CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
CP034097	Acinetobacter baumannii strain A52 plasmid pA52-OXA-72, complete sequence	0 crisprs	NA	0	0
CP034096	Acinetobacter baumannii strain A52 plasmid pA52-4, complete sequence	0 crisprs	NA	0	0
CP034095	Acinetobacter baumannii strain A52 plasmid pA52-3, complete sequence	0 crisprs	NA	0	0
CP034093	Acinetobacter baumannii strain A52 plasmid pA52-1, complete sequence	0 crisprs	DEDDh	0	3
CP034092	Acinetobacter baumannii strain A52 chromosome, complete genome	2 crisprs	cas3,DEDDh,WYL,csa3,RT	1	5
CP034094	Acinetobacter baumannii strain A52 plasmid pA52-2, complete sequence	0 crisprs	NA	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP034092_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP034092_1

664196-664280

Orphan

Consensus_repeat	Method
TTTTAACTTTGGCGCAAGACAAGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP034092_1

>merge|CP034092|1|664196-664280|CRISPRCasFinder
TTTTAACTTTGGCGCAAGACAAGCAGTGAAACTGCGCGTAGAGTAAAGAAGATTGATAATCTTTTAATTTTGGCGCAAGACAAGC

>CP034092|1|1|664196-664280|CRISPRCasFinder
TTTTAACTTTGGCGCAAGACAAGC	AGTGAAACTGCGCGTAGAGTAAAGAAGATTGATAATC
TTTTAATTTTGGCGCAAGACAAGC

Protein	Signature genes	Signature genes Name	Protein_function
CP034092.1\|QAB39413.1\|662566_662710_-\|entericidin-A/B-family-lipoprotein	unknown	unknown	gnl\|CDD\|227797
CP034092.1\|QAB39417.1\|665920_666706_-\|YdcF-family-protein	unknown	unknown	gnl\|CDD\|99750
CP034092.1\|QAB39418.1\|666832_669379_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|99797
CP034092.1\|QAB42218.1\|675357_675498_+\|hypothetical-protein	unknown	unknown	unknown
CP034092.1\|QAB39424.1\|675597_677073_+\|alanine:cation-symporter-family-protein	unknown	unknown	gnl\|CDD\|376500
CP034092.1\|QAB39409.1\|652763_653300_+\|purine-binding-chemotaxis-protein-CheW	unknown	unknown	gnl\|CDD\|223905
CP034092.1\|QAB39423.1\|674971_675175_+\|hypothetical-protein	unknown	unknown	unknown
CP034092.1\|QAB39421.1\|672514_673729_+\|Bcr/CflA-family-efflux-MFS-transporter	unknown	unknown	gnl\|CDD\|340878
CP034092.1\|QAB39411.1\|660804_661269_+\|hypothetical-protein	unknown	unknown	unknown
CP034092.1\|QAB39407.1\|651933_652317_+\|response-regulator	unknown	unknown	gnl\|CDD\|381093
CP034092.1\|QAB39420.1\|670212_672387_-\|TIGR01666-family-membrane-protein	unknown	unknown	gnl\|CDD\|130727
CP034092.1\|QAB39422.1\|673756_674461_-\|nitroreductase	unknown	unknown	gnl\|CDD\|380313
CP034092.1\|QAB39412.1\|661304_662441_-\|succinyl-diaminopimelate-desuccinylase	unknown	unknown	gnl\|CDD\|237265
CP034092.1\|QAB39416.1\|664340_664844_+\|L,D-transpeptidase	unknown	unknown	gnl\|CDD\|341130
CP034092.1\|QAB39419.1\|669536_670112_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379303
CP034092.1\|QAB42217.1\|651012_651612_-\|hypothetical-protein	unknown	unknown	unknown
CP034092.1\|QAB39410.1\|656748_657957_-\|IS256-like-element-ISAba26-family-transposase	unknown	unknown	gnl\|CDD\|225865
CP034092.1\|QAB39415.1\|663821_664190_+\|DUF454-domain-containing-protein	unknown	unknown	gnl\|CDD\|377291
CP034092.1\|QAB39414.1\|662808_663717_-\|DUF1853-family-protein	unknown	unknown	gnl\|CDD\|378094
CP034092.1\|QAB39408.1\|652340_652703_+\|response-regulator	unknown	unknown	gnl\|CDD\|381093

Protein	Function_ID	Function_description	E-value
CP034092.1\|QAB39413.1\|662566_662710_-\|entericidin-A/B-family-lipoprotein	gnl\|CDD\|227797	COG5510, COG5510, Predicted small secreted protein [Function unknown].	4.44613e-07
CP034092.1\|QAB39417.1\|665920_666706_-\|YdcF-family-protein	gnl\|CDD\|99750	cd06259, YdcF-like, YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been idenitified. The family also includes Escherichia coli sanA and Salmonella typhimurium sfiX, which are involved in vancomycin resistance; sfiX may also be involved in murein synthesis.	1.40229e-39
CP034092.1\|QAB39418.1\|666832_669379_-\|hypothetical-protein	gnl\|CDD\|99797	cd06200, SiR_like1, Cytochrome p450- like alpha subunits of E. coli sulfite reductase (SiR) multimerize with beta subunits to catalyze the NADPH dependent reduction of sulfite to sulfide. Beta subunits have an Fe4S4 cluster and a siroheme, while the alpha subunits (cysJ gene) are of the cytochrome p450 (CyPor) family having FAD and FMN as prosthetic groups and utilizing NADPH. Cypor (including cyt -450 reductase, nitric oxide synthase, and methionine synthase reductase) are ferredoxin reductase (FNR)-like proteins with an additional N-terminal FMN domain and a connecting sub-domain inserted within the flavin binding portion of the FNR-like domain. The connecting domain orients the N-terminal FMN domain with the C-terminal FNR domain. NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases. CYPOR transfers two electrons from NADPH to the heme of cytochrome p450 via FAD and FMN. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues, and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule, which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.	3.54371e-132
CP034092.1\|QAB39424.1\|675597_677073_+\|alanine:cation-symporter-family-protein	gnl\|CDD\|376500	pfam01235, Na_Ala_symp, Sodium:alanine symporter family.	0
CP034092.1\|QAB39409.1\|652763_653300_+\|purine-binding-chemotaxis-protein-CheW	gnl\|CDD\|223905	COG0835, CheW, Chemotaxis signal transduction protein [Cell motility and secretion / Signal transduction mechanisms].	2.92747e-31
CP034092.1\|QAB39421.1\|672514_673729_+\|Bcr/CflA-family-efflux-MFS-transporter	gnl\|CDD\|340878	cd17320, MFS_MdfA_MDR_like, Multidrug transporter MdfA and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as MdfA (also called chloramphenicol resistance pump Cmr), EmrD, MdtM, MdtL, bicyclomycin resistance protein (also called sulfonamide resistance protein), and the uncharacterized inner membrane transport protein YdhC. EmrD is a proton-dependent secondary transporter, first identified as an efflux pump for uncouplers of oxidative phosphorylation. It expels a range of drug molecules and amphipathic compounds across the inner membrane of E. coli. Similarly, MdfA is a secondary multidrug transporter that exports a broad spectrum of structurally and electrically dissimilar toxic compounds. These MDR transporters are drug/H+ antiporters (DHA) belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.59576e-94
CP034092.1\|QAB39420.1\|670212_672387_-\|TIGR01666-family-membrane-protein	gnl\|CDD\|130727	TIGR01666, Uncharacterized_protein_HI_1680, TIGR01666 family membrane protein. This model represents a clade of sequences from gamma and beta proteobacteria. These proteins are >700 amino acids long and many have been annotated as putative membrane proteins. The gene from Salmonella has been annotated as a putative efflux transporter. The gene from E. coli has the name yccS. [Cell envelope, Other].	0
CP034092.1\|QAB39422.1\|673756_674461_-\|nitroreductase	gnl\|CDD\|380313	cd02136, PnbA_NfnB-like, nitroreductase similar to Mycobacterium smegmatis NfnB. Members of this family utilize FMN as a cofactor and catalyze reduction of a variety of nitroaromatic compounds, including nitrofurans, nitrobenzens, nitrophenol, nitrobenzoate and quinones by using either NADH or NADPH as a source of reducing equivalents in an obligatory two-election transfer mechanism. The enzyme is typically a homodimer. Mycobacterium smegmatis nitroreductase NfnB plays a role in resistance to benzothiazinone.	1.03168e-34
CP034092.1\|QAB39410.1\|656748_657957_-\|IS256-like-element-ISAba26-family-transposase	gnl\|CDD\|225865	COG3328, COG3328, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	3.54199e-136
CP034092.1\|QAB39416.1\|664340_664844_+\|L,D-transpeptidase	gnl\|CDD\|341130	cd16913, YkuD_like, L,D-transpeptidases/carboxypeptidases similar to Bacillus YkuD. Members of the YkuD-like family of proteins are found in a range of bacteria. The best studied member Bacillus YkuD has been shown to act as an L,D-transpeptidase that gives rise to an alternative pathway for peptidoglycan cross-linking. Another member Helicobacter pylori Csd6 functions as an L,D-carboxypeptidase and regulates helical cell shape and motility. The conserved region contains a conserved histidine and cysteine, with the cysteine thought to be an active site residue.	8.56335e-26
CP034092.1\|QAB39419.1\|669536_670112_-\|hypothetical-protein	gnl\|CDD\|379303	pfam13630, SdpI, SdpI/YfhL protein family. This family of proteins includes the SdpI and YfhL proteins from B. subtilis. The SdpI protein is a multipass integral membrane protein that protects toxin-producing cells from being killed. Killing is mediated by the exported toxic protein SdpC an extracellular protein that induces the synthesis of an immunity protein.	0.00838382
CP034092.1\|QAB39407.1\|651933_652317_+\|response-regulator	gnl\|CDD\|381093	cd17538, REC_D1_PleD-like, first (D1) phosphoacceptor receiver (REC) domain of response regulator PleD and similar domains. PleD contains a REC domain (D1) with the phosphorylatable aspartate, a REC-like adaptor domain (D2), and the enzymatic diguanylate cyclase (DGC) domain, also called the GGDEF domain according to a conserved sequence motif, as its output domain. The GGDEF-containing PleD response regulators are global regulators of cell metabolism in some important human pathogens. This model describes D1 of PleD and similar domains. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	1.27194e-36
CP034092.1\|QAB39412.1\|661304_662441_-\|succinyl-diaminopimelate-desuccinylase	gnl\|CDD\|237265	PRK13009, PRK13009, succinyl-diaminopimelate desuccinylase; Reviewed.	0
CP034092.1\|QAB39415.1\|663821_664190_+\|DUF454-domain-containing-protein	gnl\|CDD\|377291	pfam04304, DUF454, Protein of unknown function (DUF454). Predicted membrane protein.	4.46882e-39
CP034092.1\|QAB39414.1\|662808_663717_-\|DUF1853-family-protein	gnl\|CDD\|378094	pfam08907, DUF1853, Domain of unknown function (DUF1853). This family of proteins are functionally uncharacterized.	5.07662e-40
CP034092.1\|QAB39408.1\|652340_652703_+\|response-regulator	gnl\|CDD\|381093	cd17538, REC_D1_PleD-like, first (D1) phosphoacceptor receiver (REC) domain of response regulator PleD and similar domains. PleD contains a REC domain (D1) with the phosphorylatable aspartate, a REC-like adaptor domain (D2), and the enzymatic diguanylate cyclase (DGC) domain, also called the GGDEF domain according to a conserved sequence motif, as its output domain. The GGDEF-containing PleD response regulators are global regulators of cell metabolism in some important human pathogens. This model describes D1 of PleD and similar domains. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	2.79368e-36

>CP034092.1|QAB39415.1|663821_664190_+|DUF454-domain-containing-protein
MRTLFWRTLVVIFITLGIIGAILPGMPTTVFLILAAWAASKGWPQMDAWLLNHPKYGPTLRDWRANGTVPRKAKWIATIMMTASGILMLFTSAPFWVKVFTDTTMLVVAIWLWLRPEPKLKD
>CP034092.1|QAB39414.1|662808_663717_-|DUF1853-family-protein
MNIASIKTSYFEPWLQFSHPMVRQLAFTIASPNLLSQLPCSLTIRHSFQLHTDKNWEQHFQNYLPRLKQLDEAPEPLLQFMSRLKSTRLGLRFENLLWFWLQEDQYHPYQLLGHSIQKIDGAKTLGELDFLVLNQNTQEIEHWEVALKYYLGEGQLNLEQWSGLNRQDTLSKKLYHFTDKQFQFSEALGFKVQQRFAVLKGQLYLPLNLPQEQPIPEWVNLKRRLGTWGTEIPKSDFYRLERHEWLCPHQKASSNTAYWWTDGLYCQNINETRFYMFRHPALLSLKPSLIKNNGVLQETTSL
>CP034092.1|QAB39413.1|662566_662710_-|entericidin-A/B-family-lipoprotein
MMKKVLVASVMVAFVLTGCNTFKGFGQDVSKAGDAVTNTAQKTENKM
>CP034092.1|QAB39412.1|661304_662441_-|succinyl-diaminopimelate-desuccinylase
MNHSDTLSLSLELLQQPSVTPIDHTCQTIMADRLAKVGFHIEPMRFGDVDNLWARRGTEGPVFCFAGHTDVVPTGRLDAWNSDPFAPEIRDGKLYGRGSADMKTALAAMVVASERFVAKHPNHKGSIAFLITSDEEGPAVNGTVKVIETLEKRNEKITWCLVGEPSSTHKLGDIVKNGRRGSLNAVLKVQGKQGHVAYPHLARNPIHEASPALAELCQTVWDNGNEYFPATSFQISNIHAGTGATNVIPGALEVTFNFRYSTEVTAEQLKQRVHEILDKHGLQYEIVWNLSGLPFLTPVGELVNAAQTAILNVTGTETELSTSGGTSDGRFIAPTGAQVLELGVLNATIHQINEHVDVHDLDPLTDIYEQILENLLAQ
>CP034092.1|QAB39411.1|660804_661269_+|hypothetical-protein
MKGSVNTSLIANMDQQELQHLITVSTGFIDAYIIECNDQVPMLLPQNIVLSAMDVKNGVKHIEWHDVKLPVYSVHNAIDQHAVALVIEGEDISQRFALICKTMPVSTRLRISEIVDEMDEHEAEQHPAVFKYVRMQHQRYYIPNLEYIEKTLGL
>CP034092.1|QAB39410.1|656748_657957_-|IS256-like-element-ISAba26-family-transposase
MDEATIKSMAAELAKGLKTPEDLNQMTAVFKKFMIETALNTELSDHLGYEKHQPKKGSNSRNGFSSKTITTQDGQLALDIPRDREGSFEPQIIKKHQTRITSMDDQILSLYAKGMTNREIVAFFKEMYDADVSASLISKVTDAVIEQVTEWQNRALDSLYPVVYLDCIVVKVRQHSNVINKSVYLALGINMDGQKELLGMWIAQTEGAKFWLSVMTELKNRGVQDILVACVDGLKGFPDAIASVYPHTDIQLCIVHVVRNSLRFVSWKDYKAVTSGLKAIYQASTEENALKSLDIFCDQWNHQYPKIGESWRANWENIRTIFSYPAEIRHAIYTTNAIESLNSVIRHSTKKRKIFSSDDSVKKVIYLATSNAAKKWTMPIQNWRLAMNWFTIQFDDRLKDHL
>CP034092.1|QAB39409.1|652763_653300_+|purine-binding-chemotaxis-protein-CheW
MAANGFIELLRLSKRGNKNYASVQNEAQRWSGIAFEMRGQYFVAPLGEVSEVIYPPKYTPVPNTQSWVKGLANIRGRLLSVSDLAHFISGQRSSFSSTQKVLCISHHDQYVGLVVDQVLGIQHFNKKSFFSQSSDLEENLKEYCQGYFHQHNQHWHVFLFSRLLQNPHYMNASTKFIN
>CP034092.1|QAB39408.1|652340_652703_+|response-regulator
MARILIVDDSPTETFRFKEILTKHGYDVLEASNGADGVTLAKAEQPDLVLMDVVMPGVNGFQATRQITRDEDTKHIPVVIVSTKDQATDRVWGKRQGAIDYLIKPIEEKQLIDVIKQFLN
>CP034092.1|QAB39407.1|651933_652317_+|response-regulator
MEDAFQNLKVMVIDDSKTIRRTAETLLQREGCEVITAVDGFEALSKIAEANPDIVFVDIMMPRLDGYQTCALIKNSQNYQNIPVIMLSSKDGLFDQAKGRVVGSDEYLTKPFSKDELLNAIRNHVSS
>CP034092.1|QAB42217.1|651012_651612_-|hypothetical-protein
MSVSIGIASCGALFFSSPTLAANAAPKAVWYRYYDQHGIANISTSVTPAHIRYGYEALDQNMQVIKRNHPYNSEADLNQSSQRALSARYREEDNKLKRAYSNSKTATIKRDQALLAIKKQINYQQDQLSQLQQDKILFKRQEMEYFRKGEQVPERHKTLIENNLMNINKVKQTLEILSKTYNRTNKDYENIIERLKKLE
>CP034092.1|QAB39416.1|664340_664844_+|L,D-transpeptidase
MSQFKLEDADILIDLANQTLSLPKHNKFYVVSTGKNGIGEQENTGKTPRGWHRVAKKFGMQSPKNAVFIARQPTGEVYSSELAAQFPERDWILSRILWLDGLEEGFNKGEGHDTMQRYIYIHGTPDKEPMGVPMSHGCIRMRNEEIIELFDLVSEDALVYLSEQSLT
>CP034092.1|QAB39417.1|665920_666706_-|YdcF-family-protein
MQVSKWIRIFLAVIGSILFLDGLFLAFLNKIHVGTLVPLVLGAFFCLYALFYYHLERFFFYHYRLHTLWRFGWLCFWIWLIGLGYFFNFIKENKDASQNLPAVKAIIVLGSGVENGQPSAILAKRLDTAAPVALSQPQAKVILTGGLDFSEKEPEALVMSRYLEQHFHIAKDRMILEDKSTSTELNLKNSKPLLEQAHISINQPIAIVTSDFHTPRAAAIAKKQGYTQVYMVAAETPLITRYNVWLREYFAYASGWLLNEY
>CP034092.1|QAB39418.1|666832_669379_-|hypothetical-protein
MFKKFLFQIHWFLGISAGLILSIMGVTGAIYSYDQQILKWVNTDSYVVQAQSSPKLTPAQLYQHFTTIQPEIKINSITIAKDPTASSVVNIEKEGERRGYNMMVNPYTAQVLPEVQGRKLLLLIQQIHRNLTAGEFGKQITGACALMLIYFVLSGLYLRWPKKHSARQWLAVKPKLKGRNFIWDLHAVVGTWVIVFYLLFACTGLYWSYDWWRSGMFKVLGIEQPKMQGHSGSGRNKDQLPKIQLDNAQLITALNQTWSGFNNQIGRDYSTLTVNLPKKDDGKIELSFVDATPQHERARNQAVYNYKTANIEKMELYEDKKLNQKIMSSMLPVHRGSFFGPVYQFVAMLASLAMPLFFVTGWMLYLKRRKQKKLTQAARQSLAGHYIDQNAKPWLITYATQTGVAEQLAWSTATSLQEAHQPVQVKSVQQLTEADLQQHEQILFVISTYGTGEAPDLASNFAKKLLKTNLELQHVKYAVLALGSKEYPDTYCSFGYTVDEWLKNNGAKALFDIIEVDNANPADIQNWNQALVKATKLDLHAVNIEKVFDNWTLQQRDLLNPNSLGQPAYNIELTASHEAVWQAGDIAEIQPGNSPERINKFLQHHHILKNAVVDSLQVSIEKALWNKDLTGEIEPFANLDHLLEQLPTLPTREYSIASIPSQQVLRLVVRQQYDESGDLGLGSGWLTQHTEINQNVALRIRTNESFHLIDDNRPIICIGNGTGIAGLMSLLHTRTRHNYTENWLIFGERQRAHDFFYASTIEAWQTMGMLKRLDLAFSRDQEQRVYVQDIIRQNAAELVNWIERGAVLYVCGSIDGMASGVDQALIHILGEEQVDELRQQGRYRRDVY
>CP034092.1|QAB39419.1|669536_670112_-|hypothetical-protein
MTAKTLYAYTLQPVPYEVSEAEQRNAQLLIWRSTNKISTKIWAIMGVILALAILGLIFIKNYSTVICWVAIVCVVLYYLGRKYGLEWYVKRKMNEFPVQEIKGIRLGVQPHGIVMRQQMGLQEGVGTIGWKNIYEWYNTPDFILVNFKVKDPKGQEQQGAYILPKRMDSKNFSFNTIRKHLKESVGEPKTL
>CP034092.1|QAB39420.1|670212_672387_-|TIGR01666-family-membrane-protein
MKSWFKRLKRATYNTSFMYNVRMLIAFSGTAFVPYFLGHQLATIPLTLGVVAAGLSDIDDRFSVRIMNLIYTYIGFFITAASVQLLFPYPMLFALGLIASCIGWILLGSLGRRYATISYGCLVVSVYTMLGVHLFDQWYIQPALLVAGAAWYGLIATISFLLFPVRQLQDKLAASYASLGDFLFAKSNLFDVDMTPASYQQSMIDLSLENGKLITIFNDLKTALLTRLKGDRGQKGTRRSLHYYFVAQDIHERADSAHIDYQKLAKIFQHSDILFRFQRILAIQGKACQELNECILQRKPYIHNKRFKQSFENLRLSLVKLRDDQQYDLLWVNALFALYRNLKSIDSQLLNLETEQHIQSDKVKQAENQLKDDDLKGWNDIVVRIKQNLTPESVLFRHAIRVSIVLFIGYVFIQMTHIEYGYWIMLTALFVSQPNFNATKRRLRLRIVGTLVGIIVGLSIVFLVPSVEGQLVMLILSGVLFFELRSKQYAQATAFITILALINFNLDGSAVAAAIPRFVDTLIGCALAWFGVTFIWPDWKFRRLPRSIRRSLQAQCNYLAEVVKQYHEGHNHALNYRIVRRAAHNTDAEVASLISTLATEPDFDPTRKSDIFEFLCLNHTFLSYIAALGAHREKIQDQAVLNVLDQALDDIQGALLRDEMPDLTAQNMLQTIRQRLSQNDEDDQKSLIILQQLSLMLSVLNRFSMLKQRLSHDLDNDASELASL
>CP034092.1|QAB39421.1|672514_673729_+|Bcr/CflA-family-efflux-MFS-transporter
MSEQTAQRQYSIGWIMLLALLTALGPLSIDMYLPALPQMAHDFGVSTQMVANTLPAYFFGLAIGQLVYGPLSDRIGRKKPLYFGLALYAVASLFCVLATNEWSLIAARILQALGGCVGVVMARAAIRDRLDVQGSAQAFSSMMIVMGLAPILAPMIGAWILIWFPWQAIFIALLIVGAICWLCVHFFFKETLAVDKRLKLSLYQVATLYGAIFKDASFRLPMFAGCLTGAALFCYISSAPAVFMDQYGLNQQEFAYVFGLNAFGIMLMSSLNKHLTTRVEITKRLKAGSMVQVTGASIVLIAGLISAAPLWLVMLGLFLAISGIGLTGPNAMALAMSKQGARAGTASAIMGSMQFACGLLGGVLLNFLIWSASLNMGVMMVLFTLSGFIVVLKAIRQAKSQSLS
>CP034092.1|QAB39422.1|673756_674461_-|nitroreductase
MNLEQVRLVDEAITSRHSVRAFLSTPIEPEVIKDILRVASRAPSGTNTQPWKVYVVTGHKRDEMVERVCAAQIEVSKNPELAEQYKETFAYYPEKWVSPFIDRRRENGWGLYGLLDIKKGEKEKMAAQQLRNFKLFDAPVGIFFTVNKAMGIGSKMDIAMMIQNVMVAAKARGLDTCPQAAWNHFHPLVLDILGAADDEELVCAIALGHADPEHIVNTFITPREPVENFAVFLD
>CP034092.1|QAB39423.1|674971_675175_+|hypothetical-protein
MSLPLINKQFMKQGLAITIATMKMNVTHATTEPQEIQQLGTDLNALFFNEKEKGTDSRVMTMACYSL
>CP034092.1|QAB42218.1|675357_675498_+|hypothetical-protein
MFSGAMNLFYLKGAFSHVTFKGLVLGMMLLKLVTVIAIQVTLKVFP
>CP034092.1|QAB39424.1|675597_677073_+|alanine:cation-symporter-family-protein
MNEQLNATLMSWVQFFNEPLWDFLVIFLLAVGIFYTVLTGAVQIRMFLQSIRVMKSSRTEGEDEHGLTPFQAFVTGLASRVGVGNIAGVAIAIAIGGPGAVFWMWVTAVLGMSSAFIESTLAQLFKVRDSNSKQFRGGPAYYITQGLRSKTFGVIFALALIFTYGFVFNSVQINAIANASSHAWGWDKANLIAHLGGVDLEISWVGLALVVMVALAIFGGIKRIAKFAEMFVPLKAGLYLSVALYIALSNYAILPDVLKLIVTEAFHFNAAAGGFFGAAVSMAMMQGIKRGLFSNEAGMGSAPNAAAASDVKHPVNQGLVQMLGVFVDTFIVCTSTAIIILVSGVYQDAGFVGVELTQRALETQVGHWGADFLAVLLFLFCYSAVLGNYAYAESNVQFINNNPKVMFIFRIFVLVMVYFGAIGSVPLVWSMADLFMGIMATINLVAILLLTPMARTLLKDYRAQLKQGIKEPVFKINKYPELKKKVDSDIW

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP034092_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP034092_2

1941979-1942060

Orphan

Consensus_repeat	Method
AAAGCGTTGCTTTACTTATCCTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP034092_2

>merge|CP034092|2|1941979-1942060|CRISPRCasFinder
AAAGCGTTGCTTTACTTATCCTCTTCCACTCGAGCACAGCTCTCGTCTTGCGCTCGGGTAAAGCGTTGCTTTACTTATCCTC

>CP034092|2|2|1941979-1942060|CRISPRCasFinder
AAAGCGTTGCTTTACTTATCCTC	TTCCACTCGAGCACAGCTCTCGTCTTGCGCTCGGGT
AAAGCGTTGCTTTACTTATCCTC

Protein	Signature genes	Signature genes Name	Protein_function
CP034092.1\|QAB40536.1\|1944605_1945877_+\|sigma-54-dependent-Fis-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225114
CP034092.1\|QAB40530.1\|1938000_1938855_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|227311
CP034092.1\|QAB40531.1\|1939021_1939939_+\|EamA-family-transporter	unknown	unknown	gnl\|CDD\|273359
CP034092.1\|QAB40532.1\|1939971_1940976_-\|homoserine-dehydrogenase	unknown	unknown	gnl\|CDD\|235763
CP034092.1\|QAB40524.1\|1932458_1932704_-\|ferredoxin-family-protein	unknown	unknown	gnl\|CDD\|224069
CP034092.1\|QAB40543.1\|1952789_1953752_-\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	unknown	unknown	gnl\|CDD\|238958
CP034092.1\|QAB40541.1\|1950219_1951755_-\|diaminohydroxyphosphoribosylaminopyrimidine-deaminase	unknown	unknown	gnl\|CDD\|237001
CP034092.1\|QAB40525.1\|1932724_1934458_-\|fumarate-reductase/succinate-dehydrogenase-flavoprotein-subunit	unknown	unknown	gnl\|CDD\|181346
CP034092.1\|QAB40539.1\|1947993_1948779_-\|acetoin-reductase	unknown	unknown	gnl\|CDD\|187624
CP034092.1\|QAB40527.1\|1935471_1936821_+\|chromate-efflux-transporter	unknown	unknown	gnl\|CDD\|273350
CP034092.1\|QAB40538.1\|1946905_1947964_-\|2,3-butanediol-dehydrogenase	unknown	unknown	gnl\|CDD\|176195
CP034092.1\|QAB40528.1\|1936904_1937513_-\|FMN-dependent-NADH-azoreductase	unknown	unknown	gnl\|CDD\|234675
CP034092.1\|QAB40542.1\|1951756_1952776_-\|alpha-ketoacid-dehydrogenase-subunit-beta	unknown	unknown	gnl\|CDD\|223101
CP034092.1\|QAB40535.1\|1943717_1944413_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293810
CP034092.1\|QAB40529.1\|1937608_1938004_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
CP034092.1\|QAB40537.1\|1945946_1946858_+\|bestrophin	unknown	unknown	gnl\|CDD\|376448
CP034092.1\|QAB40533.1\|1941085_1941877_-\|sulfite-exporter-TauE/SafE-family-protein	unknown	unknown	gnl\|CDD\|376667
CP034092.1\|QAB40544.1\|1954116_1955103_+\|lipoyl-synthase	unknown	unknown	gnl\|CDD\|237261
CP034092.1\|QAB40526.1\|1934486_1935230_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225099
CP034092.1\|QAB40540.1\|1948805_1950209_-\|dihydrolipoyl-dehydrogenase	unknown	unknown	gnl\|CDD\|235798

Protein	Function_ID	Function_description	E-value
CP034092.1\|QAB40536.1\|1944605_1945877_+\|sigma-54-dependent-Fis-family-transcriptional-regulator	gnl\|CDD\|225114	COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms].	3.70342e-121
CP034092.1\|QAB40530.1\|1938000_1938855_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|227311	COG4977, COG4977, Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription].	4.38745e-34
CP034092.1\|QAB40531.1\|1939021_1939939_+\|EamA-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	8.67813e-15
CP034092.1\|QAB40532.1\|1939971_1940976_-\|homoserine-dehydrogenase	gnl\|CDD\|235763	PRK06270, PRK06270, homoserine dehydrogenase; Provisional.	4.07312e-78
CP034092.1\|QAB40524.1\|1932458_1932704_-\|ferredoxin-family-protein	gnl\|CDD\|224069	COG1146, COG1146, Ferredoxin [Energy production and conversion].	3.35255e-10
CP034092.1\|QAB40543.1\|1952789_1953752_-\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	gnl\|CDD\|238958	cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC). PDC catalyzes the irreversible oxidative decarboxylation of pyruvate to produce acetyl-CoA in the bridging step between glycolysis and the citric acid cycle. ADC participates in the breakdown of acetoin while BCADC participates in the breakdown of branched chain amino acids. BCADC catalyzes the oxidative decarboxylation of 4-methyl-2-oxopentanoate, 3-methyl-2-oxopentanoate and 3-methyl-2-oxobutanoate (branched chain 2-oxo acids derived from the transamination of leucine, valine and isoleucine).	1.46231e-132
CP034092.1\|QAB40541.1\|1950219_1951755_-\|diaminohydroxyphosphoribosylaminopyrimidine-deaminase	gnl\|CDD\|237001	PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed.	7.2815e-113
CP034092.1\|QAB40525.1\|1932724_1934458_-\|fumarate-reductase/succinate-dehydrogenase-flavoprotein-subunit	gnl\|CDD\|181346	PRK08275, PRK08275, putative oxidoreductase; Provisional.	0
CP034092.1\|QAB40539.1\|1947993_1948779_-\|acetoin-reductase	gnl\|CDD\|187624	cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol dehydrogenase-like, classical (c) SDRs. 2,3-butanediol dehydrogenases (BDHs) catalyze the NAD+ dependent conversion of 2,3-butanediol to acetonin; BDHs are classified into types according to their stereospecificity as to substrates and products. Included in this subgroup are Klebsiella pneumonia meso-BDH which catalyzes meso-2,3-butanediol to D(-)-acetonin, and Corynebacterium glutamicum L-BDH which catalyzes lX+)-2,3-butanediol to L(+)-acetonin. This subgroup is comprised of classical SDRs with the characteristic catalytic triad and NAD-binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.07969e-113
CP034092.1\|QAB40527.1\|1935471_1936821_+\|chromate-efflux-transporter	gnl\|CDD\|273350	TIGR00937, Chromate_transport_protein, chromate transporter, chromate ion transporter (CHR) family. Members of this family probably act as chromate transporters, and are found in Pseudomonas aeruginosa, Alcaligenes eutrophus, Vibrio cholerae, Bacillus subtilis, Ochrobactrum tritici, cyanobacteria and archaea. The protein reduces chromate accumulation and is essential for chromate resistance. [Transport and binding proteins, Anions].	1.33551e-60
CP034092.1\|QAB40538.1\|1946905_1947964_-\|2,3-butanediol-dehydrogenase	gnl\|CDD\|176195	cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase. (2R,3R)-2,3-butanediol dehydrogenase, a zinc-dependent medium chain alcohol dehydrogenase, catalyzes the NAD(+)-dependent oxidation of (2R,3R)-2,3-butanediol and meso-butanediol to acetoin. BDH functions as a homodimer. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit.	0
CP034092.1\|QAB40528.1\|1936904_1937513_-\|FMN-dependent-NADH-azoreductase	gnl\|CDD\|234675	PRK00170, PRK00170, azoreductase; Reviewed.	3.23768e-86
CP034092.1\|QAB40542.1\|1951756_1952776_-\|alpha-ketoacid-dehydrogenase-subunit-beta	gnl\|CDD\|223101	COG0022, AcoB, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion].	3.26675e-168
CP034092.1\|QAB40535.1\|1943717_1944413_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293810	cd07724, POD-like_MBL-fold, ETHE1 (PDO type I), persulfide dioxygenase A (PDOA, PDO type II) and related proteins; MBL-fold metallo-hydrolase domain. Persulfide dioxygenase (PDO, also known as sulfur dioxygenase, SDO, EC 1.13.11.18) is a non-heme iron-dependent oxygenase which catalyzes the oxidation of glutathione persulfide to glutathione and persulfite in the mitochondria. Mutations in ethe1 (the human PDO gene) are responsible for a rare autosomal recessive metabolic disorder called ethylmalonic encephalopathy. Arabidopsis thaliana ETHE1 is essential for embryo and endosperm development. Bacterial ETHE1-type PDOs are also called Type 1 PDOs. Type II PDOs (also called PDOAs), are mainly proteobacterial. These enzymes belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	2.29474e-86
CP034092.1\|QAB40529.1\|1937608_1938004_+\|transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.15826e-39
CP034092.1\|QAB40537.1\|1945946_1946858_+\|bestrophin	gnl\|CDD\|376448	pfam01062, Bestrophin, Bestrophin, RFP-TM, chloride channel. Bestrophin is a 68-kDa basolateral plasma membrane protein expressed in retinal pigment epithelial cells (RPE). It is encoded by the VMD2 gene, which is mutated in Best macular dystrophy, a disease characterized by a depressed light peak in the electrooculogram. VMD2 encodes a 585-amino acid protein with an approximate mass of 68 kDa which has been designated bestrophin. Bestrophin shares homology with the Caenorhabditis elegans RFP gene family, named for the presence of a conserved arginine (R), phenylalanine (F), proline (P), amino acid sequence motif. Bestrophin is a plasma membrane protein, localized to the basolateral surface of RPE cells consistent with a role for bestrophin in the generation or regulation of the EOG light peak. Bestrophin and other RFP family members represent a new class of chloride channels, indicating a direct role for bestrophin in generating the light peak. The VMD2 gene underlying Best disease was shown to represent the first human member of the RFP-TM protein family. More than 97% of the disease-causing mutations are located in the N-terminal RFP-TM domain implying important functional properties. The bestrophins are four-pass transmembrane chloride-channel proteins, and the RFP-TM or bestrophin domain extends from the N-terminus through approximately 350 amino acids and contains all of the TM domains as well as nearly all reported disease causing mutations. Interestingly, the RFP motif is not conserved evolutionarily back beyond Metazoa, neither is it in plant members.	5.2685e-82
CP034092.1\|QAB40533.1\|1941085_1941877_-\|sulfite-exporter-TauE/SafE-family-protein	gnl\|CDD\|376667	pfam01925, TauE, Sulfite exporter TauE/SafE. This is a family of integral membrane proteins where the alignment appears to contain two duplicated modules of three transmembrane helices. The proteins are involved in the transport of anions across the cytoplasmic membrane during taurine metabolism as an exporter of sulfoacetate. This family used to be known as DUF81.	6.08411e-23
CP034092.1\|QAB40544.1\|1954116_1955103_+\|lipoyl-synthase	gnl\|CDD\|237261	PRK12928, PRK12928, lipoyl synthase; Provisional.	0
CP034092.1\|QAB40526.1\|1934486_1935230_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|225099	COG2188, PhnF, Transcriptional regulators [Transcription].	2.95412e-75
CP034092.1\|QAB40540.1\|1948805_1950209_-\|dihydrolipoyl-dehydrogenase	gnl\|CDD\|235798	PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed.	0

>CP034092.1|QAB40533.1|1941085_1941877_-|sulfite-exporter-TauE/SafE-family-protein
MLLLVVEGIVIGFLLGLTGAGGGILAVPALMTSQGWSVAQAAPIGLLAVALSTLIGTIEGLFKKIVRYRAAIWIALIGAPMAHIGILIANTISPIWLMLMFSLVMFTVGYRLISNRVSDFHNPPCQVNPSTGRFIWNFKTGSVLASIGIIAGLLTGMLGVGGGFVIVPALRKVTNLDMHSIVATSLMIIFLISGMSIVMHIAEGFHYPVAITSAFALACAFGMLLGRRAIRFIPSAIVQRVFALMVFAVAIYMVIKIVNLTNI
>CP034092.1|QAB40532.1|1939971_1940976_-|homoserine-dehydrogenase
MKRINVAICGFGRIGQQIAELLLNRSTYYKQKYQIDARLVGVCNSSSGLIDQEGLQASKWLDKTQYQAGLTEQKFLEQVQADVIIETGPSDYVTGGKGLFYLNYALTHNMNAIAVSKGALVVEGKKIISLAHQHNKKLFFSGATAAALPTVDLFEYNLAGCQILEIEGVFTGTTNFILNDMLQHECAFADSLEKAQAKGIAEPNSSFDVDGWDTAAKITILANTVLGADVKIQDIPRQGISHVTADHIRDWKKENVIPRLVGFIHVKNQQIQTGVELRLVPANHPFAHLQGSNKCIRVLTQEMGEFVVSGGASAPLATAAAALKDFELMLKTGC
>CP034092.1|QAB40531.1|1939021_1939939_+|EamA-family-transporter
MNILLYVAVVLIWGTTWIGIAVQSHYATPVVAILWRFAISALLLWVVLLFLGKLQRIALKDHLFCMLQGLCVFGLNFICFYTAVKYVNSGLESVIFSMAVFFNAINALIFFKQKPSPNFAPAALLGLSGIVLLFWHDLINSQFNAQLLMGIGLCAIGTYGFSLGNMISVRHQKRGLNIFSTNCYAMTYGALVMLILALFTGQDLMPPMNFPFLSSVLYLAVFGTVIGFSAYFSLVGRIGAAKAAYSTLLFPLVALTVSTFFEGYEWTLNAVFGILLILLGNYLMFSKFEIGKKLFSNQKNCEKQA
>CP034092.1|QAB40530.1|1938000_1938855_-|helix-turn-helix-domain-containing-protein
MAYQTLEQLQQSKAKLHETVVLDENMQLAFWSNQQDRVSVCSDHHTLSLYIQDGYESYQKTPAGWKNGGGPGRFCLLPEHQESTWDIRGGLKFVHLYYTDQHLRDVAEKIWDKEPNQIELNEVVFNDDERIRALYQFFLLDCDWQDSSNHLQMSTTASLLLNHLIRKYSSVQWQQPTIKGGLAPHKLKYIQEWIEDHLDQALTLSDLANVVNLSEYHFAHMFKQSMNMAPHQYVMQRRLTKAKGLIQSSQLSLQDIALVCGFSSASHLSHRFKQFYGMSPSQLR
>CP034092.1|QAB40529.1|1937608_1938004_+|transcriptional-regulator
MTVTIPHDIQSSDCQRVSQVLARVGEKWSILIVMTLASHPHRFSEIKRRINGISQRMLTLCLRGLERDGLVKRTVYPVVPPHVEYELTPLGHSLTEPVIALGQWAQQHIADIDAARAAFDAAQEKPITLDT
>CP034092.1|QAB40528.1|1936904_1937513_-|FMN-dependent-NADH-azoreductase
MKLLQIDTSILGEQSVSRQLTSSVIRQLSTAYPDAEIIHHDFALEPIPHLSDAEFLAWQGVEPNNEAAQQRVARNTQYLDEFLSSDIVVIGAPMYNFSFPSQLKAWLDRLSVAGKTFRYTENGPQGLVEGKRVIIASSRGGVYSEGSPAEALDYQETYIKAFFNFIGVTDITFVRAEGIAFGPEARQAALDNAAAQIAQLAG
>CP034092.1|QAB40527.1|1935471_1936821_+|chromate-efflux-transporter
MQQKQLNTPDDSVEQVTFWQAFLFWLKLGFISFGGPAGQIAVMHQELVEQKRWISEKRFLHALNYCMLLPGPEAQQLATYIGWLMHRTVGGLVAGILFVLPSLFILIGLSWVYIKFGDVPVIAGIFYGIKPAVTAIVFHATYRIGSRSLKNKFLWVVAIAAFFAIFVLKLPFPLIVLSAGIAGYLASKKYPELFSSAGGHKASQKDYGPAYIDDDTPTPEHAKFHWSRLARLIFVAIALWLLPILALGAYFGWHHSYTQMAWFFTKAALLTFGGAYAVLPYVYQGAVNHFGWLSPTQMIDGLALGETTPGPLIMVVAFVGFLGGVNHSLLGSEHLFFAGALGAVIVTWFTFLFSFVFIFAGAPIIESTHNEIKFTAPLTAITAAVVGVILNLALFFSYHVLWPQGFSGHFDIVAALITVAAFIALFRFNINVLYVIFASALVGLAVTFF
>CP034092.1|QAB40526.1|1934486_1935230_-|GntR-family-transcriptional-regulator
MSQLPQDPKNHKPLYDQLRELILNKIVNGEYAVLSQIPSENEFAEQFGVSRITVRQALNQLQLEGYIFKVPGKGTFVSKPKTFQNISSLQGFAEAMSSAGHEILNRVISAELKQIPMHVVPKLKLPVKANVYEIQRVRLLNRQPVSYELTYLPEHIGLKLKEKAIDLRTTDIFKALEQECDIPLGHADLSIDATVADEELAALLQVEIGTPVLRVERLTHDANGQPIDYEYLYFSGDTFQYRLRIHR
>CP034092.1|QAB40525.1|1932724_1934458_-|fumarate-reductase/succinate-dehydrogenase-flavoprotein-subunit
MENKYLEFDIVVIGGGTAGPMAAIKAKQENPNLKVLLIEKANVKRSGAISMGMDGLNNAVIPGYATPEQYTKEITIANEGVVNQTTVYAYAKHSFTTIQQLDQWGIKFEKDETGEFAVKKVHHMGAYVLPMPEGHDVKKVLYRQLKRAQVKINNRIVTTKLLKNEQGAINGVLGFDCRSGDFYVIKTKAAILCCGAAGRLGLPASGYLMGTYENPTNAGDGYAMAYHAGAELANLECFQINPLIKDYNGPACAYVTGPLGGYTANSKGERFIECDYWSGQMMWEFYQELESGNGPVYLKVDHLAEETIQTIEEILHTNERPSRGRFHEGRGTNYRQDMVEMHISEIGFCSGHSASGVWVNEKAETSVKGLYSAGDMAAVPHNYMLGAFTYGWFAGVNAAQYVNAVEDSELNQSEIEAEKARIFAPLNCSEGLPPEQVEYKLRRFVNDYLQPPKTRQKMEIGLKRFEEIKQDIKRISARNPHELMRAAEVSFIRDCAEMAARASLFREESRWGLYHYRADFPQKNNSDWFCHAHLKKDEHGNMVSFKKPIEPYVVPINQDEAVSYDHLRIQKDVALAD
>CP034092.1|QAB40524.1|1932458_1932704_-|ferredoxin-family-protein
MAFIFKEVQHRTVAPVIIDEDKCIADKGCTVCVDVCPMDLLAIDPTTQKAYMQFDECWYCMPCEKDCPTNAVKVNIPYLLK
>CP034092.1|QAB40535.1|1943717_1944413_-|MBL-fold-metallo-hydrolase
MFFKQFFEKESSTYTYMLGCEETRGAVLIDPVASDIEIYAKELEQHQFTLIYTLDTHVHADHITAADLLRERFHCKSVLHRNSEVSCGDILITDGCMLKVGNLSIEARYTPGHTNACTSYLVGNMIFTGDALLIDGCGRTDFQQGNAGTLYDSIHKQLFSLPDNTILYPGHDYKGRLSSTIGYERLNNSRLGQNRSREDFIELMNNLNLPYPKQIDKALPANQACGSISQL
>CP034092.1|QAB40536.1|1944605_1945877_+|sigma-54-dependent-Fis-family-transcriptional-regulator
MAKLNFELEQDFYILFEQLKALFPNASLFLADTTTQAIHYKFNTDDISVENIAALTQDHHNQYLEINTPKMRKRFIYQEHDIYIAEHRIIGKLHILQPVSIENDIVDEVELTEQLQDLAKVFNSCSPEMTRMFSIIQRVAITEFPVLVRGESGSGKELVAKAIHDYSQRKNKIFVAINCAALNSNILESELFGHVKGAFTGAIRDHKGVFERAAGGTLFLDEIAEIPLELQAKLLRVLETGEFTPVGGEKPIQANVRIITATHKALREEAKAGRFRHDLLYRLRVIPIFIPPLRERKVDIPLIVDQILKESTTQLDTMPRHVNQKAMQVLLNYDWPGNVRELKNTLLYALTMANGKDEIEVEDLPNELLDADEYVKLPENNAELTPENVQAALEKYNHNLNMVANIFGISRTTLWRYRQKHKL
>CP034092.1|QAB40537.1|1945946_1946858_+|bestrophin
MIVRDKSNVFKLLFAWKGTILPKVLPALSFVVLISACVVWLSYYHWIQIPTVPAIGFTIFGVILSICTGFRNNACYDRWWEGRKLWGALIANARHIVRDSHVLSNEKREHLIHQVLIFSNLLRDRLRQQTVEPTKFLEHAYLNNSSLNYLNEHINAPQFVLENIQKDLVKALKDGEISDIIYSTLNRHIIELGNIQAGCDRIAGTPLPYSYSVLLHRAVYCFCFILPFSLEAALGIWTPLIVGLIAYMFLGLDALSAQIEEPFGLQENDLPLDSIVRLIERESLSSLGQPLPPIIEAQNNNLL
>CP034092.1|QAB40538.1|1946905_1947964_-|2,3-butanediol-dehydrogenase
MKAARFYDRGDIRIEDIPEPEVTPGTVGIKVAWCGICGTDLHEFMEGPIFIPPCGHPHPISGESAPITMGHEFSGVVYAVGEGVDDIEIGQHVVVEPYIVADDVPTGPGDNYHLSKNMNFIGLGGRGGGLSEKIAVKRRWVHPISNKIPLDQAALIEPLSVGHHAFVRSGAKAGDIALVGGAGPIGLLLSAILKAKGLKVIITELSAKRKEKAKESGVADYILDPSEVDVVSEVMKITNGDGVDVAFECSSVNKVLDTLVAAVKPTGVIVIVSIWSHPASINVHSVVMKELDVRGTIAYVNDHQETIKLVEEGKINLEPFITQRIQLDDLISQGFETLIHNNESAVKIIVHP
>CP034092.1|QAB40539.1|1947993_1948779_-|acetoin-reductase
MVKGLKNKVVLVTGAAQGIGRGIALRLAQEGAHIALVDMKQDRLNDVQQEIQALGVNASTFIADVSDREQVYAAINHAEQALGGFDVMINNAGIAQVQAIADITPDEFQKIVDINIGGVLWGIQAAAAKFKQREHKGKIINACSIAGHDGFALLGIYSATKFAVRALTQAAAKEYASHGITVNGYCPGIVGTDMWVEIDKRFAEITGAAIGETYKKYVEGIALGRAQTPDDVAALVAFLASEDSDYITGQSILTDGGIVYR
>CP034092.1|QAB40540.1|1948805_1950209_-|dihydrolipoyl-dehydrogenase
MSEAQFDLIVIGAGPGGYVAAIRAAQLGLKTAIVEERHLGGICLNWGCIPTKALLAGAELATQFKHAGQFGFQVSQLDFDIQKLVQHSRQVSAQLVQGIDYLLKKNQVTVFSGRAQLTAKEKIEVTDAQGNRQALSAPHIILATGAKARHVPQLPVDGTYVWSYKEALVPEQLPKSLLVVGSGAIGSEFASLYQDLGCQVTLIDLAKQILPTEDVEVAQFVRKQFEQKGMKVLTDAVVQSIQIENEQVHCVVETANDVQTLVFDRVLSAIGVQPNTTGLGLERLGVELNPQGFVAIDDYCKTNVAGLYAIGDVAGAPCLAHKASHEAMICVEKIAGVKNVHSLDRSQIPGCIFTHPQVASIGLTENAAKAKNLPIRIGKFSLTANGKALAIGDASGFVKTVVHAETGELLGAHMVGHEVTEHIQGFAIAKYLEATDESLAQVIFPHPTLSEAMHESILASMQRAIHM
>CP034092.1|QAB40541.1|1950219_1951755_-|diaminohydroxyphosphoribosylaminopyrimidine-deaminase
MSEIKTLEIPKWGLSMEEGTIAQWLIKEGDSFNKGDEICEIETTKIVNVLEAPFAGTLRKILAKDGDTLPVGGLIAVCADSEVSDAEIEKFIASLGGSAAQAPEAPSEQSKAETSAPVAEKTEQPQTVAASASAPAKVAKEDYAVPESLQGYQTSNELFATPHALKLAEKHNVNLAKVTGSGREGRISVQDIQKAVQAAGGQWPDVKQQTQAKVVKSTADDSQVLATPVARRLAKQWGINLNDCRVSGTRGRVCKEDVEAVYYRNNPTSVNEQPVQCAAQPQSTVTTVAMNGMRKAIASRLQAAKRNAPHFRLVVDLNVEALQKLRKQINETVPQVKLSINDMLIKAAAAALIKVPEVNVQFDEATQSILQFSQADISVAVAIPNGLITPIVKAANQKSLAQISDDMRDLATRAKTGKLQPDEFQGGSFSISNLGMLGIKQFDAIINPPQGAIMALGASESRAVVENGNVVVREIVTATLSCDHRVIDGAVGAKFLASFKQFVENPALILV
>CP034092.1|QAB40542.1|1951756_1952776_-|alpha-ketoacid-dehydrogenase-subunit-beta
MPNKSFRNAIKEAIESEMRRDPTVFVVGEDVRGGHGGKNTEENQLEGFGGVLGVTKGLWTEFGSERVIDTPITESAIIGMAAGAAATGLRPVADLMFMDFYGVCHDMLYNQAAKFRYMFGGKAKAPMVVRGMIGAGFSAAAQHSQSPYNVFAAVPGLKVVVPSSPYDVKGLLIQAIRDDDPVVFCEHKMLYDIKGEVPDDAYTIPFGVANYTREGTDVTIIALGLMVHRANEVADKLAKDGISVEVVDPRTISPLDEEGILESVASTGRVVIVDESAARCGFGHDVAALIAQKGFHYLKAPVELVTPPHTPVPFSPVLEKEWIPSVERIEQAVRKTLEA
>CP034092.1|QAB40543.1|1952789_1953752_-|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha
MQLTEEQLLAAYKRMRDIREFEDRLHEENTNGDIPGFIHLYSGEEAVAVGICENLTDKDYITSTHRGHGHCIAKGCDIHAMMLEIFGKDDGLCRGKGGSMHIADLDKGMLGANGIVGGGPPLAIGAALTAKTLKTGGVGLSFTGDGGSNQGLTFEAMNMAVVLKLPVIFVFENNGFGEGTGHDYAVGSKDIAGRAAGFGLPAVKVDGTDFFAVYEAAQTAIERARRGEGPSVIETITNRFYGHFEGDPGLIRSKEEVEFIKENKDPLKIFREKVKGKIDEAKLDEIDAASKANVDDAVAKARAAAYPKPEQLLTDVYVSY
>CP034092.1|QAB40544.1|1954116_1955103_+|lipoyl-synthase
MDLKRQIETGIKLRGIDKVSRIPIKILPTEELPKKPEWIRAKITDFEEIQRIKNLLRQQKLHSVCEEAACPNLPECFGGGTATFMIMGDICTRRCPFCDVAHGRPMPLDENEPKHLAETVANLNLKYVVITSVDRDDLHDGGAAHFVKCIEEIRNRCPDTLIEILVPDFRGRLETALSTLSLSPPDVFNHNIETVPRLYKAMRPGSDYQHSLNLLKRFKKYCPDIKTKCGLMVGLGEIEAEVIALLNDLKDHDVDLVTIGQYLQPSKSHAPIHRFVNLQEFERYTQHGQRLGFKNIWSAPMVRSSYFADRQYFGESAPKPFSREDVLS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP034092_2	2.1\|1942002\|36\|CP034092\|CRISPRCasFinder	1942002-1942037	36	NZ_CP012711	Psychrobacter urativorans strain R310.10B plasmid 5, complete sequence	43400-43435	3	0.917
CP034092_2	2.1\|1942002\|36\|CP034092\|CRISPRCasFinder	1942002-1942037	36	NZ_CP024448	Moraxella osloensis strain NP7 plasmid pNP7-5, complete sequence	20098-20133	4	0.889
CP034092_2	2.1\|1942002\|36\|CP034092\|CRISPRCasFinder	1942002-1942037	36	NZ_CP024446	Moraxella osloensis strain NP7 plasmid pNP7-3, complete sequence	63667-63702	5	0.861
CP034092_2	2.1\|1942002\|36\|CP034092\|CRISPRCasFinder	1942002-1942037	36	NZ_CP024445	Moraxella osloensis strain NP7 plasmid pNP7-2, complete sequence	29619-29654	6	0.833
CP034092_2	2.1\|1942002\|36\|CP034092\|CRISPRCasFinder	1942002-1942037	36	NZ_CP024186	Moraxella osloensis strain TT16 plasmid p1, complete sequence	95169-95204	6	0.833
CP034092_2	2.1\|1942002\|36\|CP034092\|CRISPRCasFinder	1942002-1942037	36	NZ_CP024186	Moraxella osloensis strain TT16 plasmid p1, complete sequence	29226-29261	6	0.833
CP034092_2	2.1\|1942002\|36\|CP034092\|CRISPRCasFinder	1942002-1942037	36	NZ_CP024177	Moraxella osloensis strain YHS plasmid pYHS1, complete sequence	95137-95172	6	0.833
CP034092_2	2.1\|1942002\|36\|CP034092\|CRISPRCasFinder	1942002-1942037	36	NZ_CP024177	Moraxella osloensis strain YHS plasmid pYHS1, complete sequence	29194-29229	6	0.833
CP034092_2	2.1\|1942002\|36\|CP034092\|CRISPRCasFinder	1942002-1942037	36	NZ_CP024186	Moraxella osloensis strain TT16 plasmid p1, complete sequence	25313-25348	8	0.778
CP034092_2	2.1\|1942002\|36\|CP034092\|CRISPRCasFinder	1942002-1942037	36	NZ_CP024177	Moraxella osloensis strain YHS plasmid pYHS1, complete sequence	25281-25316	8	0.778
CP034092_2	2.1\|1942002\|36\|CP034092\|CRISPRCasFinder	1942002-1942037	36	NZ_CP040258	Moraxella osloensis strain MOXF1 plasmid pMOXF1, complete sequence	46821-46856	8	0.778
CP034092_2	2.1\|1942002\|36\|CP034092\|CRISPRCasFinder	1942002-1942037	36	NZ_CP024446	Moraxella osloensis strain NP7 plasmid pNP7-3, complete sequence	38673-38708	9	0.75
CP034092_2	2.1\|1942002\|36\|CP034092\|CRISPRCasFinder	1942002-1942037	36	NZ_AP017383	Moraxella osloensis strain KMC41 plasmid pMOSL2, complete sequence	53808-53843	9	0.75
CP034092_2	2.1\|1942002\|36\|CP034092\|CRISPRCasFinder	1942002-1942037	36	NZ_CP024183	Moraxella osloensis strain KSH plasmid p3, complete sequence	11703-11738	9	0.75

1. spacer 2.1|1942002|36|CP034092|CRISPRCasFinder matches to NZ_CP012711 (Psychrobacter urativorans strain R310.10B plasmid 5, complete sequence) position: , mismatch: 3, identity: 0.917

ttccactcgagcacagctctcgtcttgcgctcgggt	CRISPR spacer
tcccactcgagcacagctctcgtcttgggctcgggc	Protospacer
*.************************* *******.

2. spacer 2.1|1942002|36|CP034092|CRISPRCasFinder matches to NZ_CP024448 (Moraxella osloensis strain NP7 plasmid pNP7-5, complete sequence) position: , mismatch: 4, identity: 0.889

ttccact-cgagcacagctctcgtcttgcgctcgggt	CRISPR spacer
-tccactacgagcatagctctcgccttgcgctcgggc	Protospacer
 ****** ******.********.************.

3. spacer 2.1|1942002|36|CP034092|CRISPRCasFinder matches to NZ_CP024446 (Moraxella osloensis strain NP7 plasmid pNP7-3, complete sequence) position: , mismatch: 5, identity: 0.861

ttccactcgagcacagctctcgtcttgcgctcgggt	CRISPR spacer
gcccactcgagcatagctctcgccttgcgctcgggc	Protospacer
 .***********.********.************.

4. spacer 2.1|1942002|36|CP034092|CRISPRCasFinder matches to NZ_CP024445 (Moraxella osloensis strain NP7 plasmid pNP7-2, complete sequence) position: , mismatch: 6, identity: 0.833

ttccactcgagcacagctctcgtcttgcgctcgggt	CRISPR spacer
aatcactcgagcacagctctcgccttgcactcgggc	Protospacer
  .*******************.*****.******.

5. spacer 2.1|1942002|36|CP034092|CRISPRCasFinder matches to NZ_CP024186 (Moraxella osloensis strain TT16 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.833

ttccactcgagcacagctctcgtcttgcgctcgggt	CRISPR spacer
aatcactcgagcacagctctcgccttgcactcgggc	Protospacer
  .*******************.*****.******.

6. spacer 2.1|1942002|36|CP034092|CRISPRCasFinder matches to NZ_CP024186 (Moraxella osloensis strain TT16 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.833

ttccactcgagcacagctctcgtcttgcgctcgggt	CRISPR spacer
gcctactcgagcatagctctcgccttgcgctcgggc	Protospacer
 .*.*********.********.************.

7. spacer 2.1|1942002|36|CP034092|CRISPRCasFinder matches to NZ_CP024177 (Moraxella osloensis strain YHS plasmid pYHS1, complete sequence) position: , mismatch: 6, identity: 0.833

ttccactcgagcacagctctcgtcttgcgctcgggt	CRISPR spacer
aatcactcgagcacagctctcgccttgcactcgggc	Protospacer
  .*******************.*****.******.

8. spacer 2.1|1942002|36|CP034092|CRISPRCasFinder matches to NZ_CP024177 (Moraxella osloensis strain YHS plasmid pYHS1, complete sequence) position: , mismatch: 6, identity: 0.833

ttccactcgagcacagctctcgtcttgcgctcgggt	CRISPR spacer
gcctactcgagcatagctctcgccttgcgctcgggc	Protospacer
 .*.*********.********.************.

9. spacer 2.1|1942002|36|CP034092|CRISPRCasFinder matches to NZ_CP024186 (Moraxella osloensis strain TT16 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.778

ttccactcgagcacagctctcgtcttgcgctcgggt	CRISPR spacer
gcccactcgagcatagctctcgccttgcgtcggggc	Protospacer
 .***********.********.******.. ***.

10. spacer 2.1|1942002|36|CP034092|CRISPRCasFinder matches to NZ_CP024177 (Moraxella osloensis strain YHS plasmid pYHS1, complete sequence) position: , mismatch: 8, identity: 0.778

ttccactcgagcacagctctcgtcttgcgctcgggt	CRISPR spacer
gcccactcgagcatagctctcgccttgcgtcggggc	Protospacer
 .***********.********.******.. ***.

11. spacer 2.1|1942002|36|CP034092|CRISPRCasFinder matches to NZ_CP040258 (Moraxella osloensis strain MOXF1 plasmid pMOXF1, complete sequence) position: , mismatch: 8, identity: 0.778

ttccactcgagcacagctctcgtcttgcgctcgggt	CRISPR spacer
ccccactcgagcatagctctcgccttgcgtcggggc	Protospacer
..***********.********.******.. ***.

12. spacer 2.1|1942002|36|CP034092|CRISPRCasFinder matches to NZ_CP024446 (Moraxella osloensis strain NP7 plasmid pNP7-3, complete sequence) position: , mismatch: 9, identity: 0.75

ttccactcgagcacagctctcgtcttgcgctcgggt	CRISPR spacer
gctcactcgagcatagctctcgccttgcgtcggggc	Protospacer
 ..**********.********.******.. ***.

13. spacer 2.1|1942002|36|CP034092|CRISPRCasFinder matches to NZ_AP017383 (Moraxella osloensis strain KMC41 plasmid pMOSL2, complete sequence) position: , mismatch: 9, identity: 0.75

ttccactcgagcacagctctcgtcttgcgctcgggt	CRISPR spacer
gcccactcgagcatagctctcgccttgcgtcgcggc	Protospacer
 .***********.********.******..  **.

14. spacer 2.1|1942002|36|CP034092|CRISPRCasFinder matches to NZ_CP024183 (Moraxella osloensis strain KSH plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.75

ttccactcgagcacagctctcgtcttgcgctcgggt	CRISPR spacer
gcccactcgagcatagctctcgccttgcgtcgcggc	Protospacer
 .***********.********.******..  **.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1007361 : 1012253

Acinetobacter_phage(71.43%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAB39700.1\|1007361_1007673_-	hypothetical protein	E2GLX6	Acinetobacter_phage	6.3e-20	50.0
QAB39701.1\|1007669_1008134_-	DUF551 domain-containing protein	A0A0P0HSE1	Acinetobacter_phage	1.1e-63	70.8
QAB39702.1\|1008143_1008659_-	hypothetical protein	A0A0A8WFY3	Clostridium_phage	1.9e-05	26.4
QAB39703.1\|1008713_1009373_-	hypothetical protein	NA	NA	NA	NA
QAB39704.1\|1009385_1010054_-	ATP-binding protein	K7PMI2	Enterobacteria_phage	7.6e-63	56.7
QAB39705.1\|1010115_1010445_-	hypothetical protein	NA	NA	NA	NA
QAB39706.1\|1010444_1010825_-	hypothetical protein	NA	NA	NA	NA
QAB39707.1\|1010824_1011016_-	hypothetical protein	A0A1B1P9G9	Acinetobacter_phage	2.4e-14	66.7
QAB39708.1\|1011218_1011962_-	helix-turn-helix domain-containing protein	A0A1B1P9J5	Acinetobacter_phage	2.4e-81	61.9
QAB39709.1\|1012061_1012253_+	helix-turn-helix domain-containing protein	J7HXD2	Acinetobacter_phage	8.4e-07	55.4

DBSCAN-SWA_2

1015422 : 1037813

Acinetobacter_phage(35.71%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAB39713.1\|1015422_1016331_+	hypothetical protein	A0A2H4JC66	uncultured_Caudovirales_phage	1.6e-26	31.7
QAB39714.1\|1016435_1016999_+	hypothetical protein	A0A0F7LAN7	uncultured_marine_virus	5.9e-24	37.1
QAB39715.1\|1016995_1019074_+	carbohydrate-binding protein	A0A2H4J6H2	uncultured_Caudovirales_phage	1.1e-67	27.4
QAB39716.1\|1019076_1019532_+	N-acetyltransferase	X2L0B0	Vibrio_phage	4.6e-11	32.0
QAB39717.1\|1019524_1020037_+	hypothetical protein	A0A218MN86	uncultured_virus	7.7e-15	35.8
QAB39718.1\|1020024_1020450_+	hypothetical protein	NA	NA	NA	NA
QAB39719.1\|1020449_1022516_+	methyl-coenzyme M reductase	NA	NA	NA	NA
QAB39720.1\|1022512_1025383_+	lytic transglycosylase domain-containing protein	A0A222YY44	Escherichia_phage	6.9e-52	34.0
QAB39721.1\|1025386_1027912_+	hypothetical protein	A0A0F6TK45	Escherichia_coli_O157_typing_phage	6.4e-110	31.4
QAB39722.1\|1027908_1028202_+	hypothetical protein	NA	NA	NA	NA
QAB39723.1\|1028264_1028573_+	hypothetical protein	NA	NA	NA	NA
QAB39724.1\|1028572_1030246_+	transcriptional regulator	A0A2H4JCA3	uncultured_Caudovirales_phage	2.0e-136	45.7
QAB39725.1\|1030255_1032538_+	hypothetical protein	U5PW98	Acinetobacter_phage	3.4e-09	37.0
QAB39726.1\|1032647_1033610_+	hypothetical protein	NA	NA	NA	NA
QAB39727.1\|1033688_1034084_+	hypothetical protein	A0A0D4DBQ9	Acinetobacter_phage	1.2e-55	85.0
QAB39728.1\|1034080_1034635_+	lysozyme	A0A068CDE9	Acinetobacter_phage	3.2e-83	83.2
QAB39729.1\|1034759_1034954_+	hypothetical protein	A0A1B1P9F8	Acinetobacter_phage	6.7e-28	93.8
QAB39730.1\|1034950_1036168_-	DUF4102 domain-containing protein	A0A0P0IRB7	Acinetobacter_phage	4.3e-120	54.8
QAB39731.1\|1036556_1037813_+	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	1.6e-16	79.6

DBSCAN-SWA_3

1163517 : 1178324

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAB39832.1\|1163517_1164072_-	GTP cyclohydrolase I FolE	A0A0P0HSD2	Acinetobacter_phage	2.7e-98	100.0
QAB39833.1\|1164328_1165828_+	xanthine dehydrogenase small subunit	A0A0P0IVM8	Acinetobacter_phage	1.0e-277	96.6
QAB39834.1\|1165829_1168205_+	xanthine dehydrogenase molybdopterin binding subunit	A0A0P0I429	Acinetobacter_phage	0.0e+00	99.4
QAB39835.1\|1168211_1169195_+	xanthine dehydrogenase accessory protein XdhC	A0A0P0IKN7	Acinetobacter_phage	6.6e-188	98.8
QAB39836.1\|1169205_1169901_-	DNA mismatch repair protein MutS	A0A0P0IDT4	Acinetobacter_phage	2.2e-121	99.6
QAB39837.1\|1169910_1170717_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	6.7e-146	99.3
QAB42238.1\|1170726_1171776_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	9.8e-190	100.0
QAB39838.1\|1172131_1174864_+	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	0.0e+00	97.8
QAB39839.1\|1174871_1177643_+	M1 family peptidase	A0A0P0IY26	Acinetobacter_phage	0.0e+00	98.8
QAB39840.1\|1177739_1178324_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	1.7e-111	100.0

DBSCAN-SWA_4

1421579 : 1461689

Acinetobacter_phage(71.79%)

tail,head,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAB40055.1\|1421579_1422788_+	DUF4102 domain-containing protein	A0A0P0IKP2	Acinetobacter_phage	1.8e-107	47.8
QAB40056.1\|1422784_1423054_-	DNA-binding protein	A0A0N7IRE8	Acinetobacter_phage	1.8e-15	53.5
QAB40057.1\|1423091_1423892_+	hypothetical protein	I3PUZ7	Vibrio_phage	1.8e-10	35.8
QAB40058.1\|1423891_1425208_+	DNA helicase	A0A2H4J6D5	uncultured_Caudovirales_phage	3.6e-165	74.5
QAB40059.1\|1425204_1425462_+	hypothetical protein	A0A2H4J6Z3	uncultured_Caudovirales_phage	7.3e-22	61.5
QAB40060.1\|1425631_1425943_+	hypothetical protein	A0A1J0MGQ3	Acinetobacter_phage	1.4e-35	75.5
QAB40061.1\|1426552_1427200_+	hypothetical protein	A0A0D4DBZ8	Acinetobacter_phage	7.8e-12	92.9
QAB40062.1\|1427196_1427625_+	VRR-NUC domain-containing protein	A0A0D4DBJ8	Acinetobacter_phage	4.7e-74	97.9
QAB40063.1\|1427634_1428186_+	hypothetical protein	A0A1B1P9I8	Acinetobacter_phage	1.3e-60	63.9
QAB40064.1\|1428314_1428617_+	hypothetical protein	NA	NA	NA	NA
QAB40065.1\|1428836_1429055_+	hypothetical protein	A0A0D4DCM7	Acinetobacter_phage	2.9e-35	97.2
QAB40066.1\|1429383_1429659_+	hypothetical protein	A0A0D4DC07	Acinetobacter_phage	1.8e-34	74.7
QAB40067.1\|1429742_1430642_+	hypothetical protein	NA	NA	NA	NA
QAB40068.1\|1430665_1431271_+	hypothetical protein	NA	NA	NA	NA
QAB40069.1\|1431328_1431814_+	hypothetical protein	A0A0D4DC11	Acinetobacter_phage	8.0e-38	52.2
QAB40070.1\|1431908_1433102_+	hypothetical protein	A0A173GCS4	Salmonella_phage	4.1e-67	36.9
QAB42245.1\|1433331_1433862_+	hypothetical protein	NA	NA	NA	NA
QAB40071.1\|1433903_1434365_+	DNA-packaging protein	I6S1J2	Salmonella_phage	7.1e-44	62.9
QAB40072.1\|1434380_1435874_+\|terminase	terminase	A0A2H4J8J8	uncultured_Caudovirales_phage	1.8e-197	67.1
QAB40073.1\|1435870_1437349_+	DUF4055 domain-containing protein	A0A0D4DCP1	Acinetobacter_phage	5.1e-144	54.0
QAB40074.1\|1437317_1438400_+\|head	phage head morphogenesis protein	A0A1B1P9B7	Acinetobacter_phage	2.1e-134	68.2
QAB40075.1\|1438572_1439337_+	hypothetical protein	A0A0H5AWD1	Pseudomonas_phage	1.1e-60	58.6
QAB40076.1\|1439348_1440317_+	hypothetical protein	R9TJ64	Synechococcus_phage	2.4e-126	71.3
QAB40077.1\|1440528_1440906_+	hypothetical protein	A0A0D4DC24	Acinetobacter_phage	1.3e-38	68.0
QAB40078.1\|1440907_1441294_+	glutamate 5-kinase	A0A1B1P9E3	Acinetobacter_phage	1.1e-58	85.4
QAB40079.1\|1441349_1442063_+	hypothetical protein	NA	NA	NA	NA
QAB40080.1\|1442096_1442519_+	hypothetical protein	A0A1B1P9D5	Acinetobacter_phage	2.5e-59	81.4
QAB40081.1\|1442520_1442916_+	hypothetical protein	A0A1B1P9D6	Acinetobacter_phage	8.8e-67	93.1
QAB40082.1\|1443076_1443604_+	Rha family transcriptional regulator	A0A1B1P9D9	Acinetobacter_phage	1.9e-53	63.2
QAB40083.1\|1443603_1443870_+	hypothetical protein	A0A1B1P9E1	Acinetobacter_phage	6.1e-40	88.6
QAB40084.1\|1443933_1444134_+	hypothetical protein	NA	NA	NA	NA
QAB40085.1\|1444241_1444595_+	hypothetical protein	A0A0P0IY61	Acinetobacter_phage	7.9e-59	96.6
QAB40086.1\|1444594_1445899_+\|tail	phage tail protein	A0A0D4DCQ4	Acinetobacter_phage	1.1e-84	46.9
QAB40087.1\|1445951_1446869_+	hypothetical protein	A0A0P0IL42	Acinetobacter_phage	3.3e-165	97.0
QAB40088.1\|1446938_1447454_+	hypothetical protein	A0A0D4DBX8	Acinetobacter_phage	8.5e-78	98.6
QAB42246.1\|1447381_1447702_+	hypothetical protein	A0A1B1P9F7	Acinetobacter_phage	3.3e-24	57.7
QAB40089.1\|1448111_1448303_+	hypothetical protein	NA	NA	NA	NA
QAB40090.1\|1448292_1448673_+	hypothetical protein	NA	NA	NA	NA
QAB40091.1\|1448762_1449101_+	hypothetical protein	NA	NA	NA	NA
QAB40092.1\|1449188_1449632_+	hypothetical protein	NA	NA	NA	NA
QAB40093.1\|1449739_1450420_+	hypothetical protein	A0A0R6PJY5	Moraxella_phage	2.5e-53	49.3
QAB40094.1\|1450421_1450685_+	hypothetical protein	NA	NA	NA	NA
QAB40095.1\|1452372_1452903_+	DUF4065 domain-containing protein	A0A0R6PK62	Moraxella_phage	1.5e-21	37.4
QAB40096.1\|1452928_1453711_+	hypothetical protein	NA	NA	NA	NA
QAB40097.1\|1453791_1454190_+	hypothetical protein	J7I0X8	Acinetobacter_phage	3.5e-71	96.2
QAB40098.1\|1454189_1454696_+	DUF1833 domain-containing protein	A0A0P0IKN4	Acinetobacter_phage	7.2e-90	95.2
QAB40099.1\|1454692_1455055_+	hypothetical protein	A0A0P0J0A2	Acinetobacter_phage	2.2e-56	87.5
QAB40100.1\|1455047_1458485_+	hypothetical protein	J7HXG3	Acinetobacter_phage	0.0e+00	94.7
QAB40101.1\|1458553_1458943_+	hypothetical protein	J7I481	Acinetobacter_phage	2.5e-66	100.0
QAB40102.1\|1458983_1459529_+	hypothetical protein	A0A0P0IW03	Acinetobacter_phage	1.5e-93	93.9
QAB40103.1\|1459632_1460298_-	hypothetical protein	NA	NA	NA	NA
QAB40104.1\|1460390_1461689_-	Y-family DNA polymerase	A0A2H4JBL5	uncultured_Caudovirales_phage	3.4e-160	62.4

DBSCAN-SWA_5

2702202 : 2738789

Acinetobacter_phage(74.19%)

tail,transposase,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAB41200.1\|2702202_2703564_+	DUF4102 domain-containing protein	A0A0R6PGY7	Moraxella_phage	2.5e-76	41.5
QAB41201.1\|2703569_2704007_+	hypothetical protein	NA	NA	NA	NA
QAB41202.1\|2704036_2705056_+	HNH endonuclease	NA	NA	NA	NA
QAB41203.1\|2705084_2705720_+	SOS response-associated peptidase	A0A218MNF5	uncultured_virus	2.0e-68	56.9
QAB41204.1\|2705866_2706367_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A2H4J538	uncultured_Caudovirales_phage	1.2e-44	58.3
QAB41205.1\|2706363_2707662_+	Y-family DNA polymerase	A0A2H4JBL5	uncultured_Caudovirales_phage	4.1e-161	62.6
QAB41206.1\|2708559_2709105_-	hypothetical protein	J7I0Y1	Acinetobacter_phage	3.0e-97	96.1
QAB41207.1\|2709203_2709386_-	hypothetical protein	NA	NA	NA	NA
QAB41208.1\|2709486_2709693_-	hypothetical protein	NA	NA	NA	NA
QAB41209.1\|2709749_2710139_-	hypothetical protein	J7I481	Acinetobacter_phage	2.5e-66	100.0
QAB41210.1\|2710207_2713654_-	hypothetical protein	A0A0D4DBG7	Acinetobacter_phage	0.0e+00	96.8
QAB41211.1\|2713646_2714009_-	hypothetical protein	A0A0D4DCJ1	Acinetobacter_phage	9.8e-65	97.5
QAB41212.1\|2714005_2714512_-	DUF1833 domain-containing protein	J7HXQ5	Acinetobacter_phage	1.9e-90	96.4
QAB41213.1\|2714511_2714910_-	hypothetical protein	J7I0X8	Acinetobacter_phage	1.0e-70	97.0
QAB41214.1\|2714970_2715447_-	hypothetical protein	NA	NA	NA	NA
QAB41215.1\|2715482_2716070_-	hypothetical protein	NA	NA	NA	NA
QAB41216.1\|2716160_2721464_-\|tail	phage tail protein	J7I4Q7	Acinetobacter_phage	0.0e+00	76.6
QAB41217.1\|2721582_2722299_-	hypothetical protein	NA	NA	NA	NA
QAB41218.1\|2722650_2722827_-	hypothetical protein	A0A0R6PIB1	Moraxella_phage	8.2e-09	59.6
QAB41219.1\|2722931_2723390_-	helix-turn-helix domain-containing protein	A0A0P0IRJ4	Acinetobacter_phage	1.8e-84	99.3
QAB41220.1\|2723398_2723698_-	DUF4258 domain-containing protein	A0A0P0IE58	Acinetobacter_phage	7.4e-50	100.0
QAB42306.1\|2723943_2724273_-	hypothetical protein	A0A1B1P9F7	Acinetobacter_phage	4.1e-25	60.2
QAB41221.1\|2724200_2724716_-	hypothetical protein	A0A0D4DBX8	Acinetobacter_phage	3.4e-71	94.2
QAB41222.1\|2725013_2725442_-	hypothetical protein	A0A0D4DBV9	Acinetobacter_phage	1.3e-71	98.6
QAB41223.1\|2725451_2726555_-\|head	phage head morphogenesis protein	A0A0D4DBL9	Acinetobacter_phage	2.1e-187	88.6
QAB41224.1\|2726565_2728008_-	DUF4055 domain-containing protein	A0A0D4DCP1	Acinetobacter_phage	1.1e-273	95.2
QAB41225.1\|2729352_2730561_+\|transposase	IS256-like element ISAba26 family transposase	A0A218MNI5	uncultured_virus	3.1e-46	46.5
QAB41226.1\|2730747_2731218_-	DUF2280 domain-containing protein	A0A0D4DC15	Acinetobacter_phage	3.0e-82	100.0
QAB41227.1\|2731276_2731918_-	hypothetical protein	A0A0D4DBV4	Acinetobacter_phage	5.2e-125	99.1
QAB41228.1\|2731886_2732321_-	hypothetical protein	A0A0P0IVP9	Acinetobacter_phage	1.1e-78	97.2
QAB41229.1\|2732382_2732838_-	hypothetical protein	A0A0P0HSF5	Acinetobacter_phage	3.5e-83	98.7
QAB41230.1\|2733500_2733737_-	hypothetical protein	NA	NA	NA	NA
QAB41231.1\|2733945_2734290_-	hypothetical protein	NA	NA	NA	NA
QAB41232.1\|2734752_2735007_-	hypothetical protein	NA	NA	NA	NA
QAB41233.1\|2734978_2735455_-	hypothetical protein	A0A2H4J548	uncultured_Caudovirales_phage	1.2e-25	40.3
QAB41234.1\|2735451_2735853_-	DUF559 domain-containing protein	A0A0P0I8E8	Acinetobacter_phage	4.1e-64	91.6
QAB41235.1\|2735849_2736791_-	helix-turn-helix domain-containing protein	A0A0P0HSN8	Acinetobacter_phage	2.4e-22	57.8
QAB41236.1\|2736790_2737084_-	hypothetical protein	A0A0P0I444	Acinetobacter_phage	9.8e-23	57.3
QAB41237.1\|2737080_2737353_-	hypothetical protein	A0A0P0IVP2	Acinetobacter_phage	3.0e-10	45.7
QAB41238.1\|2737406_2737691_-	hypothetical protein	NA	NA	NA	NA
QAB41239.1\|2737721_2737979_-	hypothetical protein	A0A0P0IY81	Acinetobacter_phage	2.7e-08	40.6
QAB42307.1\|2738057_2738789_+	peptidase S24	A0A0R6PJ00	Moraxella_phage	2.5e-27	36.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP034093

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 78401

Pseudomonas_phage(29.27%)

capsid,integrase,tail,terminase

attL 20456:20474|attR 61668:61686

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAB42371.1\|1129_1510_-	hypothetical protein	NA	NA	NA	NA
QAB42372.1\|1583_2186_-	hypothetical protein	J9Q7Z7	Salmonella_phage	1.1e-31	42.8
QAB42373.1\|2317_3154_-	hypothetical protein	NA	NA	NA	NA
QAB42374.1\|3246_5187_-	recombinase RecF	L7TNH6	Rhizobium_phage	2.4e-117	42.5
QAB42375.1\|5186_6302_-	serine/threonine protein phosphatase	A0A2H4P756	Pseudomonas_phage	1.7e-59	38.1
QAB42376.1\|6335_6557_-	hypothetical protein	NA	NA	NA	NA
QAB42377.1\|6644_7025_-	hypothetical protein	NA	NA	NA	NA
QAB42378.1\|7024_7486_-	hypothetical protein	NA	NA	NA	NA
QAB42379.1\|7482_7842_-	hypothetical protein	NA	NA	NA	NA
QAB42380.1\|7929_10128_-	recombinase RecA	J9Q736	Salmonella_phage	3.6e-53	50.7
QAB42381.1\|10130_11168_-	5'-3' exonuclease	J9Q7S6	Salmonella_phage	2.3e-50	36.9
QAB42382.1\|11230_12091_-	hypothetical protein	A0A2H4P7I7	Pseudomonas_phage	1.9e-29	31.5
QAB42383.1\|12233_13322_-	hypothetical protein	A0A2H4P749	Pseudomonas_phage	5.0e-11	35.3
QAB42384.1\|13411_14677_-	hypothetical protein	A0A2H4P750	Pseudomonas_phage	5.9e-72	38.1
QAB42385.1\|14673_15249_-	hypothetical protein	A0A0K0N6H6	Gordonia_phage	1.6e-24	51.3
QAB42386.1\|15297_17655_-	DNA polymerase III subunit alpha	L7TNG6	Rhizobium_phage	5.6e-177	43.3
QAB42387.1\|17700_18381_-	hypothetical protein	NA	NA	NA	NA
QAB42388.1\|18431_19097_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
QAB42389.1\|19122_20367_-	porphyrin biosynthesis protein	L7TKP0	Rhizobium_phage	2.4e-86	41.7
20456:20474	attL	NA	NA	NA	NA
QAB42390.1\|20511_22434_-	cobalamin biosynthesis protein CobT	A0A2H4P735	Pseudomonas_phage	2.5e-74	42.6
QAB42391.1\|22674_22869_-	hypothetical protein	NA	NA	NA	NA
QAB42392.1\|23291_23711_+	XRE family transcriptional regulator	NA	NA	NA	NA
QAB42393.1\|24049_24634_+\|integrase	site-specific integrase	A0A0A8WF93	Clostridium_phage	8.9e-07	29.3
QAB42394.1\|24630_25047_-	hypothetical protein	NA	NA	NA	NA
QAB42395.1\|25249_25927_+	partition protein	E5FFJ3	Burkholderia_phage	2.8e-12	26.8
QAB42396.1\|25923_26352_+	hypothetical protein	NA	NA	NA	NA
QAB42397.1\|26339_26960_-	hypothetical protein	NA	NA	NA	NA
QAB42398.1\|27033_27606_-	guanylate kinase	A0A218KC48	Bacillus_phage	1.2e-08	28.5
QAB42479.1\|27645_28107_-	hypothetical protein	NA	NA	NA	NA
QAB42399.1\|28124_29540_-	DNA ligase	A0A2H4P729	Pseudomonas_phage	4.2e-87	40.0
QAB42400.1\|29552_30062_-	hypothetical protein	NA	NA	NA	NA
QAB42401.1\|30058_30667_-	hypothetical protein	NA	NA	NA	NA
QAB42402.1\|30660_31152_-	hypothetical protein	NA	NA	NA	NA
QAB42403.1\|31151_31706_-	hypothetical protein	NA	NA	NA	NA
QAB42404.1\|31769_32864_-	DNA primase	A0A2H4P738	Pseudomonas_phage	3.9e-88	43.9
QAB42405.1\|32951_34355_-	DNA helicase	L7TS87	Rhizobium_phage	1.5e-84	39.0
QAB42406.1\|34391_34823_-	hypothetical protein	NA	NA	NA	NA
QAB42407.1\|34910_35642_-	hypothetical protein	L7TM14	Rhizobium_phage	4.5e-16	26.6
QAB42408.1\|35758_36880_-	RepB family plasmid replication initiator protein	NA	NA	NA	NA
QAB42409.1\|37012_37252_+	hypothetical protein	NA	NA	NA	NA
QAB42410.1\|37890_38529_-	lysozyme	A0A075DXC6	Acinetobacter_phage	2.2e-67	63.1
QAB42411.1\|38528_38921_-	hypothetical protein	A0A0P0I8L9	Acinetobacter_phage	1.1e-32	55.5
QAB42412.1\|39044_39248_+	hypothetical protein	NA	NA	NA	NA
QAB42413.1\|39306_39558_-	hypothetical protein	NA	NA	NA	NA
QAB42414.1\|39567_40293_-	hypothetical protein	NA	NA	NA	NA
QAB42415.1\|40306_40621_-	hypothetical protein	NA	NA	NA	NA
QAB42416.1\|40621_52870_-	hypothetical protein	A4JX16	Burkholderia_virus	1.1e-154	36.4
QAB42417.1\|52893_53472_-\|tail	tail assembly protein	J9Q7F8	Salmonella_phage	1.1e-25	36.1
QAB42418.1\|53465_54215_-\|tail	phage tail protein	J9Q7R4	Salmonella_phage	6.0e-48	40.5
QAB42419.1\|54211_54907_-\|tail	phage minor tail protein L	J9Q7Y5	Salmonella_phage	2.8e-60	48.0
QAB42420.1\|54906_55233_-\|tail	phage tail protein	D6PGG4	uncultured_phage	1.2e-08	31.1
QAB42421.1\|55306_60895_-\|tail	tail length tape measure protein	NA	NA	NA	NA
QAB42480.1\|60897_61194_-	hypothetical protein	NA	NA	NA	NA
QAB42422.1\|61250_61604_-	hypothetical protein	NA	NA	NA	NA
QAB42423.1\|61698_62244_-	hypothetical protein	A0A2H4P707	Pseudomonas_phage	6.3e-39	52.2
61668:61686	attR	NA	NA	NA	NA
QAB42424.1\|62328_62826_-	HK97 gp10 family phage protein	NA	NA	NA	NA
QAB42425.1\|62825_63212_-	hypothetical protein	J9Q6D8	Salmonella_phage	1.6e-12	32.8
QAB42426.1\|63208_63559_-	hypothetical protein	J9Q7F6	Salmonella_phage	4.3e-09	35.1
QAB42481.1\|63545_64184_-	hypothetical protein	NA	NA	NA	NA
QAB42427.1\|64242_65013_-	hypothetical protein	NA	NA	NA	NA
QAB42428.1\|65019_65514_-	hypothetical protein	L7TKJ9	Rhizobium_phage	6.8e-08	28.7
QAB42429.1\|65652_66555_-\|capsid	phage major capsid protein	A0A2H4P701	Pseudomonas_phage	6.9e-91	58.3
QAB42430.1\|66690_67569_-	hypothetical protein	A0A2H4P6Z8	Pseudomonas_phage	7.3e-13	29.4
QAB42431.1\|67612_69283_-	hypothetical protein	J9Q7R1	Salmonella_phage	8.1e-146	51.9
QAB42432.1\|69328_70573_-\|terminase	terminase	A0A2H4P6Z9	Pseudomonas_phage	1.3e-151	62.4
QAB42433.1\|70582_71188_-	DNA-binding protein	J9Q6D4	Salmonella_phage	4.0e-18	34.3
QAB42434.1\|71339_71741_-	hypothetical protein	NA	NA	NA	NA
QAB42435.1\|71852_72347_-	hypothetical protein	A0A0D4DBK8	Acinetobacter_phage	7.0e-05	33.0
QAB42436.1\|72315_72639_-	hypothetical protein	NA	NA	NA	NA
QAB42437.1\|72629_73583_-	hypothetical protein	A0A2H4P6X5	Pseudomonas_phage	4.6e-61	42.1
QAB42438.1\|73621_74044_-	thioredoxin	NA	NA	NA	NA
QAB42439.1\|74040_74697_-	ATP-binding cassette domain-containing protein	L7TNS9	Rhizobium_phage	6.6e-59	54.3
QAB42440.1\|74696_75347_-	chromosome partitioning protein ParB	L7TMF9	Rhizobium_phage	3.8e-35	41.9
QAB42441.1\|75343_75946_-	hypothetical protein	NA	NA	NA	NA
QAB42442.1\|75974_76613_-	chromosome partitioning protein ParB	L7TL04	Rhizobium_phage	1.0e-48	46.1
QAB42443.1\|76691_78401_+	DEAD/DEAH box helicase	L7TNS5	Rhizobium_phage	2.0e-131	46.2

DBSCAN-SWA_2

92770 : 100661

Enterobacteria_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAB42457.1\|92770_94348_+	DNA cytosine methyltransferase	K4HZD0	Acidithiobacillus_phage	2.8e-31	25.6
QAB42458.1\|94481_94925_+	DNA mismatch endonuclease Vsr	E5E3X5	Burkholderia_phage	4.2e-33	49.3
QAB42459.1\|95329_96937_+	DUF2813 domain-containing protein	K7PHD1	Enterobacteria_phage	2.7e-130	48.6
QAB42460.1\|96933_97800_+	HNH endonuclease	K7PK19	Enterobacteria_phage	3.8e-38	34.4
QAB42461.1\|98329_98539_+	hypothetical protein	NA	NA	NA	NA
QAB42462.1\|98530_98893_-	hypothetical protein	NA	NA	NA	NA
QAB42463.1\|99797_100661_-	hypothetical protein	A0A2H4P788	Pseudomonas_phage	1.1e-08	24.8

DBSCAN-SWA_3

103888 : 109351

Pseudomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAB42470.1\|103888_104428_-	3'-5' exonuclease	J9Q6J8	Salmonella_phage	8.9e-38	48.9
QAB42471.1\|104681_105266_-	hypothetical protein	NA	NA	NA	NA
QAB42472.1\|105608_106280_-	AAA family ATPase	NA	NA	NA	NA
QAB42473.1\|106276_106642_-	nucleotide pyrophosphohydrolase	A0A0S0NAG1	Pseudomonas_phage	2.8e-35	63.6
QAB42474.1\|106634_106892_-	hypothetical protein	NA	NA	NA	NA
QAB42475.1\|106922_107150_-	hypothetical protein	NA	NA	NA	NA
QAB42476.1\|107149_107434_-	hypothetical protein	NA	NA	NA	NA
QAB42477.1\|107437_108349_-	hypothetical protein	A0A0K2FHE7	Achromobacter_phage	7.7e-66	44.4
QAB42478.1\|108361_109351_-	ribonucleotide-diphosphate reductase subunit beta	A0A2H4P762	Pseudomonas_phage	2.5e-54	38.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP034092

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP034093

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection