CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
CP035172	Lactobacillus plantarum strain SRCM103418 plasmid unnamed4	0 crisprs	NA	0	0
CP035173	Lactobacillus plantarum strain SRCM103418 plasmid unnamed5	0 crisprs	NA	0	0
CP035168	Lactobacillus plantarum strain SRCM103418 chromosome, complete genome	1 crisprs	csa3,cas3,DEDDh,DinG	0	6
CP035169	Lactobacillus plantarum strain SRCM103418 plasmid unnamed1	0 crisprs	NA	0	0
CP035171	Lactobacillus plantarum strain SRCM103418 plasmid unnamed3	1 crisprs	csa3	1	0
CP035170	Lactobacillus plantarum strain SRCM103418 plasmid unnamed2	0 crisprs	NA	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP035168_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP035168_1

528692-528777

Orphan

Consensus_repeat	Method
AATAAGATACTTTAAGTTTCTTA	CRISPRCasFinder

1 spacers

csa3

The CRISPR arrays of CP035168_1

>merge|CP035168|1|528692-528777|CRISPRCasFinder
AATAAGATACTTTAAGTTTCTTATTGACTTTTTCTTTATATAGCGTATTATACCAGTTATGCGAATAAGACACTTTAAGTTTCTTA

>CP035168|1|1|528692-528777|CRISPRCasFinder
AATAAGATACTTTAAGTTTCTTA	TTGACTTTTTCTTTATATAGCGTATTATACCAGTTATGCG
AATAAGACACTTTAAGTTTCTTA

Protein	Signature genes	Signature genes Name	Protein_function
CP035168.1\|QAS25994.1\|532951_533518_+\|DUF1211-domain-containing-protein	unknown	unknown	gnl\|CDD\|226078
CP035168.1\|QAS25981.1\|519215_519722_+\|sugar-O-acetyltransferase	unknown	unknown	gnl\|CDD\|100047
CP035168.1\|QAS25997.1\|535555_536284_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
CP035168.1\|QAS25987.1\|524999_525998_-\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
CP035168.1\|QAS25991.1\|528791_530270_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
CP035168.1\|QAS25995.1\|533666_534704_-\|aldehyde-reductase	unknown	unknown	gnl\|CDD\|187538
CP035168.1\|QAS25996.1\|534830_535397_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
CP035168.1\|QAS25982.1\|519738_520485_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
CP035168.1\|QAS25993.1\|531778_532732_+\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381318
CP035168.1\|QAS25992.1\|530589_530829_+\|hypothetical-protein	unknown	unknown	unknown
CP035168.1\|QAS25984.1\|521821_522112_-\|ArsR-family-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
CP035168.1\|QAS25983.1\|520589_521759_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340882
CP035168.1\|QAS25990.1\|528075_528675_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
CP035168.1\|QAS28277.1\|531075_531267_-\|hypothetical-protein	unknown	unknown	unknown
CP035168.1\|QAS25988.1\|525994_526789_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
CP035168.1\|QAS25999.1\|537065_537350_-\|DUF1905-domain-containing-protein	unknown	unknown	gnl\|CDD\|378097
CP035168.1\|QAS25985.1\|522373_523270_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187572
CP035168.1\|QAS25986.1\|523250_523763_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274100
CP035168.1\|QAS25989.1\|527025_527955_+\|ferrichrome-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238558
CP035168.1\|QAS25998.1\|536416_536782_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647

Protein	Function_ID	Function_description	E-value
CP035168.1\|QAS25981.1\|519215_519722_+\|sugar-O-acetyltransferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	1.58107e-53
CP035168.1\|QAS25997.1\|535555_536284_-\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	1.6523e-89
CP035168.1\|QAS25987.1\|524999_525998_-\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	3.26834e-81
CP035168.1\|QAS25991.1\|528791_530270_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	3.33042e-71
CP035168.1\|QAS25995.1\|533666_534704_-\|aldehyde-reductase	gnl\|CDD\|187538	cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs. This subgroup contains aldehyde reductase of the extended SDR-type and related proteins. Aldehyde reductase I (aka carbonyl reductase) is an NADP-binding SDR; it has an NADP-binding motif consensus that is slightly different from the canonical SDR form and lacks the Asn of the extended SDR active site tetrad. Aldehyde reductase I catalyzes the NADP-dependent reduction of ethyl 4-chloro-3-oxobutanoate to ethyl (R)-4-chloro-3-hydroxybutanoate. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	7.62333e-95
CP035168.1\|QAS25996.1\|534830_535397_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	0.000180161
CP035168.1\|QAS25982.1\|519738_520485_+\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	3.19662e-91
CP035168.1\|QAS25993.1\|531778_532732_+\|aldo/keto-reductase	gnl\|CDD\|381318	cd19092, AKR_BsYcsN_EcYdhF-like, Bacillus subtilis YcsN, Escherichia coli YdhF and similar proteins. Bacillus subtilis YcsN and Escherichia coli YdhF are prototypes of this family. They are uncharacterized aldo/keto reductase family oxidoreductases.	1.36135e-129
CP035168.1\|QAS25994.1\|532951_533518_+\|DUF1211-domain-containing-protein	gnl\|CDD\|226078	COG3548, COG3548, Predicted integral membrane protein [Function unknown].	2.49763e-28
CP035168.1\|QAS25984.1\|521821_522112_-\|ArsR-family-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	1.19262e-17
CP035168.1\|QAS25983.1\|520589_521759_-\|MFS-transporter	gnl\|CDD\|340882	cd17324, MFS_NepI_like, Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily. This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	6.1996e-56
CP035168.1\|QAS25990.1\|528075_528675_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	5.49788e-09
CP035168.1\|QAS25988.1\|525994_526789_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	1.91464e-114
CP035168.1\|QAS25999.1\|537065_537350_-\|DUF1905-domain-containing-protein	gnl\|CDD\|378097	pfam08922, DUF1905, Domain of unknown function (DUF1905). This domain is found in a set of hypothetical bacterial proteins.	1.07383e-22
CP035168.1\|QAS25985.1\|522373_523270_+\|SDR-family-oxidoreductase	gnl\|CDD\|187572	cd05262, SDR_a7, atypical (a) SDRs, subgroup 7. This subgroup contains atypical SDRs of unknown function. Members of this subgroup have a glycine-rich NAD(P)-binding motif consensus that matches the extended SDRs, TGXXGXXG, but lacks the characteristic active site residues of the SDRs. This subgroup has basic residues (HXXXR) in place of the active site motif YXXXK, these may have a catalytic role. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	8.52059e-129
CP035168.1\|QAS25986.1\|523250_523763_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|274100	TIGR02366, conserved_hypothetical_protein, probable dihydroxyacetone kinase regulator. The seed alignment for this family was built from a set of closely related uncharacterized proteins associated with operons for the type of bacterial dihydroxyacetone kinase that transfers PEP-derived phosphate from a phosphoprotein, as in phosphotransferase system transport, rather than from ATP. Members have a TetR transcriptional regulator domain (pfam00440) at the N-terminus and sequence homology throughout.	3.33884e-08
CP035168.1\|QAS25989.1\|527025_527955_+\|ferrichrome-ABC-transporter-substrate-binding-protein	gnl\|CDD\|238558	cd01138, FeuA, Periplasmic binding protein FeuA. These proteins have predicted to function as initial receptors in ABC transport of metal ions in some eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.	2.57254e-56
CP035168.1\|QAS25998.1\|536416_536782_+\|transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.16334e-31

>CP035168.1|QAS25990.1|528075_528675_-|TetR/AcrR-family-transcriptional-regulator
MTKTRRRGAELENAIYQAARDILNQDGLEQLTFANVAEQAGTSKPVIYRRWRSPLELAIAAIQDQIITENHGQLDEVNLTGQTLSEDLFQVLKRFTVSINTFNQALVITWFHHLDQQANPEVKDLLNAVKKIDAHAIERVCQRAQQRGELRTGTLSCDLQLMPFDWLRYRAFANEPITDATLHLLVDDLLVPAYQHALG
>CP035168.1|QAS25989.1|527025_527955_+|ferrichrome-ABC-transporter-substrate-binding-protein
MTKRWQIVKLGLVLGLMGSLLLGACGAKQPTSTTVTRTDYLKHKVKVPKHPKRIVASYLEDDLVALGIKPVVQWSVKNGSGTQAYLKKQLKGVPLIDYSLPYEAVTKAKPDLILMGTSSAVANGKYAQYNKIAPTYVVKNGTTVTWRQTFLDVAKVVNRQAKAKKVLAKYDEQVQTTRQALKKSGQHKVAVLWVTNNTAYMVNDNSASGALLYQDLQLGEPSLVKQVSKSATADWSAVSLEKLAKLDADDIFLVNSQKSASLFKDPLWKNIKAVKNNHLYQYGDSSSWQYSGPIAYSQMIDMVKTDLLK
>CP035168.1|QAS25988.1|525994_526789_-|ABC-transporter-ATP-binding-protein
MNTIEAQNISIGYGDKVIVDQLSITIPHGQITTLIGPNGSGKSTLIRAIAHLLPPTTGVILLDHQNIQQIKSKTFAKKIAVLPQSNQTANDLTVEELVSFGRLPYRRPLSGLTTTDHQKIEWALTQASLQDLRQRPLSTLSGGQRQRAWIAMAVAQDTDTIILDEPTTYLDLTHQLEVMQLVKKLNEQAHRTIIMALHDLNHAARISDQLIALKDGHVLAHGPVSTVMTAANLKTIFNIDATLVDYHGTPLILTYNGCQEVAPA
>CP035168.1|QAS25987.1|524999_525998_-|iron-ABC-transporter-permease
MKSTSRYWGWLALSTGVLILVMGLSLRFGADQMRTATVWHVLTTTHTGNLDQQIIRHIRVPRVLGAALIGAALAGSGALMQAVTRNPLADSGLLGINAGAGLMLTLCLAFFPKLSTLQTTGWAIIGAAASAGLIFSISTARHVQLDPTILVLAGIAISSLLTALSEGLALVLQLKQDLAFWYFGGLGAVSWTQLKFLGPGLVLGLLLTLLLAPQLNLAYLTDDNAQSLGKSLPLLRGLALICAVILSGISVALVGTITFVGLMIPHMARWLVGANYRNSMPLTLILGATLTVGADLIARLVNPPHETPFGIIISLIGVPCFIYLARKEPMKA
>CP035168.1|QAS25986.1|523250_523763_-|TetR/AcrR-family-transcriptional-regulator
MANQRNQRMQATILLAYENLLSDKPFRKITVQDISDAALVHRSTFYKHFQDQYDLLEALFEQKRQQSKLTIDQIFTHPFETLNSFGNARFQETLRHQFNDDAFRDAFLNYLIHLCKDTVDDDQRLVRFLAVGRIKGLTLWITVGNAPYNIFTDTATLDNIFSNPLNTVNY
>CP035168.1|QAS25985.1|522373_523270_+|SDR-family-oxidoreductase
MTKVFITGGTGFVGSAVVQELVANGFEVVGLARSETSAQKLISWGAQPVRGSLTSLSTLATAAAQADAIIHLGFNNDFRHFFQAGAMDRRAIETMGRAISGTNKPLVVTYGTTGIRKHVETEHEVADTGLLKWLTPRKSEIVARQLMAQNINAFVVRLSPAVHGAGDMGFTRTVIERAKKSHRAEYFGLGTHAWSAVHRLDAAHLFYLVTMYGLEHPTTNERVFNAVAEESITTAAIARTISRKLNVPLKAKYNPLSFGDTAMLYLINCPTSSQLTRQILGWVPVQPDLLTDISSSRY
>CP035168.1|QAS25984.1|521821_522112_-|ArsR-family-transcriptional-regulator
MIIKQLSDNEIRIQIFKALSDEVRLNIIAMLYEKQTEMSCGEIGETLDINKSTASYHFKTLREAGLTTTRKKGQNKYVSLNIDAFNEILPGFLDTL
>CP035168.1|QAS25983.1|520589_521759_-|MFS-transporter
MRRYSLMFFLTMFLIGTDTFLISPLLPTLARMYGVSTSISGWMVSAYAIGYACFALISGPISDGRNRKKVMIWGLLAFSMSTFLCGFSYTFPAMLFFRFLAGVSASFVTPQVWASIPVIVDKKHIVKVMGYATAGLSVSQLVGIPIGSYLAVNSWHTPFFVISGAALILLISNAIALPELEFGHKFKTSFFKTYTSVLHNSKALNYLFAYLIFQTGSFTAITFISTWFTNSFGLTLTGVGTAMIAIGAGNLIGSLFSGNLVNRMGLEKTFLFELIALITLYLILPFITTFWLAEIVLTLAFLFNGFIFPIFMTTLQSTTINARSTVSSLSNAAMYFGETLAGIIGGVLFKQFHSYLGISIFAALMILFALLVYAKSGVFKPENNNSIED
>CP035168.1|QAS25982.1|519738_520485_+|SDR-family-oxidoreductase
MSIKGKVVVITGASSGIGAATAKLLAAKGAKVVLGARREERLQALSQAIGDNAVYQVTDVTDRQQVRALIDLAVSKFGHVDVLYNNAGTMPQGNLSDREYDKWQMMLNVNIMGVLNGIGEVLPIMQKQHDGLIIATDSVAGHVVYPASAVYNGTKYAVRAIMEGLRQEEKEHGIRSTIVSPGAVRTELVNTIGNTQIQAGISELMNADDRQGLALNPEDIANAVLFAIDQPKHVAISEVLVRPAQQEV
>CP035168.1|QAS25981.1|519215_519722_+|sugar-O-acetyltransferase
MQTIQPIVDANQRRIQALNVTREPSEIRERLAEITGQTIDISVEIRVPLWTDYGRNLKIGKRVFINDNVQITDLGGIELADDVLIGPGAMLLSVNHPLDPAKRHAVEVQPIHIERNAWIGAGAKVLAGVTVGENAVVGAGAVVTKSVPANTVVAGVPAKVIKTIEQVD
>CP035168.1|QAS25991.1|528791_530270_+|DHA2-family-efflux-MFS-transporter-permease-subunit
MQAKAKISKATMTIAWVVVFGAMAPLLDSTMINIAINNLVTSFHSSVTTVQWAVTGYLLATGVAVPFSSWLLNRFDGKAVFVAGEILFGLGSIFAAVAPNIQLLIIARLVQGFAGGLIMPLLTTLLVQTAGAAVMGQMMATVGLPMILGPLIGPVIGGIIIKFASWHWIFWINVPVVLISIALILWKMPNYPAQNRTAKMDFIGILLLIVSSSAIIYSLVNAAHTDRFNNATSIEMLILGAIALISYVVWAAWQKERAVVPLHLFKFASFDGAGLGLFIAGTVLNGAMLLLPLYFQNVRGMSVINAALALLPQGAGMLVSRTLTGRLTDQIGAKYVVLGSVVITFVGTLPFYWFGQQTSYWILALILFVRGIGAGGILMSLMADAYTGMQPGQVPAATIGTRIIQNIGSAFGSALITTIVTAYSTHQVNVFERHLKAGTYHVDAAHLQVFTTSHLQAIRLAAFQQGFLVIAIAAIVIILPTLLLTNKLKAAK
>CP035168.1|QAS25992.1|530589_530829_+|hypothetical-protein
MKKVYLRYQKQVDSFININKIMLLLEFVLLFVVKGSIDHYNQLPYDWFAYLTTLIHYFLGTFAFFGIILVIECVWNKFK
>CP035168.1|QAS28277.1|531075_531267_-|hypothetical-protein
MAAFSEKQLKKAPITDQEFEKVVAVAKPDVQGIHSVCQQLVISFIAEERFLAVFGDGTCHPSN
>CP035168.1|QAS25993.1|531778_532732_+|aldo/keto-reductase
MKTIQIGASQLKASAVALGIMRMVRLDTDAAVNVLETVHDRGVNFIDSADIYGNGDSERIFGQALKQSSLKREDFFIQSKGGIVLDPEKSSGELVFGQRYDFSKQHLIATVDKILQRMQLDYLDSFLLHRPDPLMDPAEVAAAFDELQATGKVRHFGVSNFNPMQVEMLQAAVSQKLMINQLQFGVMHTGPIQFGLHTNMQDTASLNHDGEIIEYSRLHHMTIQTWSPYQYGMFAGTFIDNPKFPELNAKLQELADQYHVTKNAIATAWILRHPANMQVILGSMNPQHLDESIAGTDVTLTRQEWYDVYFAAGNDLP
>CP035168.1|QAS25994.1|532951_533518_+|DUF1211-domain-containing-protein
MNKARLEAFTDAIIAIVLTLLVLDLPRPQTPSVRALFAEWQSIYVYIITFTLLISIWLNHHDLFVQVKKIDRVVFWANSFWLLCQSFIPFMASWITKFTHSKWPAVFYILTGFVWMLAYQLLVAAVRRLNPHIHRMSSPALSVVFGGFLVVLTVALINPDVGLFLIPVHAFVSVILATKRKWHLRKYF
>CP035168.1|QAS25995.1|533666_534704_-|aldehyde-reductase
MQKQLVVVTGGSGFIAIHIIRQLLQQGYAVRTTVRSLAKAPVIKEMLTNGGITDLSALEIVVADLAHDEHWSEAMAGATYAIDVASPTPKLNFKNKAEMIRPAVDGVRRVLTASRDAGVKRVVLTSAYGAIFAGHKNRTTPYTEADWSDLNWKAIHPYQESKTRAELAAWDFINHEGRGLELTTVNPVAVMGPVLSAKYSHSNIQIQQFLEGQVKAVPNVDSGYVDVRDVASLHLLAMTAPQANGERFLATTGETLSMLDVANVLRQAFPAFASQLPTKTIPNAAVKLAAKARPELRMVASLVGTYAETSNHKAQTLLDWHPRPAAESIIATAQSMIDLGIVTKP
>CP035168.1|QAS25996.1|534830_535397_+|TetR/AcrR-family-transcriptional-regulator
MAATNHAQAIKKDSQTYLTTALLQLLRTHDLDTITVTQVVKRAGVSRMAFYRNFTTLEDLLSTYFAPAIAARFQDVLQHVPANQKLLAMGQFFSDFAPTLRLAEQRGFENIIQQLFNANMTNYYQATMTNGMLTAVQLKYWTRFMSAGVYAIWREWLLGGQLESLTTIHEILATLQTATMQALTQAQK
>CP035168.1|QAS25997.1|535555_536284_-|SDR-family-oxidoreductase
MKPLVVITGASSGFGAEIAKLFAADNYPLLLLGRRQAKLAALSANFENAMIDTVDVTNYHQFETAVRKAEAKYGKTDLLVNNAGLMLLGNVQNQDPQEWQTMLNTNVMGVLNGTQIVLNDMRDREHGTILNMSSLAGKKTFVNHAAYVASKFGVHGLSETLREENAPKNVRVMLVAPGAAETELLTHVTSKSALSDYEAWKASMGGLTLDPKHVAATVKFMYDMPQNVNIREVDIAATAQDA
>CP035168.1|QAS25998.1|536416_536782_+|transcriptional-regulator
MLKERVTAQPRYRNEFDATMQLIRGKWKIMILFELAEVKVSRFADLQHHIQAVSHKTLASQLKELEQDELIERHDFKTAQPHVEYRLTAKGQSLIPILDAICTWGDQHVDPALIERSLCDE
>CP035168.1|QAS25999.1|537065_537350_-|DUF1905-domain-containing-protein
MKTYQFDAPIQAATIGKGGAYVACPFDIRDLFGKGRVKVHATFDEVPYNGSIVNMGVKNLDGSICYILGIRKDIRAKLHKSIGDVVAVTVTAID

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

37667 : 54843

Lactobacillus_phage(27.27%)

capsid,terminase,tail,integrase,head,portal

attL 37461:37474|attR 48228:48241

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
37461:37474	attL	NA	NA	NA	NA
QAS25562.1\|37667_38822_-\|integrase	site-specific integrase	A0A172LN96	Lactococcus_phage	8.0e-60	36.7
QAS28257.1\|38900_39545_-	transcriptional regulator	NA	NA	NA	NA
QAS25563.1\|39692_39872_+	DNA-binding protein	E9LUT5	Lactobacillus_phage	2.5e-21	89.7
QAS25564.1\|39914_40022_+	hypothetical protein	NA	NA	NA	NA
QAS25565.1\|40154_40373_+	hypothetical protein	NA	NA	NA	NA
QAS25566.1\|40369_41170_+	DNA replication protein	NA	NA	NA	NA
QAS25567.1\|41169_42564_+	virulence protein	A0A1W6JQD6	Staphylococcus_phage	2.8e-67	39.7
QAS25568.1\|42709_43189_+	hypothetical protein	NA	NA	NA	NA
QAS25569.1\|43203_43515_+	hypothetical protein	NA	NA	NA	NA
QAS25570.1\|43501_43840_+\|head,tail	head-tail adaptor protein	A0A2P0ZLF0	Lactobacillus_phage	6.0e-08	35.6
QAS25571.1\|43832_44222_+	HNH endonuclease	A0A1J0MFT4	Staphylococcus_phage	3.0e-19	44.7
QAS25572.1\|45124_45598_+\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
QAS25573.1\|45594_47298_+\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	7.0e-121	40.5
QAS25574.1\|47251_47452_+	hypothetical protein	NA	NA	NA	NA
QAS25575.1\|47452_48553_+\|portal	phage portal protein	A0A2H4J9Q5	uncultured_Caudovirales_phage	4.6e-49	34.3
48228:48241	attR	NA	NA	NA	NA
QAS25576.1\|48549_50091_+\|capsid	phage major capsid protein	B8R651	Lactobacillus_phage	6.3e-44	25.7
QAS25577.1\|50207_50477_+\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
QAS25578.1\|50626_51004_+	hypothetical protein	NA	NA	NA	NA
QAS25579.1\|51127_51328_+	cold-shock protein	Q9AZD3	Lactococcus_phage	1.4e-20	71.4
QAS25580.1\|51414_51645_+	hypothetical protein	NA	NA	NA	NA
QAS25581.1\|52247_52955_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.9e-44	40.1
QAS25582.1\|52968_54843_+	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	5.5e-34	31.8

DBSCAN-SWA_2

857671 : 866185

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAS26277.1\|857671_858157_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0
QAS26278.1\|858140_859271_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
QAS26279.1\|859273_860005_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.6e-37	37.3
QAS26280.1\|860006_860261_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
QAS26281.1\|860260_860941_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
QAS26282.1\|860933_863153_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	4.5e-144	39.3
QAS26283.1\|863137_864592_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.5e-50	34.0
QAS26284.1\|864588_865614_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.7e-59	41.0
QAS26285.1\|865606_866185_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-21	33.9

DBSCAN-SWA_3

1068735 : 1109545

Lactobacillus_phage(73.33%)

capsid,terminase,holin,tail,integrase,portal

attL 1067671:1067685|attR 1091223:1091237

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1067671:1067685	attL	NA	NA	NA	NA
QAS26464.1\|1068735_1069857_-\|integrase	site-specific integrase	D6PSS4	Lactobacillus_phage	7.6e-47	32.4
QAS26465.1\|1070121_1071741_-	hypothetical protein	A0A1S5SA14	Streptococcus_phage	3.1e-94	47.9
QAS26466.1\|1072060_1072237_-	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	9.1e-08	53.4
QAS28292.1\|1072376_1073075_-	hypothetical protein	NA	NA	NA	NA
QAS26467.1\|1073199_1074063_-	carboxypeptidase regulatory-like domain-containing protein	NA	NA	NA	NA
QAS26468.1\|1074116_1074548_-	hypothetical protein	O03904	Lactobacillus_phage	2.1e-74	94.4
QAS26469.1\|1074556_1074955_-	helix-turn-helix domain-containing protein	O03970	Lactobacillus_phage	7.2e-69	97.7
QAS26470.1\|1075122_1075389_+	XRE family transcriptional regulator	O03906	Lactobacillus_phage	6.1e-40	97.7
QAS26471.1\|1075545_1075827_-	hypothetical protein	NA	NA	NA	NA
QAS26472.1\|1076087_1076393_+	DUF771 domain-containing protein	NA	NA	NA	NA
QAS26473.1\|1076459_1076972_+	XRE family transcriptional regulator	D6PST4	Lactobacillus_phage	1.8e-27	42.9
QAS26474.1\|1077039_1077210_+	hypothetical protein	NA	NA	NA	NA
QAS26475.1\|1077342_1077729_+	hypothetical protein	NA	NA	NA	NA
QAS26476.1\|1077725_1078613_+	recombinase RecT	E9LUM3	Lactobacillus_phage	1.5e-61	47.0
QAS26477.1\|1078536_1079397_+	hypothetical protein	A0A0P0IZH9	Lactobacillus_phage	9.5e-74	49.2
QAS26478.1\|1079477_1080266_+	DNA replication protein DnaD	NA	NA	NA	NA
QAS26479.1\|1080246_1081089_+	ATP-binding protein	O03914	Lactobacillus_phage	5.1e-149	94.6
QAS26480.1\|1081245_1081968_+	oxidoreductase	A0A141E1D3	Streptococcus_phage	3.3e-51	46.0
QAS26481.1\|1081972_1082491_+	hypothetical protein	O03915	Lactobacillus_phage	2.0e-55	69.1
QAS26482.1\|1082487_1082868_+	hypothetical protein	NA	NA	NA	NA
QAS26483.1\|1082860_1083028_+	hypothetical protein	A0A2P0ZLB5	Lactobacillus_phage	7.5e-12	70.9
QAS26484.1\|1083227_1083419_+	hypothetical protein	D6PSV3	Lactobacillus_phage	1.4e-22	81.0
QAS26485.1\|1083411_1083783_+	hypothetical protein	A0A2K9VD97	Lactobacillus_phage	4.3e-31	89.0
QAS26486.1\|1084098_1084566_+	hypothetical protein	B4XYT9	Lactobacillus_phage	1.4e-15	40.0
QAS26487.1\|1084801_1084969_+	BC1881 family protein	NA	NA	NA	NA
QAS26488.1\|1084965_1085175_-	KTSC domain-containing protein	NA	NA	NA	NA
QAS26489.1\|1085835_1086039_+	hypothetical protein	NA	NA	NA	NA
QAS26490.1\|1086478_1087039_+\|terminase	terminase small subunit	O03926	Lactobacillus_phage	3.9e-60	86.3
QAS26491.1\|1087019_1088345_+\|terminase	PBSX family phage terminase large subunit	A0A1S5SA45	Streptococcus_phage	1.7e-138	55.7
QAS26492.1\|1088347_1089943_+\|portal	phage portal protein	B5LPR1	Bacillus_virus	9.9e-85	37.8
QAS26493.1\|1089818_1091021_+	hypothetical protein	A0A059T7W2	Listeria_phage	3.1e-38	31.0
QAS26494.1\|1091084_1091696_+	hypothetical protein	NA	NA	NA	NA
1091223:1091237	attR	NA	NA	NA	NA
QAS26495.1\|1091709_1092657_+\|capsid	N4-gp56 family major capsid protein	A8ASJ6	Listeria_phage	5.2e-89	59.5
QAS26496.1\|1093016_1093421_+	hypothetical protein	A5GYM1	Lactococcus_phage	2.6e-05	26.9
QAS26497.1\|1093421_1093811_+	hypothetical protein	NA	NA	NA	NA
QAS26498.1\|1093807_1094209_+	hypothetical protein	NA	NA	NA	NA
QAS26499.1\|1094208_1094634_+	hypothetical protein	NA	NA	NA	NA
QAS26500.1\|1094651_1095269_+	hypothetical protein	NA	NA	NA	NA
QAS26501.1\|1095387_1095906_+	hypothetical protein	NA	NA	NA	NA
QAS26502.1\|1095902_1096544_+	hypothetical protein	U3PFU8	Lactobacillus_phage	3.3e-07	29.9
QAS26503.1\|1096559_1102199_+\|tail	phage tail tape measure protein	A0A1S5SFC1	Streptococcus_phage	1.1e-21	25.4
QAS26504.1\|1102199_1103018_+\|tail	phage tail family protein	NA	NA	NA	NA
QAS26505.1\|1103029_1104157_+	hypothetical protein	O03938	Lactobacillus_phage	4.0e-72	42.3
QAS26506.1\|1104149_1104371_+	hypothetical protein	NA	NA	NA	NA
QAS26507.1\|1104367_1104658_+	hypothetical protein	NA	NA	NA	NA
QAS26508.1\|1106482_1107268_+	hypothetical protein	O03971	Lactobacillus_phage	9.1e-132	90.8
QAS26509.1\|1107267_1107588_+	DUF2977 domain-containing protein	Q7M292	Lactobacillus_phage	2.4e-30	80.8
QAS26510.1\|1107584_1107761_+	XkdX family protein	NA	NA	NA	NA
QAS26511.1\|1107744_1108899_+	LysM peptidoglycan-binding domain-containing protein	O03950	Lactobacillus_phage	1.1e-45	38.5
QAS26512.1\|1108899_1109196_+	hypothetical protein	A0A1I9KK55	Lactobacillus_phage	5.8e-39	76.5
QAS26513.1\|1109182_1109545_+\|holin	holin	A0A2K9VCG4	Lactobacillus_phage	5.5e-15	63.8

DBSCAN-SWA_4

1374874 : 1486520

108

Lactobacillus_phage(61.54%)

capsid,terminase,holin,integrase,protease,tail,transposase,head,tRNA,portal

attL 1392418:1392435|attR 1461011:1461028

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAS26749.1\|1374874_1375650_-\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2
QAS26750.1\|1375903_1376569_+	sugar transferase	NA	NA	NA	NA
QAS26751.1\|1376568_1377660_+	glycosyltransferase family 1 protein	NA	NA	NA	NA
QAS26752.1\|1377675_1378704_+	glycosyltransferase	NA	NA	NA	NA
QAS26753.1\|1378700_1379975_+	polysaccharide polymerase	NA	NA	NA	NA
QAS26754.1\|1379959_1380928_+	glycosyltransferase	NA	NA	NA	NA
QAS28302.1\|1382565_1383888_-	metallophosphoesterase	NA	NA	NA	NA
QAS26755.1\|1384027_1385995_-	PTS fructose transporter subunit IIC	NA	NA	NA	NA
QAS26756.1\|1386016_1386934_-	1-phosphofructokinase	NA	NA	NA	NA
QAS26757.1\|1386930_1387686_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.6e-21	31.8
QAS26758.1\|1387933_1389229_+	GTPase ObgE	NA	NA	NA	NA
QAS26759.1\|1389375_1389660_-	hypothetical protein	NA	NA	NA	NA
QAS26760.1\|1390092_1391028_+	ribonuclease Z	NA	NA	NA	NA
QAS26761.1\|1391037_1391829_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
QAS26762.1\|1391841_1392192_+	LapA family protein	NA	NA	NA	NA
QAS26763.1\|1392213_1394547_+	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	1.4e-74	31.4
1392418:1392435	attL	NA	NA	NA	NA
QAS26764.1\|1394565_1395084_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	9.5e-29	42.1
QAS26765.1\|1395226_1395811_-	ArsR family transcriptional regulator	NA	NA	NA	NA
QAS26766.1\|1395926_1397138_+	MFS transporter	NA	NA	NA	NA
QAS26767.1\|1397234_1397582_-	heavy metal-binding domain-containing protein	NA	NA	NA	NA
QAS26768.1\|1397693_1398377_+	SAM-dependent methyltransferase	NA	NA	NA	NA
QAS26769.1\|1398551_1398758_+	hypothetical protein	NA	NA	NA	NA
QAS26770.1\|1399295_1400459_-\|integrase	site-specific integrase	E9LUK6	Lactobacillus_phage	3.0e-62	37.1
QAS26771.1\|1400629_1400992_-	hypothetical protein	E9LUS2	Lactobacillus_phage	2.1e-59	95.8
QAS26772.1\|1401148_1401337_-	hypothetical protein	E9LUS5	Lactobacillus_phage	2.1e-26	100.0
QAS26773.1\|1401654_1401855_-	hypothetical protein	E9LUS6	Lactobacillus_phage	5.5e-25	97.0
QAS26774.1\|1402036_1402735_-	hypothetical protein	Q9AZW5	Lactococcus_phage	2.1e-18	36.8
QAS26775.1\|1402743_1403130_-	hypothetical protein	NA	NA	NA	NA
QAS26776.1\|1403187_1403466_-	hypothetical protein	D2KRD5	Lactobacillus_phage	1.3e-21	59.3
QAS26777.1\|1403475_1403814_-	XRE family transcriptional regulator	Q8W5Y0	Listeria_phage	1.0e-15	42.2
QAS26778.1\|1404059_1404281_+	hypothetical protein	NA	NA	NA	NA
QAS28303.1\|1404286_1404994_+	phage regulatory protein	D2IYT0	Enterococcus_phage	6.8e-70	62.2
QAS26779.1\|1405005_1405215_+	hypothetical protein	NA	NA	NA	NA
QAS26780.1\|1405330_1405657_-	RNA polymerase III	E9LUT2	Lactobacillus_phage	2.7e-53	98.1
QAS26781.1\|1405714_1405975_+	hypothetical protein	NA	NA	NA	NA
QAS26782.1\|1406663_1406918_+	hypothetical protein	NA	NA	NA	NA
QAS26783.1\|1406920_1407121_+	hypothetical protein	E9LUT7	Lactobacillus_phage	2.6e-27	92.4
QAS26784.1\|1407470_1407776_+	hypothetical protein	NA	NA	NA	NA
QAS26785.1\|1407795_1408488_+	hypothetical protein	E9LUU3	Lactobacillus_phage	1.1e-117	88.7
QAS26786.1\|1408511_1409069_+	hypothetical protein	X2KXT0	Enterococcus_phage	4.2e-22	50.5
QAS26787.1\|1409858_1410644_+	ATP-binding protein	E9LUN6	Lactobacillus_phage	7.0e-132	90.4
QAS26788.1\|1410779_1411082_+	hypothetical protein	E9LUN7	Lactobacillus_phage	1.6e-44	91.0
QAS26789.1\|1411084_1411396_+	hypothetical protein	A0A2P0ZLB4	Lactobacillus_phage	7.2e-48	90.3
QAS26790.1\|1411491_1412610_+	DNA cytosine methyltransferase	A0A1I9KKE7	Lactobacillus_phage	1.5e-127	60.4
QAS26791.1\|1413255_1413426_+	hypothetical protein	E9LUP4	Lactobacillus_phage	3.8e-19	91.1
QAS26792.1\|1413406_1413838_+	transcriptional regulator	E9LUP5	Lactobacillus_phage	5.1e-76	97.9
QAS26793.1\|1414577_1414874_+	hypothetical protein	NA	NA	NA	NA
QAS26794.1\|1414914_1415757_-\|transposase	IS3 family transposase	Q6J1X2	Lactobacillus_phage	8.8e-157	99.3
QAS26795.1\|1415810_1416062_-\|transposase	IS3 family transposase	Q6J1X3	Lactobacillus_phage	9.2e-38	96.4
QAS26796.1\|1416335_1416668_+	HNH endonuclease	A0A0C5AFD8	Paenibacillus_phage	8.8e-20	47.7
QAS26797.1\|1416826_1417285_+\|terminase	phage terminase small subunit P27 family	F8J1A9	Lactobacillus_phage	3.1e-15	35.3
QAS26798.1\|1419082_1420312_+\|portal	phage portal protein	A0A0U3SQF0	Bacillus_phage	8.4e-108	50.8
QAS26799.1\|1420283_1421003_+\|protease	Clp protease ClpP	A0A0B5A796	Paenibacillus_phage	2.0e-64	57.0
QAS26800.1\|1421005_1422151_+\|capsid	phage major capsid protein	A0A0C5AEH1	Paenibacillus_phage	4.9e-86	45.6
QAS26801.1\|1422383_1422728_+\|head,tail	phage gp6-like head-tail connector protein	F8J1B6	Lactobacillus_phage	2.6e-06	33.0
QAS26802.1\|1422711_1423074_+\|head,tail	head-tail adaptor protein	E9LUQ5	Lactobacillus_phage	6.4e-64	96.7
QAS26803.1\|1423063_1423504_+\|tail	phage tail protein	E9LUQ6	Lactobacillus_phage	9.4e-78	97.3
QAS26804.1\|1423500_1423884_+	hypothetical protein	E9LUQ7	Lactobacillus_phage	2.1e-65	97.6
QAS26805.1\|1423884_1424523_+\|tail	phage tail protein	E9LUQ8	Lactobacillus_phage	3.9e-109	93.4
QAS26806.1\|1424724_1425108_+	hypothetical protein	E9LUQ9	Lactobacillus_phage	5.7e-63	98.4
QAS26807.1\|1425104_1425296_+	hypothetical protein	E9LUR0	Lactobacillus_phage	1.5e-27	100.0
QAS26808.1\|1425308_1430531_+\|tail	phage tail protein	E9LUR1	Lactobacillus_phage	0.0e+00	70.0
QAS26809.1\|1430602_1430794_+	hypothetical protein	E9LUR2	Lactobacillus_phage	6.8e-25	100.0
QAS26810.1\|1430786_1431562_-\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2
QAS26811.1\|1433296_1435675_+	hypothetical protein	E9LUR3	Lactobacillus_phage	0.0e+00	94.6
QAS26812.1\|1435667_1438433_+\|tail	phage tail protein	A0A2P0ZL34	Lactobacillus_phage	5.9e-194	50.1
QAS26813.1\|1438425_1438680_+	hypothetical protein	E9LUR5	Lactobacillus_phage	1.4e-30	100.0
QAS26814.1\|1439606_1440779_+	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	3.9e-211	98.2
QAS26815.1\|1440778_1441042_+\|holin	holin	E9LUR9	Lactobacillus_phage	2.0e-38	100.0
QAS26816.1\|1441054_1441585_+\|holin	holin	E9LUS0	Lactobacillus_phage	2.9e-41	100.0
QAS26817.1\|1442822_1444034_+	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
QAS26818.1\|1444511_1446254_+	ABC transporter permease subunit	NA	NA	NA	NA
QAS26819.1\|1446272_1447064_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.0e-31	37.3
QAS26820.1\|1447044_1448229_+	LytR family transcriptional regulator	NA	NA	NA	NA
QAS26821.1\|1448380_1448953_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
QAS26822.1\|1449704_1450646_-	glycosyltransferase	V9QJB1	Oenococcus_phage	2.4e-78	49.0
QAS26823.1\|1451090_1451483_-	hypothetical protein	NA	NA	NA	NA
QAS26824.1\|1452074_1453244_+	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
QAS28304.1\|1454228_1454390_+	hypothetical protein	NA	NA	NA	NA
QAS26825.1\|1454478_1455111_-	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	2.3e-16	56.2
QAS26826.1\|1455262_1455502_+	DUF896 domain-containing protein	NA	NA	NA	NA
QAS26827.1\|1455599_1455836_+	YneF family protein	NA	NA	NA	NA
QAS26828.1\|1455892_1456528_-	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
QAS26829.1\|1456639_1457398_+\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
QAS26830.1\|1457381_1457687_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
QAS26831.1\|1457771_1458770_+	D-2-hydroxyacid dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	1.0e-47	35.2
QAS26832.1\|1459058_1459781_-	HAD family hydrolase	NA	NA	NA	NA
QAS26833.1\|1460005_1460809_+	30S ribosomal protein S2	NA	NA	NA	NA
QAS26834.1\|1460911_1461790_+	elongation factor Ts	NA	NA	NA	NA
1461011:1461028	attR	NA	NA	NA	NA
QAS26835.1\|1461990_1462713_+	UMP kinase	NA	NA	NA	NA
QAS26836.1\|1462714_1463278_+	ribosome recycling factor	NA	NA	NA	NA
QAS26837.1\|1463397_1464177_+	isoprenyl transferase	R9W0U9	Flavobacterium_phage	1.1e-23	43.1
QAS26838.1\|1464192_1464978_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
QAS26839.1\|1465015_1466293_+\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
QAS26840.1\|1466332_1468042_+\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
QAS26841.1\|1468535_1472849_+	DNA polymerase III subunit alpha	A0A1X9SH08	Bradyrhizobium_phage	1.0e-14	34.0
QAS26842.1\|1473144_1473621_+	ribosome maturation factor RimP	NA	NA	NA	NA
QAS26843.1\|1473641_1474859_+	transcription termination/antitermination protein NusA	NA	NA	NA	NA
QAS26844.1\|1474903_1475203_+	YlxR family protein	NA	NA	NA	NA
QAS26845.1\|1475192_1475498_+	hypothetical protein	NA	NA	NA	NA
QAS26846.1\|1475512_1478089_+	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	9.6e-21	23.3
QAS26847.1\|1478111_1478465_+	30S ribosome-binding factor RbfA	NA	NA	NA	NA
QAS26848.1\|1479113_1480478_+	MFS transporter	NA	NA	NA	NA
QAS26849.1\|1480470_1481640_+	chorismate synthase	NA	NA	NA	NA
QAS26850.1\|1481648_1482176_+	amino acid biosynthesis protein	NA	NA	NA	NA
QAS26851.1\|1482189_1483488_+	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
QAS26852.1\|1484590_1485112_+	shikimate kinase	NA	NA	NA	NA
QAS26853.1\|1485596_1486520_+\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA

DBSCAN-SWA_5

1970546 : 1979063

Lactobacillus_phage(85.71%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAS27304.1\|1970546_1971542_-	glycosyltransferase	S5FKN0	Shigella_phage	3.1e-52	38.8
QAS27305.1\|1972168_1972306_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
QAS27306.1\|1972401_1972842_+	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	3.0e-76	98.6
QAS27307.1\|1972912_1973473_-	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	2.7e-101	100.0
QAS27308.1\|1973560_1975999_-	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.6
QAS27309.1\|1976001_1976616_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
QAS27310.1\|1976958_1977906_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	1.0e-177	99.7
QAS27311.1\|1978091_1979063_+	peptidase S41	A0A2P0ZL68	Lactobacillus_phage	5.9e-181	98.5

DBSCAN-SWA_6

2764853 : 2875768

101

Lactobacillus_phage(26.67%)

transposase,protease,tRNA,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAS27950.1\|2764853_2766125_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	4.5e-96	43.7
QAS27951.1\|2766591_2768205_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	2.8e-143	49.7
QAS27952.1\|2768377_2768986_-	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
QAS27953.1\|2769030_2769471_-	DUF1934 domain-containing protein	NA	NA	NA	NA
QAS27954.1\|2769833_2770766_+	lipoate--protein ligase family protein	NA	NA	NA	NA
QAS27955.1\|2770780_2772133_+	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	5.2e-26	32.9
QAS27956.1\|2772152_2772962_+	sugar-phosphatase	NA	NA	NA	NA
QAS27957.1\|2773131_2774118_-	lipoprotein	NA	NA	NA	NA
QAS27958.1\|2774200_2775223_-	YdcF family protein	NA	NA	NA	NA
QAS27959.1\|2775512_2776493_-	ribose-phosphate diphosphokinase	A0A2K9L8D8	Tupanvirus	4.9e-42	36.3
QAS27960.1\|2776848_2777682_-	serine hydrolase	NA	NA	NA	NA
QAS27961.1\|2777917_2779300_-	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A2K9L140	Tupanvirus	7.4e-28	33.2
QAS27962.1\|2779368_2780205_-	pur operon repressor	NA	NA	NA	NA
QAS27963.1\|2780697_2780961_-	hypothetical protein	NA	NA	NA	NA
QAS27964.1\|2780975_2781518_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
QAS27965.1\|2782597_2783401_-	metal ABC transporter permease	NA	NA	NA	NA
QAS27966.1\|2783387_2784086_-	ABC transporter ATP-binding protein	A0A1V0SGN0	Hokovirus	1.2e-15	27.8
QAS27967.1\|2784354_2785299_-	alpha/beta hydrolase	NA	NA	NA	NA
QAS27968.1\|2785344_2785527_+	hypothetical protein	NA	NA	NA	NA
QAS27969.1\|2785608_2786475_-	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
QAS27970.1\|2786607_2786859_-	hypothetical protein	NA	NA	NA	NA
QAS27971.1\|2786963_2787854_-	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
QAS27972.1\|2787850_2788414_-	ribonuclease M5	NA	NA	NA	NA
QAS27973.1\|2788400_2789177_-	TatD family deoxyribonuclease	NA	NA	NA	NA
QAS27974.1\|2789428_2789917_-	hypothetical protein	NA	NA	NA	NA
QAS27975.1\|2790479_2791370_+	transcriptional regulator	NA	NA	NA	NA
QAS27976.1\|2791403_2792588_-	Bcr/CflA family efflux MFS transporter	NA	NA	NA	NA
QAS27977.1\|2792820_2794872_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	2.7e-90	35.8
QAS27978.1\|2795193_2795583_-	NUDIX domain-containing protein	NA	NA	NA	NA
QAS27979.1\|2796179_2797022_-	DUF72 domain-containing protein	NA	NA	NA	NA
QAS27980.1\|2797021_2797726_-	NAD-dependent protein deacetylase	NA	NA	NA	NA
QAS27981.1\|2797747_2798707_-	IpaB/EvcA family protein	NA	NA	NA	NA
QAS27982.1\|2798699_2799974_-	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
QAS27983.1\|2800019_2800937_-	Ppx/GppA family phosphatase	NA	NA	NA	NA
QAS27984.1\|2801106_2801901_-	hypothetical protein	NA	NA	NA	NA
QAS27985.1\|2801905_2803138_-	hypothetical protein	NA	NA	NA	NA
QAS27986.1\|2803493_2804507_-\|tRNA	tRNA-dihydrouridine synthase family protein	NA	NA	NA	NA
QAS27987.1\|2804619_2805366_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
QAS27988.1\|2805515_2806412_-	ROK family protein	NA	NA	NA	NA
QAS27989.1\|2806532_2807969_-	glycosyl hydrolase family protein	A0A0B5JD41	Pandoravirus	9.7e-31	25.5
QAS28338.1\|2807986_2809342_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
QAS27990.1\|2809564_2809987_-	DUF3284 domain-containing protein	NA	NA	NA	NA
QAS27991.1\|2809976_2810165_-	hypothetical protein	NA	NA	NA	NA
QAS27992.1\|2810171_2811533_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
QAS27993.1\|2811605_2812316_-	GntR family transcriptional regulator	NA	NA	NA	NA
QAS27994.1\|2812723_2813740_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
QAS27995.1\|2814179_2814956_-	carbon-nitrogen family hydrolase	NA	NA	NA	NA
QAS27996.1\|2815213_2817523_+	ATP-dependent DNA helicase	NA	NA	NA	NA
QAS27997.1\|2817617_2817821_-	hypothetical protein	NA	NA	NA	NA
QAS27998.1\|2817958_2818645_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
QAS27999.1\|2818738_2819419_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
QAS28000.1\|2819505_2820174_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
QAS28001.1\|2821020_2822397_-	HlyD family secretion protein	NA	NA	NA	NA
QAS28002.1\|2822412_2824563_-	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	6.1e-45	27.9
QAS28003.1\|2824829_2825000_+\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnE	NA	NA	NA	NA
QAS28004.1\|2825024_2825183_+\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA
QAS28005.1\|2825281_2826055_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
QAS28006.1\|2826360_2827104_-	response regulator transcription factor	NA	NA	NA	NA
QAS28007.1\|2828038_2829214_-\|transposase	IS256 family transposase	NA	NA	NA	NA
QAS28008.1\|2829443_2830286_-\|transposase	IS3 family transposase	Q6J1X2	Lactobacillus_phage	8.8e-157	99.3
QAS28009.1\|2830339_2830591_-\|transposase	IS3 family transposase	Q6J1X3	Lactobacillus_phage	9.2e-38	96.4
QAS28010.1\|2831576_2831744_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
QAS28011.1\|2831871_2832072_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
QAS28012.1\|2833263_2833932_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
QAS28013.1\|2833956_2834109_+	hypothetical protein	NA	NA	NA	NA
QAS28014.1\|2834888_2835089_-	hypothetical protein	NA	NA	NA	NA
QAS28015.1\|2835429_2836614_-	cation:proton antiporter	NA	NA	NA	NA
QAS28016.1\|2836658_2838035_-	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
QAS28017.1\|2838560_2839376_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
QAS28018.1\|2839535_2840408_+	AraC family transcriptional regulator	NA	NA	NA	NA
QAS28019.1\|2840478_2841270_+	HAD family hydrolase	NA	NA	NA	NA
QAS28020.1\|2841273_2842428_+	MFS transporter	NA	NA	NA	NA
QAS28021.1\|2842431_2843049_+	sugar O-acetyltransferase	NA	NA	NA	NA
QAS28022.1\|2843327_2843792_-	hypothetical protein	NA	NA	NA	NA
QAS28023.1\|2844082_2844502_-	hypothetical protein	NA	NA	NA	NA
QAS28024.1\|2845076_2845322_-	hypothetical protein	NA	NA	NA	NA
QAS28025.1\|2845580_2845832_+\|transposase	IS3 family transposase	Q6J1X3	Lactobacillus_phage	9.2e-38	96.4
QAS28026.1\|2845885_2846728_+\|transposase	IS3 family transposase	Q6J1X2	Lactobacillus_phage	8.8e-157	99.3
QAS28027.1\|2846768_2847734_-	hypothetical protein	NA	NA	NA	NA
QAS28339.1\|2847857_2847974_-	hypothetical protein	NA	NA	NA	NA
QAS28340.1\|2848354_2848561_-	hypothetical protein	NA	NA	NA	NA
QAS28028.1\|2848593_2850414_-	hypothetical protein	NA	NA	NA	NA
QAS28029.1\|2850415_2854111_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
QAS28030.1\|2854697_2855420_-	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	3.2e-30	31.9
QAS28031.1\|2855434_2857264_-	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
QAS28032.1\|2857278_2858796_-	glycerol kinase	NA	NA	NA	NA
QAS28033.1\|2859261_2860593_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
QAS28034.1\|2860670_2861642_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.0e-23	31.2
QAS28035.1\|2861642_2863169_-	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
QAS28036.1\|2863406_2863853_+	ribonuclease H	NA	NA	NA	NA
QAS28037.1\|2866345_2867245_-	oxidoreductase	NA	NA	NA	NA
QAS28038.1\|2867381_2868302_+	ribonucleoside hydrolase RihC	NA	NA	NA	NA
QAS28039.1\|2868467_2869040_-	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
QAS28040.1\|2869143_2869599_-	hypothetical protein	NA	NA	NA	NA
QAS28041.1\|2869617_2870088_-	transcriptional regulator	NA	NA	NA	NA
QAS28042.1\|2870197_2871394_+	DUF2075 domain-containing protein	NA	NA	NA	NA
QAS28043.1\|2871424_2871934_+	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
QAS28044.1\|2872046_2872415_-	DUF1304 domain-containing protein	NA	NA	NA	NA
QAS28045.1\|2872679_2874185_-	copper oxidase	NA	NA	NA	NA
QAS28046.1\|2874342_2875011_-	ribose 5-phosphate isomerase A	NA	NA	NA	NA
QAS28047.1\|2875204_2875768_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP035171

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP035171_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP035171_1

8103-8204

Orphan

Consensus_repeat	Method
ACCCATACTGAAAGCTAGTACTAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP035171_1

>merge|CP035171|1|8103-8204|CRISPRCasFinder
ACCCATACTGAAAGCTAGTACTATGATTAGCCATTACAGAATAGCAGTATAGCTTACCATATGAGAGCTATCGCTCAAACCCATACTGAAAGCTAGTACTGT

>CP035171|1|1|8103-8204|CRISPRCasFinder
ACCCATACTGAAAGCTAGTACTAT	GATTAGCCATTACAGAATAGCAGTATAGCTTACCATATGAGAGCTATCGCTCAA
ACCCATACTGAAAGCTAGTACTGT

Protein	Signature genes	Signature genes Name	Protein_function
CP035171.1\|QAS28444.1\|24604_25300_+\|glycerophosphodiester-phosphodiesterase	unknown	unknown	gnl\|CDD\|176506
CP035171.1\|QAS28438.1\|14817_15747_-\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
CP035171.1\|QAS28439.1\|16092_17856_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227904
CP035171.1\|QAS28434.1\|5036_5219_+\|hypothetical-protein	unknown	unknown	unknown
CP035171.1\|QAS28442.1\|22346_23177_+\|carbohydrate-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223472
CP035171.1\|QAS28433.1\|2303_2582_+\|hypothetical-protein	unknown	unknown	unknown
CP035171.1\|QAS28451.1\|2622_3327_-\|hypothetical-protein	unknown	unknown	unknown
CP035171.1\|QAS28441.1\|21384_22347_+\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224096
CP035171.1\|QAS28440.1\|18125_18680_-\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
CP035171.1\|QAS28437.1\|6920_7163_+\|hypothetical-protein	unknown	unknown	unknown
CP035171.1\|QAS28445.1\|26689_27307_+\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
CP035171.1\|QAS28443.1\|23173_24538_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270451
CP035171.1\|QAS28452.1\|10170_10368_-\|hypothetical-protein	unknown	unknown	unknown
CP035171.1\|QAS28446.1\|27770_28160_-\|hypothetical-protein	unknown	unknown	unknown
CP035171.1\|QAS28435.1\|5621_6410_+\|ParA-family-protein	unknown	unknown	gnl\|CDD\|379293
CP035171.1\|QAS28436.1\|6402_6636_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP035171.1\|QAS28440.1\|18125_18680_-\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	5.59273e-53
CP035171.1\|QAS28442.1\|22346_23177_+\|carbohydrate-ABC-transporter-permease	gnl\|CDD\|223472	COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism].	4.26194e-74
CP035171.1\|QAS28445.1\|26689_27307_+\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	1.06358e-45
CP035171.1\|QAS28438.1\|14817_15747_-\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	8.37609e-69
CP035171.1\|QAS28439.1\|16092_17856_+\|hypothetical-protein	gnl\|CDD\|227904	COG5617, COG5617, Predicted integral membrane protein [Function unknown].	8.00797e-05
CP035171.1\|QAS28444.1\|24604_25300_+\|glycerophosphodiester-phosphodiesterase	gnl\|CDD\|176506	cd08563, GDPD_TtGDE_like, Glycerophosphodiester phosphodiesterase domain of Thermoanaerobacter tengcongensis and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in Thermoanaerobacter tengcongensis glycerophosphodiester phosphodiesterase (TtGDE, EC 3.1.4.46) and its uncharacterized homologs. Members in this family show high sequence similarity to Escherichia coli GP-GDE, which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols. Despite the fact that most of GDPD family members exist as the monomer, TtGDE can function as a dimeric unit. Its catalytic mechanism is based on the general base-acid catalysis, which is similar to that of phosphoinositide-specific phospholipases C (PI-PLCs, EC 3.1.4.11). A divalent metal cation is required for the enzyme activity of TtGDE.	3.09866e-73
CP035171.1\|QAS28443.1\|23173_24538_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270451	cd14748, PBP2_UgpB, The periplasmic-binding component of ABC transport system specific for sn-glycerol-3-phosphate; possesses type 2 periplasmic binding fold. This group includes the periplasmic component of an ABC transport system specific for sn-glycerol-3-phosphate (G3P) and closely related proteins from archaea and bacteria. Under phophate starvation conditions, Escherichia coli can utilize G3P as phosphate source when exclusively imported by an ATP-binding cassette (ABC) transporter composed of the periplasmic binding protein, UgpB, the transmembrane subunits, UgpA and UgpE, and a homodimer of the nucleotide binding subunit, UgpC. Members of this group belong to the type 2 periplasmic-binding fold superfamily. PBP2 proteins are comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	7.1815e-73
CP035171.1\|QAS28435.1\|5621_6410_+\|ParA-family-protein	gnl\|CDD\|379293	pfam13614, AAA_31, AAA domain. This family includes a wide variety of AAA domains including some that have lost essential nucleotide binding residues in the P-loop.	3.64979e-33
CP035171.1\|QAS28441.1\|21384_22347_+\|sugar-ABC-transporter-permease	gnl\|CDD\|224096	COG1175, UgpA, ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism].	2.3941e-80

>CP035171.1|QAS28437.1|6920_7163_+|hypothetical-protein
MLGSLLQLLGLSRWYHHEQHADRSNARKASGQSAFSYQDLNGLRKLAFWLFVISVFMNWGMFGAIMLIAWIAMWAVSLLF
>CP035171.1|QAS28436.1|6402_6636_+|hypothetical-protein
MADDFLNKLAQQANQQLGDNESPFKQKKEVTRPVQVRESTYKMVKDIAYHKDAKIVDVIDSMLKYAINSDEFSENNK
>CP035171.1|QAS28435.1|5621_6410_+|ParA-family-protein
MTCKTLLHFNFKGGVGKTTLSVMDTYLLGELGHKVLLIDLDPQANATEIMRTTYNVKTEPNVDLFNGLLKLDLTHSIIELTDNVSMIPADWSLSLWPGKVEKIRNHDRMLILKTLIEQFKSQFEYIIVDVPPTLSIFTNNAILASDYVSLVLQTQKQAYTSVLKTAQYMYQLKNDYHATFDVSGVILYLVKRDAKVDREITKAATESFGDAVFINRIWQQERVKLFSNTGIKDEDYWDKKAISMYTMVLKEELHRIEEINNG
>CP035171.1|QAS28434.1|5036_5219_+|hypothetical-protein
MLPTTSINLHSRLNPLKNALMDADSTYLVLFGYQLLVVTMPKHRFTTRAVNGRPHHSSPA
>CP035171.1|QAS28451.1|2622_3327_-|hypothetical-protein
MTYRDSRFVLVPHSVSLLLRKQIIVNLKRGWQYITAQNSPLTLTMEKQINKIVAAEDALVPGELRQEKGGVDLGSEDFFEPPLINEKQEQSFLQKILADPRTTITDKALTVMYHNMRQQIFWDGNKGTATLSANKIMIDGGAGLINVPLDKWDQWNELIANYYQTNDMTKIKQWTYDNGIQGLQIRANKKLSDNELNQMYKQLKKTDKLELKLVEDEISKRTQNHLKDFAKNNL
>CP035171.1|QAS28433.1|2303_2582_+|hypothetical-protein
MPNQYEKLVEQQARLKQKIEREDFKLRQSKYYENRQARKARSRRLIQKGDLLEKYFQADNLSVEQTEELLKIFADYVNAHKPNKLKNDQPNN
>CP035171.1|QAS28452.1|10170_10368_-|hypothetical-protein
MIFIAAELVAISLTCVAGFVLGVAAWRFTALEATDVALLVLSVLAADLTAVLLTWLIEPEAALVV
>CP035171.1|QAS28438.1|14817_15747_-|IS30-family-transposase
MSSITYSERIKIETFCELGLSNIQMSDRLKRSPATISYELARCEPYQAEVAQTDAEYKRSRCGRKTKLSDELKQTILNHLRLSWSPEMIAHEFKLATKSIYNWLNQGKIEFSLNDLPEHGVRQRRNLDQRSKYNQSLGRSIEQRPIVVNRRNRIGDFELDTIVGPRGHSKAVLLTLIDRKSRFLWAYRLKNRTAVTVNEALNKFLATFNGPVHSFTVDRGTEFSGLVSLESQYGIKTYYCHAYTPAERGSNERFNRNLRYFYPKGTYFEHISAQGLKTTLLEINQRPLKIFGWQTPYQVMLTNLSKNSD
>CP035171.1|QAS28439.1|16092_17856_+|hypothetical-protein
MLSIRFKRILTSVQAKPIINVLIILVLAFVSSYPAFTGHFFALSNDGAIHLARLESLYQAFKVGRLPSLVNFIGFNNSGVAMNAMYPWLTMMIYVIPRLLIQSPMLALALGFFIMNTITITNSYLLAKYLGHSRLITLLGLITYQFNAYHFQLMYTRVAIGEAFGYAFLPLVILGLFKIWNREKSGIFWLSIGMSLVANSHVLSLMMFTILVGILETIRLFSRKMDLNELKYLMLSVGLTILMSLYSLFNVIDWILHNKMVSPTPALIGLDPNHEFSRILSNDITESATGAHMGIAITFILIYLLAQLLSKTTGSWRYWAIGAGSIFILAQNWLPTYKLINTPATLIQFTMRFLTIVAMGTTIALILYLNHNNWHMPATAIFISLFVIIIGLTGVIQFHNQNKCNYLWSLAHHHSSFIVNQFQIRHLTSKNYYKNVQRMDVPDYHLKNPNVERAIKHALKRDLNFKNANRLNKKTVAFDHKSRAKFKFISANDQQVSFKFHQSHTKALKLPVIGYKNVNYQIKVNDHLVKYAHSQGQLKANLPAGHSKITVSIANNSRHGWALFITLFAYIASLLIFSSHWRIGARH
>CP035171.1|QAS28440.1|18125_18680_-|recombinase-family-protein
MKYGYARVSTTDQKLANQIELLKLAGAEKIFQEKFTGTTTARPEFQKLLRVLKTGDTLIVTKLDRFARNTREALAIIQELFKENVKVNILNMGLIDNTPTGQLVFTIFSAFAQFERDMIVTRTQEGKLYAKQHDPLFREGRPKTYSDEQIRFAYELRKQGMTYKMIERKTGISKRTQQRRFKSI
>CP035171.1|QAS28441.1|21384_22347_+|sugar-ABC-transporter-permease
MLKSPAQSTPTTPPSVEKTKSEIADQEAKFTLNAKDKYFAWAFLGPSLLILGVFIFYPMVKTLYLSLFLTNTVGKTTVFVGLSNYINLLTSADYLSSLGVTLFYVFAVTIITIALGLVLANLASKRLPGIGIFRTLFSATMGVSVSVAAIFWLFIFNPSTGFLSLISTWMHLPQIPWLTDPTAAMWAVIVTTVWMNLGFTFLILLGAMTSVPTTLYEAANIEGASSRFQFFHITIPSISPTLFFVSIITLIESFKSFGLIDLMTKGGPTNATNMLVYRIYKDAFYSGNYAQASAESIILTIIIALFTLLQFKVLEKRVNY
>CP035171.1|QAS28442.1|22346_23177_+|carbohydrate-ABC-transporter-permease
MDIVTKPKLSRRIWDYVLLTVLAVVVLAPFLIGLWTSFLPTMQIAKGNFLSTQVSFQNYIDAFTQTPILRYLGNSLVISTTTMIAQLLFCSMSAYAFVFLKFKGRKFLFGLFLATMMLPFEAEIIPNFQTVKALGLLNTYSVMVIPFLISAFGVFMLRQSFMQMPIELKEAADIEGLGHFQFYWKMVLPYNRIPLMTLGAYSFLGAWNQYLWPMLTTFSNDFRPVQNGLRQLQSEETFNDWGMIQATAAIVVIPTLIVLFIGQHYFKSGVNEGAVK
>CP035171.1|QAS28443.1|23173_24538_+|ABC-transporter-substrate-binding-protein
MMKKLAAFMKNYALPIFAVFAIVLGIVFVNEYKNASAAKASRIPVVFWNEMGGPAEVALDKMVDDFNKSQDKYEVIPQYQGAYDEAVQKIIQSHGTSASPALFQSFDISTAQMMHSKYTTPVQKFIDEDNYDTSDISPVARSFYSNKGTQLAMPFNTSQPVLYYNSSLFKKYGVTPPSKSPSYSEVTRAAKELYEKSHHKVKGMTMEIYGWLMEEALANAHTSLINNGDGHTGNPTKIDLNNPTTKKFLTWIRTNIKSGDFVNYGSGSSAETNEIAAFLANKLGIFVQSSAYIGQLTTGTKNKLGISYFPHPDGVKANGVGIGGAALWISNDKPAKTQRGAWEFIKFTQTAKNQANWQKATGYLALNKNSQKTKTLQDLYKKVPAAKVPGEQLASAKPNNTNSGILMEGMQLTRELEETAMESVYNGADINSALNTANKAMNANLKTTNKADDR
>CP035171.1|QAS28444.1|24604_25300_+|glycerophosphodiester-phosphodiesterase
MSKKTLIFGHRGYPFKFPENSLKGFKYAIDHGIDGLEFDVHLTKDNIPVIIHDEKINRTTDGKGLINRYTLQEVQQFHMRDGETIPTLKDLLALAVHRPVHLNLEFKTNKIHYPNIEQIVLDLVKQYDLIYPVIYSSFNLDSLKVAYRIDPSQQYCLLSDHVIKDAKTLILKEHLAGLHLSHYQPLANVDERIWTVDDPKDQKRLLADHVAGIITDNFEQAVRLKNDVVAM
>CP035171.1|QAS28445.1|26689_27307_+|recombinase-family-protein
MKIGYARVSSTDQNLARQIKALKKAECEKIFEEKQSGKSTENRPELQAAIAYVRQGDTLVIASLDRLSRNYDDASDIIKQIRDKQVKMEVLDAPFLSMRTGDSDMDKFMFDLLTKLLAYMAQTERKKIRERQRQGIEIAKANGKYRGTRPAYAADAPNPQKRFIYRRIVDQLRNKATGAPISYRAIAAETGVSVQTVINIKNRLV
>CP035171.1|QAS28446.1|27770_28160_-|hypothetical-protein
MQLNNSPQVCRLLEILKADSCKAYVKPIDFTKLFTECFFVTASQINPRIKAQHGYFMFQPFLETTSISTIQNMITQQYEPQKIIVPATYKDLIQKELRHLGYSRETLFPDEEALGVKYSETINSINNSH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP035171_1	1.1\|8127\|54\|CP035171\|CRISPRCasFinder	8127-8180	54	NZ_CP035171	Lactobacillus plantarum strain SRCM103418 plasmid unnamed3	8127-8180	0	1.0
CP035171_1	1.1\|8127\|54\|CP035171\|CRISPRCasFinder	8127-8180	54	NZ_CP025589	Lactobacillus plantarum strain KC3 plasmid unnamed3, complete sequence	21850-21903	3	0.944

1. spacer 1.1|8127|54|CP035171|CRISPRCasFinder matches to NZ_CP035171 (Lactobacillus plantarum strain SRCM103418 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

gattagccattacagaatagcagtatagcttaccatatgagagctatcgctcaa	CRISPR spacer
gattagccattacagaatagcagtatagcttaccatatgagagctatcgctcaa	Protospacer
******************************************************

2. spacer 1.1|8127|54|CP035171|CRISPRCasFinder matches to NZ_CP025589 (Lactobacillus plantarum strain KC3 plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.944

gattagccattacagaatagcagtatagcttaccatatgagagctatcgctcaa-	CRISPR spacer
gattagccattagagaatagcagtatagcttaccatatgggagcta-cgctcaaa	Protospacer
************ **************************.****** *******

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP035168

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP035171

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection