mismatch: 8, identity: 0.75

attaaaacgtaaatataacattctaaaagcag	CRISPR spacer
aataacatgtaaatataacattctaatgaatg	Protospacer
* *** *.****************** ..  *

223. spacer 2.54|1637491|32|CP029684|CRISPRCasFinder,CRT matches to NZ_LR214986 (Mycoplasma cynos strain NCTC10142 plasmid 13) position: , mismatch: 8, identity: 0.75

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
ttcaatcaataatttttgagccagatactgaa	Protospacer
   ***.*********** ******* * * *

224. spacer 2.57|1637674|32|CP029684|CRISPRCasFinder,CRT matches to MK448722 (Streptococcus phage Javan269, complete genome) position: , mismatch: 8, identity: 0.75

atcgtgttaatgaagccttatcagaagttaca	CRISPR spacer
agggtgttaatcaagctttatcagaaaatgga	Protospacer
*  ******** ****.*********. *. *

225. spacer 2.67|1638284|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR214986 (Mycoplasma cynos strain NCTC10142 plasmid 13) position: , mismatch: 8, identity: 0.75

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
ttcaatcaataatttttgagccagatactgaa	Protospacer
   ***.*********** ******* * * *

226. spacer 2.74|1638711|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP007144 (Hymenobacter swuensis DY53 plasmid pHsw1, complete sequence) position: , mismatch: 8, identity: 0.75

-tgcaatcttggagcaatcagcaggtaaagggt	CRISPR spacer
gtgccg-cttggtggaatcagcaggtaaagaaa	Protospacer
 *** . ***** * ***************..

227. spacer 2.76|1638833|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NC_003276 (Nostoc sp. PCC 7120 = FACHB-418 plasmid pCC7120alpha, complete sequence) position: , mismatch: 8, identity: 0.75

ctacaattagattctatttctagttatcaaac	CRISPR spacer
atacaattagattctattgctagtcatagtca	Protospacer
 ***************** *****.** .

228. spacer 2.76|1638833|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NC_007410 (Trichormus variabilis ATCC 29413 plasmid A, complete sequence) position: , mismatch: 8, identity: 0.75

ctacaattagattctatttctagttatcaaac	CRISPR spacer
atacaattagattctattgctagtaatagtca	Protospacer
 ***************** ***** ** .

229. spacer 2.76|1638833|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP047243 (Trichormus variabilis 0441 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ctacaattagattctatttctagttatcaaac	CRISPR spacer
atacaattagattctattgctagtaatagtca	Protospacer
 ***************** ***** ** .

230. spacer 2.79|1639016|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to KC170283 (Uncultured bacterium plasmid pDS1, complete sequence) position: , mismatch: 8, identity: 0.75

ctaattttatttgtcatttttgtacctcttta	CRISPR spacer
ccatttttctttgtcatttttgtatctccaac	Protospacer
*.* **** ***************.***.

231. spacer 2.81|1639138|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP053192 (Enterobacter hormaechei strain EGYMCRVIM plasmid pMS-37b, complete sequence) position: , mismatch: 8, identity: 0.75

ttgtctcgatgaatacggtcatattcagtttg	CRISPR spacer
gagtaatgatgaatacggttatattcattttt	Protospacer
  **  .************.******* ***

232. spacer 2.91|1639748|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP042416 (Leuconostoc citreum strain CBA3624 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

ttcaacaagacgctgacaatgccaaactagat	CRISPR spacer
ttgccttaaacgctgccaatgccaaactaaat	Protospacer
**   . *.****** *************.**

233. spacer 2.97|1640114|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR214994 (Mycoplasma hyopneumoniae strain NCTC10127 plasmid 3) position: , mismatch: 8, identity: 0.75

ttttttatcagtcagcccaaacaattcccgat	CRISPR spacer
atatttatcagttagcccaaaaaattaaggag	Protospacer
 * *********.******** ****   **

234. spacer 2.97|1640114|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR214996 (Mycoplasma hyopneumoniae strain NCTC10127 plasmid 5) position: , mismatch: 8, identity: 0.75

ttttttatcagtcagcccaaacaattcccgat	CRISPR spacer
atatttatcagttagcccaaaaaattaaggag	Protospacer
 * *********.******** ****   **

235. spacer 1.4|52285|30|CP029684|CRISPRCasFinder,CRT matches to NZ_CP024309 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3b, complete sequence) position: , mismatch: 9, identity: 0.7

ggactgcgaagacaatcggcaagaaatcac	CRISPR spacer
gctttgcgaagacaatcggcaataagctcg	Protospacer
*  .****************** **...

236. spacer 1.8|52549|30|CP029684|CRISPRCasFinder,CRT matches to MH153812 (Rhodococcus phage Grayson, complete genome) position: , mismatch: 9, identity: 0.7

taataataccagctgcgggaatatttagtt	CRISPR spacer
ccataataccacctgcggtaatattatcga	Protospacer
. ********* ****** ******

237. spacer 1.9|52615|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NC_011961 (Thermomicrobium roseum DSM 5159 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.7

gcgattgatgcgctccacctcgctggtgtt	CRISPR spacer
cccggctatgcgctccacctcgatggtgcc	Protospacer
 * . . *************** *****..

238. spacer 1.9|52615|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015419 (Rhodovulum sulfidophilum DSM 1374 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

gcgattgatgcgctccacctcgctggtgtt	CRISPR spacer
gatgaccatgcgctgcacctcgctggtgcc	Protospacer
*  . . ******* *************..

239. spacer 1.9|52615|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015422 (Rhodovulum sulfidophilum strain SNK001 plasmid, complete sequence) position: , mismatch: 9, identity: 0.7

gcgattgatgcgctccacctcgctggtgtt	CRISPR spacer
gatgaccatgcgctgcacctcgctggtgcc	Protospacer
*  . . ******* *************..

240. spacer 1.9|52615|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020385 (Rhodovulum sp. MB263 plasmid pRSMBA, complete sequence) position: , mismatch: 9, identity: 0.7

gcgattgatgcgctccacctcgctggtgtt	CRISPR spacer
gatgaccatgcgctgcacctcgctggtgcc	Protospacer
*  . . ******* *************..

241. spacer 1.22|53473|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MN694061 (Marine virus AFVG_250M743, complete genome) position: , mismatch: 9, identity: 0.7

ccaactaattgctttattgatattagcaat	CRISPR spacer
atctctaattgcattattgatattagatgg	Protospacer
 .  ******** *************  .

242. spacer 1.22|53473|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MN694511 (Marine virus AFVG_250M1047, complete genome) position: , mismatch: 9, identity: 0.7

ccaactaattgctttattgatattagcaat	CRISPR spacer
atctctaattgcattattgatattagatgg	Protospacer
 .  ******** *************  .

243. spacer 1.22|53473|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP044461 (Acinetobacter indicus strain B18 plasmid pB18-6, complete sequence) position: , mismatch: 9, identity: 0.7

ccaactaattgctttattgatattagcaat	CRISPR spacer
caaactaatggctttattgatatctttttc	Protospacer
* ******* *************.  .  .

244. spacer 1.22|53473|30|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NC_031022 (Shigella phage SHSML-45, complete genome) position: , mismatch: 9, identity: 0.7

ccaactaattgctttattgatattagcaat	CRISPR spacer
gtttgtccttgctgtattgatattagcaac	Protospacer
 .   *  ***** ***************.

245. spacer 1.24|52286|29|CP029684|PILER-CR matches to NZ_CP024309 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3b, complete sequence) position: , mismatch: 9, identity: 0.69

gactgcgaagacaatcggcaagaaatcac	CRISPR spacer
ctttgcgaagacaatcggcaataagctcg	Protospacer
  .****************** **...

246. spacer 1.25|52352|29|CP029684|PILER-CR matches to NZ_CP025798 (Vibrio owensii strain 051011B plasmid unnamed1) position: , mismatch: 9, identity: 0.69

tatcggtgtcttcatcaaagtctggttcg	CRISPR spacer
agcgggtgtcttcatcacagtctggcgta	Protospacer
 .. ************* *******. ..

247. spacer 2.3|1634379|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 9, identity: 0.719

gcaccgagttcgttcgccgtttcgtttatttt	CRISPR spacer
tcaccgaggtcggtcgccgtttcggatgatcc	Protospacer
 ******* *** ***********  *. *..

248. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP026049 (Raoultella planticola strain FDAARGOS_64 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctgacgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

249. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP050860 (Klebsiella pneumoniae strain SCH6109 plasmid pSCH6109-Vir, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctggcgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

250. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctggcgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

251. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP029739 (Klebsiella pneumoniae strain AR_0087 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctggcgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

252. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP037442 (Klebsiella sp. PO552 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctgacgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

253. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP023417 (Klebsiella pneumoniae strain 1050 plasmid pKp1050-1, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctgacgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

254. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to MN543585 (Klebsiella pneumoniae strain GH27TC plasmid pGH27TC_fusion, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctggcgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

255. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP026276 (Klebsiella oxytoca strain KONIH5 plasmid pKOR-ab4d, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctgacgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

256. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to MN543571 (Klebsiella pneumoniae strain GH27 plasmid pGH27_175, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctggcgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

257. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP031563 (Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctggcgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

258. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP035776 (Klebsiella pneumoniae strain R46 plasmid pR46-270, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctggcgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

259. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP031818 (Klebsiella pneumoniae strain INF235-sc-2280127 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctgacgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

260. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP024875 (Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctggcgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

261. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP021958 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctgacgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

262. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP026186 (Klebsiella pneumoniae strain KPNIH49 plasmid pKPN-3967, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctgacgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

263. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP028549 (Klebsiella variicola strain WCHKP19 plasmid p1_020019, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctgacgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

264. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP015026 (Klebsiella pneumoniae strain Kpn223 plasmid pKPN-065, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctggcgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

265. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP030920 (Escherichia coli strain KL53 plasmid pKL53-L, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctggcgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

266. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP008842 (Klebsiella michiganensis strain M1 plasmid pKOXM1A, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctgacgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

267. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP026154 (Klebsiella pneumoniae strain F10(AN) plasmid pF10AN_1, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctggcgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

268. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP017451 (Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctgacgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

269. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP045194 (Klebsiella pneumoniae strain YML0508 plasmid pYML0508_1, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctggcgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

270. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to CP027603 (UNVERIFIED_ORG: Klebsiella pneumoniae strain AR_0080 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctggcgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

271. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP042546 (Klebsiella michiganensis strain C52 plasmid pC52_001, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctgacgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

272. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP046613 (Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-1, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctggcgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

273. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to MN824002 (Klebsiella pneumoniae strain N201205880 plasmid p205880-2FIIK, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctggcgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

274. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP024507 (Klebsiella pneumoniae strain KSB2_1B plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctgacgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

275. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP031809 (Klebsiella pneumoniae strain INF206-sc-2280074 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctggcgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

276. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP050827 (Klebsiella pneumoniae strain Bckp212 plasmid pBckp212-1, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctggcgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

277. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP021697 (Klebsiella pneumoniae strain AR_0158 plasmid tig00000161, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctggcgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

278. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP043934 (Klebsiella pneumoniae strain 555 plasmid pSCKLB555-2, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctggcgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

279. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to MK649826 (Klebsiella pneumoniae strain 130411-38618 plasmid p130411-38618_1, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctggcgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

280. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP014763 (Klebsiella pneumoniae strain KPNIH39 plasmid pKPN-332, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctgacgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

281. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP047634 (Klebsiella pneumoniae strain K2606 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctggcgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

282. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_MK773537 (Klebsiella pneumoniae strain QDE2 plasmid pQDE2-C, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctggcgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

283. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP028952 (Klebsiella aerogenes strain AR_0161 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
ctggcgatttcgtcagcgatattgttaatgtc	Protospacer
.*  .********** ******* *****

284. spacer 2.10|1634807|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP019203 (Salmonella enterica subsp. enterica serovar Infantis strain CFSAN003307 plasmid pCFSAN003307, complete sequence) position: , mismatch: 9, identity: 0.719

ttttaagtatgccagcaggaacattggagcga	CRISPR spacer
gatgcgttttgccagcaggaacaatgcagcga	Protospacer
  *  . * ************** ** *****

285. spacer 2.10|1634807|32|CP029684|CRISPRCasFinder,CRT matches to NZ_LN868945 (Salmonella enterica subsp. enterica serovar Senftenberg strain NCTC10384 plasmid 3, complete sequence) position: , mismatch: 9, identity: 0.719

ttttaagtatgccagcaggaacattggagcga	CRISPR spacer
gatgcgttttgccagcaggaacaatgcagcga	Protospacer
  *  . * ************** ** *****

286. spacer 2.10|1634807|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP022659 (Salmonella enterica subsp. enterica strain RM11060 plasmid pRM11060-1, complete sequence) position: , mismatch: 9, identity: 0.719

ttttaagtatgccagcaggaacattggagcga	CRISPR spacer
gatgcgttttgccagcaggaacaatgcagcga	Protospacer
  *  . * ************** ** *****

287. spacer 2.15|1635112|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP045225 (Clostridioides difficile strain TW11 plasmid p_TW11, complete sequence) position: , mismatch: 9, identity: 0.719

ccgctgat--ttaccagatgatctaagtgataaa	CRISPR spacer
--ataaatcattatcagatgatataagtgataat	Protospacer
  .. .**  ***.******** **********

288. spacer 2.16|1635173|32|CP029684|CRISPRCasFinder,CRT matches to MN693563 (Marine virus AFVG_25M273, complete genome) position: , mismatch: 9, identity: 0.719

acaacgttgatgaaaaatacgttgattggact	CRISPR spacer
aagacgttgatgttaaatacgttgataataga	Protospacer
* .*********  ************ . *

289. spacer 2.16|1635173|32|CP029684|CRISPRCasFinder,CRT matches to MN693168 (Marine virus AFVG_25M530, complete genome) position: , mismatch: 9, identity: 0.719

acaacgttgatgaaaaatacgttgattggact	CRISPR spacer
aagacgttgatgttaaatacgttgataataga	Protospacer
* .*********  ************ . *

290. spacer 2.16|1635173|32|CP029684|CRISPRCasFinder,CRT matches to MN693137 (Marine virus AFVG_25M529, complete genome) position: , mismatch: 9, identity: 0.719

acaacgttgatgaaaaatacgttgattggact	CRISPR spacer
aagacgttgatgttaaatacgttgataataga	Protospacer
* .*********  ************ . *

291. spacer 2.16|1635173|32|CP029684|CRISPRCasFinder,CRT matches to MN693236 (Marine virus AFVG_25M528, complete genome) position: , mismatch: 9, identity: 0.719

acaacgttgatgaaaaatacgttgattggact	CRISPR spacer
aagacgttgatgttaaatacgttgataataga	Protospacer
* .*********  ************ . *

292. spacer 2.16|1635173|32|CP029684|CRISPRCasFinder,CRT matches to MN693091 (Marine virus AFVG_25M527, complete genome) position: , mismatch: 9, identity: 0.719

acaacgttgatgaaaaatacgttgattggact	CRISPR spacer
aagacgttgatgttaaatacgttgataataga	Protospacer
* .*********  ************ . *

293. spacer 2.16|1635173|32|CP029684|CRISPRCasFinder,CRT matches to MN693526 (Marine virus AFVG_25M251, complete genome) position: , mismatch: 9, identity: 0.719

acaacgttgatgaaaaatacgttgattggact	CRISPR spacer
aagacgttgatgttaaatacgttgataataga	Protospacer
* .*********  ************ . *

294. spacer 2.16|1635173|32|CP029684|CRISPRCasFinder,CRT matches to MN693529 (Marine virus AFVG_25M294, complete genome) position: , mismatch: 9, identity: 0.719

acaacgttgatgaaaaatacgttgattggact	CRISPR spacer
aagacgttgatgttaaatacgttgataataga	Protospacer
* .*********  ************ . *

295. spacer 2.22|1635539|32|CP029684|CRISPRCasFinder,CRT matches to MN855637 (Bacteriophage sp. isolate 32, complete genome) position: , mismatch: 9, identity: 0.719

ttccatcagatgaagttttgccgttctaagcg	CRISPR spacer
atatcaaagatgaagatttgcctttctaagag	Protospacer
 * .   ******** ****** ******* *

296. spacer 2.27|1635844|32|CP029684|CRISPRCasFinder,CRT matches to MF595878 (Caldibacillus phage CBP1, complete genome) position: , mismatch: 9, identity: 0.719

atttcggcaatattttcaattcatgaattttc	CRISPR spacer
cattcggcaatatttccacttcatgccttcct	Protospacer
  *************.** ******  **...

297. spacer 2.35|1636332|32|CP029684|CRISPRCasFinder,CRT matches to MN693652 (Marine virus AFVG_250M189, complete genome) position: , mismatch: 9, identity: 0.719

cttttcctgccgtttctgccattgcttgctcc	CRISPR spacer
ctttacctgctgtttctgccatttgcatttca	Protospacer
**** *****.************  .  .**

298. spacer 2.35|1636332|32|CP029684|CRISPRCasFinder,CRT matches to MN304815 (Burkholderiales phage 68_11, complete genome) position: , mismatch: 9, identity: 0.719

cttttcctgccgtttctgccattgcttgctcc	CRISPR spacer
ccgttcgtgccgttgctgccattgctgccgtt	Protospacer
*. *** ******* ***********  * ..

299. spacer 2.43|1636820|32|CP029684|CRISPRCasFinder,CRT matches to NC_018501 (Bacillus thuringiensis HD-771 plasmid p02, complete sequence) position: , mismatch: 9, identity: 0.719

attaaaacgtaaatataacattctaaaagcag	CRISPR spacer
attaatacgcaaatataacattccattcttaa	Protospacer
***** ***.*************.*    .*.

300. spacer 2.46|1637003|32|CP029684|CRISPRCasFinder,CRT matches to NC_049501 (Salmonella phage allotria, complete genome) position: , mismatch: 9, identity: 0.719

gatccgttgcatgattcttatgcagctgcctt	CRISPR spacer
agaccgttgcatgaatgttatgcagctggaga	Protospacer
.. *********** * ***********

301. spacer 2.46|1637003|32|CP029684|CRISPRCasFinder,CRT matches to JN126049 (Salmonella phage PhiSH19, complete genome) position: , mismatch: 9, identity: 0.719

gatccgttgcatgattcttatgcagctgcctt	CRISPR spacer
agaccgttgcatgaatgttatgcagctggaga	Protospacer
.. *********** * ***********

302. spacer 2.46|1637003|32|CP029684|CRISPRCasFinder,CRT matches to MT074474 (Salmonella phage aagejoakim, complete genome) position: , mismatch: 9, identity: 0.719

gatccgttgcatgattcttatgcagctgcctt	CRISPR spacer
agaccgttgcatgaatgttatgcagctggaga	Protospacer
.. *********** * ***********

303. spacer 2.46|1637003|32|CP029684|CRISPRCasFinder,CRT matches to NC_049508 (Salmonella phage maane, complete genome) position: , mismatch: 9, identity: 0.719

gatccgttgcatgattcttatgcagctgcctt	CRISPR spacer
agaccgttgcatgaatgttatgcagctggaga	Protospacer
.. *********** * ***********

304. spacer 2.54|1637491|32|CP029684|CRISPRCasFinder,CRT matches to NZ_LR134418 (Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 9) position: , mismatch: 9, identity: 0.719

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
cgacatcaagaatttttgcgccagattgtaaa	Protospacer
 .* **.** *****************  . *

305. spacer 2.67|1638284|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR134418 (Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 9) position: , mismatch: 9, identity: 0.719

aaaaattaataatttttgcgccagattcagca	CRISPR spacer
cgacatcaagaatttttgcgccagattgtaaa	Protospacer
 .* **.** *****************  . *

306. spacer 2.70|1638467|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MH674341 (Escherichia coli strain EC07 plasmid pUR-EC07, complete sequence) position: , mismatch: 9, identity: 0.719

ggttacttcaaggaacagcttttgtgctgcta	CRISPR spacer
atcaacttccaggatcagcttttgtgcgggca	Protospacer
. . ***** **** ************ * .*

307. spacer 2.76|1638833|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP046399 (Bacillus sp. A260 plasmid unnamed11, complete sequence) position: , mismatch: 9, identity: 0.719

ctacaattagattctatttctagttatcaaac	CRISPR spacer
taaaaattatattctatttctaattataagga	Protospacer
. * ***** ************.**** *..

308. spacer 2.76|1638833|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP031066 (Bacillus sp. SH8-8 plasmid pl193, complete sequence) position: , mismatch: 9, identity: 0.719

ctacaattagattctatttctagttatcaaac	CRISPR spacer
taaaaattatattctatttctaattataagga	Protospacer
. * ***** ************.**** *..

309. spacer 2.76|1638833|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP031063 (Bacillus sp. AR4-2 plasmid pl192, complete sequence) position: , mismatch: 9, identity: 0.719

ctacaattagattctatttctagttatcaaac	CRISPR spacer
taaaaattatattctatttctaattataagga	Protospacer
. * ***** ************.**** *..

310. spacer 2.79|1639016|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to AP013360 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G1, isolate: uvMED-CGR-U-MedDCM-OCT-S40-C16) position: , mismatch: 9, identity: 0.719

ctaattttatttgtcatttttgtacctcttta	CRISPR spacer
ggaattttatttgtccttcttgtacttttggc	Protospacer
  ************* **.******.*.*

311. spacer 2.79|1639016|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NC_049398 (Lactococcus phage 16802, complete genome) position: , mismatch: 9, identity: 0.719

ctaattttatttgtcatttttgtacctcttta	CRISPR spacer
aagtttttaattgtcatttttttacctttctt	Protospacer
  . ***** *********** *****.*.*

312. spacer 2.79|1639016|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NC_049483 (Lactococcus phage CHPC52, complete genome) position: , mismatch: 9, identity: 0.719

ctaattttatttgtcatttttgtacctcttta	CRISPR spacer
aagtttttaattgtcatttttttacctttctt	Protospacer
  . ***** *********** *****.*.*

313. spacer 2.81|1639138|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP041067 (Bacillus megaterium strain KNU-01 plasmid pKNU_01_3, complete sequence) position: , mismatch: 9, identity: 0.719

ttgtctcgatgaatacggtcatattcagtttg	CRISPR spacer
atcaataaatgaatactgtcattttcagttta	Protospacer
 *   * .******** ***** ********.

314. spacer 2.85|1639382|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028348 (Novosphingobium sp. THN1 plasmid pTHN, complete sequence) position: , mismatch: 9, identity: 0.719

tcagcccagttcgtcgaaatgaactgcgaaat	CRISPR spacer
agcggccaattcgtcgaagtgaactgcgccac	Protospacer
   * ***.*********.*********  *.

315. spacer 2.89|1639626|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MN692970 (Marine virus AFVG_117M24, complete genome) position: , mismatch: 9, identity: 0.719

tttctagttctgataactaagtcagaattacc	CRISPR spacer
atttctattatgacaactaagtcagaattaaa	Protospacer
 **.. .** ***.****************

316. spacer 2.96|1640053|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NC_014633 (Ilyobacter polytropus DSM 2926 plasmid pILYOP01, complete sequence) position: , mismatch: 9, identity: 0.719

agccctattttatcttttccccgtcaatatat	CRISPR spacer
acaggatttttatcttatcccggtcaatattt	Protospacer
*      ********* **** ******** *

317. spacer 2.103|1634255|32|CP029684|CRT matches to MN693637 (Marine virus AFVG_250M988, complete genome) position: , mismatch: 9, identity: 0.719

cttataaccaatgacaaagaaagcaatgttat	CRISPR spacer
aaaatacccaatgacaaagaaatcaatcattg	Protospacer
   *** *************** ****  *

318. spacer 2.103|1634255|32|CP029684|CRT matches to MN856091 (Myoviridae sp. isolate 9, partial genome) position: , mismatch: 9, identity: 0.719

cttataaccaatgacaaagaaagcaatgttat	CRISPR spacer
ggagaaactaatgaccaagaaagcaatgcaat	Protospacer
   . ***.****** ************. **

319. spacer 1.5|52351|30|CP029684|CRISPRCasFinder,CRT matches to NZ_CP025798 (Vibrio owensii strain 051011B plasmid unnamed1) position: , mismatch: 10, identity: 0.667

gtatcggtgtcttcatcaaagtctggttcg	CRISPR spacer
aagcgggtgtcttcatcacagtctggcgta	Protospacer
. .. ************* *******. ..

320. spacer 2.1|1634255|34|CP029684|CRISPRCasFinder matches to MN693637 (Marine virus AFVG_250M988, complete genome) position: , mismatch: 10, identity: 0.706

cttataaccaatgacaaagaaagcaatgttatag	CRISPR spacer
aaaatacccaatgacaaagaaatcaatcattgat	Protospacer
   *** *************** ****  *  *

321. spacer 2.4|1634440|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP028980 (Lactobacillus plantarum strain LQ80 plasmid pLQ803, complete sequence) position: , mismatch: 10, identity: 0.688

tttttgatttcgtcatcgatatttttaattgg	CRISPR spacer
aacaatattccgtcttcgatatttttaatcgt	Protospacer
  .   ***.**** **************.*

322. spacer 2.16|1635173|32|CP029684|CRISPRCasFinder,CRT matches to NZ_LN907829 (Erwinia gerundensis isolate E_g_EM595 plasmid pEM02, complete sequence) position: , mismatch: 10, identity: 0.688

acaacgttgatgaaaaatacgttgattggact	CRISPR spacer
taaccgttgacgaaaaacacgttgattttcaa	Protospacer
  * ******.******.*********

323. spacer 2.19|1635356|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP017589 (Pantoea stewartii subsp. stewartii DC283 plasmid pDSJ08, complete sequence) position: , mismatch: 10, identity: 0.688

ctctttttgcgcttgcggttgaccctcccacc	CRISPR spacer
ctctttttgcgcctgccgttgacggacaacgg	Protospacer
************.*** ******   *

324. spacer 2.27|1635844|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP031953 (Phaeobacter inhibens strain 2.10 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

atttcggcaatattttcaattcatgaattttc	CRISPR spacer
atttccgcaatattttcaatccagcgcggctg	Protospacer
***** **************.**  .   .*

325. spacer 2.27|1635844|32|CP029684|CRISPRCasFinder,CRT matches to NC_018421 (Phaeobacter inhibens 2.10 plasmid pPGA2_239, complete sequence) position: , mismatch: 10, identity: 0.688

atttcggcaatattttcaattcatgaattttc	CRISPR spacer
atttccgcaatattttcaatccagcgcggctg	Protospacer
***** **************.**  .   .*

326. spacer 2.27|1635844|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP019308 (Phaeobacter inhibens strain DOK1-1 plasmid pDOK1-1-1, complete sequence) position: , mismatch: 10, identity: 0.688

atttcggcaatattttcaattcatgaattttc	CRISPR spacer
atttccgcaatattttcaatccagcgcggctg	Protospacer
***** **************.**  .   .*

327. spacer 2.29|1635966|32|CP029684|CRISPRCasFinder,CRT matches to AP018932 (Escherichia phage KIT03 DNA, complete sequence) position: , mismatch: 10, identity: 0.688

aagaaagcctaaccgaaaaataccaaaattat	CRISPR spacer
atttccgcctaatcgaataataccaaaatctg	Protospacer
*     ******.**** ***********.

328. spacer 2.42|1636759|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP044185 (Salmonella enterica subsp. enterica strain AR-0403 plasmid pAR-0403) position: , mismatch: 10, identity: 0.688

catcatcaggatcttcccgttcaattttggtt	CRISPR spacer
tatcatcagtatcttccccttcaaaatcttcc	Protospacer
.******** ******** *****  *.  ..

329. spacer 2.42|1636759|32|CP029684|CRISPRCasFinder,CRT matches to KT264818 (Gokushovirus WZ-2015a isolate 70Chd477, complete genome) position: , mismatch: 10, identity: 0.688

catcatcaggatcttcccgttcaattttggtt	CRISPR spacer
tatcatcagggtcttcctgttcaaaacagaaa	Protospacer
.*********.******.******  . *.

330. spacer 2.42|1636759|32|CP029684|CRISPRCasFinder,CRT matches to KX513874 (Human gut gokushovirus isolate SH-CHD11, complete genome) position: , mismatch: 10, identity: 0.688

catcatcaggatcttcccgttcaattttggtt	CRISPR spacer
aatcatcagggtcttcctgttcaaaacagaag	Protospacer
 *********.******.******  . *.

331. spacer 2.46|1637003|32|CP029684|CRISPRCasFinder,CRT matches to MT074478 (Salmonella phage moki, complete genome) position: , mismatch: 10, identity: 0.688

gatccgttgcatgattcttatgcagctgcctt	CRISPR spacer
agatcgttgcatgaatgttatgcagctggaga	Protospacer
.. .********** * ***********

332. spacer 2.46|1637003|32|CP029684|CRISPRCasFinder,CRT matches to NC_029042 (Salmonella phage 38, complete genome) position: , mismatch: 10, identity: 0.688

gatccgttgcatgattcttatgcagctgcctt	CRISPR spacer
agatcgttgcatgaatgttatgcagctggaga	Protospacer
.. .********** * ***********

333. spacer 2.57|1637674|32|CP029684|CRISPRCasFinder,CRT matches to AP013538 (Uncultured phage_MedDCM-OCT-S45-C4 DNA, complete genome, group G7, isolate: uvMED-CGR-U-MedDCM-OCT-S45-C4) position: , mismatch: 10, identity: 0.688

atcgtgttaatgaagccttatcagaagttaca	CRISPR spacer
ctgtcaagaatgaacccttatcagaaattact	Protospacer
 *  ..  ****** ***********.****

334. spacer 2.57|1637674|32|CP029684|CRISPRCasFinder,CRT matches to NC_030920 (Bacillus phage Eldridge, complete genome) position: , mismatch: 10, identity: 0.688

atcgtgttaatgaagccttatcagaagttaca	CRISPR spacer
gggaagaggatgaatccttatcagatgttaca	Protospacer
.  . *  .***** ********** ******

335. spacer 2.70|1638467|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029127 (Klebsiella oxytoca strain AR380 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

ggttacttcaaggaacagcttttgtgctgcta	CRISPR spacer
atcaacttccaggatcagcttttgtgccagtg	Protospacer
. . ***** **** ************.. *.

336. spacer 2.76|1638833|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018742 (Bacillus cereus strain FORC_047 plasmid pFORC47_2, complete sequence) position: , mismatch: 10, identity: 0.688

ctacaattagattctatttctagttatcaaac	CRISPR spacer
taaaaattatattctatttctaattataggga	Protospacer
. * ***** ************.**** ...

337. spacer 2.77|1638894|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MG948468 (Pantoea phage vB_PagS_Vid5, complete genome) position: , mismatch: 10, identity: 0.688

tcccatggggaataaatctgaaaagtgttgct	CRISPR spacer
caggctgggaaataaatctaaaaagtgtttgc	Protospacer
.    ****.*********.*********  .

338. spacer 2.79|1639016|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NC_014628 (Paenibacillus polymyxa SC2 plasmid pSC2, complete sequence) position: , mismatch: 10, identity: 0.688

ctaattttatttgtcatttttgtacctcttta	CRISPR spacer
tctggtttatctgtcatttttgttcctcctcg	Protospacer
.. . *****.************ ****.*..

339. spacer 2.79|1639016|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to CP040041 (Acinetobacter baumannii strain VB958 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

ctaattttatttgtcatttttgtacctcttta	CRISPR spacer
attattttatttgtcagttttttaccatggct	Protospacer
 * ************* **** **** .  .

340. spacer 2.81|1639138|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP022377 (Providencia stuartii strain BML2537 plasmid pBML2537, complete sequence) position: , mismatch: 10, identity: 0.688

ttgtctcgatgaatacggtcatattcagtttg	CRISPR spacer
gataaataatgaatacggttatattcattttg	Protospacer
      ..***********.******* ****

341. spacer 2.81|1639138|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018877 (Bacillus megaterium strain JX285 plasmid 4, complete sequence) position: , mismatch: 10, identity: 0.688

ttgtctcgatgaatacggtcatattcagtttg	CRISPR spacer
tccataagaggaatacggtaatattcagttat	Protospacer
*.  .  ** ********* **********

342. spacer 2.90|1639687|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP040783 (Bacillus thuringiensis strain HM-311 plasmid p1, complete sequence) position: , mismatch: 10, identity: 0.688

gaacggttaaattaacacttaatggagtagta	CRISPR spacer
acggggataaattaatacttaatggagtgaag	Protospacer
. . ** ********.************.. .

343. spacer 2.90|1639687|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NC_020394 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-233, complete sequence) position: , mismatch: 10, identity: 0.688

gaacggttaaattaacacttaatggagtagta	CRISPR spacer
acggggataaattaatacttaatggagtgaag	Protospacer
. . ** ********.************.. .

344. spacer 2.90|1639687|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP014283 (Bacillus thuringiensis strain Bt185 plasmid pBT1850636, complete sequence) position: , mismatch: 10, identity: 0.688

gaacggttaaattaacacttaatggagtagta	CRISPR spacer
acggggataaattaatacttaatggagtgaag	Protospacer
. . ** ********.************.. .

345. spacer 2.90|1639687|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP016596 (Bacillus cereus strain K8 plasmid pBCM301, complete sequence) position: , mismatch: 10, identity: 0.688

gaacggttaaattaacacttaatggagtagta	CRISPR spacer
acggggataaattaatacttaatggagtgaag	Protospacer
. . ** ********.************.. .

346. spacer 2.90|1639687|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP010112 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-6, complete sequence) position: , mismatch: 10, identity: 0.688

gaacggttaaattaacacttaatggagtagta	CRISPR spacer
acggggataaattaatacttaatggagtgaag	Protospacer
. . ** ********.************.. .

347. spacer 2.90|1639687|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP007513 (Bacillus bombysepticus plasmid pBb, complete genome) position: , mismatch: 10, identity: 0.688

gaacggttaaattaacacttaatggagtagta	CRISPR spacer
acggggataaattaatacttaatggagtgaag	Protospacer
. . ** ********.************.. .

348. spacer 2.90|1639687|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP014865 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK1, complete sequence) position: , mismatch: 10, identity: 0.688

gaacggttaaattaacacttaatggagtagta	CRISPR spacer
acggggataaattaatacttaatggagtgaag	Protospacer
. . ** ********.************.. .

349. spacer 2.90|1639687|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP053952 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

gaacggttaaattaacacttaatggagtagta	CRISPR spacer
acggggataaattaatacttaatggagtgaag	Protospacer
. . ** ********.************.. .

350. spacer 2.90|1639687|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to CP046512 (Bacillus cereus strain JHU plasmid p1, complete sequence) position: , mismatch: 10, identity: 0.688

gaacggttaaattaacacttaatggagtagta	CRISPR spacer
acggggataaattaatacttaatggagtgaag	Protospacer
. . ** ********.************.. .

351. spacer 2.90|1639687|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP042875 (Bacillus cereus strain 09 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

gaacggttaaattaacacttaatggagtagta	CRISPR spacer
acggggataaattaatacttaatggagtgaag	Protospacer
. . ** ********.************.. .

352. spacer 2.90|1639687|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 10, identity: 0.688

gaacggttaaattaacacttaatggagtagta	CRISPR spacer
acggggataaattaatacttaatggagtgaag	Protospacer
. . ** ********.************.. .

353. spacer 2.90|1639687|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 10, identity: 0.688

gaacggttaaattaacacttaatggagtagta	CRISPR spacer
acggggataaattaatacttaatggagtgaag	Protospacer
. . ** ********.************.. .

354. spacer 2.90|1639687|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP045607 (Bacillus cereus strain SB1 plasmid p1, complete sequence) position: , mismatch: 10, identity: 0.688

gaacggttaaattaacacttaatggagtagta	CRISPR spacer
acggggataaattaatacttaatggagtgaag	Protospacer
. . ** ********.************.. .

355. spacer 2.90|1639687|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to CP020755 (Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence) position: , mismatch: 10, identity: 0.688

gaacggttaaattaacacttaatggagtagta	CRISPR spacer
acggggataaattaatacttaatggagtgaag	Protospacer
. . ** ********.************.. .

356. spacer 2.90|1639687|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015730 (Bacillus cereus strain A1 plasmid pBCA1, complete sequence) position: , mismatch: 10, identity: 0.688

gaacggttaaattaacacttaatggagtagta	CRISPR spacer
acggggataaattaatacttaatggagtgaag	Protospacer
. . ** ********.************.. .

357. spacer 2.90|1639687|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP050184 (Bacillus thuringiensis strain HER1410 plasmid pLUSID1, complete sequence) position: , mismatch: 10, identity: 0.688

gaacggttaaattaacacttaatggagtagta	CRISPR spacer
acggggataaattaatacttaatggagtgaag	Protospacer
. . ** ********.************.. .

358. spacer 2.90|1639687|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP010090 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence) position: , mismatch: 10, identity: 0.688

gaacggttaaattaacacttaatggagtagta	CRISPR spacer
acggggataaattaatacttaatggagtgaag	Protospacer
. . ** ********.************.. .

359. spacer 2.90|1639687|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021062 (Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence) position: , mismatch: 10, identity: 0.688

gaacggttaaattaacacttaatggagtagta	CRISPR spacer
acggggataaattaatacttaatggagtgaag	Protospacer
. . ** ********.************.. .

360. spacer 2.90|1639687|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP053949 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

gaacggttaaattaacacttaatggagtagta	CRISPR spacer
acggggataaattaatacttaatggagtgaag	Protospacer
. . ** ********.************.. .

361. spacer 2.91|1639748|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028945 (Vibrio sp. dhg plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

ttcaacaagacgctgacaatgccaaactagat	CRISPR spacer
cagatttagactctgacagtgccaaactagca	Protospacer
.  * . **** ******.***********

362. spacer 2.99|1640236|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MT840189 (Bacteriophage sp. Joined_contig_348 genomic sequence) position: , mismatch: 10, identity: 0.688

ttgatttgctgcaatggcttgtgttggcttag	CRISPR spacer
acatactgctgcagtggcttttgttggcttgc	Protospacer
 ..  .*******.****** *********.

363. spacer 2.103|1634255|32|CP029684|CRT matches to MN035922 (Leviviridae sp. isolate H1_Bulk_30_scaffold_182 RNA-dependent RNA polymerase (H1Bulk30182_000001), hypothetical protein (H1Bulk30182_000002), and hypothetical protein (H1Bulk30182_000003) genes, complete cds) position: , mismatch: 10, identity: 0.688

cttataaccaatgacaaagaaagcaatgttat	CRISPR spacer
attataatcattgacaaagaaagcgtcaatgc	Protospacer
 ******.** *************. .. *..

364. spacer 2.22|1635539|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP046704 (Nostoc sp. ATCC 53789 plasmid pNsp_a, complete sequence) position: , mismatch: 11, identity: 0.656

ttccatcagatgaagttttgccgttctaagcg	CRISPR spacer
ccagcacaaattaagttttgccgttctaaata	Protospacer
..    **.** *****************...

365. spacer 2.35|1636332|32|CP029684|CRISPRCasFinder,CRT matches to NZ_KY940428 (UNVERIFIED: Bacillus sp. (in: Bacteria) strain PUMK-07 plasmid pMK-07, complete sequence) position: , mismatch: 11, identity: 0.656

cttttcctgccgtttctgccattgcttgctcc	CRISPR spacer
cttttcctgccatttttgccattttcccgctt	Protospacer
***********.***.******* ...  ...

366. spacer 2.35|1636332|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.656

cttttcctgccgtttctgccattgcttgctcc	CRISPR spacer
cttttcctgccatttttgccattttcccactt	Protospacer
***********.***.******* ...  ...

367. spacer 2.35|1636332|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP047086 (Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence) position: , mismatch: 11, identity: 0.656

cttttcctgccgtttctgccattgcttgctcc	CRISPR spacer
cttttcctgccatttttgccattttcccgctt	Protospacer
***********.***.******* ...  ...

368. spacer 2.35|1636332|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP041978 (Bacillus pacificus strain NCCP 15909 plasmid unnamed1, complete sequence) position: , mismatch: 11, identity: 0.656

cttttcctgccgtttctgccattgcttgctcc	CRISPR spacer
cttttcctgccatttttgccattttcccgctt	Protospacer
***********.***.******* ...  ...

369. spacer 2.35|1636332|32|CP029684|CRISPRCasFinder,CRT matches to NC_011655 (Bacillus cereus AH187 plasmid pAH187_270, complete sequence) position: , mismatch: 11, identity: 0.656

cttttcctgccgtttctgccattgcttgctcc	CRISPR spacer
cttttcctgccatttttgccattttcccgctt	Protospacer
***********.***.******* ...  ...

370. spacer 2.35|1636332|32|CP029684|CRISPRCasFinder,CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 11, identity: 0.656

cttttcctgccgtttctgccattgcttgctcc	CRISPR spacer
cttttcctgccatttttgccattttcccgctt	Protospacer
***********.***.******* ...  ...

371. spacer 2.35|1636332|32|CP029684|CRISPRCasFinder,CRT matches to NC_010924 (Bacillus cereus strain AH187 plasmid pCER270, complete sequence) position: , mismatch: 11, identity: 0.656

cttttcctgccgtttctgccattgcttgctcc	CRISPR spacer
cttttcctgccatttttgccattttcccgctt	Protospacer
***********.***.******* ...  ...

372. spacer 2.35|1636332|32|CP029684|CRISPRCasFinder,CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 11, identity: 0.656

cttttcctgccgtttctgccattgcttgctcc	CRISPR spacer
cttttcctgccatttttgccattttcccgctt	Protospacer
***********.***.******* ...  ...

373. spacer 2.35|1636332|32|CP029684|CRISPRCasFinder,CRT matches to CP045776 (Bacillus paranthracis strain CFSAN068816 plasmid p1CFSAN068816, complete sequence) position: , mismatch: 11, identity: 0.656

cttttcctgccgtttctgccattgcttgctcc	CRISPR spacer
cttttcctgccatttttgccattttcccgctt	Protospacer
***********.***.******* ...  ...

374. spacer 2.35|1636332|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 11, identity: 0.656

cttttcctgccgtttctgccattgcttgctcc	CRISPR spacer
cttttcctgccatttttgccattttcccgctt	Protospacer
***********.***.******* ...  ...

375. spacer 2.35|1636332|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP042928 (Bacillus cereus strain G1-1 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.656

cttttcctgccgtttctgccattgcttgctcc	CRISPR spacer
cttttcctgccatttttgccattttcccgctt	Protospacer
***********.***.******* ...  ...

376. spacer 2.35|1636332|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP022346 (Bacillus thuringiensis strain c25 plasmid unnamed1, complete sequence) position: , mismatch: 11, identity: 0.656

cttttcctgccgtttctgccattgcttgctcc	CRISPR spacer
cttttcctgccatttttgccattttcccactt	Protospacer
***********.***.******* ...  ...

377. spacer 2.35|1636332|32|CP029684|CRISPRCasFinder,CRT matches to CP041980 (Bacillus paranthracis strain NCCP 15910 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.656

cttttcctgccgtttctgccattgcttgctcc	CRISPR spacer
cttttcctgccatttttgccattttcccgctt	Protospacer
***********.***.******* ...  ...

378. spacer 2.35|1636332|32|CP029684|CRISPRCasFinder,CRT matches to NC_016792 (Bacillus cereus NC7401 plasmid pNCcld, complete sequence) position: , mismatch: 11, identity: 0.656

cttttcctgccgtttctgccattgcttgctcc	CRISPR spacer
cttttcctgccatttttgccattttcccgctt	Protospacer
***********.***.******* ...  ...

379. spacer 2.35|1636332|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP040343 (Bacillus cereus strain DLOU-Weihai plasmid unnamed1, complete sequence) position: , mismatch: 11, identity: 0.656

cttttcctgccgtttctgccattgcttgctcc	CRISPR spacer
cttttcctgccatttttgccattttcccgctt	Protospacer
***********.***.******* ...  ...

380. spacer 2.35|1636332|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP040341 (Bacillus cereus strain DLOU-Tangshan plasmid unnamed1, complete sequence) position: , mismatch: 11, identity: 0.656

cttttcctgccgtttctgccattgcttgctcc	CRISPR spacer
cttttcctgccatttttgccattttcccgctt	Protospacer
***********.***.******* ...  ...

381. spacer 2.35|1636332|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.656

cttttcctgccgtttctgccattgcttgctcc	CRISPR spacer
cttttcctgccatttttgccattttcccgctt	Protospacer
***********.***.******* ...  ...

382. spacer 2.35|1636332|32|CP029684|CRISPRCasFinder,CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 11, identity: 0.656

cttttcctgccgtttctgccattgcttgctcc	CRISPR spacer
cttttcctgccatttttgccattttcccgctt	Protospacer
***********.***.******* ...  ...

383. spacer 2.70|1638467|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KU130396 (Escherichia coli strain S68 plasmid pS68, complete sequence) position: , mismatch: 11, identity: 0.656

ggttacttcaaggaacagcttttgtgctgcta	CRISPR spacer
atcaacttccaggatcagcttttgtgccagcg	Protospacer
. . ***** **** ************.. ..

384. spacer 2.70|1638467|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019561 (Escherichia coli strain KSC1031 plasmid pMRGN1031, complete sequence) position: , mismatch: 11, identity: 0.656

ggttacttcaaggaacagcttttgtgctgcta	CRISPR spacer
atcaacttccaggatcagcttttgtgccagcg	Protospacer
. . ***** **** ************.. ..

385. spacer 2.70|1638467|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020547 (Escherichia coli strain ZJ3920 plasmid pZJ3920-2, complete sequence) position: , mismatch: 11, identity: 0.656

ggttacttcaaggaacagcttttgtgctgcta	CRISPR spacer
atcaacttccaggatcagcttttgtgccagcg	Protospacer
. . ***** **** ************.. ..

386. spacer 2.70|1638467|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021845 (Escherichia coli strain EC1515 plasmid pEC1515-1, complete sequence) position: , mismatch: 11, identity: 0.656

ggttacttcaaggaacagcttttgtgctgcta	CRISPR spacer
atcaacttccaggatcagcttttgtgccagcg	Protospacer
. . ***** **** ************.. ..

387. spacer 2.70|1638467|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP026237 (Citrobacter freundii complex sp. CFNIH3 plasmid pCFR-9161, complete sequence) position: , mismatch: 11, identity: 0.656

ggttacttcaaggaacagcttttgtgctgcta	CRISPR spacer
atcaacttccaggatcagcttttgtgccagcg	Protospacer
. . ***** **** ************.. ..

388. spacer 2.70|1638467|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP054369 (Escherichia coli strain SCU-115 plasmid pSCU-115-1, complete sequence) position: , mismatch: 11, identity: 0.656

ggttacttcaaggaacagcttttgtgctgcta	CRISPR spacer
atcaacttccaggatcagcttttgtgccagcg	Protospacer
. . ***** **** ************.. ..

389. spacer 2.70|1638467|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024244 (Escherichia coli O128:H27 strain 90-9281 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.656

ggttacttcaaggaacagcttttgtgctgcta	CRISPR spacer
atcaacttccaggatcagcttttgtgccagcg	Protospacer
. . ***** **** ************.. ..

390. spacer 2.70|1638467|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MN915010 (Escherichia coli strain TJ-33 plasmid pNDM-TJ33, complete sequence) position: , mismatch: 11, identity: 0.656

ggttacttcaaggaacagcttttgtgctgcta	CRISPR spacer
atcaacttccaggatcagcttttgtgccagcg	Protospacer
. . ***** **** ************.. ..

391. spacer 2.70|1638467|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MN915012 (Escherichia coli strain GD-33 plasmid pNDM33-2, complete sequence) position: , mismatch: 11, identity: 0.656

ggttacttcaaggaacagcttttgtgctgcta	CRISPR spacer
atcaacttccaggatcagcttttgtgccagcg	Protospacer
. . ***** **** ************.. ..

392. spacer 2.70|1638467|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MN915013 (Escherichia coli strain TD-33 plasmid pNDM-TD33, complete sequence) position: , mismatch: 11, identity: 0.656

ggttacttcaaggaacagcttttgtgctgcta	CRISPR spacer
atcaacttccaggatcagcttttgtgccagcg	Protospacer
. . ***** **** ************.. ..

393. spacer 2.70|1638467|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021841 (Escherichia coli strain EC974 plasmid pEC974-1, complete sequence) position: , mismatch: 11, identity: 0.656

ggttacttcaaggaacagcttttgtgctgcta	CRISPR spacer
atcaacttccaggatcagcttttgtgccagcg	Protospacer
. . ***** **** ************.. ..

394. spacer 2.70|1638467|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to CP034251 (Salmonella enterica subsp. enterica serovar Derby strain Sa64 plasmid pSa64T-188, complete sequence) position: , mismatch: 11, identity: 0.656

ggttacttcaaggaacagcttttgtgctgcta	CRISPR spacer
atcaacttccaggatcagcttttgtgccagcg	Protospacer
. . ***** **** ************.. ..

395. spacer 2.70|1638467|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to CP034252 (Salmonella enterica subsp. enterica serovar Derby strain Sa64 plasmid pSa64-96, complete sequence) position: , mismatch: 11, identity: 0.656

ggttacttcaaggaacagcttttgtgctgcta	CRISPR spacer
atcaacttccaggatcagcttttgtgccagcg	Protospacer
. . ***** **** ************.. ..

396. spacer 2.70|1638467|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP041303 (Escherichia coli strain MSHS 133 plasmid pCys-11, complete sequence) position: , mismatch: 11, identity: 0.656

ggttacttcaaggaacagcttttgtgctgcta	CRISPR spacer
atcaacttccaggatcagcttttgtgccagcg	Protospacer
. . ***** **** ************.. ..

397. spacer 2.70|1638467|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP026206 (Escherichia coli strain ECONIH5 plasmid pECO-cbb3, complete sequence) position: , mismatch: 11, identity: 0.656

ggttacttcaaggaacagcttttgtgctgcta	CRISPR spacer
atcaacttccaggatcagcttttgtgccagcg	Protospacer
. . ***** **** ************.. ..

398. spacer 2.70|1638467|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP031615 (Klebsiella pneumoniae strain ZYST1 plasmid pZYST1C2, complete sequence) position: , mismatch: 11, identity: 0.656

ggttacttcaaggaacagcttttgtgctgcta	CRISPR spacer
atcaacttccaggatcagcttttgtgccagcg	Protospacer
. . ***** **** ************.. ..

399. spacer 2.70|1638467|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024977 (Escherichia coli strain CV839-15 plasmid pCV839-15-p3, complete sequence) position: , mismatch: 11, identity: 0.656

ggttacttcaaggaacagcttttgtgctgcta	CRISPR spacer
atcaacttccaggatcagcttttgtgccagcg	Protospacer
. . ***** **** ************.. ..

400. spacer 2.70|1638467|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP036181 (Escherichia coli strain WCHEC025970 plasmid p2_025970, complete sequence) position: , mismatch: 11, identity: 0.656

ggttacttcaaggaacagcttttgtgctgcta	CRISPR spacer
atcaacttccaggatcagcttttgtgccagcg	Protospacer
. . ***** **** ************.. ..

401. spacer 2.70|1638467|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP030921 (Escherichia coli strain KL53 plasmid pKL53-M, complete sequence) position: , mismatch: 11, identity: 0.656

ggttacttcaaggaacagcttttgtgctgcta	CRISPR spacer
atcaacttccaggatcagcttttgtgccagcg	Protospacer
. . ***** **** ************.. ..

402. spacer 2.70|1638467|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NC_019097 (Escherichia coli plasmid Plm, complete sequence) position: , mismatch: 11, identity: 0.656

ggttacttcaaggaacagcttttgtgctgcta	CRISPR spacer
atcaacttccaggatcagcttttgtgccagcg	Protospacer
. . ***** **** ************.. ..

403. spacer 2.70|1638467|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NC_006671 (Escherichia coli A2363 plasmid pAPEC-O2-R, complete sequence) position: , mismatch: 11, identity: 0.656

ggttacttcaaggaacagcttttgtgctgcta	CRISPR spacer
atcaacttccaggatcagcttttgtgccagcg	Protospacer
. . ***** **** ************.. ..

404. spacer 2.70|1638467|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP039604 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014868 plasmid p12-6919.1, complete sequence) position: , mismatch: 11, identity: 0.656

ggttacttcaaggaacagcttttgtgctgcta	CRISPR spacer
atcaacttccaggatcagcttttgtgccagcg	Protospacer
. . ***** **** ************.. ..

405. spacer 2.70|1638467|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NC_019111 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSal8934a, complete sequence) position: , mismatch: 11, identity: 0.656

ggttacttcaaggaacagcttttgtgctgcta	CRISPR spacer
atcaacttccaggatcagcttttgtgccagcg	Protospacer
. . ***** **** ************.. ..

406. spacer 2.70|1638467|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP025339 (Salmonella enterica subsp. enterica serovar Typhimurium strain BL10 plasmid p113k, complete sequence) position: , mismatch: 11, identity: 0.656

ggttacttcaaggaacagcttttgtgctgcta	CRISPR spacer
atcaacttccaggatcagcttttgtgccagcg	Protospacer
. . ***** **** ************.. ..

407. spacer 2.70|1638467|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019220 (Klebsiella pneumoniae strain 1756 plasmid pKp1756, complete sequence) position: , mismatch: 11, identity: 0.656

ggttacttcaaggaacagcttttgtgctgcta	CRISPR spacer
atcaacttccaggatcagcttttgtgccagcg	Protospacer
. . ***** **** ************.. ..

408. spacer 2.70|1638467|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP041441 (Escherichia coli strain YPE12 plasmid pYPE12-122k, complete sequence) position: , mismatch: 11, identity: 0.656

ggttacttcaaggaacagcttttgtgctgcta	CRISPR spacer
atcaacttccaggatcagcttttgtgccagcg	Protospacer
. . ***** **** ************.. ..

409. spacer 2.70|1638467|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP041394 (Escherichia coli strain ECOL-18-VL-LA-PA-Ryan-0026 plasmid p45407_2) position: , mismatch: 11, identity: 0.656

ggttacttcaaggaacagcttttgtgctgcta	CRISPR spacer
atcaacttccaggatcagcttttgtgccagcg	Protospacer
. . ***** **** ************.. ..

410. spacer 2.70|1638467|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to MN124285 (Escherichia coli strain RKI3099 plasmid pRKI3099a, complete sequence) position: , mismatch: 11, identity: 0.656

ggttacttcaaggaacagcttttgtgctgcta	CRISPR spacer
atcaacttccaggatcagcttttgtgccagcg	Protospacer
. . ***** **** ************.. ..

411. spacer 2.70|1638467|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MG825377 (Escherichia coli strain 1108 plasmid p1108-emrB, complete sequence) position: , mismatch: 11, identity: 0.656

ggttacttcaaggaacagcttttgtgctgcta	CRISPR spacer
atcaacttccaggatcagcttttgtgccagcg	Protospacer
. . ***** **** ************.. ..

412. spacer 2.70|1638467|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MF174860 (Escherichia coli strain 6/14/6b plasmid pIncF-MU4, complete sequence) position: , mismatch: 11, identity: 0.656

ggttacttcaaggaacagcttttgtgctgcta	CRISPR spacer
atcaacttccaggatcagcttttgtgccagcg	Protospacer
. . ***** **** ************.. ..

413. spacer 2.85|1639382|32|CP029684|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022567 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK03, complete sequence) position: , mismatch: 11, identity: 0.656

tcagcccagttcgtcgaaatgaactgcgaaat	CRISPR spacer
ggcttccacttcgtcgaaatgaacggcggcgc	Protospacer
    .*** *************** ***. ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

221822 : 230363

uncultured_virus(33.33%)

tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAS69228.1\|221822_222581_-	nicotinamide mononucleotide transporter	A0A1B1SDZ0	Weissella_phage	1.5e-83	64.3
QAS69229.1\|222721_224347_-	chaperonin GroEL	A0A240F779	uncultured_virus	7.6e-157	55.3
QAS69230.1\|224350_224626_-	co-chaperone GroES	A0A221S452	uncultured_virus	5.8e-09	37.2
QAS69231.1\|224742_225408_-	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
QAS69232.1\|225486_226512_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	4.3e-49	35.1
QAS69233.1\|226508_227024_-	ribosomal-protein-alanine N-acetyltransferase	NA	NA	NA	NA
QAS69234.1\|227007_227733_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
QAS69235.1\|227732_228728_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	2.8e-53	39.4
QAS69236.1\|228757_229507_-	acyl-ACP thioesterase	NA	NA	NA	NA
QAS69237.1\|229499_230363_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	2.3e-75	53.9

DBSCAN-SWA_2

751342 : 763254

Enterococcus_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAS69711.1\|751342_752815_-	glucose-6-phosphate dehydrogenase	M4SIY3	Cyanophage	2.4e-61	32.8
QAS69712.1\|752891_754121_+	MFS transporter	A0A2H4PQR6	Staphylococcus_phage	4.3e-35	26.7
QAS69713.1\|754141_755536_-	hemolysin	NA	NA	NA	NA
QAS69714.1\|755614_756079_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A217ER62	Bacillus_phage	2.0e-06	28.0
QAS69715.1\|756422_756668_+	NrdH-redoxin	X2KRY7	Enterococcus_phage	3.6e-10	42.9
QAS69716.1\|756738_758910_+	ribonucleotide-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	4.3e-232	55.2
QAS69717.1\|758943_759957_+	ribonucleotide-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	1.3e-114	63.0
QAS69718.1\|760073_760802_-	hypothetical protein	NA	NA	NA	NA
QAS69719.1\|761177_761867_+	DNA-binding response regulator	NA	NA	NA	NA
QAS69720.1\|761859_763254_+	sensor histidine kinase	A0A2K9L0Z8	Tupanvirus	2.8e-14	28.8

DBSCAN-SWA_3

1063255 : 1070691

Streptococcus_phage(28.57%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAS70635.1\|1063255_1064131_+	UTP--glucose-1-phosphate uridylyltransferase	A0A127AW70	Bacillus_phage	3.4e-71	49.0
QAS70009.1\|1064228_1065170_+	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	2.2e-76	46.6
QAS70010.1\|1065186_1065618_+	hypothetical protein	A0A0R8VB27	Thermobifida_phage	5.7e-11	32.3
QAS70011.1\|1065614_1066595_+	hypothetical protein	A1IMD5	Streptococcus_phage	1.4e-73	44.6
QAS70012.1\|1066594_1067542_+	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	4.2e-30	33.3
QAS70013.1\|1067595_1068207_+\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	1.1e-47	51.3
QAS70014.1\|1068310_1068535_+	transcriptional regulator	NA	NA	NA	NA
QAS70015.1\|1068552_1070691_+\|protease	ATP-dependent Clp protease ATP-binding subunit	H6X3M6	Enterobacteria_phage	3.7e-119	39.9

DBSCAN-SWA_4

1275854 : 1318809

Oenococcus_phage(58.97%)

tRNA,integrase,head,tail,terminase,protease,capsid,portal

attL 1272292:1272306|attR 1335341:1335355

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1272292:1272306	attL	NA	NA	NA	NA
QAS70215.1\|1275854_1278287_+\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	65.9
QAS70216.1\|1278573_1280238_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
QAS70217.1\|1280395_1282060_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
QAS70218.1\|1282123_1283053_+	peptide ABC transporter permease	NA	NA	NA	NA
QAS70219.1\|1283045_1284059_+	ABC transporter permease	NA	NA	NA	NA
QAS70220.1\|1284060_1285215_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.0e-14	25.1
QAS70221.1\|1285211_1286132_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.6e-21	31.6
QAS70222.1\|1286180_1287842_+	polysaccharide biosynthesis protein	NA	NA	NA	NA
QAS70223.1\|1287834_1289253_+	dipeptidase PepV	NA	NA	NA	NA
QAS70224.1\|1289263_1290100_+	undecaprenyl-diphosphatase	NA	NA	NA	NA
QAS70225.1\|1290231_1290897_-	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	3.4e-47	45.0
QAS70226.1\|1291052_1291442_-	large conductance mechanosensitive channel protein MscL	NA	NA	NA	NA
QAS70227.1\|1291774_1292818_-\|integrase	site-specific integrase	V9QKF1	Oenococcus_phage	3.7e-88	51.2
QAS70228.1\|1292833_1293073_-	XRE family transcriptional regulator	Q6EVM2	Oenoccocus_phage	1.0e-22	67.1
QAS70229.1\|1293114_1293369_-	hypothetical protein	NA	NA	NA	NA
QAS70230.1\|1293370_1294015_-	two pore domain potassium channel family protein	NA	NA	NA	NA
QAS70649.1\|1294081_1294753_-	hypothetical protein	O48432	Lactobacillus_phage	3.1e-19	31.1
QAS70231.1\|1294941_1295586_-	XRE family transcriptional regulator	A0A2H4J245	uncultured_Caudovirales_phage	1.7e-22	35.9
QAS70232.1\|1295714_1295939_+	XRE family transcriptional regulator	NA	NA	NA	NA
QAS70233.1\|1295950_1296151_+	hypothetical protein	V9QJB5	Oenococcus_phage	4.3e-22	77.3
QAS70234.1\|1296310_1296571_+	hypothetical protein	NA	NA	NA	NA
QAS70235.1\|1296567_1296954_+	hypothetical protein	NA	NA	NA	NA
QAS70236.1\|1296972_1297911_+	hypothetical protein	V9QIX7	Oenococcus_phage	1.2e-109	66.2
QAS70650.1\|1297907_1298585_+	DUF1071 domain-containing protein	Q9XJE4	Lactococcus_phage	4.7e-52	56.2
QAS70237.1\|1298581_1299040_+	single-stranded DNA-binding protein	A0A2P0VHT2	Streptococcus_phage	4.0e-39	55.3
QAS70238.1\|1299052_1299793_+	DNA replication protein	A0A1P8VVR3	Streptococcus_phage	2.1e-53	50.0
QAS70239.1\|1299789_1300335_+	hypothetical protein	NA	NA	NA	NA
QAS70240.1\|1300318_1301605_+	replicative DNA helicase	A0A097BYG3	Leuconostoc_phage	1.4e-84	43.8
QAS70241.1\|1301759_1302245_+	SAM-dependent methyltransferase	D2IYU6	Enterococcus_phage	4.7e-54	59.4
QAS70242.1\|1302222_1302585_+	hypothetical protein	V5URS7	Oenococcus_phage	6.8e-42	68.6
QAS70243.1\|1302596_1303088_+	hypothetical protein	Q5K5K4	Oenococcus_phage	1.5e-60	72.2
QAS70244.1\|1303264_1304344_+	hypothetical protein	Q6SE88	Lactobacillus_prophage	2.3e-48	32.7
QAS70651.1\|1304321_1304699_+	hypothetical protein	Q6SE87	Lactobacillus_prophage	1.3e-27	46.8
QAS70245.1\|1304935_1306156_+	hypothetical protein	Q5K5K2	Oenococcus_phage	8.1e-111	50.1
QAS70246.1\|1306514_1306946_-	hypothetical protein	A0A288TY51	Enterococcus_phage	3.2e-06	40.7
QAS70652.1\|1306926_1307115_-	XRE family transcriptional regulator	NA	NA	NA	NA
QAS70247.1\|1307114_1307702_-	hypothetical protein	D2KRC9	Lactobacillus_phage	4.4e-06	34.9
QAS70248.1\|1307836_1308064_+	hypothetical protein	V5USP4	Oenococcus_phage	3.9e-19	55.4
QAS70249.1\|1308060_1308264_-	hypothetical protein	V9QJ89	Oenococcus_phage	1.4e-07	46.8
QAS70250.1\|1308406_1308688_+	hypothetical protein	NA	NA	NA	NA
QAS70251.1\|1308726_1309491_+\|terminase	terminase	V5URT8	Oenococcus_phage	3.2e-113	79.9
QAS70252.1\|1309474_1310776_+\|terminase	PBSX family phage terminase large subunit	V5UTH5	Oenococcus_phage	4.0e-225	85.2
QAS70253.1\|1310794_1312258_+\|portal	phage portal protein	V9QKI8	Oenococcus_phage	1.1e-178	64.8
QAS70254.1\|1312229_1312538_+\|protease	ribosomal-processing cysteine protease Prp	V5UQW6	Oenococcus_phage	1.3e-22	58.3
QAS70255.1\|1312527_1313697_+\|head	phage head morphogenesis protein	V5US81	Oenococcus_phage	1.0e-163	73.7
QAS70256.1\|1313856_1314489_+\|capsid	phage capsid protein	V9QKX5	Oenococcus_phage	1.4e-37	48.3
QAS70257.1\|1314501_1314855_+	hypothetical protein	V5UQS0	Oenococcus_phage	1.9e-36	66.4
QAS70258.1\|1314866_1315922_+\|capsid	major capsid protein E	V9QKJ3	Oenococcus_phage	2.3e-122	66.4
QAS70259.1\|1315935_1316250_+	hypothetical protein	V5URN4	Oenococcus_phage	3.9e-33	71.0
QAS70260.1\|1316236_1316593_+	hypothetical protein	V5US85	Oenococcus_phage	3.6e-43	68.1
QAS70261.1\|1316585_1317140_+	hypothetical protein	V5USK0	Oenococcus_phage	1.3e-76	73.8
QAS70262.1\|1317136_1317505_+	hypothetical protein	V5UQS4	Oenococcus_phage	1.2e-38	68.3
QAS70263.1\|1317508_1317964_+\|tail	phage tail protein	V5USQ9	Oenococcus_phage	2.3e-50	70.3
QAS70264.1\|1318048_1318447_+	hypothetical protein	V9QJA0	Oenococcus_phage	9.2e-48	73.7
QAS70265.1\|1318536_1318809_+	hypothetical protein	V9QKH3	Oenococcus_phage	3.2e-28	73.5
1335341:1335355	attR	NA	NA	NA	NA

DBSCAN-SWA_5

1651778 : 1670689

Synechococcus_phage(15.38%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAS70550.1\|1651778_1652489_-	ABC transporter	G9BWD6	Planktothrix_phage	2.0e-24	35.3
QAS70551.1\|1652499_1652682_-	hypothetical protein	NA	NA	NA	NA
QAS70552.1\|1653075_1654632_-	GMP synthase (glutamine-hydrolyzing)	A0A1V0SH76	Hokovirus	2.8e-15	31.8
QAS70553.1\|1654632_1655193_-	hypoxanthine phosphoribosyltransferase	A0A2K9L2A2	Tupanvirus	5.9e-08	27.4
QAS70554.1\|1655189_1656491_-	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	1.2e-19	32.1
QAS70555.1\|1656487_1657798_-	adenylosuccinate synthase	L7Y4J5	Megavirus	7.4e-62	35.3
QAS70556.1\|1657885_1659034_-	guanosine monophosphate reductase	A0A0N9Q9A5	Chrysochromulina_ericina_virus	1.1e-40	36.2
QAS70557.1\|1659233_1660511_-	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
QAS70558.1\|1660523_1662053_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/inosine monophosphate cyclohydrolase	Q58MG4	Prochlorococcus_phage	3.5e-71	48.2
QAS70666.1\|1662049_1662628_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	3.4e-27	38.2
QAS70559.1\|1662645_1663683_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SCX2	Cyanophage	1.7e-64	41.4
QAS70560.1\|1663684_1665196_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.2e-50	33.1
QAS70561.1\|1665207_1667430_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	2.9e-143	40.8
QAS70562.1\|1667429_1668095_-	phosphoribosylformylglycinamidine synthase I	NA	NA	NA	NA
QAS70563.1\|1668096_1668360_-	phosphoribosylformylglycinamidine synthase	NA	NA	NA	NA
QAS70564.1\|1668361_1669087_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3FUQ7	Synechococcus_phage	4.6e-37	39.7
QAS70565.1\|1669083_1670202_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
QAS70566.1\|1670194_1670689_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.1e-17	47.3

Anti-CRISPR protein detection

Acr_ID: CP029684.1|QAS70234.1|1296310_1296571_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

CP029684.1|QAS70234.1|1296310_1296571_+|hypothetical-protein

1296310_1296571_+

86 aa aa

1275854-1318809

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
CP029684_2	TypeI-E	2.36\|1636393\|32\|CP029684\|CRISPRCasFinder,CRT	1636393-1636424	32	1292071-1292102	0
CP029684_2	TypeI-E	2.37\|1636454\|32\|CP029684\|CRISPRCasFinder,CRT	1636454-1636485	32	1315930-1315961	1

1. spacer 2.36|1636393|32|CP029684|CRISPRCasFinder,CRT matches to CP029684 position: 1292071-1292102, mismatch: 0

cccaccagctgtctggcattgagatagttcgt	CRISPR spacer
cccaccagctgtctggcattgagatagttcgt	Protospacer
********************************

2. spacer 2.37|1636454|32|CP029684|CRISPRCasFinder,CRT matches to CP029684 position: 1315930-1315961, mismatch: 1

gtagtcatggacaattcagcacagattcaatc	CRISPR spacer
gtagtcatggacaattcagcacaaattcaatc	Protospacer
***********************.********

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP029684

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information