CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP025073	Bordetella pertussis strain J384 chromosome, complete genome	5 crisprs	csa3,cas3,DinG,DEDDh	0	0	28	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP025073_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP025073_1

251632-251716

Orphan

Consensus_repeat	Method
GGTGCCTGTCCCCGCGGGGACAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP025073_1

>merge|CP025073|1|251632-251716|CRISPRCasFinder
GGTGCCTGTCCCCGCGGGGACAGATACCGTCTTGGCCGTCAAGCGTTCATGGCGTATGACAGGGTGCCTGTCCCCGCGGGGACAG

>CP025073|1|1|251632-251716|CRISPRCasFinder
GGTGCCTGTCCCCGCGGGGACAG	ATACCGTCTTGGCCGTCAAGCGTTCATGGCGTATGACAG
GGTGCCTGTCCCCGCGGGGACAG

Protein	Signature genes	Signature genes Name	Protein_function
CP025073.1\|AZW59372.1\|257425_258817_+\|class-II-fumarate-hydratase	unknown	unknown	gnl\|CDD\|234779
CP025073.1\|AZW59376.1\|262003_263758_+\|gamma-glutamyltransferase	unknown	unknown	gnl\|CDD\|223482
CP025073.1\|AZW59370.1\|254640_255279_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|182775
CP025073.1\|AZW59371.1\|256737_257274_-\|bifunctional-alanine-racemase/tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE	unknown	unknown	gnl\|CDD\|223873
CP025073.1\|AZW59367.1\|250571_251621_+\|phosphoribosylformylglycinamidine-cyclo-ligase	unknown	unknown	gnl\|CDD\|235439
CP025073.1\|AZW59361.1\|242590_244693_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|129868
CP025073.1\|AZW59364.1\|247566_248922_-\|polynucleotide-adenylyltransferase-PcnB	unknown	unknown	gnl\|CDD\|130997
CP025073.1\|AZW59359.1\|240589_241333_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
CP025073.1\|AZW59358.1\|239157_239568_+\|4-carboxymuconolactone-decarboxylase	unknown	unknown	gnl\|CDD\|131478
CP025073.1\|AZW59363.1\|247078_247570_-\|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase	unknown	unknown	gnl\|CDD\|172582
CP025073.1\|AZW59362.1\|246103_247060_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
CP025073.1\|AZW59375.1\|260997_261897_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176107
CP025073.1\|AZW59374.1\|259949_260933_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugE	unknown	unknown	gnl\|CDD\|270295
CP025073.1\|AZW59373.1\|258833_259814_-\|AEC-family-transporter	unknown	unknown	gnl\|CDD\|223751
CP025073.1\|AZW62575.1\|255421_256666_-\|N-acetylmuramoyl-L-alanine-amidase	unknown	unknown	gnl\|CDD\|182376
CP025073.1\|AZW59365.1\|248922_249621_-\|HAD-IB-family-hydrolase	unknown	unknown	gnl\|CDD\|319796
CP025073.1\|AZW59366.1\|249617_250319_-\|DnaA-regulatory-inactivator-Hda	unknown	unknown	gnl\|CDD\|236347
CP025073.1\|AZW59360.1\|241376_242420_-\|C4-dicarboxylate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270320
CP025073.1\|AZW59369.1\|252664_254554_-\|DNA-mismatch-repair-protein-MutL	unknown	unknown	gnl\|CDD\|234630
CP025073.1\|AZW59368.1\|251726_252668_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626

Protein	Function_ID	Function_description	E-value
CP025073.1\|AZW59372.1\|257425_258817_+\|class-II-fumarate-hydratase	gnl\|CDD\|234779	PRK00485, fumC, fumarate hydratase; Reviewed.	0
CP025073.1\|AZW59376.1\|262003_263758_+\|gamma-glutamyltransferase	gnl\|CDD\|223482	COG0405, Ggt, Gamma-glutamyltransferase [Amino acid transport and metabolism].	0
CP025073.1\|AZW59370.1\|254640_255279_+\|hypothetical-protein	gnl\|CDD\|182775	PRK10847, PRK10847, DedA family protein.	1.10927e-69
CP025073.1\|AZW59371.1\|256737_257274_-\|bifunctional-alanine-racemase/tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE	gnl\|CDD\|223873	COG0802, COG0802, Predicted ATPase or kinase [General function prediction only].	2.28113e-54
CP025073.1\|AZW59367.1\|250571_251621_+\|phosphoribosylformylglycinamidine-cyclo-ligase	gnl\|CDD\|235439	PRK05385, PRK05385, phosphoribosylaminoimidazole synthetase; Provisional.	0
CP025073.1\|AZW59361.1\|242590_244693_+\|hypothetical-protein	gnl\|CDD\|129868	TIGR00786, TRAP_transporter_permease_protein_SiaT, TRAP transporter, DctM subunit. The Tripartite ATP-independent Periplasmic Transporter (TRAP-T) Family (TC 2.A.56)- DctM subunit TRAP-T family permeases generally consist of three components, and these systems have so far been found in Gram-negative bacteria, Gram-postive bacteria and archaea. Only one member of the family has been both sequenced and functionally characterized. This system is the DctPQM system of Rhodobacter capsulatus (Forward et al., 1997). DctP is a periplasmic dicarboxylate (malate, fumarate, succinate) binding receptor that is biochemically well-characterized. DctQ is an integral cytoplasmic membrane protein with 4 putative transmembrane a-helical spanners (TMSs). DctM is a second integral cytoplasmic membrane protein with 12 putative TMSs. These proteins have been shown to be both necessary and sufficient for the proton motive force-dependent uptake of dicarboxylates into R. capsulatus. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	2.77055e-96
CP025073.1\|AZW59364.1\|247566_248922_-\|polynucleotide-adenylyltransferase-PcnB	gnl\|CDD\|130997	TIGR01942, pcnB, poly(A) polymerase. This model describes the pcnB family of poly(A) polymerases (also known as plasmid copy number protein). These enzymes sequentially add adenosine nucleotides to the 3' end of RNAs, targeting them for degradation by the cell. This was originally described for anti-sense RNAs, but was later demonstrated for mRNAs as well. Members of this family are as yet limited to the gamma- and beta-proteobacteria, with putative members in the Chlamydiacae and spirochetes. This family has homology to tRNA nucleotidyltransferase (cca).	4.58369e-147
CP025073.1\|AZW59359.1\|240589_241333_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	5.58304e-45
CP025073.1\|AZW59358.1\|239157_239568_+\|4-carboxymuconolactone-decarboxylase	gnl\|CDD\|131478	TIGR02425, putative_gamma-carboxymuconolactone_decarboxylase, 4-carboxymuconolactone decarboxylase. Members of this family are 4-carboxymuconolactone decarboxylase, which catalyzes the third step in the catabolism of protocatechuate (and therefore the fourth step in the catabolism of para-hydroxybenzoate, of 3-hydroxybenzoate, of vanillate, etc.). Most members of this family are encoded within protocatechuate catabolism operons. This protein is sometimes found as a fusion protein with other enzymes of the pathway, as in Rhodococcus opacus, Streptomyces avermitilis, and Caulobacter crescentus. [Energy metabolism, Other].	1.36265e-47
CP025073.1\|AZW59363.1\|247078_247570_-\|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase	gnl\|CDD\|172582	PRK14092, PRK14092, 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.	2.78166e-87
CP025073.1\|AZW59362.1\|246103_247060_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	6.01101e-118
CP025073.1\|AZW59375.1\|260997_261897_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176107	cd08415, PBP2_LysR_opines_like, The C-terminal substrate-domain of LysR-type transcriptional regulators involved in the catabolism of opines and that of related regulators, contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate-domain of LysR-type transcriptional regulators, OccR and NocR, involved in the catabolism of opines and that of LysR for lysine biosynthesis which clustered together in phylogenetic trees. Opines, such as octopine and nopaline, are low molecular weight compounds found in plant crown gall tumors that are produced by the parasitic bacterium Agrobacterium. There are at least 30 different opines identified so far. Opines are utilized by tumor-colonizing bacteria as a source of carbon, nitrogen, and energy. NocR and OccR belong to the family of LysR-type transcriptional regulators that positively regulates the catabolism of nopaline and octopine, respectively. Both nopaline and octopalin are arginine derivatives. In Agrobacterium tumefaciens, NocR regulates expression of the divergently transcribed nocB and nocR genes of the nopaline catabolism (noc) region. OccR protein activates the occQ operon of the Ti plasmid in response to octopine. This operon encodes proteins required for the uptake and catabolism of octopine. The occ operon also encodes the TraR protein, which is a quorum-sensing transcriptional regulator of the Ti plasmid tra regulon. LysR is the transcriptional activator of lysA gene encoding diaminopimelate decarboxylase, an enzyme that catalyses the decarboxylation of diaminopimelate to produce lysine. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.62875e-38
CP025073.1\|AZW59374.1\|259949_260933_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugE	gnl\|CDD\|270295	cd13577, PBP2_BugE_Glu, Glutamate transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	4.35876e-158
CP025073.1\|AZW59373.1\|258833_259814_-\|AEC-family-transporter	gnl\|CDD\|223751	COG0679, COG0679, Predicted permeases [General function prediction only].	1.13912e-41
CP025073.1\|AZW62575.1\|255421_256666_-\|N-acetylmuramoyl-L-alanine-amidase	gnl\|CDD\|182376	PRK10319, PRK10319, N-acetylmuramoyl-L-alanine amidase AmiA.	7.29619e-86
CP025073.1\|AZW59365.1\|248922_249621_-\|HAD-IB-family-hydrolase	gnl\|CDD\|319796	cd02612, HAD_PGPPase, phosphatidylglycerol-phosphate phosphatase, similar to Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C. This family includes Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C, PgpC (previously named yfhB) which catalyzes the dephosphorylation of phosphatidylglycerol-phosphate (PGP) to phosphatidylglycerol (PG). This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	3.91431e-64
CP025073.1\|AZW59366.1\|249617_250319_-\|DnaA-regulatory-inactivator-Hda	gnl\|CDD\|236347	PRK08903, PRK08903, DnaA regulatory inactivator Hda; Validated.	2.81236e-100
CP025073.1\|AZW59360.1\|241376_242420_-\|C4-dicarboxylate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270320	cd13602, PBP2_TRAP_BpDctp6_7, Substrate-binding domain of a pyroglutamic acid binding DctP subfamily of the tripartite ATP-independent periplasmic transporters; contains the type 2 periplasmic binding protein fold. DctP6 and DctP7 groups of the TRAP transporters that involved in pyroglutamic acid transport. TRAP transporters are a large family of solute transporters ubiquitously found in bacteria and archaea. They are comprised of a periplasmic substrate-binding protein (SBP; often called the P subunit) and two unequally sized integral membrane components: a large transmembrane subunit involved in the translocation process (the M subunit) and a smaller membrane of unknown function (the Q subunit). The driving force of TRAP transporters is provided by electrochemical ion gradients (either protons or sodium ions) across the cytoplasmic membrane, rather than ATP hydrolysis. This substrate-binding domain belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.99378e-85
CP025073.1\|AZW59369.1\|252664_254554_-\|DNA-mismatch-repair-protein-MutL	gnl\|CDD\|234630	PRK00095, mutL, DNA mismatch repair endonuclease MutL.	0
CP025073.1\|AZW59368.1\|251726_252668_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	4.17279e-156

>CP025073.1|AZW59367.1|250571_251621_+|phosphoribosylformylglycinamidine-cyclo-ligase
MTNQHSAPLTYRDAGVDIDAGDALVDRIKPLAARTMRPGVLAGIGGFGALFEVPKKFREPVLVSGTDGVGTKLRLAFDWNRHDTVGIDLVAMSVNDILVQGAEPLYFLDYFACGKLSVDTAAAVVGGIARGCELAGCALIGGETAEMPGMYPDGEYDLAGFAVGAVDKSAIIDGKSIQPGDVVLGLASSGAHSNGYSLVRKILERAGARPDQDFHGQPLVDVVMAPTRIYVKQVLAALDRHGPAIKGLAHITGGGLLDNVPRILQPGMAAQLQRDGWEMPKLFQWLQQQGSVADAEMHRVFNCGIGMVLVVAADQADAVAATLREQGEIVNRIGEIVPQQDGMAQTVVV
>CP025073.1|AZW59366.1|249617_250319_-|DnaA-regulatory-inactivator-Hda
MNRQLLLDVLPAPAPALNNYIAGPNGQALAAAHALTAGRAIYLWGPAGCGRTHLLRGLSARPEAIYIDAARAAQSLRELAEADSTAPMPRLVAVDDVHRMDDARQAGLFALYNRWRESAATGRAFALAVSGDRAPMSLPLREDLRTRLGWDLVFRLDPLSDADKLAALTAQAAERGLQLAPEVINWMLTHHERDIRKLAALLDALDRYSLATGRPITIPLLRAMLADPHSQAT
>CP025073.1|AZW59365.1|248922_249621_-|HAD-IB-family-hydrolase
MTTRRLALFDLDHTLLPLDSDYQWADFLARTGRAGDPAEARRRNDDLMERYNRGELTAEQAAEFMLGLLAAHSPVELAAWHEEFMRDVIRPSLTVQAVDVVRGHLAAGDLCALVTATNSFVTAPIARAFGVQHLIATDPEYRDGRYTGRIEGTPSFREGKVVRVNQWLAGMGLALGDFAESYFYSDSVNDVPLLEAVTRPIAANPSPGLREIAQARGWQVIDLFDHLEDAKS
>CP025073.1|AZW59364.1|247566_248922_-|polynucleotide-adenylyltransferase-PcnB
MITETIRKFVGRLFAPALRGPQRIGAERHGIDRRNVSRHAIKVCDVLRQHGYEAYIVGGAVRDLIVGLEPKDFDVATNATPEQIRPLFRRARIIGRRFQLVHVVFGQEIIETSTFRAPASDDQETDEHGRILRDNVFGSQEEDAARRDFTMNALYYDPHTEEVIDYHQGVQDLKKRQVRIIGDPVKRYREDPVRMLRAVRFAAKLNGSIDTATRQPIRTMASLIENVPASRLFDEMLKLLTCGHAMDCLRQLRNDGLHHGLLPLLDVVLEQPGGENFVELALERTDARVRAGKTISPSFLFAALLWQLVDVRWKQLRAQGEHNIPALVQAADSVLDEQTEKLAIQRRFSSDMREIWFMQPRFERRAGKTIYRMLEQPRFRAACDFLQLRAAAGEFDSVLAQWWMDLANGDDATRAEMIEETAHLPRETGDAPAQKRRRPRRRPSNRPREPQ
>CP025073.1|AZW59363.1|247078_247570_-|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase
MNGSPASTLAYVGLGASLGDAAATLRSVLAELAAAPGILACKASRLYRTAPVEAQGPDFVNAVAALDTTLAPLDLLDLLQALEQRHGRERPYRNAPRTLDLDLLLYGEQAIDHPRLSVPHPRMHERAFVLAPLCELVPALRLAQGDCAALLAALEDQAIEPLR
>CP025073.1|AZW59362.1|246103_247060_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MKKRIWGTLLAAAMTVGSGAAHAGYPDKAVRIVVPFAAGGGVDALARPFAKELGDILGQSIVVENKPSNTGQIGATDVARAAADGYTLLLSSAAFATTPAFYPQVPYDPVKDFSPVMIMAAAPQVLVASNRFKAASLPDVLAQARQSDRINFALSASTGIQALATAMLAGQGGVTFMTIPYKGAGAAFMDLISGEVDLMIDNPASSLVHVRAGKLRVLATTGSKRMAILPDVPTVAETLPGFEARNWFVLAAPQGTPPAVIQKLNEASARALNTPAMRQMLERDGIDLVADSPAHAAAFLQDEIAKWGKVVKEGNLQP
>CP025073.1|AZW59361.1|242590_244693_+|hypothetical-protein
MSSIEMPAPVMPIEPAELAGASPYPLAIDQDFCLIRWMAAISRACGALATVALLLMALSMCYEIFSRYLFNAPTAWATEISGYLLVATVFFGLAAAQASNSHVQVELWIDRLSAPVRLRVELLCQWLALLFCVVLGWQMASFNVREYLNDTRDWGLLSTPQWMPELAVSVGMVVFCMSILVDIYRLSPPAQAWRRWLTPALLALLAAALVALGANAVPMAAGGRFDWGMALIVAALLACAWAWSGVRTLAHVVLVVGGCAVLYGLARGQSLGWVAFLLVASMMLLLFLGVRIGVALGLVGLFGVYFLLSRPQLSLLAERAWSSTNTFTLTAVPMFIFMGGLLLRSGITAGMFDALVRWFGRAPGGLAHASAGASAVFAAVSGSSLATAATLGKVACPDMIERGYSPRLTYGVAAAGATLGILIPPSIPMIIYGTTVGASVTHLFLAGMLPGLLLMACFMLGALVWALAVPGSAPVARAYTLREKLSASRGMVPFVAIIGAVLGSMYTGVATPTEAAAIGAVSAFVLCLVRRQLSWRALFEIAHDSAKVTALLLLIVVGAGIFSWVFDYLRLPREVVNLIQGADLSPALIVAAMVLAYLVLGMFVESIAMMLMTLPVTYPIAMSLGLDPIWFGVFLVLMIELGLITPPVGMVLFVLRSMNEKARFTDIIRGALPFVLIILLFLCLIYIYPQIVMWLPQQVK
>CP025073.1|AZW59360.1|241376_242420_-|C4-dicarboxylate-ABC-transporter-substrate-binding-protein
MSQRFPLPRGFQAALAAAALCTASWSGAAAAQTYDLTMAVITSPGDGYSILTASVPERVAKATDGKVKVTVSDSLVPPAQIATAVREGRVDMSAALHTYLAADEPRMGIFNLPGLINNIQEYKQVCDAFWCEDTRKIWKDKWNAIVLAEGAWCTQQLFSKDPIHKVEDFKGKRLRVHNPQTAEVVNALGGKPVAMPTTEIFPALERGVIDGLFISTCVGGSLEFWRIAKNVQNWSLGPINGWAILANPDSWQKLPADVQKQVQGAMDALQQEAFGNYDTFVSNAQQEMMKKGVTFWVAPEEERAKLMQQQYIGPSYEAWNKRAKQVGFDGPAYLDRVRTTLGKSASN
>CP025073.1|AZW59359.1|240589_241333_-|GntR-family-transcriptional-regulator
MPFPFCNTNRMTSPAAPEGEFKVQRVASVLRHSVTESIRNAILVGRFRPGERLPERELCEMTGVSRTLVREALRQLESEGLIVVIPHRGPVVERLSPEQARGIYQVREELEGLACQLFAEHATEPQLAALQEAFQALKRALTRGTPLEQIAAKNAFYQQLLDGAGNEALTTTLRLLNSRVMLLRSTSMQAPGRAKHSVAELSNLLQALVARDGKAARKAGSLHVRNAASVAIAILQDSLADAAATAE
>CP025073.1|AZW59358.1|239157_239568_+|4-carboxymuconolactone-decarboxylase
MALRPEFQTEQFQKGLAVRRAVVGDAYVDKSLNSADDLTASLQKLVTEYCWGEVWTRPGLERKTRSFLNLAMLIALNRPNELRLHLRGAINNGVTKDEIVEVVLQAAIYCGVPAALDAMKAVREVVETMEKEGAFA
>CP025073.1|AZW59368.1|251726_252668_-|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MTPRAIICLAGPTAAGKSASTLALAQRWPLEIINVDSATIYRGMDIGTAKPSAAERAQVPQHLLDIRDPAQSYSAAEFRADALRLIAEIHARGRIPLLAGGTMLYYKALREGLDDLPQADPALRAELEARAARLGWPALHAELALLDPATAARLSPNDSQRIQRALEICRLAGQPMSALLQGERRGDAPSPYRYVTLSLEPSERAALHARIAQRFDAMLAAGLVEEVRGLHARPDLHPGLPSVRCVGYRQMWSYLDGDIDLDTAREQGVAATRQLAKRQLTWLRAQPERVIIDCLAGDAVARTVDAMARALPD
>CP025073.1|AZW59369.1|252664_254554_-|DNA-mismatch-repair-protein-MutL
MSDRRPIATLPDLLISQIAAGEVIERPASVLKEILENAIDAGARAIEVRLEGGGIRRIAVTDDGSGIPPEELPLALTRHATSKIRSLDELESVASMGFRGEALASIASVADLTIISRTRGAEHAWQIDGGSLQVSPASGPPGTTIDVRQLFDRVPARRKFLRSEATEFGHCVDAMERIALAHPEVAFRLFHHDRAQRQWLPADHGQRIRDVLGAEFVGHVLPVLAAAGAIALMGMVTRPTAARARADRQYLYVNGRFVRDRTVSHALRSAYADVLHGDRQPAYVLYLDIDPGAVDVNVHPAKHEVRFRDSGAVHRFVSQVVGQTLAQTGGAEAVPAGVPDGAAPDTAYAGEPAAAAPGLAEPRAPYPAAYPSPGQSPYQGSPARPHTQVPFRLHGEPAGIPATDWQSLYRPLPGDAAPAATALRAAPATPLPTADEHPLGQALAQLHGIYILAQNSRGLVLVDMHAAHERVVYEQLKRALDDRALPRQDLLVPVVFHAAEKDVALVEEHETQLNELGFEMRPSGPASIAVRSVPALLARGDIESLARAVLRDLGAVGVSRLLTEQRNELLSTMACHGSVRANRRLTLEEMNALLRQMEITERADQCNHGRPTWVQWSVNDLDKLFLRGQ
>CP025073.1|AZW59370.1|254640_255279_+|hypothetical-protein
MLDFFNMVLHIDQTLGIWVEQYGVWVYLVLFLIVFAETGLVVLPFLPGDSLLFIAGAFGATGHMDPVLTAALLIVAAISGNTVNYTIGRYIGPRVFSMNLRFLDRNALMRTHAFYEKHGGKTIVMSRFIPVIRTFAPFVAGVADMRLARFQLFNIGGALLWVISLVAAGYFFGNIPLVREHLNTIVLIGLGAAIVPVVIGALVRLLQVRRGQ
>CP025073.1|AZW62575.1|255421_256666_-|N-acetylmuramoyl-L-alanine-amidase
MRTWPADEYTRVTLELDSELKAEHFTLENPHRLVVDIEGLSVNAALNDLVSKVRHDDPYIQGLRVAQNRPNVVRLVFDLKQSVAPQVFTLKPVADYQYRLVLDLYPKVAQDPLMAILNKQSGPDVDDPLARVLDEIARNQPAPDQPAAPLARGQEPAPALPAPPIKPLPAPGRSASRKRMLTIALDPGHGGEDPGAIGRSGLREKDVVLRIARRLKTLIDAQPYMRAYLTRDDDYFVPLHVRVQKARRVRADLFVSIHADAFIKPTANGSSVFALSERGASSTQARWLADKENAADLIGGVNLGSHDRQVAKVLLDLSTTAQINDSLKVGSAFLDEIKKINRLHKNRVEQAGFAVLKAPDIPSILVETAFISNPKEEALLRSAAHQEKLAQAMMTGIDRYFTANPPLARVGDVS
>CP025073.1|AZW59371.1|256737_257274_-|bifunctional-alanine-racemase/tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE
MSAPPTTLCLHLPDEAATENLARQLAPLVDGRRGGQPGGQIHLQGDLGAGKTAFTRALLRECGIQGRIKSPSYALLESYKVSNLYFYHLDFYRFSDSREWLDAGFRDLLRDDAVVLIEWPERAAGLLPPPDLLISLAYADQGRDASLTAHTARGQTWLNAIVPPPTARSLPAPPPADA
>CP025073.1|AZW59372.1|257425_258817_+|class-II-fumarate-hydratase
MKTRTEKDTFGPIEVPEQHLWGAQTQRSLHFFAISTEKMPVPLVAAMARLKRAAAKVNAELGELDPQVADAIMRAADEVIAGKWPDEFPLSVWQTGSGTQSNMNMNEVLANRASELLGGERGEGRKVHPNDHVNRGQSSNDTFPTAMHVAAAVEVEHRVLPALKALRGTLAAKSAAFYDIVKIGRTHLQDATPLTLGQEISGYVAQLDLAEQQIRATLAGLHQLAIGGTAVGTGLNAHPQFSAKVSAELAHDTGSAFVSAPNKFQALASHEALLFAHGALKTLAAGLMKIANDVRWLASGPRSGLGEISIPENEPGSSIMPGKVNPTQCEAVTMLAAQVMGNDVAINVGGASGNFELNVFKPLVIHNFLQSVRLLADGMVSFDKHCAAGIEPNRERITELVERSLMLVTALNPHIGYDKAAQIAKKAHKENLSLKEAALALGHLTEAQFAEWVVPGDMTNARR
>CP025073.1|AZW59373.1|258833_259814_-|AEC-family-transporter
MSENSSLRRDAEAPLLSIFLPGSMSVALLVLPDFMLVALGWALRHKLGFSREFFAGTERMVYFVLFPALLFQSILRTPISAGHAMQLLQATAALMACGVALAWLAGPVLRPAPVALASAAQCGYRFNTYIGLALAASLAGGPGQTIMALIVGFAVPMANVAAVYGLARHSGNGLLRELARNPLLVSTLLSLACNLAGLSLPGPIDTVMARLGAAALALGIMCVGASLAWEGGKGHGRLIGWMLAVKLAAMPSAALGIAWALGLPALETRMLVLFSALPTASAAYVLAMRMGGDGRMVAVLISLGTLASAATIPLWLTAAAGLGAPN
>CP025073.1|AZW59374.1|259949_260933_+|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugE
MNKVRTLVQAIAVATGLVAAAGAQAADAYPSKAIRVIVPFAPGGSTDIIARLVTQRMSQELGQPMVVENKGGAGGAIGASEAARAEPDGYTLSIATVSTMAVNPACRPKDLPYDPIKDFQPVTNFANTANVVAVNPKFPAKDFKGFLEELKKNPGKYSYGSSGTCGVLHLMGESFKMATGTDIVHVPYKGSGPAVADAVGGQIELIFDNLPSSMPQIQAGKLRAMAIAWPTRIDAIKDVPTFADAGFPVLNQPVWYGLLAPKGTPMDVVNKLRDAAVVALKDPKVIKALDDQGSAPSGNTPEEFAKEIKEQYDWAQDVVKKQNIKLD
>CP025073.1|AZW59375.1|260997_261897_-|LysR-family-transcriptional-regulator
MRLRHIEIFEAIRRTGSLTEAAAALHISQPAASKLLAHAEAQLGFKLFERVKGRLVATREAEILAPEVARLNQDLGSVRRLAASLRDRPHGHLRLGCAPALGLGLLPGVVRASRDAQPGITFDIHTHHSAELVQGLLAHELDLAITFDANNHPGLTRTSLGHTELVHLSRLPGAGTTRLQELGGETLIVLDARDASGSLLQMALDAQGLAPRVAIQVQTHYVACALAEAGCGDAVVDAITARAMLRPGMALRRLEPALRVPISVMTRSQDALSTLHHDFIERLRQACSVLQAQPAPQPE
>CP025073.1|AZW59376.1|262003_263758_+|gamma-glutamyltransferase
MPLRTLLAALCAAAICQAPAWAREAPGVAREDVNPEIASARSERAQAHAQRYMIATANPLASEAGYRILRAGGSATDAIIAAQLVLNLVEPQSSGIGGGAFMVHYDRGAGELRVYDSRETAPAAARPDRFLREGKPLSYAESVNNGRAVGTPGLLRGLELAHRQHGKLPWQALFEPAIAMAEQGFAVSPRLHESIAGDKALAAQPAAARYFYGPDGQAWPVGHRLRNPEFAATLRSIAREGADAFYRGPIARDIVAAVRAHPTPGDLAEADLAGYRAVVREPVCGLYRGYRLCGAPPPSSGPLAVLQMLGELEQYPLARMRPGSVEAVHYFSEAGRLAFADRDFYVADPAFVDVPVRALLDPAYLRQRGALIRPDRSMKTALPGDPQGLLAERARDDAIEVPSTSHLVAVDAAGNVVSMTSTIEAAFGSKIFVRGFLLNNEMTDFSSSYRDPEGRLVANRVEPGKRPRSSMAPMIVFRAGKPVLALGSPGGSAIINYVAKTLVGVLDWKLDVQQAIALPNLGSRNKETELERGTALEALAPALRRMGHEVRITDFPSGIQGIVIGPHGLAGGADPRREGLALGD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP025073_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP025073_2

433075-433168

Orphan

Consensus_repeat	Method
GTGCCTGTCCCCGCCGGGACAGGCAC	CRISPRCasFinder

1 spacers

DEDDh

The CRISPR arrays of CP025073_2

>merge|CP025073|2|433075-433168|CRISPRCasFinder
GTGCCTGTCCCCGCCGGGACAGGCACCCGGGCCCAGGAAAACCCCCACGCTGCGCCCGCTGTGCGGGCGTGCCTGTCCCCGCCGGGACAGGCAC

>CP025073|2|2|433075-433168|CRISPRCasFinder
GTGCCTGTCCCCGCCGGGACAGGCAC	CCGGGCCCAGGAAAACCCCCACGCTGCGCCCGCTGTGCGGGC
GTGCCTGTCCCCGCCGGGACAGGCAC

Protein	Signature genes	Signature genes Name	Protein_function
CP025073.1\|AZW59526.1\|424564_426076_+\|TRAP-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270238
CP025073.1\|AZW59529.1\|431363_432314_+\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025073.1\|AZW59540.1\|443188_444361_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173841
CP025073.1\|AZW59522.1\|420414_421473_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133030
CP025073.1\|AZW59537.1\|440251_441037_+\|enoyl-CoA-hydratase	unknown	unknown	gnl\|CDD\|181723
CP025073.1\|AZW59530.1\|432445_432844_-\|elongation-factor-G	unknown	unknown	gnl\|CDD\|234569
CP025073.1\|AZW59539.1\|442085_443063_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176106
CP025073.1\|AZW59528.1\|428184_428919_-\|DNA-polymerase-III-subunit-epsilon	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|235574
CP025073.1\|AZW59523.1\|421602_422097_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
CP025073.1\|AZW59524.1\|422189_423167_+\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025073.1\|AZW59538.1\|441103_442075_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270234
CP025073.1\|AZW59532.1\|433813_434158_-\|TIGR01244-family-phosphatase	unknown	unknown	gnl\|CDD\|225984
CP025073.1\|AZW59533.1\|434257_435658_-\|PLP-dependent-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|224089
CP025073.1\|AZW59531.1\|433254_433725_-\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180
CP025073.1\|AZW62585.1\|426091_427405_-\|short-chain-fatty-acids-transporter	unknown	unknown	gnl\|CDD\|224942
CP025073.1\|AZW59536.1\|439026_440259_+\|CoA-transferase	unknown	unknown	gnl\|CDD\|367110
CP025073.1\|AZW59534.1\|437446_437965_-\|methyltransferase	unknown	unknown	gnl\|CDD\|224204
CP025073.1\|AZW59525.1\|423362_424568_+\|sodium/glutamate-symporter	unknown	unknown	gnl\|CDD\|129314
CP025073.1\|AZW59535.1\|438075_438831_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223930
CP025073.1\|AZW59527.1\|427595_427775_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377342

Protein	Function_ID	Function_description	E-value
CP025073.1\|AZW59526.1\|424564_426076_+\|TRAP-transporter-substrate-binding-protein	gnl\|CDD\|270238	cd13520, PBP2_TAXI_TRAP, Substrate binding domain of TAXI proteins of the tripartite ATP-independent periplasmic transporters; the type 2 periplasmic binding protein fold. This group includes Thermus thermophilus GluBP (TtGluBP) of TAXI-TRAP family and closely related proteins. TRAP transporters are ubiquitous in prokaryotes, but absent from eukaryotes. They are comprised of an SBP (substrate-binding protein) of the DctP or TAXI families and two unequally sized integral membrane components. Although TtGluBP is predicted to be an L-glutamate and/or an L-glutamine-binding protein, the substrate spectrum of TAXI proteins remains to be defined. A sequence-homology search also shows that TtGluBP shares low sequence homology with putative immunogenic proteins of uncharacterized function. The substrate-binding domain of TAXI proteins belongs to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and tworeceptor cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	9.13066e-82
CP025073.1\|AZW59529.1\|431363_432314_+\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.02206e-23
CP025073.1\|AZW59540.1\|443188_444361_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|173841	cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26. Putative acyl-CoA dehydrogenases (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha, beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	4.27565e-82
CP025073.1\|AZW59522.1\|420414_421473_-\|glycosyltransferase	gnl\|CDD\|133030	cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.	4.18053e-89
CP025073.1\|AZW59537.1\|440251_441037_+\|enoyl-CoA-hydratase	gnl\|CDD\|181723	PRK09245, PRK09245, crotonase/enoyl-CoA hydratase family protein.	5.15941e-155
CP025073.1\|AZW59530.1\|432445_432844_-\|elongation-factor-G	gnl\|CDD\|234569	PRK00007, PRK00007, elongation factor G; Reviewed.	1.37761e-90
CP025073.1\|AZW59539.1\|442085_443063_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176106	cd08414, PBP2_LTTR_aromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of aromatic compounds and that of other related regulators, contains type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LTTRs involved in degradation of aromatic compounds, such as CbnR, BenM, CatM, ClcR and TfdR, as well as that of other transcriptional regulators clustered together in phylogenetic trees, including XapR, HcaR, MprR, IlvR, BudR, AlsR, LysR, and OccR. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the substrate-binding domains from ionotropic glutamate receptors, LysR-like transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	2.33368e-60
CP025073.1\|AZW59528.1\|428184_428919_-\|DNA-polymerase-III-subunit-epsilon	gnl\|CDD\|235574	PRK05711, PRK05711, DNA polymerase III subunit epsilon; Provisional.	2.40573e-142
CP025073.1\|AZW59523.1\|421602_422097_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.34959e-07
CP025073.1\|AZW59524.1\|422189_423167_+\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.0826e-23
CP025073.1\|AZW59538.1\|441103_442075_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270234	cd07012, PBP2_Bug_TTT, Bug (Bordetella uptake gene) protein family of periplasmic solute-binding receptors; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) proteins present in a number of bacterial species, but mainly in proteobacteria. In eubacteria, at least three families of periplasmic binding-protein dependent transporters are known: the ATP-binding cassette (ABC) transporters, the tripartite ATP-independent periplasmic transporters, and the tripartite tricarboxylate transporters (TTT). Bug proteins are the PBP components of the TTT. Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	2.06741e-117
CP025073.1\|AZW59532.1\|433813_434158_-\|TIGR01244-family-phosphatase	gnl\|CDD\|225984	COG3453, COG3453, Uncharacterized protein conserved in bacteria [Function unknown].	3.40043e-35
CP025073.1\|AZW59533.1\|434257_435658_-\|PLP-dependent-aminotransferase-family-protein	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	3.43796e-109
CP025073.1\|AZW59531.1\|433254_433725_-\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	9.38587e-30
CP025073.1\|AZW62585.1\|426091_427405_-\|short-chain-fatty-acids-transporter	gnl\|CDD\|224942	COG2031, AtoE, Short chain fatty acids transporter [Lipid metabolism].	6.57351e-166
CP025073.1\|AZW59536.1\|439026_440259_+\|CoA-transferase	gnl\|CDD\|367110	pfam02515, CoA_transf_3, CoA-transferase family III. CoA-transferases are found in organisms from all lines of descent. Most of these enzymes belong to two well-known enzyme families, but recent work on unusual biochemical pathways of anaerobic bacteria has revealed the existence of a third family of CoA-transferases. The members of this enzyme family differ in sequence and reaction mechanism from CoA-transferases of the other families. Currently known enzymes of the new family are a formyl-CoA: oxalate CoA-transferase, a succinyl-CoA: (R)-benzylsuccinate CoA-transferase, an (E)-cinnamoyl-CoA: (R)-phenyllactate CoA-transferase, and a butyrobetainyl-CoA: (R)-carnitine CoA-transferase. In addition, a large number of proteins of unknown or differently annotated function from Bacteria, Archaea and Eukarya apparently belong to this enzyme family. Properties and reaction mechanisms of the CoA-transferases of family III are described and compared to those of the previously known CoA-transferases.	8.36236e-118
CP025073.1\|AZW59534.1\|437446_437965_-\|methyltransferase	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	1.12064e-44
CP025073.1\|AZW59525.1\|423362_424568_+\|sodium/glutamate-symporter	gnl\|CDD\|129314	TIGR00210, Sodium/glutamate_symport_carrier_protein, sodium--glutamate symport carrier (gltS). [Transport and binding proteins, Amino acids, peptides and amines].	1.2444e-106
CP025073.1\|AZW59535.1\|438075_438831_+\|hypothetical-protein	gnl\|CDD\|223930	COG0861, TerC, Membrane protein TerC, possibly involved in tellurium resistance [Inorganic ion transport and metabolism].	1.14565e-78
CP025073.1\|AZW59527.1\|427595_427775_-\|hypothetical-protein	gnl\|CDD\|377342	pfam04391, DUF533, Protein of unknown function (DUF533). Some family members may be secreted or integral membrane proteins.	0.00323203

>CP025073.1|AZW59530.1|432445_432844_-|elongation-factor-G
MTRRTSIERYRNIGISAHIDAGKATTTERILFYTGITHKLGEVHEGAATMDWMEQEQGRGITITSAATTAFWRGMAGNYPEHRINIIDTPGHVDFTIEVERSMRVLDGACMVYDSVGGVQEVATVMVVLPGQ
>CP025073.1|AZW59529.1|431363_432314_+|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDKYNLLTVHS
>CP025073.1|AZW59528.1|428184_428919_-|DNA-polymerase-III-subunit-epsilon
MRQIIFDTETTGLDPAQGHRIVEIGCVEIVNRMVTGNNLHLYLNPDRDSDPEALAVHGLTTEFLADKPRFAEVAEQFLAFIADAELIAHNAAFDVKFFNAELQRIGRDPLNTHCENIVDSLLHARSLHPGKRNSLDALCDRYGISNAHRTLHGALLDSQLLAEVWLAMTRGQDALLIDVDDQGANANGALVLGKFDASVLTVLAASEAELAEHAAYLQALDKAVGGACAWRAIEPLPAESGQPG
>CP025073.1|AZW59527.1|427595_427775_-|hypothetical-protein
MHPDTNTMLIIIAAAVALMIVGFGLRDRNLGLGLLGIGLIAALATIAYKAYITFNSFYY
>CP025073.1|AZW62585.1|426091_427405_-|short-chain-fatty-acids-transporter
MFKLMSRSAVKMVERYLPDPYVFVVLLTLVAAGAAMIIEGQTPMAVVRWWGNGFWGLLTFAMQMLLVLVTGYMLASTPLVKRMLARLASLATSAGGAIILVSVVSLAASWINWGFGLVVGALFAKQIARQVRVDYRLLVASAYSGFIIWHGGLAGSIPLTIATEGHFSADKIGIIPTGDTIFAVFNLVIVVAMFILVPLVNRLMLPDEKESVYVDPARLEEASVPASDDDKRPAARLENSRLLAWLIAAGGLAYMFDYYVVRGAGLNLNVINFSFLILAILLHGTPRRLLASLDEAIKGGAGIVIQFPFYAGIMAIMMDSGLAATLSEWFVSIASAATLPFWTFISAGIVNIFIPSGGGQWAVQSPIVISAAQALGADMPRVAMAVAWGDAWTNMLQPFWALPVLAIAGLKAKDIMGYCIIQLLVTGVIISVGLSFF
>CP025073.1|AZW59526.1|424564_426076_+|TRAP-transporter-substrate-binding-protein
MTMFIRWLILSACLLLAACSRAPDTEILQRDVGQTLAATYGPDLFDIVALRRMGSATDSTAPPGQTRRVVYYDVVLGLKKDLTLGAWDQPGAAALVSLLGAGPRSISGVKSSGNAAGDQIVAHASAIYQRDAEQWVHVAPASFTATEAPSLDTGAPPPVTRQLLQTLEQITRSVPYSASSTAQHVVQQELERSVARINGRLARLQKGYPLATGPDKGEYLAFGQALAAIGRNEQVRVIPLITGGSADNMAMLRSGAAVAALSQADIAQLAYEGKGPFESQGPFSGLRALGSLYPELVHIVVRQGDGIATVGALRGKKIALGPSGSAVRTTLETVLAAHGLQPGRDYAVIDTPAAAALPQLSEGRVDAVAQVIGTPAAPLRAALTQARLALLPLDRAAIDKLVQADPTLMALDIPANTYPSQAAAIPTVGMAALLVTTADLTRDEAAHMVDVVYRAGQDLLAAGSAQGAQVSAANAGRGLSIPLHDGAVEAFEKLGAPPLPEGR
>CP025073.1|AZW59525.1|423362_424568_+|sodium/glutamate-symporter
MISLTPVQSLLACCLVLVAGRILTTRIGVLSRYSIPDPIVGGLLFAVLATALDTWGGIQISLETNIKPTLLLIFFGCIGLTADLKLLARGGPRLIAFLLALIPFLVLQNAVGLGLAWLLDMHPLMGLIGGTITLVGGHGTGAAYAARFADINNIQDVMALAMTAATIGLVLGGIIGGPVAEWLIRRHKLDPRMAGKDANQVLPEVETTAEAPTATSFITSLTAVFVTVVVGTYLAGLVEDAPISLPNFLWCLATGAIIRNFGGYVGIRLDDRVSEIIGSISLSLFLGLTMMTLDLSSVVRLAGPLALMLVAQALVCALYAGWAVFRMLKRDYEAAVMAAAFCGFAMGATATAIANMQALTRRHGPAPESFIVVPVTGAFLVDILNVIVLTSLIALPFVGGM
>CP025073.1|AZW59524.1|422189_423167_+|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHSYMVRADLAG
>CP025073.1|AZW59523.1|421602_422097_+|GNAT-family-N-acetyltransferase
MPQSYIVRTMRPADVEAVLRVQAAVYPASLLESAALFQNRIEIAPATCQVALDGQDLIGYLIAYPWDAGLPPALDRSLERLPGAADTWFVHDCAVLPAAQGGGVAAALLAGGRAQARRLGLRRASLVALAQAVGYWLRHGYQPLADSDALRAKLAGYGDGARYM
>CP025073.1|AZW59522.1|420414_421473_-|glycosyltransferase
MFMYTEFRSQLLAGAGTSAAGQSARMAVLAGDGATGVQVSCVVPGLNEAANLRVLVPALRACLEQWCASWEIIVVDDGSTDDTAELMAQWSAVEGIRYVQLSRNFGKEAALTAGLEAADGDAVICLDADMQHPPELIGDMLAAWRNGADMVYAVRRQRDDEPWFKRVGARAFYRLLSTARGVEVPPHAGDFRLMDRRVVEALVALPERTRFMKGLYAWVGFKSQAVPYTPQARRHGASHFSAWKLFRLACDGLTAFTTWPLRLVSLIGVLFALLSLSYGGYLVADYLISGNAVSGWTTIVTALLFFAGINLISLGVVGEYVARIFDEVKGRPLFIARQRRGRAKRAAKARSQ
>CP025073.1|AZW59531.1|433254_433725_-|universal-stress-protein
MFKKILIPTDGSPLSAQAANAGICFARSTGAEVVALHVTQPFAATIGFDGMAAAYAITDEDYEKASAEQAEKYLKLILDRAETAGVKAESRAVSNFNVADGIVQAAGEAGCDLIFIGSHGRSGLSRLLLGSVTAKVLSLAHTAVLVYRVKEDKDKK
>CP025073.1|AZW59532.1|433813_434158_-|TIGR01244-family-phosphatase
MSAAIKPLTENFAVAPQLGPADMADVAAAGYKSVIINRPDFEGGPDQPTAADVSQAAQALGLQVEYQPVVGSAMTAADVARFAELLRTMPGPVLAYCRTGTRCTNLFAAAQQLG
>CP025073.1|AZW59533.1|434257_435658_-|PLP-dependent-aminotransferase-family-protein
MRQADATLVTQLADDLARRIDEHGLRPGTRLPSIRRMAEQSGVSRFTVVEAYDRLVARGLVQSRHGAGFFVRARSASLTALASARVPQAAPETPVRVDVSWLLRNMFRETAAGMPGGAGLLPPEWLDPDMVAAAVRAVGRTVRGNLVSYGSPQGYAPLRQQLASMLQADGVPAHPERNLLTTNGVTHGLDIVARHLIKPGDTVLVEDPAWFVIFGRLAAFGARPVGVPRGPDGPDLAMLDRLAAEHKPRLYIINGAVHNPIGHTLSAGAAYDILRLAERHDFMVVEDDTYADLHPGGAMKLAALDRLERVILVGGFSKMLAASLRVGYIAAGAETLQRLTDLKMLAGLTSPELGERVVHRVLVEGQYQRHIERVRARVNEARLRSIQALQQLGLSVPHEPHAGMFVWADCGRDSEPVARNAAERGMLLAPGTLFSPSGAPSTMLRFSVAMVDTPGIWQSIAAVMAQ
>CP025073.1|AZW59534.1|437446_437965_-|methyltransferase
MDTVWMEIWTTVRNEFADIPDVAEATRIVLRLGMAVALGGLLGYERERSGKAAGLRTHMLVALGAALFVLVPLQGGMEVGDLSRVLQGVIAGIGFLGAGVIIKLGNEGEIRGLTTSAGIWLTAAIGVAAGMGREATALASTLIALFVLAALRRLEKRIAARDDKRVVAQPPP
>CP025073.1|AZW59535.1|438075_438831_+|hypothetical-protein
MDYLVSLAQQPAAWAALATLIAMEVVLGIDNLIFISILTNKLPPQHQTKARRIGIGMALILRLALLGTVAFIVQLTQPVFELFGHGFSWRDVILVAGGLFLVWKATKEIHHHVDPNPGDDMFGGKAATLGFAAAVAQILMLDLVFSIDSIITAVGMTEHIPIMFVAVIVAVAVMLLAAEPLARFIERNPTVVMLALAFLMMIGMTLIAEGFGAHVPKGYIYAAMAFSALVEGLNMMARRAREGRGAGAAGG
>CP025073.1|AZW59536.1|439026_440259_+|CoA-transferase
MSGPLEGVRILDVTTVLMGPYATQILGDLGADVIKVEPPAGDNVRGIGPGRHADMGGIFLHANRSKRSIALDLKNPAGREALLKVAATCDVLVYNVRPQAMARLGLSYAEVAQANPSILYVGMYGYDQRGPYAARAAYDDLIQGAVGIPSLSVEAGSDIPRYAPSAMVDRIVGISAANAVTAGLYHRARTGQGQAIDVPMFETMAHLILGDHMMGQTFEPPLGPPGYPRILNADRRPYATRNGHICVLLYADKHWKAFFELIGQPGRDAADPRFRDIGTRTQHIHAIYRLVSDAIASRTTEEWLAAFEAADIPAMPVHTMASLLRDPHLEAIGFFGMVDHPSEGAVRMMAVPSRWSGTPPQPRGHAPRLGEHSVDVLKEAGYDDEAIAALVRNGAAIAAARQLPEGTDHD
>CP025073.1|AZW59537.1|440251_441037_+|enoyl-CoA-hydratase
MTDFLRHERHGGVLLLTMDRERTRNALSDADAVEALVQACARIGADLSVRAVVLTGSHGVFSSGGNLKTLSDTVGAGLGEPVHSLQAYRSGIQRIPLALYNLEVPTIAAVNGPAIGAGCDLACMCDIRLAARQASFAESFVKLGLTPGDGGAWLLPRIVGMSRACELAFTGRSIDAARARELGLVSEVFDADALLPAALALAQEIAQHSGHALRLTKRLLREGQHTRLDTLLELSAGFQALAHHTQEHAGALDAHLSRKRG
>CP025073.1|AZW59538.1|441103_442075_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MHSRTLALALLSVAALAQGGSARAASDYPAHPVKIIVSLPPGSGADTTARFLSKHLAERFKQPFVVENRPGGNSFIAAQAVATAPPDGYTLFVASNSPMTTNAAVFKNLPYDAVKDFAPVAPIARFPMALVVPANSPYRSVADLVAAARAAPGQLNFASGTATYQVVLELFHEQNGIKATHVPYKGTSAALADVAGGVVQYSVADVSAALPLIRGGKLRPLAVTSTRRIKDLPDVPTMQESGNKGFEAYAWTAAFFPAKVDPAIVARVSDAVQALVRSQEGKAFMEQLGGEPFVGGPDTLAAFQRDELASMRRIAKLANIQQE
>CP025073.1|AZW59539.1|442085_443063_-|LysR-family-transcriptional-regulator
MWTGQYIVHIASPAHHWRRAVELRQLKQLLVLSETLNFHRAAERLHMAQPPLSTAIKKLEQELGVQLFERLPAGLQPTPAAEVVLRYARATLFYADEIQRAAQEGASGKQGMLKVGFVGSSIYSLMPQLLSAFRKDYPRVDLVIEESTTVDLLRRLDAHTLDVALVRFPVLEPSTARITLLQADHLMLAVPAGSRYAQRDDVALDELADEPFIGYSRTHVPGMHALIMYAFQQYGVVPHIAQEAIQVQTILSLVESGLGLAIVPKVACRQAGSGVRLVNVPQLAETIKVGIALAVHPDNATPTTANFVDMACRLMQTEPAAGQAR
>CP025073.1|AZW59540.1|443188_444361_+|acyl-CoA-dehydrogenase
MGAILGTIIEALQLAAIPAHDEALRPAVRAFLDEALREMPADRRARSWMGHDAEFSRALARQGWLGLTLPVEYGGAGRSNFARFVLSEELLAVGAPVSAHWVADRQTAPLILRFGSPAQRAFYLPRIIRGEAFFAIGMSEPDTGSDLASVRTRATPVADGWLLNGRKIWTTNAHRSHYMCALVRTSGAPEDRHRGLSQMIFDLALPGIEIRPIRDIAGDAHFCEVLFDNVLLPHDALVGEEGSGWRQVMAELALERSGPERIYSSMVLLDGWLAHLRCDAAPQRAQVCLAGRLAARLAVLRSMSLAVSQRLEQGADASLAAVLVKDLGTEFEQAVPELIGQALHASPQPAPDDVLMRTLAYLTLINPTFSLRGGTRHILRGIIARELGLR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP025073_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP025073_3

1000516-1000610

Orphan

Consensus_repeat	Method
TAAAAGGGCACCCGCAAGGGTGTCCTTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP025073_3

>merge|CP025073|3|1000516-1000610|CRISPRCasFinder
TAAAAGGGCACCCGCAAGGGTGTCCTTTTATTGCGAAAAGATATCTGGAAGAAAGCCTTTTCAGAGTAAAAGGGCACCCGCAAGGGTGCCTTTTT

>CP025073|3|3|1000516-1000610|CRISPRCasFinder
TAAAAGGGCACCCGCAAGGGTGTCCTTTT	ATTGCGAAAAGATATCTGGAAGAAAGCCTTTTCAGAG
TAAAAGGGCACCCGCAAGGGTGCCTTTTT

Protein	Signature genes	Signature genes Name	Protein_function
CP025073.1\|AZW60023.1\|1006247_1006820_-\|chorismate--pyruvate-lyase	unknown	unknown	gnl\|CDD\|225703
CP025073.1\|AZW60021.1\|1002535_1003585_+\|NADP(H)-dependent-aldo-keto-reductase	unknown	unknown	gnl\|CDD\|381320
CP025073.1\|AZW60020.1\|1001480_1002431_-\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025073.1\|AZW62607.1\|994678_995587_+\|sulfate-adenylyltransferase-subunit-CysD	unknown	unknown	gnl\|CDD\|235375
CP025073.1\|AZW60024.1\|1006879_1007611_+\|rRNA-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|224108
CP025073.1\|AZW60027.1\|1014015_1014267_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	unknown	unknown	gnl\|CDD\|225170
CP025073.1\|AZW60013.1\|989945_990980_+\|sulfate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224529
CP025073.1\|AZW60026.1\|1012563_1013946_+\|multidrug-transporter	unknown	unknown	gnl\|CDD\|273830
CP025073.1\|AZW60019.1\|1000659_1001385_+\|CoA-pyrophosphatase	unknown	unknown	gnl\|CDD\|239518
CP025073.1\|AZW60010.1\|986032_986962_+\|electron-transfer-flavoprotein-subunit-alpha	unknown	unknown	gnl\|CDD\|224936
CP025073.1\|AZW60025.1\|1009387_1012567_+\|multidrug-efflux-RND-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|273335
CP025073.1\|AZW60014.1\|992816_993881_+\|sulfate/thiosulfate-import-ATP-binding-protein-CysA	unknown	unknown	gnl\|CDD\|213263
CP025073.1\|AZW60011.1\|987205_989032_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173842
CP025073.1\|AZW60018.1\|1000068_1000449_+\|50S-ribosomal-protein-L19	unknown	unknown	gnl\|CDD\|235418
CP025073.1\|AZW62608.1\|1007662_1008580_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
CP025073.1\|AZW60017.1\|998890_999763_-\|multidrug-DMT-transporter-permease	unknown	unknown	gnl\|CDD\|274527
CP025073.1\|AZW60015.1\|997074_998349_+\|radical-SAM-protein	unknown	unknown	gnl\|CDD\|275263
CP025073.1\|AZW60016.1\|998502_998883_+\|hypothetical-protein	unknown	unknown	unknown
CP025073.1\|AZW60012.1\|989114_989756_+\|peroxiredoxin	unknown	unknown	gnl\|CDD\|239314
CP025073.1\|AZW60022.1\|1003722_1004739_-\|IS110-family-transposase-IS1663	unknown	unknown	gnl\|CDD\|376773

Protein	Function_ID	Function_description	E-value
CP025073.1\|AZW60023.1\|1006247_1006820_-\|chorismate--pyruvate-lyase	gnl\|CDD\|225703	COG3161, UbiC, 4-hydroxybenzoate synthetase (chorismate lyase) [Coenzyme metabolism].	1.05194e-17
CP025073.1\|AZW60021.1\|1002535_1003585_+\|NADP(H)-dependent-aldo-keto-reductase	gnl\|CDD\|381320	cd19094, AKR_Tas-like, Escherichia coli Tas protein and similar proteins. Escherichia coli Tas protein is the prototype of this family. It is an NADP(H)-dependent aldo-keto reductase that catalyzes the reversible reduction of ketones to the respective alcohols using NADP(H) as a hydride donor.	0
CP025073.1\|AZW60020.1\|1001480_1002431_-\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	8.66858e-23
CP025073.1\|AZW62607.1\|994678_995587_+\|sulfate-adenylyltransferase-subunit-CysD	gnl\|CDD\|235375	PRK05253, PRK05253, sulfate adenylyltransferase subunit CysD.	0
CP025073.1\|AZW60024.1\|1006879_1007611_+\|rRNA-pseudouridine-synthase	gnl\|CDD\|224108	COG1187, RsuA, 16S rRNA uridine-516 pseudouridylate synthase and related pseudouridylate synthases [Translation, ribosomal structure and biogenesis].	7.73356e-72
CP025073.1\|AZW60027.1\|1014015_1014267_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	gnl\|CDD\|225170	COG2261, COG2261, Predicted membrane protein [Function unknown].	2.42408e-12
CP025073.1\|AZW60013.1\|989945_990980_+\|sulfate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224529	COG1613, Sbp, ABC-type sulfate transport system, periplasmic component [Inorganic ion transport and metabolism].	0
CP025073.1\|AZW60026.1\|1012563_1013946_+\|multidrug-transporter	gnl\|CDD\|273830	TIGR01845, Outer_membrane_protein_OprM, efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family. Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined. [Cellular processes, Detoxification, Transport and binding proteins, Porins].	9.9815e-102
CP025073.1\|AZW60019.1\|1000659_1001385_+\|CoA-pyrophosphatase	gnl\|CDD\|239518	cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes. The need of CoAses mainly arises under conditions of oxidative stress. CoAse has a conserved Nudix fold and requires a single divalent cation for catalysis. In addition to a signature Nudix motif G[X5]E[X7]REUXEEXGU, where U is Ile, Leu, or Val, CoAse contains an additional motif upstream called the NuCoA motif (LLTXT(SA)X3RX3GX3FPGG) which is postulated to be involved in CoA recognition. CoA plays a central role in lipid metabolism. It is involved in the initial steps of fatty acid sythesis in the cytosol, in the oxidation of fatty acids and the citric acid cycle in the mitochondria, and in the oxidation of long-chain fatty acids in peroxisomes. CoA has the important role of activating fatty acids for further modification into key biological signalling molecules.	5.50907e-72
CP025073.1\|AZW60010.1\|986032_986962_+\|electron-transfer-flavoprotein-subunit-alpha	gnl\|CDD\|224936	COG2025, FixB, Electron transfer flavoprotein, alpha subunit [Energy production and conversion].	1.05379e-120
CP025073.1\|AZW60025.1\|1009387_1012567_+\|multidrug-efflux-RND-transporter-permease-subunit	gnl\|CDD\|273335	TIGR00915, Probable_aminoglycoside_efflux_pump, The (Largely Gram-negative Bacterial) Hydrophobe/Amphiphile Efflux-1 (HAE1) Family. Proteins scoring above the trusted cutoff (1000) form a tight clade within the RND (Resistance-Nodulation-Cell Division) superfamily. Proteins scoring greater than the noise cutoff (100) appear to form a larger clade, cleanly separated from more distant homologs that include cadmium/zinc/cobalt resistance transporters. This family is one of several subfamilies within the scope of pfam00873. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Unknown substrate].	0
CP025073.1\|AZW60014.1\|992816_993881_+\|sulfate/thiosulfate-import-ATP-binding-protein-CysA	gnl\|CDD\|213263	cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter. Part of the ABC transporter complex cysAWTP involved in sulfate import. Responsible for energy coupling to the transport system. The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.	3.07125e-165
CP025073.1\|AZW60011.1\|987205_989032_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|173842	cd01153, ACAD_fadE5, Putative acyl-CoA dehydrogenases similar to fadE5. Putative acyl-CoA dehydrogenase (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	6.94362e-153
CP025073.1\|AZW60018.1\|1000068_1000449_+\|50S-ribosomal-protein-L19	gnl\|CDD\|235418	PRK05338, rplS, 50S ribosomal protein L19; Provisional.	1.34063e-62
CP025073.1\|AZW62608.1\|1007662_1008580_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.56316e-67
CP025073.1\|AZW60017.1\|998890_999763_-\|multidrug-DMT-transporter-permease	gnl\|CDD\|274527	TIGR03340, phn_DUF6, phosphonate utilization associated putative membrane protein. This family of hydrophobic proteins has some homology to families of integral membrane proteins such as (pfam00892) and may be a permease. It occurs in the vicinity of various types of operons for the catabolism of phosphonates in Vibrio, Pseudomonas, Polaromonas and Thiomicrospira.	3.74356e-26
CP025073.1\|AZW60015.1\|997074_998349_+\|radical-SAM-protein	gnl\|CDD\|275263	TIGR04470, hypothetical_protein_ALIPUT_00462, radical SAM mobile pair protein B. Members of this family are the downstream member (B) of a pair of tandem-encoded radical SAM enzymes. Most of these radical SAM gene pairs have an additional upstream regulatory gene in the MarR family. Examples of high sequence identity (over 96 percent) from cassettes in several Treponema species of the oral cavity to those in multiple Firmicutes in the gut microbiome suggest recent lateral gene transfer, as might be expected for antibiotic resistance genes. The function is unknown.	4.71758e-24
CP025073.1\|AZW60012.1\|989114_989756_+\|peroxiredoxin	gnl\|CDD\|239314	cd03016, PRX_1cys, Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine. They are homodimeric thiol-specific antioxidant (TSA) proteins that confer a protective role in cells by reducing and detoxifying hydrogen peroxide, peroxynitrite, and organic hydroperoxides. As with all other PRXs, a cysteine sulfenic acid intermediate is formed upon reaction of 1-cys PRX with its substrates. Having no resolving cysteine, the oxidized enzyme is resolved by an external small-molecule or protein reductant such as thioredoxin or glutaredoxin. Similar to typical 2-cys PRX, 1-cys PRX forms a functional dimeric unit with a B-type interface, as well as a decameric structure which is stabilized in the reduced form of the enzyme. Other oligomeric forms, tetramers and hexamers, have also been reported. Mammalian 1-cys PRX is localized cellularly in the cytosol and is expressed at high levels in brain, eye, testes and lung. The seed-specific plant 1-cys PRXs protect tissues from reactive oxygen species during desiccation and are also called rehydrins.	3.35179e-132
CP025073.1\|AZW60022.1\|1003722_1004739_-\|IS110-family-transposase-IS1663	gnl\|CDD\|376773	pfam02371, Transposase_20, Transposase IS116/IS110/IS902 family. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS116, IS110 and IS902. This region is often found with pfam01548. The exact function of this region is uncertain. This family contains a HHH motif suggesting a DNA-binding function.	2.74666e-23

>CP025073.1|AZW60018.1|1000068_1000449_+|50S-ribosomal-protein-L19
MNLIAILEQEEIARLTGGNAVTEFAPGDTVVVSVNVVEGTRKRVQAFEGVVIAKRNRGLNSSFIVRKISSGEAVERTFQLYSPQIAGIEVKRRGDVRRAKLYYLRSRSGKSARIKEKLVLKKAKSA
>CP025073.1|AZW60017.1|998890_999763_-|multidrug-DMT-transporter-permease
MSYTSLILVVLAAMAHAAWNLLAKRAAMVGPMFVFAYGLAATILYAPWVIWVLAHDGMVWSWPVVLCILASSMLHLGYSLCLQRGYQVADLSVVYPIARGTGPLLSTMGAFTLLSEPATTTGIAGMLCVVGGVLLIATQGRLGMFRQAQAWIGVRWGVVIGLFIAAYTVVDAYGVKILLIMPVLFDWFTCATRTLMMTPHVLRRRAQYWPAMRGYWHLAIAVGVLSPLGYILVLYALRNGAPLSLVAPAREMSMMLGTLAGMFLLREKVGIGRLAGCLAILAGVVLLGSS
>CP025073.1|AZW60016.1|998502_998883_+|hypothetical-protein
MTIATTLDAATSLPTAVPGRTLGALRRLARAWAGAAVPQRKWPFPPTPPGQAQPCTPCTDSQPRSVQAVQPAQARALHAQAELSGAATQAATQVLSTKAKIIDVLLVAVWGAMIPALMWLGAAGGF
>CP025073.1|AZW60015.1|997074_998349_+|radical-SAM-protein
MASTEHSFSAGFGSPAAAPAALRGRGAVTNVPHRFQQADRVRVDDGWANPDYTAGSDAAALPSVAEALGQGGRRAIPIAVEGADASPNTCAQAPAPRTIVQAEEARKMLSRNDSPDIPFDVAANPYRGCEHGCVYCYARPTHAYLGYSPGLDFETRLVAKANAVAALRAELARPGYRASPINIGSATDAYQPIERTWRLTRGMLELLLQTRHPLTVVTKNALVERDLDLLQDLARQKLVTVFVSITTLDAAMARTLEPRASAPYRRLQTVRTLAQAGVPVGVLVAPVIPFINDESLEHILQEASAAGACYASYTVLRLPWEVKEVFETWLQAHFPDRAQRVLHRIEDLRNGRRNDTAFGSRMRGTGIWADLLRQRFALATRKLDLNRHRPELDTHRFVPPLEPGLPPARGRREARAQPGQLALF
>CP025073.1|AZW62607.1|994678_995587_+|sulfate-adenylyltransferase-subunit-CysD
MSAVMTRSHLDWLESEAIFILREVAAECARPALLFSGGKDSVVLLRLAEKAFRPGRFPFPLLHIDTGHNYDEVISFRDARAAELGETLLVRSVEDSIARGSVALRRETDSRNAAQAVTLLEAIEELGLDACIGGARRDEEKARAKERIFSFRDEFGQWDPKAQRPELWNLFNTRVHRGENMWVFPISNWTELDVWQYIQRERLALPSIYYSHTREVVRRKGLLVPVTRLTPPAEGETVEQLAVRFRTVGDISCTCPVASDAADPAAIIAETAVTDITERGATRMDDQTSEASMERRKREGYF
>CP025073.1|AZW60014.1|992816_993881_+|sulfate/thiosulfate-import-ATP-binding-protein-CysA
MSIEVRGLSKRFGAFRALDEVSLHIETGELVALLGPSGCGKTTLLRIIAGLESADAGSVLFAGEDATEVDVRQRQVGFVFQHYALFKHMTVFENVAFGLRVRHRSQRPSEARIRAKVLDLLGLVQLDWLADRYPAQLSGGQRQRIALARALAVEPRVLLLDEPFGALDAKVRKELRRWLRRLHDELHVASVFVTHDQEEALEVTDRVVLMNAGRIEQVGSPREVWERPATPFVYGFLGDVNQLHGHATRGVWRLGEVALPAPDLPEADNQRAIAYVRPHDIDLARAGTAAPGIPVRLNHVYLAGPSAYLELARQDDQAIIEAQVPEPLFRSLGLKEGEALLAQPRRARVFAVQP
>CP025073.1|AZW60013.1|989945_990980_+|sulfate-ABC-transporter-substrate-binding-protein
MPRNTAGIRGAIVALATVFSLGLPWAVQAQDKQTLLNVSYDPTRELYRAVDEAFIKEYQARAGVDLTVRQSHGGSGRQARSVIDGLDADVVTLALAYDIDAIADRGLLPQDWQKRLPRNSSPYTSTIVFLVRKGNPRQIHDWDDLVKDGVQVITPNPKTSGGARWNYLAAWAYALARNEGSEAKAREFVGQLLSHVPVLDTGARGSTTTFVERGVGDVLLAWENEAFLAREELGPDKFDIVVPSLSILAEPPVAVVDKVVDRKGTRAAAQAYLEYLYTPAAQEIIARNFYRPTDAGVAAKYASRFPKLKLVTIDDPIFGGWRKAQKDHFSDGGTFDQVYQPQRK
>CP025073.1|AZW60012.1|989114_989756_+|peroxiredoxin
MGQLRLGDTAPDFEQKSSIGPLRLYDYLGDSWGVLFSHPADFTPVCTTELGYTAKLAGEFAKRNVKVLALSVDPVDSHTKWIDDINDTQSTTVNFPILADDDRKVSELYDMIHPNANATLTVRSVFVIDPAKKVRLTITYPASTGRNFDEILRVIDSLQLTDSHSVATPVNWKDGEDVIIVPSLKDEAVIKEKFPKGYKALRPYLRITPQPNK
>CP025073.1|AZW60011.1|987205_989032_+|acyl-CoA-dehydrogenase
MTYATPLQDFRFALNELAGLEEILKLPGFEEVTPDLVDAILEENARFVQQAIAPLNVAGDTKPPVWNDGQVTTTPGFSQGFADYTAGGWQGLQHPQKWGGQGLPKVVAAPAGENIQAASLAFSLCPMLTDGVIEALLTVGSEAQRQTYVPKLIGGQWTGTMNLTEPQAGSDLAQVATRAVRQDDGSYRLSGQKIFITYGEHDLAENIIHLVLARTPDAPAGVKGISLFIVPKYLVNEDGSRGKRNDVWCASLEHKLGIHGSPTAVLLYGAGKGEVGEGAVGYLVGEANRGLEYMFIMMNAARYSVGQQGIGVSERAYQHAQAYARERVQGRAIEGSAAPVTIAHHPDVQRMLLTMRALTEAARAVSYVAAAAHDKGTHHPDAEVRARNRAFYEYLVPIVKGFSTESAVEVASLGIQVHGGMGFIEETGAAQHYRDARILPIYEGTTAIQANDLVGRKTLRDGGATAHASIAAMRDTLKAVAAEAQRADTADHTALRVLRDNFDQAIQSYEGAVEFILAHAASNVRAVYSSSVPYLMLAGVVHGGWQMARAALACRRHLAAGSGDAFHRHKLGTALFYGAHILPRALALAAAVRAGDVADSCGSMADIA
>CP025073.1|AZW60010.1|986032_986962_+|electron-transfer-flavoprotein-subunit-alpha
MTTLVIAEHDNAQLKGATLNTIAAASRLGGEVHVLVAGSGAQAVAEQAAQAARVSKVLLADAPQLAEGLAENLAAQVLAVAGGYSHILFAATASGKNVAPRVAAKLDVAQISDIIGVESADTFQRPIYAGNAIATVQSGDAVKVITVRTTGFDAVAAQGGSAAVEALDAVADSGLSRFVGREVAKSDRPELAGARVVVSGGRGLGSAENFKILDPLADKLGAALGASRAAVDAGYAPNDWQVGQTGKIVAPQLYVAVGISGAIQHLAGMKDSKVIVAINKDPEAPIFGVADYGLVGDLFQVVPELTGAL
>CP025073.1|AZW60019.1|1000659_1001385_+|CoA-pyrophosphatase
MSDSAPSRPRRTPVRPLFDPMAQPWETANQGLARVDERLLTPPELRSSLRPADHWRLDPLCAAEPRAPGREGSLVAAAVLIPLVMRADGVRVMLTQRAAHLHDHAGQVSFPGGRIEVSDATPVAAALREAQEETGLPVQQVEVLGSMPQYFTATGFAITPVVSLVQPDFELAPDAFEVAEVFEVPLSFLMDPANHRLYRAALPDGYVRQYYAMPWQRYFIWGATAGMLRNLYQTVREALPG
>CP025073.1|AZW60020.1|1001480_1002431_-|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS
>CP025073.1|AZW60021.1|1002535_1003585_+|NADP(H)-dependent-aldo-keto-reductase
MKYRKLGHTDLDVSLIGLGTMTWGEQNTEAQAHEQLDYALAHGINLVDAAEMYPVPPKPETQGRTESCIGSWLARTGRRHEVVLASKAAGPVRDAKRPSHIRDGKTFLDRKNLTQALDASLKRLQTDYLDLYQLHWPDRTTNTFGKLAYPWVDDAHTVPIEETLEVLQDFVRAGKVRHVGLSNETPWGVARFLQAAEKHGLPKVATIQNPYNLLNRIFEIGLAEFSHREGVGLLAYSPLAMGILSGKYLDGARPEGSRLALFTRFTRYSNPQAEAAARDYVMLARDHGLAPAQMALAWVNQRPFVSSNLMGATTLAQLKENIESVEVTLSDEVLQGIEAIHARQPNPAP
>CP025073.1|AZW60022.1|1003722_1004739_-|IS110-family-transposase-IS1663
MADSSLLSAGGQVHVFIGIDVSKAKLDCTLLTAEADKCKTKVVVNTAAGVQALLAWCAKHGAQPAQLHAILEPTGLYHEQAATALPQVRVSLVNPAQARDFAKALALRSKNDALDSYVLARYGQTLSPALWHPAPLHARQLRALLTRREALSKDLLRELNRKEKSQFSPSAPLVDGSIDKAIAFLREQIKQIERAIDQHIDNHPDLKQDCELLNSIPAIGPQAGNAILAVMHNRHIDSAQSLAAYLGVVPVQRQSGSSLNSCARLSKAGPSQVRATLYMAALVGTRHNPHIRALYQRLLKAGKSKKAALGAAMRKLVHLCFGVLKNRIPYQPNYAMNG
>CP025073.1|AZW60023.1|1006247_1006820_-|chorismate--pyruvate-lyase
MTTPIPLARGWLPAAPSTLDPLRKYWLFRPGALTAGLRQLGHVRLRVLAEYPTGAPRDEADGMRIAAQSPVWVREVLMSIDGVDSVVARSLTPLRASHGVWQGMRRLLTRPLADMLYHDPGIHRSVFVCRRLAAGVPFHATAIARAPAGGPEPALWARRSAFWRAGQPLLVAECFLPAFWSLARAPVAPR
>CP025073.1|AZW60024.1|1006879_1007611_+|rRNA-pseudouridine-synthase
MEKVRISKLMSERGLCSRREADSYIERGWVRVDGVVVSELGARALPDQVITLERAAAARQTARVTILLHKPVGYVSGQAEKGYTPAVALIDARSRYAGDRAPQRFERGQLQGLAVAGRLDIDSQGLLVLTQDGRIAKKLIGEDSEVDKEYLVRVQGRLSEAGLALLNHGLSLDGKPLRPAQVRWQNADQLRFVLREGKKRQIRRMCELVGLRVVGLKRVRIGRVSLGDLPAGQWRYLRADERF
>CP025073.1|AZW62608.1|1007662_1008580_-|LysR-family-transcriptional-regulator
MELFVEVARTLSFGRAAENLAIPKSTLSRQVAELERSVGLRLLSRTTRRVELTEAGQLYFERCQRIVAEARIAHEELQNLVETPSGPLRVNMPADFGTDFLSEAFTEFSRRYPEVTFYLDLASPEHAERVFQTCDVSIEIGDLPDSTHIARLLGVLPAHLYASPDYLARHGEPQHPDDLPRHECIQFRAGTGRVTRWPLNSGERHVEITPGNRFSVNSVSMVRNLATLGAGIAILAPMGNVREDIESGRLKRILPDWLAGPFPVYAVTDTRMLPAKTRIFVEFLMERLSNKTLAGQNNPAFLNLR
>CP025073.1|AZW60025.1|1009387_1012567_+|multidrug-efflux-RND-transporter-permease-subunit
MAKFFIDRPVFAWVIAIVLMMAGALSILSLPVAQYPNIAPPAISINVTYPGASAQTVQDTVVQVIEQQMNGIDNLQYISSESNSDGSMSITLTFSQGTNPDTAQVQVQNKLAVAQPLLPLEVQQQGIRVTKATKNFLIVAGFVSTDGTMDKSDLADYVASYIQDPISRTPGVGNFQLFGAPYAMRIWISPEKLVNFGLTASDVTTAIREQNVQVSSGQLGGQPAVRGQQLNATVIGPSRLQTPEAFGRILLKVNRDGSQVRLKDVASIELGAQTYAIDSYYNGKPASGLAIKLASGANALDTAQAVRETINGLKPYFPPGMDVVYPYDTTPFVSLSIEGVVKTLFEAVLLVFLVMYLFLQNVRATLIPTLAVPVVLLGTFGVLAAFGYSINTLTMFGMVLAIGLLVDDAIVVVENVERVMAEEGLSPRQATRKSMGQITGALIGIAMVLAAVFVPMAFFGGSTGVIYRQFSITIVSSMVLSVVVAIVFTPALCATMLKPIPKGHHGSKKGFFGWFNRTFERSSQAYANNVARSMGRTKRLLLIYVVILLGMAWMFMRIPTAFLPDEDQGILFAQVQAPAGATSERTQATIDAAVKYLLEDEKESVASVFAVNGFSFGGRGQNAAILFIKLRDWNERKGAEHRAAAVAARANAKFRAELRDAQAAVFAPPAVMELGNATGFDFQLQDRAGVGHEKLLAARNQLLQEAGASPMLVAVRPNGIEDAPQYQLDIDREKARALGVSITEINNTLATAWGSSYVNDFIDRGRVKKVFVQGEASSRMLPQDLDKWYVRNNAGDMVPFSAFSSAQWTFGPQKLNRYNGVPSYNIQGQAAPGYSSGDAMAEMERLADKLPLGIGYDWTGLSFEERLSGAQAPALYAISLIVVFLCLAALYESWSIPTAVMLVVPLGVVGALLATMTRGLSNDVYFQVGLLTTIGLAAKNAILIVEFAKEHYEEGASLTEAAVHAARQRLRPILMTSLAFILGVVPLAISTGAGSGSQNAIGTGVIGGMLTGTFLAIFFVPLFFVLTLRLFKVKRASENREDDDPHGGAQPATHGGQPQ
>CP025073.1|AZW60026.1|1012563_1013946_+|multidrug-transporter
MKPVVMRTLLSLAVATALAGCSLAPTYERPQAPVDAAYPSGPAYGAPGQAAAGAPAAADVGWRDFFGDPLLQELLALSLANNRDLRVAALNVEAARLNPSGQAGISRSYQVGASLSTWELDLFGRIRSLSEQALQLYLAQDETRLATQLTLVAETANAYLTLRADQELLALTRQTLAAQQESYKLTRQSYDLGVATELDLSQAEISLRTAERNLSQYTRMAAQDRNALVLLVGQPLPAGIGAQLDQAVALPDGVVLADLPAGLPSDLLARRPDIRAAEHQLQAANASIGAARAAFFPRISLTGSAGTASASLGGLFDAGSGAWSFAPQISVPIFAGGALRASLDLAKIQKDIGIARYEQAIQSGFREVSDALAGRGTLQEQIRSQELLVQANQRAYDLSQQRYQQGIDNYLSVLDSQRSLYTAQQTLVETRLARLSNLIQLYKALGGGWSERTVAAAQAG
>CP025073.1|AZW60027.1|1014015_1014267_-|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein
MNIIIMIIVGFVVGLITRAIMPGDQNMGYIMTTILGIIGSVVAGFLGQQLGWYAPGEPAGWIGSVVGAIIVLFVVGLVAKKRA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP025073_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP025073_4

1897990-1898117

Orphan

Consensus_repeat	Method
AAAAAGCCCCCTCGGGGGGCAGCAAGCCCGCATAGCGGGCGCAGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP025073_4

>merge|CP025073|4|1897990-1898117|CRISPRCasFinder
AAAAAGCCCCCTCGGGGGGCAGCAAGCCCGCATAGCGGGCGCAGCGTGGGGGCACTACTTTGCCGCTGGGCCGCCCCAAGGCAAAAAGCCCCCTCGGGGGGCAGCAAGCCCGCGTAGCGGGCGCAGCG

>CP025073|4|4|1897990-1898117|CRISPRCasFinder
AAAAAGCCCCCTCGGGGGGCAGCAAGCCCGCATAGCGGGCGCAGCG	TGGGGGCACTACTTTGCCGCTGGGCCGCCCCAAGGC
AAAAAGCCCCCTCGGGGGGCAGCAAGCCCGCGTAGCGGGCGCAGCG

Protein	Signature genes	Signature genes Name	Protein_function
CP025073.1\|AZW60738.1\|1893424_1894066_+\|CoA-transferase-subunit-B	unknown	unknown	gnl\|CDD\|188219
CP025073.1\|AZW60735.1\|1888595_1889753_+\|thiolase	unknown	unknown	gnl\|CDD\|180434
CP025073.1\|AZW60739.1\|1894100_1894832_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|270296
CP025073.1\|AZW60746.1\|1903195_1903708_+\|Fe-S-cluster-assembly-transcriptional-regulator-IscR	unknown	unknown	gnl\|CDD\|273927
CP025073.1\|AZW60740.1\|1894849_1895062_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|270296
CP025073.1\|AZW60732.1\|1886898_1887354_+\|MaoC-family-dehydratase	unknown	unknown	gnl\|CDD\|239534
CP025073.1\|AZW60750.1\|1905712_1906225_+\|co-chaperone-protein-HscB	unknown	unknown	gnl\|CDD\|235133
CP025073.1\|AZW60745.1\|1902488_1902980_+\|low-molecular-weight-phosphotyrosine-protein-phosphatase	unknown	unknown	gnl\|CDD\|319971
CP025073.1\|AZW60736.1\|1889774_1890551_+\|3-oxoacyl-ACP-reductase	unknown	unknown	gnl\|CDD\|235546
CP025073.1\|AZW60743.1\|1898919_1900122_-\|aspartate/tyrosine/aromatic-aminotransferase	unknown	unknown	gnl\|CDD\|181731
CP025073.1\|AZW60749.1\|1905386_1905710_+\|iron-sulfur-cluster-assembly-protein-IscA	unknown	unknown	gnl\|CDD\|213674
CP025073.1\|AZW60747.1\|1903725_1904937_+\|IscS-subfamily-cysteine-desulfurase	unknown	unknown	gnl\|CDD\|184450
CP025073.1\|AZW60748.1\|1904974_1905385_+\|Fe-S-cluster-assembly-scaffold-IscU	unknown	unknown	gnl\|CDD\|183087
CP025073.1\|AZW60734.1\|1888167_1888599_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224462
CP025073.1\|AZW60737.1\|1892715_1893432_+\|3-oxoadipate-CoA-transferase	unknown	unknown	gnl\|CDD\|131482
CP025073.1\|AZW60751.1\|1906354_1908217_+\|chaperone-protein-HscA	unknown	unknown	gnl\|CDD\|235360
CP025073.1\|AZW60744.1\|1900199_1902236_+\|UvrABC-system-protein-B	unknown	unknown	gnl\|CDD\|235395
CP025073.1\|AZW60733.1\|1887367_1888171_+\|enoyl-CoA-hydratase/isomerase-family-protein	unknown	unknown	gnl\|CDD\|223955
CP025073.1\|AZW60741.1\|1895632_1896583_+\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025073.1\|AZW60742.1\|1898140_1898869_-\|transcriptional-repressor-LexA	unknown	unknown	gnl\|CDD\|234688

Protein	Function_ID	Function_description	E-value
CP025073.1\|AZW60738.1\|1893424_1894066_+\|CoA-transferase-subunit-B	gnl\|CDD\|188219	TIGR02428, 3-oxoadipate_CoA-transferase_subunit_B, 3-oxoacid CoA-transferase, B subunit. Various members of this family are characterized as the B subunits of succinyl-CoA:3-ketoacid-CoA transferase (EC 2.8.3.5), beta-ketoadipate:succinyl-CoA transferase (EC 2.8.3.6), acetyl-CoA:acetoacetate CoA transferase (EC 2.8.3.8), and butyrate-acetoacetate CoA-transferase (EC 2.8.3.9). This represents a very distinct clade with strong sequence conservation within the larger family defined by pfam01144. The A subunit represents a different clade in pfam01144.	3.32577e-117
CP025073.1\|AZW60735.1\|1888595_1889753_+\|thiolase	gnl\|CDD\|180434	PRK06158, PRK06158, thiolase; Provisional.	0
CP025073.1\|AZW60739.1\|1894100_1894832_+\|hypothetical-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	8.17828e-106
CP025073.1\|AZW60746.1\|1903195_1903708_+\|Fe-S-cluster-assembly-transcriptional-regulator-IscR	gnl\|CDD\|273927	TIGR02010, Putative_HTH-type_transcriptional_regulator, iron-sulfur cluster assembly transcription factor IscR. This model describes IscR, an iron-sulfur binding transcription factor of the ISC iron-sulfur cluster assembly system. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other, Regulatory functions, DNA interactions].	1.00126e-77
CP025073.1\|AZW60740.1\|1894849_1895062_+\|hypothetical-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	1.69368e-19
CP025073.1\|AZW60732.1\|1886898_1887354_+\|MaoC-family-dehydratase	gnl\|CDD\|239534	cd03450, NodN, NodN (nodulation factor N) contains a single hot dog fold similar to those of the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit. Rhizobium and related species form nodules on the roots of their legume hosts, a symbiotic process that requires production of Nod factors, which are signal molecules involved in root hair deformation and meristematic cell division. The nodulation gene products, including NodN, are involved in producing the Nod factors, however the role played by NodN is unclear.	1.89129e-75
CP025073.1\|AZW60750.1\|1905712_1906225_+\|co-chaperone-protein-HscB	gnl\|CDD\|235133	PRK03578, hscB, Fe-S protein assembly co-chaperone HscB.	2.55481e-79
CP025073.1\|AZW60745.1\|1902488_1902980_+\|low-molecular-weight-phosphotyrosine-protein-phosphatase	gnl\|CDD\|319971	cd16343, LMWPTP, Low molecular weight protein tyrosine phosphatase. Low molecular weight protein tyrosine phosphatases (LMW-PTP) are a family of small soluble single-domain enzymes that are characterized by a highly conserved active site motif (V/I)CXGNXCRS and share no sequence similarity with other types of protein tyrosine phosphatases (PTPs). LMW-PTPs play important roles in many biological processes and are widely distributed in prokaryotes and eukaryotes.	1.04407e-74
CP025073.1\|AZW60736.1\|1889774_1890551_+\|3-oxoacyl-ACP-reductase	gnl\|CDD\|235546	PRK05653, fabG, 3-oxoacyl-ACP reductase FabG.	4.84544e-78
CP025073.1\|AZW60743.1\|1898919_1900122_-\|aspartate/tyrosine/aromatic-aminotransferase	gnl\|CDD\|181731	PRK09257, PRK09257, aromatic amino acid transaminase.	0
CP025073.1\|AZW60749.1\|1905386_1905710_+\|iron-sulfur-cluster-assembly-protein-IscA	gnl\|CDD\|213674	TIGR02011, Protein_yfhF., iron-sulfur cluster assembly protein IscA. This model represents the IscA component of the ISC system for iron-sulfur cluster assembly. The ISC system consists of IscRASU, HscAB and an Isc-specific ferredoxin. IscA previously was believed to act as a scaffold and now is seen as an iron donor protein. This clade is limited to the proteobacteria. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	4.04388e-54
CP025073.1\|AZW60747.1\|1903725_1904937_+\|IscS-subfamily-cysteine-desulfurase	gnl\|CDD\|184450	PRK14012, PRK14012, IscS subfamily cysteine desulfurase.	0
CP025073.1\|AZW60748.1\|1904974_1905385_+\|Fe-S-cluster-assembly-scaffold-IscU	gnl\|CDD\|183087	PRK11325, PRK11325, scaffold protein; Provisional.	5.84746e-99
CP025073.1\|AZW60734.1\|1888167_1888599_+\|hypothetical-protein	gnl\|CDD\|224462	COG1545, COG1545, Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only].	1.42164e-21
CP025073.1\|AZW60737.1\|1892715_1893432_+\|3-oxoadipate-CoA-transferase	gnl\|CDD\|131482	TIGR02429, 3-oxoadipate_CoA-transferase_subunit_A, 3-oxoacid CoA-transferase, A subunit. Various members of this family are characterized as the A subunits of succinyl-CoA:3-ketoacid-CoA transferase (EC 2.8.3.5), beta-ketoadipate:succinyl-CoA transferase (EC 2.8.3.6), acetyl-CoA:acetoacetate CoA transferase (EC 2.8.3.8), and butyrate-acetoacetate CoA-transferase (EC 2.8.3.9). This represents a very distinct clade with strong sequence conservation within the larger family defined by pfam01144. The B subunit represents a different clade in pfam01144, described by TIGR02428. The two are found in general as tandem genes and occasionally as a fusion.	2.11885e-141
CP025073.1\|AZW60751.1\|1906354_1908217_+\|chaperone-protein-HscA	gnl\|CDD\|235360	PRK05183, hscA, chaperone protein HscA; Provisional.	0
CP025073.1\|AZW60744.1\|1900199_1902236_+\|UvrABC-system-protein-B	gnl\|CDD\|235395	PRK05298, PRK05298, excinuclease ABC subunit UvrB.	0
CP025073.1\|AZW60733.1\|1887367_1888171_+\|enoyl-CoA-hydratase/isomerase-family-protein	gnl\|CDD\|223955	COG1024, CaiD, Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism].	1.56988e-63
CP025073.1\|AZW60741.1\|1895632_1896583_+\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	8.66858e-23
CP025073.1\|AZW60742.1\|1898140_1898869_-\|transcriptional-repressor-LexA	gnl\|CDD\|234688	PRK00215, PRK00215, transcriptional repressor LexA.	1.30999e-106

>CP025073.1|AZW60741.1|1895632_1896583_+|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS
>CP025073.1|AZW60740.1|1894849_1895062_+|hypothetical-protein
MGPAGIPADITAAWAKEIARVAALPDVSEKLATLGVESVSSTPQQFSAFVESEIRKWEKVVQDAHIPPVQ
>CP025073.1|AZW60739.1|1894100_1894832_+|hypothetical-protein
MKTKIKIVTLALCAFSSAVFASSFPSKPINLIVPYPPGGAVDPIALLYAEKISQSWGVPVIVLNRPGAGTTIGLNQAARAEPDGYTVVLGTASITSNAPLYRSLPYDTLKDFTYLSMAGMIPLAITANPRTAVNSMDELVGQLKKKPGSLTYSSSGNGTIIHLGGELFKSLAGVDMVHVPYKGSGPSVMAGVAGEVDLTFDSVFLMDPQVKAGKLKYIAVASEKRLKSLPEVPAIGESILVIS
>CP025073.1|AZW60738.1|1893424_1894066_+|CoA-transferase-subunit-B
MSKGWSNDEIAARIAVDLPEHAIVNLGIGLPILVANHIPEGKTIFFHSENGIIGLGPVPAPGQEDPDIVNAAKKHATLIAGASIVHHADSFSLIRGGRLDYSVLGGLQVSSGGDIANWKVPGQKGGGGVGGAMDLAVGARNVLVMMRHQDKTGASKLVKSCTFPLTAVSAVTRVYTELGIFECAGDAFIVRESAPGIGKDELLRKTEAALTFP
>CP025073.1|AZW60737.1|1892715_1893432_+|3-oxoadipate-CoA-transferase
MTAGTSTHFNQVNGVGMLNKTCESADEAVSVVESGATILISGFGDIGLPFELLHALARTSVKDLTIVSNNAGTGELGLSRLFRNRQVSRLIASFPSQPDSHHYFAAYQEGLVDLELVPQGTLAERIRAAGAGLAGFFTPTGYGTELAQGKECRMFKGKGYVFEEALPGDFAFIKAHVADAYGNFRYRRASRTFNPIMAMAARTTIAEAKQMVPVGSIDPDDVHTPGVFVDRIVEVRDE
>CP025073.1|AZW60736.1|1889774_1890551_+|3-oxoacyl-ACP-reductase
MQDKLLTLENRQVIVTGAGQGIGRALASAIAGLGGRVVAVDLNADALAALREALGHERCVTVAGNVADPSLAQQAVDAGVTAFGGVNGLVNNAGVTRTAMIDKMSISDWQQVIDVHLSGSFYFLQALGRHLLGRAKAGGDGAGAIVNISSDAGRRGTIGQINYGAAKAGVLGLTMCAAREWARYGIRTNTVGFGVVETPMTETIRGEKFRDTYLSQIPLGRWGEADEVVRPVCFLLSDADSYVTGQHLSVNGGYTIGL
>CP025073.1|AZW60735.1|1888595_1889753_+|thiolase
MIQERFPRGKTAIVACATYGIGESPGLSSLDLAVRASVQALDSVGLTPADVDGLFIGLPDDFVSGLSFTEYLGISPRLTDNNRTGGSSFLTHAIHAALALEAGLCDVALIAYGSNQRSGAGKLVSSMRPSPYEGAYKLARPVGAYALAASRYAAQYGLQKEQLGAVALAARQWAQKNPEAYMRAPLTMDECLASRLVCDPFSVRDCCLVTDGAAAVVMVRADRARDLAARPAYLLGGAAAAWHKDITNMPDLTVTAASLSGPRAMAQAGVTPADIDVLELYDAFTLNTILFLEDLGFCAKGEGGAFVEDGRIAPGGALPVNTNGGGLSCVHPGMYGLFTMVEAAQQLAGAAGERQVAQARLALAHGNGGELSSQATLILGTEETI
>CP025073.1|AZW60734.1|1888167_1888599_+|hypothetical-protein
MTEHPQAASALLPQQEYFAHLADGRFMIQRSRSSGEYVFYPRVAAPRTGAQDLEWVAASGRGTVYATTVMRVRPPAAPYNVCLVELEEGPRMMSRVEGIGPEDVQVGMAVRARIIRDDAGEPLVVFEPAGPSDAGIGQGRAAQ
>CP025073.1|AZW60733.1|1887367_1888171_+|enoyl-CoA-hydratase/isomerase-family-protein
MIMSVLEISRVGACAVLTLNRPAARNALDMDLRNALAKALPEIRDDATVRAVVLTGAGGHFCAGGDIRAIAAGQGNADVFEGRNRILSMQRWFDGLVDLEKPVIAAVDGVAFGAGLSLALAADFVLASPRATFCAVFARLGYVPDLGGMYLLPRAVGLARAKALAFSARVVGAPEALEMGIAHQLVDDRPVLDAALELAGRFEQAPAGALGIVKSVMNHAFESDRRTVYMQEALAQALCRESAFHQEAARRFLDKQAPLYQWPQEQQ
>CP025073.1|AZW60732.1|1886898_1887354_+|MaoC-family-dehydratase
MSFDSIAALKAFAGQPAAVGQPIVVDQSAIDTFGDVVHDRQWIHVDPVRAAAESPFGTTIAHGLLTLSLITGWYHQLFEFPGRKLALNYGFDKVRFPAPVPSGSALVGSFRLARVDELGPDEARCLWEVDVRVAGAERPAMVAEWLMQLRY
>CP025073.1|AZW60742.1|1898140_1898869_-|transcriptional-repressor-LexA
MRLAFFPWVLQNGAVYPYSPQKRVIAMATKLTERQQEILDLIRQTVARTGFPPTRAEIAQALGFRSPNAAEDHLKALARKGAIELTAGASRGIRLKVPDSATPSAQLTHPLLAQLVLPLVGRVAAGSPILASEHVEREVGVDPGLFAQTPDYLLKVRGMSMRDAGILEGDLLAVKRAAEARNGQIVVARLGDEVTVKRLQRQNGRIELLPENPDFAPIVVANTDEFALEGIAVGLIRTQPLH
>CP025073.1|AZW60743.1|1898919_1900122_-|aspartate/tyrosine/aromatic-aminotransferase
MSTLFASVELAPRDPILGLNEQYNADTRPGKVNLGVGVYYDDEGRIPLLQAVRKAEVARIEAAAARGYLPIEGIAGYNKGAQALLLGADSPLAAEGRVLTAQALGGTGALKIGADFLRQLLPQSKVLISDPSWENHRALFERAGFPVETYAYYDAATHGLNFEAMLAALQAAPEQTIVVLHACCHNPTGVDPTPQQWEQIAAVVKARNLVPFLDIAYQGFGEGLEQDAAVVRMFAELDLTMFISSSFSKSFSLYGERVGALTVVAGSKDEAARVLSQLKRVIRTNYSNPPTHGGTVVSTVLNTPELFALWENELAGMRDRIRLMRKELVEKIKTQGVAQDFSFVLAQRGMFSYSGLTAAQVDRLREEHGIYAVSSGRICVAALNSRNIDAVAAGIAAVLK
>CP025073.1|AZW60744.1|1900199_1902236_+|UvrABC-system-protein-B
MTAPGFVEFPDSPFHLYQPYPPAGDQPGAIDALTEGVSDGLMFQTLLGVTGSGKTYTMANMIARLGRPALVLAPNKTLAAQLYAEMREFFPRNAVEYFVSYYDYYQPEAYVPTRDLFIEKDSSINEHIEQMRLSATKSLLERRDTVIVGTVSCIYGIGNPGDYHAMVLILRTGDRISRREVLARLVAMQYTRNDADFTRGVFRVRCETIDIFPAESPELALRLTLFDDEIESLELFDPLTGRVRQKLPRFTVYPGSHYVTPRETVLRAIETIKEELRERLAQLIADGKLVEAQRLEQRTRFDLEMLQELGFCKGIENYSRHLSGAAPGEPPPTLIDYLPADALMFIDESHVTIGQLGGMYRGDRSRKETLVQYGFRLPSALDNRPLRLEEFEARMRQCVFVSATPAAYEQEHADNVVEQVVRPTGLVDPIVEVRPAHTQVDDLLGEIHKRAALQERVLVTTLTKRMAEDLTDFLSEHGVRVRYLHSDIDTVERVEIIRDLRLGVFDVLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNLNGRAILYADRITDSMRRAIDETERRRAKQIQHNTDHGITARGVSKAVRELIDGVVAPAGHDALESAVPAEVLTDEKAMAREIRRLEKLMMDHARNLEFEQAAAARDALNALKSRLLLDGVGWSG
>CP025073.1|AZW60745.1|1902488_1902980_+|low-molecular-weight-phosphotyrosine-protein-phosphatase
MMTKVLFVCMGNICRSPSAEGVFRYLVNDAGMGDVVRVDSAGTHAFHIGEAPDARAQAAARKRGYDLTHCAARQVTADDFREFDLILAMDWDNLAALQQQCPKAYQHKLMLLMRFANEFEEATVPDPYYGGPEGFGKVLDYLEDACQGVLELVRKRATQYQAA
>CP025073.1|AZW60746.1|1903195_1903708_+|Fe-S-cluster-assembly-transcriptional-regulator-IscR
MRLTTKGRFAVTAMIDLAMRQHSGPVTLAAISQRQNISLSYLEQLFGKLRRHELVDSVRGPGGGYSLARLARNVTVADIIFAVDEPLDATSCGGKRDCTSGNDGKPGKCMTHELWTTLNRKMVDYLDSVSLQDLVDQQRVRQLQEAANQAQGCSAVRVNRSTPVAANATA
>CP025073.1|AZW60747.1|1903725_1904937_+|IscS-subfamily-cysteine-desulfurase
MSNRPIYLDYSATTPVDPSVVEKMIPWLYESFGNPASRSHAFGWEAEDAVEKAREEVAKLVNADPREIVWTSGATESDNLAIKGAANFYAERGKHIITVKTEHKAVLDTCRELERQGFEVTYLDVQDDGLLSLDAFKAALRPDTILVSVMMVNNEIGVIQDIAALGEICREKGIIFHVDAAQATGKVEIDLQKLKVDLMSFSAHKTYGPKGIGALYVRRKPRVRIEAQMHGGGHERGFRSGTLATHQIVGMGEAFRLAREEMGTENERVRMLRDRLLAGLTQIEEVYVNGSMEHRVPHNLNISFNYVEGESLIMAIKELAVSSGSACTSASLEPSYVLRALGRNDELAHSSIRFTLGRFTTEQEIDFTIELIKSRVGKLRDMSPLWEMAQEGIDLNSVQWAAH
>CP025073.1|AZW60748.1|1904974_1905385_+|Fe-S-cluster-assembly-scaffold-IscU
MAYSSKVLDHYENPRNVGSFDKGDDSVGTGMVGAPACGDVMKLQIKVNEAGVIEDARFKTYGCGSAIASSSLVTEWVKGKTLDEAMNIRNTQIAEELALPPVKIHCSILAEDAIKAAVQDYKTKHGAETPEAVAAN
>CP025073.1|AZW60749.1|1905386_1905710_+|iron-sulfur-cluster-assembly-protein-IscA
MAVTLTQSAANHVGRYLQKRGKGIGLRLGVRTTGCSGMAYKLEYVDEQAADDVVFDSFGVKVFIDPKSLAYLDGTELDYAREGLNEGFRFSNPNEKATCGCGESFTV
>CP025073.1|AZW60750.1|1905712_1906225_+|co-chaperone-protein-HscB
MAADDHFSLFGLPTRFALDPVQLEQAWRAVAARVHPDRYATASAAERRVAMQWAARANEAYRQLRDPMLRARYLCEQAGVDLQTESNTAMDPAFLMQQMEWREMLDDARRDPAAFAALRAELEQARLRMQQTLSELIDERGDYQQAGTKVREWMFVEKLAQELSAAQPMQ
>CP025073.1|AZW60751.1|1906354_1908217_+|chaperone-protein-HscA
MALLQISEPGDSPAPHQRKLAVGIDLGTTNSLVAAVRSSVPEVLADAQGQVLLPSAVRYLDGGAVRIGREALLEQARDPLNTIVSVKRFMGRSAADAAASGAPYEFVDAPGMVRLRTVQGDLSPVEVSAQILAVLRQRAEDVLGDDLVGAVITVPAYFDDAQRQATRDAARLAGLNVLRLLNEPTAAAIAYGLDQAAEGIYAVYDLGGGTFDISILRLTQGVFEVIATGGDTALGGDDFDSAIVAHACAGEDVAALPVADRRALLVAARAAREALTDQAQAPFEVTLRDGRAIQATLTRAQFEQLAEPLVGRTLDSARRALRDAGLAVGDVRGVVMVGGATRMPVVRQQVGALFGTEPLTNLDPDQVVALGAALQANLLAGNRALGEDWLLLDVIPLSLGLETMGGLVERIIPRNSTIPVARAQEFTTFKDGQTAMSVHVVQGERDLVSDCRSLARFELRGIPPMVAGAARIRVTFQVDADGLLSVTAREQSTGVEAAVAVKPSYGLSDDEIARMLADSVTQADSDARARMLREQQVEARQLVESVGAALAADGDLLDPAERATVDQRLQAAAQAQSLDDVEAVRAAVQALSDATEEFAARRMDRSIRSALAGRKLDELA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP025073_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP025073_5

3435591-3435700

Orphan

Consensus_repeat	Method
TTGACTGCCAAGACGGTATCTGTCCCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP025073_5

>merge|CP025073|5|3435591-3435700|CRISPRCasFinder
TTGACTGCCAAGACGGTATCTGTCCCCGCAGGGAGGGTGCCTGTCCCCGCCGGGACAGGCACACTGCTGTACGCCATCGACGCTTGACGGCCAAGACGGTATCTGTCCCC

>CP025073|5|5|3435591-3435700|CRISPRCasFinder
TTGACTGCCAAGACGGTATCTGTCCCC	GCAGGGAGGGTGCCTGTCCCCGCCGGGACAGGCACACTGCTGTACGCCATCGACGC
TTGACGGCCAAGACGGTATCTGTCCCC

Protein	Signature genes	Signature genes Name	Protein_function
CP025073.1\|AZW61977.1\|3432048_3433458_+\|lytic-transglycosylase	unknown	unknown	gnl\|CDD\|182727
CP025073.1\|AZW61983.1\|3437983_3438934_-\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025073.1\|AZW61987.1\|3445089_3446853_+\|glutamine--tRNA-ligase	unknown	unknown	gnl\|CDD\|235424
CP025073.1\|AZW61986.1\|3443633_3444974_-\|cytochrome-ubiquinol-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|376587
CP025073.1\|AZW61985.1\|3441139_3442564_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|236531
CP025073.1\|AZW61974.1\|3429936_3430404_-\|ribonuclease-HI	unknown	unknown	gnl\|CDD\|178927
CP025073.1\|AZW61972.1\|3426162_3427041_+\|fatty-acid-desaturase	unknown	unknown	gnl\|CDD\|366126
CP025073.1\|AZW61988.1\|3446964_3447843_+\|septum-site-determining-protein-MinC	unknown	unknown	gnl\|CDD\|178806
CP025073.1\|AZW61981.1\|3436231_3436912_+\|DUF533-domain-containing-protein	unknown	unknown	gnl\|CDD\|377342
CP025073.1\|AZW61971.1\|3422257_3425236_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375438
CP025073.1\|AZW61984.1\|3440438_3441140_+\|DNA-binding-response-regulator	unknown	unknown	gnl\|CDD\|181883
CP025073.1\|AZW61989.1\|3447955_3448771_+\|septum-site-determining-protein-MinD	unknown	unknown	gnl\|CDD\|225447
CP025073.1\|AZW61980.1\|3435701_3436094_-\|OsmC-family-peroxiredoxin	unknown	unknown	gnl\|CDD\|224679
CP025073.1\|AZW61975.1\|3430446_3431217_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369777
CP025073.1\|AZW61969.1\|3420953_3421904_-\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025073.1\|AZW61970.1\|3421890_3422259_-\|hypothetical-protein	unknown	unknown	unknown
CP025073.1\|AZW61976.1\|3431237_3432038_+\|hydroxyacylglutathione-hydrolase	unknown	unknown	gnl\|CDD\|274569
CP025073.1\|AZW61982.1\|3436916_3437915_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
CP025073.1\|AZW61973.1\|3428989_3429940_+\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025073.1\|AZW61978.1\|3433552_3434338_+\|enoyl-[acyl-carrier-protein]-reductase-FabI	unknown	unknown	gnl\|CDD\|180789

Protein	Function_ID	Function_description	E-value
CP025073.1\|AZW61977.1\|3432048_3433458_+\|lytic-transglycosylase	gnl\|CDD\|182727	PRK10783, mltD, membrane-bound lytic murein transglycosylase D; Provisional.	5.28635e-76
CP025073.1\|AZW61983.1\|3437983_3438934_-\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	7.3142e-23
CP025073.1\|AZW61987.1\|3445089_3446853_+\|glutamine--tRNA-ligase	gnl\|CDD\|235424	PRK05347, PRK05347, glutaminyl-tRNA synthetase; Provisional.	0
CP025073.1\|AZW61986.1\|3443633_3444974_-\|cytochrome-ubiquinol-oxidase-subunit-I	gnl\|CDD\|376587	pfam01654, Cyt_bd_oxida_I, Cytochrome bd terminal oxidase subunit I. This family are the alternative oxidases found in many bacteria which oxidize ubiquinol and reduce oxygen as part of the electron transport chain. This family is the subunit I of the oxidase E. coli has two copies of the oxidase, bo and bd', both of which are represented here In some nitrogen fixing bacteria, e.g. Klebsiella pneumoniae this oxidase is responsible for removing oxygen in microaerobic conditions, making the oxidase required for nitrogen fixation. This subunit binds a single b-haem, through ligands at His186 and Met393 (using SW:P11026 numbering). In addition His19 is a ligand for the haem b found in subunit II.	2.21087e-123
CP025073.1\|AZW61985.1\|3441139_3442564_+\|ATP-binding-protein	gnl\|CDD\|236531	PRK09467, envZ, osmolarity sensor protein; Provisional.	3.78414e-42
CP025073.1\|AZW61974.1\|3429936_3430404_-\|ribonuclease-HI	gnl\|CDD\|178927	PRK00203, rnhA, ribonuclease H; Reviewed.	4.07937e-102
CP025073.1\|AZW61972.1\|3426162_3427041_+\|fatty-acid-desaturase	gnl\|CDD\|366126	pfam00487, FA_desaturase, Fatty acid desaturase.	2.20669e-12
CP025073.1\|AZW61988.1\|3446964_3447843_+\|septum-site-determining-protein-MinC	gnl\|CDD\|178806	PRK00030, minC, septum site-determining protein MinC.	3.47756e-166
CP025073.1\|AZW61981.1\|3436231_3436912_+\|DUF533-domain-containing-protein	gnl\|CDD\|377342	pfam04391, DUF533, Protein of unknown function (DUF533). Some family members may be secreted or integral membrane proteins.	5.6465e-62
CP025073.1\|AZW61971.1\|3422257_3425236_+\|hypothetical-protein	gnl\|CDD\|375438	pfam17936, Big_6, Bacterial Ig domain. This domain is found in a wide variety of extracellular bacterial proteins often in multiple tandem copies.	1.32844e-07
CP025073.1\|AZW61984.1\|3440438_3441140_+\|DNA-binding-response-regulator	gnl\|CDD\|181883	PRK09468, ompR, osmolarity response regulator; Provisional.	4.05363e-90
CP025073.1\|AZW61989.1\|3447955_3448771_+\|septum-site-determining-protein-MinD	gnl\|CDD\|225447	COG2894, MinD, Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning].	7.6448e-163
CP025073.1\|AZW61980.1\|3435701_3436094_-\|OsmC-family-peroxiredoxin	gnl\|CDD\|224679	COG1765, COG1765, Predicted redox protein, regulator of disulfide bond formation [Posttranslational modification, protein turnover, chaperones].	4.86152e-16
CP025073.1\|AZW61975.1\|3430446_3431217_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	9.0439e-10
CP025073.1\|AZW61969.1\|3420953_3421904_-\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	5.27808e-22
CP025073.1\|AZW61982.1\|3436916_3437915_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	7.76869e-129
CP025073.1\|AZW61976.1\|3431237_3432038_+\|hydroxyacylglutathione-hydrolase	gnl\|CDD\|274569	TIGR03413, GSH_gloB, hydroxyacylglutathione hydrolase. Members of this protein family are hydroxyacylglutathione hydrolase, a detoxification enzyme known as glyoxalase II. It follows lactoylglutathione lyase, or glyoxalase I, and acts to remove the toxic metabolite methylglyoxal and related compounds. This protein belongs to the broader metallo-beta-lactamase family (pfam00753). [Cellular processes, Detoxification].	2.85848e-146
CP025073.1\|AZW61973.1\|3428989_3429940_+\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.05216e-23
CP025073.1\|AZW61978.1\|3433552_3434338_+\|enoyl-[acyl-carrier-protein]-reductase-FabI	gnl\|CDD\|180789	PRK06997, PRK06997, enoyl-[acyl-carrier-protein] reductase FabI.	1.22848e-177

>CP025073.1|AZW61978.1|3433552_3434338_+|enoyl-[acyl-carrier-protein]-reductase-FabI
MGFLAGKRILMTGVLSNRSIAYGIARACRDQGADLAFTYVGDRFKERITEFAASFGSDIVLPCDVAEDSQIDAAFAELGKRWDGLDGLVHAIGFAPREAIAGDFLDGLSRENFRIAHDISAYSFPAMAKAALPLMEGRKGSVLTLSYLGSERVVANYNTMGLAKASLEASVRYLATALGPRGIRANAISAGPIKTLAASGIKDFSSILKFVEANAPLRRNVTIEDVGNVAAFMLSDLAAGITGEITHVDAGFSTVVPGMEN
>CP025073.1|AZW61977.1|3432048_3433458_+|lytic-transglycosylase
MRFLRLLLPLFLAVLAGCAGTAKQNQAAGPSSNRYIAQDTSRTVDLTSPPSDAWDRIRRGFAIPNLNTDLAQEWTDYYASHPESVQRMAERAGKYLYFIVDEINRRGLPTELALLPFVESAYNPTALSRSQASGLWQFIPTTGQHFNLKQDWWRDERRDPIASTYAALDYLEKLFEMQGDWYLALASYNWGEGSVQRAMAKNEAAGLSTDYLSLNMPDETRNYVPKLQAIKNIIANPRKFAVVLPPVENTPYFVAVQKNRDIDIELAARLAEMPLDEFKALNPAFNRPLIRGEHAPTLLLPADRADRFNANLQNYKGDLSSWKVYHTRRGESYAAIAKRFGISEAKLRASNDIGSKRKVAADQALLIPGVPSGDGAANIQLASLSPPVGALDNVGEPRAAAAPRGKAPARVASARPNVRTHKVSSGDTLFGLARKYGTSVGALRALNNLKGNNLKLGSQLRIPGTGTRG
>CP025073.1|AZW61976.1|3431237_3432038_+|hydroxyacylglutathione-hydrolase
MQTAPPLSAVVPLPAFSDNYIWALAHEGQAAVVDPGDAAPVLRWLRATGATLRAILLTHHHPDHVGGVLELVQATGATVYGPAGETLPHCDVRLAEGDRVTLPELALALEVLDVPGHTAGHIAYTGRAAGVERVLFCGDTLFAGGCGRLFEGTPAQMLDSLEKLSALPADTQVCCAHEYTLANLRWALAVEPANRTLQQWYQRAQELRNEGTPTLPSTIGQERETNPFLRTPHAAVAHAAAVWSGRSLATPVEVFAALRQWKNNFK
>CP025073.1|AZW61975.1|3430446_3431217_-|class-I-SAM-dependent-methyltransferase
MAEETPPIVELAEWFQTPPGQYVLAWEQAQFDEAVADIFGYYAWQVGLAEPNLLRANRMPFKAWVGAGVPPPELAQGWQACVAAAPEALPFESQSVDLLVLPHAFECAEAPHLVLREVERVLVPEGRVVISGFNPWSLWGARNLMPGMEAWLPLPLSAQVALPRLKDWFKLLSFEVERGRFGCYAPACRTDKWLRRWRFMERYGQRWWGLGGAVYVVTATKKVAAMRLIGPAWKTRRKRAQAASVVVNRQADDPGR
>CP025073.1|AZW61974.1|3429936_3430404_-|ribonuclease-HI
MQNLEGSGDGQQVEMWTDGACKGNPGPGGWGVLMRAGQHEKTMHGGERQTTNNRMELMAVIEGLRALKRPCRVTIHTDSQYVMKGMTEWLANWKRRGWRTADKKPVKNVELWQALDEQVGRHQVQWRWVRGHAGDPGNERADALANQGMEAARGR
>CP025073.1|AZW61973.1|3428989_3429940_+|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT
>CP025073.1|AZW61972.1|3426162_3427041_+|fatty-acid-desaturase
MVRPAEWLRHRRDWQSVLYLAALPALAAWQWVHGWHWALYAPMLFLTLGVGVIHHNHAHRRMWRPRWLNRLTDFWLTLLQGHPTFVFHAAHNANHHRYKHGPRDVARTYRFGGDTNHLAGYLLHPLQAVVVLYPLFLASLRRLRSRRPGVWRYCLRQYAAWLGLWGGLLALDPGKAFWLVIVPQLHGLHWLLATNYLQHAHADGGPGRHAALSYARNFEGWVNPLLFNIGLHTAHHENPRAHWSELRALHWQHYRDRVPSRLNERGLAPYMARVFVLGLFSRRCRTHTLMRP
>CP025073.1|AZW61971.1|3422257_3425236_+|hypothetical-protein
MQLWLPDGTATSVRANAAGGFEASSAGDMTSGLIRARATDRYGDTSQEVTYAYTDTVDKTAPVLSIAGVATDEATGRVTVTGRSEPDAQVTIRFPGGGRKTVRADANGAYRVRSDGDLPAGVIVVQAADAAGNSTQAQQAYQDTVDRTAPEPVQIALDTDAATGRLTVSGQAEPGGSVTVTWPDGTTQTVRVDADGGFRVTSAGDAAQGDVVVVVADQAGNRAAPVRAHYADPVDRTAPMTPTVRHATDAQTGRVTVMGRTEAGALVTVQFPDGSSKTVRAQNDGGYAATSDTDMVSGPIVVSAGDADGNRTPAQQVMYTDTLDKTAPASPSLTVREDAASGRATVTGQAEPGAAVRVVFPNGEAQTVTAGSDGAYSVTSTADMVAGEITVVAADASGNQSAPARTVFADAVDKTAPAAPTLALSEAADSGRLTVSGRTEPGASVRVTFPDGETVTVTAKADGTYTATSRADMIGGNVTVVATDTAGNAAAPVRAAYADTVDRTPPVLDTPVLNVASDSGRVTVTGVTEPGARVQVAIPGESLQTVTADSAGRYRAVSPGDVLQSGTVRVIATDAHGNASAPRDVPYQDAVDRTAPPLTIEAAVEQARTGVVNVSGKTEPNLMVSATFPDGQTAQARADGQGRYQLASPADVARSGRIAVSASDAAGNRAAARAEFTDQVDKTAPAVTIRAVTEQAGTGVATVSGATEPGATVSVTFPDGQVARATADRSGAYTVHSARDVTARGNISVIATDAAGNASPSVSRQFSNTVADTVPPSLTIAMVTTDPGNGRITVSGVTEAGARVHVVFPGGASDTVTADSKGGYRATSAGDVGSGAVTAQATDASANRSPLKTYAYTDAWQPRQLSAKDFSQSRYFVPLTTRGGTDNEPLLRITTNQQIPTAELRVALKPYKTEDRAGRLVREAITLKWGNAPGVGGDARALHFYVPDSAKAKLRKELTEVERSNDYKFWIEFTDTRFGGVARLYIKVISTL
>CP025073.1|AZW61970.1|3421890_3422259_-|hypothetical-protein
MHVGQGLGDAVHGNAPGGRVGANLGNAQRQDDFLAPRIEHDAVLAPDEILQACAPVEWRGRVLRAAAQLPRQGLAQIQPHAQLDASCEDSIGCMHGSSEPDLRNWKSPPPQFTQGARPDEHP
>CP025073.1|AZW61969.1|3420953_3421904_-|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIPPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT
>CP025073.1|AZW61980.1|3435701_3436094_-|OsmC-family-peroxiredoxin
MTIQVRANTPGGLQYTATAEGHELPLAMPQPQGEGPDPHDYFDTALGGCKALTLMVYAQRKGLPLQAVDVDVVRDASEERKGIYRLTAKLKLHGDLDDAQIDELLKVADKCPLHKLMTATDIQVSTIVVE
>CP025073.1|AZW61981.1|3436231_3436912_+|DUF533-domain-containing-protein
MSARQLLDQLLQSGQSLMQGAGAQAQQATQGGKGTFLAGLGGGALGAGALGLLLGSKKARKIGGKVAMYGGMAALGALAYRAYDQYQRNQAGGAAAPAPQTLDRLPPAPAEQHSNAVLVAMIGAAKADGHIGPDERQLLETELAKLSGDAGDRAWLEAELARPLDPAVIAQQARTPEMGAEMYLASLLVADEQSFMERAYLDELARQLKLPAELKQQLEAQVPAAA
>CP025073.1|AZW61982.1|3436916_3437915_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MRPVAPMTTMKSQVSILLAGCLLGAGAAAAQAPATYPDHAITIVVTFPPGGGTDLLARKLGAAMQQRLGQPVVVENRPGASGNIGARAVAEARPDGYTLLMVNSSFAVNPGVFRNLDFSPTRDFTAVINVAYVPSVIVTAEPAGDAGLPERLRQADTQSRTLAFASCGNGTPQHLAGEMLRQASGAWLQHVPYRGCGPALTDVLSRQVPLGIVTASSAAPFIHAGKLRALAVTSAQRSPLLPDVPTVAEQGAPGYELDQWHGLLAPAGTPPAVIQRLYEALSAIVAEPAMRRELESLGFNPVSEGPERFEALVQADIARFAALTARMGLRAD
>CP025073.1|AZW61983.1|3437983_3438934_-|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWQRPHQGIGRAVPISRLNLDEYNLLTVHS
>CP025073.1|AZW61984.1|3440438_3441140_+|DNA-binding-response-regulator
MDNPHTKLLVVDDDPALRQLLADYLNRHGYDTLLAPDASDLAARITRYAPDLLVLDRMLPGGDGADACRRLRDQGEDIPVILLTARDEAVDRIIGLEAGADDYLGKPFDPRELLARIEAVLRRKRGPSALTKDAPVSFGPFVFDPATRQLLRDDTPVKLTGGEINLLEALVRNAGKPLSRERLLALARDDDGGERNDRAIDIAILRLRRAIEEDPKQPRWIQTVWGIGYRFSP
>CP025073.1|AZW61985.1|3441139_3442564_+|ATP-binding-protein
MKLLRLPAPRSLRMRLILLVLGSVLLAQAATLATVSYFRHKFMEDVAIDYIATTIRTLRASLSQVPTDERAEFVRQASGNQWRLWSRSLPADARLQRWHRGPQEDEAERERMRREYERRHPPPDDIRRDLRGLVSELNERLSDGTRVALSRGPRPEIFISLAPSPSPDDAPPLREWLVIPLERLDPPVATPLIAFWVGGIGLVLLLAAWFSWHITRPLTRLADAADQLAAGQPQRVEPSGPHETRVLGERFNAMLDALAESDSVRRTLLSGLPHDLKGPLSRMWLRIEMADDPTLKEGLRKDLQDMQHMVDQFIGFVRGTDPAAYRYAPLALGEWLAERVGAWQGAGTDIRLQAPDNGALGIQADAVALGRLLDNLIGNALHHGAPPVEVSLRRDADMAVLEVSDHGPGIAPERRTEALRPFARLDDARTRTGNVGLGLALAEAIARAHGGGLELRQAPSGGLLVRITLPLAKA
>CP025073.1|AZW61986.1|3443633_3444974_-|cytochrome-ubiquinol-oxidase-subunit-I
MNIPPLLLARAQFTASLGFLALFLAISLALAWLLLFFKLRARWSGQSGWTAAYRFWVRIFALAFVLALACAVPVLIQLGSLWSGLMDKIGNLAGPLLGYGVLSIFIVKSCFLGVMLFGQRRVSDAAHTLAVLMVAIGQLVAVGWVLALFSWLQTPDGAVLIDGRYQVYDWRAVVLNPSFGWRLGLTVLGAFLTAGFLMLGVTAMQALRRPLDDGERHAFRAGLTVALLASLLLGPVAAGMGEVTARLQPAKAAAAAGFWHSGAEPELVVFGWPSARAQANLAAVSLAGAGGRWLHRDASLGYLGLDKFSGMQPPVAFTFWSLRLALGLGLLMLAASCATLALTCRRGFDPVALPRWWLRVLSLLMFAGALGVVATWCYDLAGMQPYAVNRAVTQSEVLGPVTTPALLYSLAGHIALYAVLLAAFVGMLFHAARYGVVPVRKTGGSS
>CP025073.1|AZW61987.1|3445089_3446853_+|glutamine--tRNA-ligase
MTHAPTPPAASNFLRPIIEDDLQANRFQGKLWAGKPGPAALQAQGQPDPARIRTRFPPEPNGYLHIGHAKSICVNFGLARDYGGVCHLRFDDTNPEKEEQEYVDAIIEAVHWLGFDWQADGNDNLYFASDYFEFMYEFAEALVQAGHAYVDEQSAEEIRASRGTLTEPGTDSPWRDRPADESLLRLREMRDGKHPDGSLVLRARIDMASPNINLRDPVMYRVRHATHHRTGNAWCIYPMYSWAHPVEDALEGITHSICTLEFEDQRPFYDWILARLAELGKLARPLPHQYEFARLNLTYVVTSKRKLLQLVREGYVDGWDDPRMPTLFGLRRRGYTPSSIRLFCDRTAVSKSDSRIDYSLLEQAVRDDLDPVAPRSVAVLDPLKLVITNYPEGRSETCSAPRNPHDPQAGVREFPFTRELWIEQDDFREEPPKKYFRLFPGNTVRLKYGYVVRCTGFTKDESGKVVEVQAEYLPDTKSGTPGADSVKVKGNITWVSAAHAVPAQVHLYDRLFADAHPDGGDKDFLACLNPNSKQTVQAWLEPGIEAVPGATWQFERLGYFTVDSKDSRPEAPVLNRIVTLRDSWQAA
>CP025073.1|AZW61988.1|3446964_3447843_+|septum-site-determining-protein-MinC
MNTESLALDFKSATLYAIRVVLHDADTTRLRAALDKRMADAGSFFENEPVVIDATRVDAPVDWPALLQALADHNLPPIGVVAEGANLQGARDAGLVPVELSTSVARAPQVIDTAPPNDVATPVPSVPEATAEATAKAGPQDDEADGEQADEAPAHNPESVPTRAARETTEANRPTATPPQSSSALVITKPLRSGQRVYARHTDLIVIGMVSQGAEVIADGNVHVYGPLRGKAMAGARGDTSARIFTTQLDAELLAVAGVYRVVEDKLDRALHNQPALVRLDGDTLRIEALKG
>CP025073.1|AZW61989.1|3447955_3448771_+|septum-site-determining-protein-MinD
MTRIVVVTSGKGGVGKTTTSASFSAGLAMRGHKTAVIDFDVGLRNLDLIMGCERRVVYDFVNVIQGEASLKQALIKDKQLENLFILPASQTRDKDALTQEGVEKVIDELKEMGFDYIVCDSPAGIEAGALMAAYFADDALVVTNPEVSSVRDSDRILGILAAKSRRAVQGDEPVKEYLLLTRYNPKRVNDGEMLSLSDIEDILRIKLIGVIPESEAVLQASNQGLPAIHLKDTDVSEAYKDVVARFLGEERSLRFTDYEKPGLLKRLFGGK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 123122

111

Planktothrix_phage(16.67%)

transposase,tRNA,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW59163.1\|0_1920_+\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG	NA	NA	NA	NA
AZW59164.1\|1916_2609_+	ribosomal RNA small subunit methyltransferase G	NA	NA	NA	NA
AZW59165.1\|2605_3403_+	ParA family protein	Q8JL10	Natrialba_phage	5.6e-20	34.9
AZW59166.1\|3409_4171_+	N-acetyltransferase	NA	NA	NA	NA
AZW59167.1\|4214_5132_+	chromosome partitioning protein ParB	I3NLC2	Bifidobacterium_phage	1.9e-16	38.1
AZW59168.1\|6721_7912_+	elongation factor Tu	A0A1V0SLW6	Klosneuvirus	3.1e-14	29.2
AZW59169.1\|8150_8531_+	preprotein translocase subunit SecE	NA	NA	NA	NA
AZW59170.1\|8540_9074_+	transcription termination/antitermination protein NusG	G3MAW2	Bacillus_virus	1.4e-11	30.5
AZW59171.1\|9137_9569_+	50S ribosomal protein L11	NA	NA	NA	NA
AZW59172.1\|9571_10270_+	50S ribosomal protein L1	NA	NA	NA	NA
AZW59173.1\|10512_11037_+	50S ribosomal protein L10	NA	NA	NA	NA
AZW59174.1\|11118_11502_+	50S ribosomal protein L7/L12	NA	NA	NA	NA
AZW59175.1\|11661_15774_+	DNA-directed RNA polymerase subunit beta	A0A0N9R0J7	Chrysochromulina_ericina_virus	2.4e-21	28.8
AZW59176.1\|15773_20018_+	DNA-directed RNA polymerase subunit beta'	A0A2I7QNZ7	Vibrio_phage	3.5e-68	24.7
AZW62563.1\|20126_20531_-	lipoprotein	NA	NA	NA	NA
AZW59177.1\|20771_21947_+	hypothetical protein	NA	NA	NA	NA
AZW59178.1\|24352_25459_-	peptidoglycan-binding protein	NA	NA	NA	NA
AZW59179.1\|26470_27286_+	DNA-binding response regulator	NA	NA	NA	NA
AZW59180.1\|27282_28233_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59181.1\|28314_28650_-	CoA transferase	NA	NA	NA	NA
AZW59182.1\|28674_29109_-	hypothetical protein	NA	NA	NA	NA
AZW59183.1\|29141_30368_-	thiolase family protein	NA	NA	NA	NA
AZW59184.1\|30364_30862_-	dehydratase	NA	NA	NA	NA
AZW62564.1\|31069_31978_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW59185.1\|32163_33006_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW59186.1\|33048_34470_+	MmgE/PrpD family protein	NA	NA	NA	NA
AZW59187.1\|34625_35576_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59188.1\|35572_36763_-	MFS transporter	NA	NA	NA	NA
AZW59189.1\|36949_37924_+\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
AZW59190.1\|37925_40064_+\|tRNA	glycine--tRNA ligase subunit beta	NA	NA	NA	NA
AZW59191.1\|40060_40600_+	D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase	NA	NA	NA	NA
AZW59192.1\|40603_41332_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
AZW59193.1\|41318_42212_+	M48 family peptidase	NA	NA	NA	NA
AZW59194.1\|42282_42678_+	lactoylglutathione lyase	NA	NA	NA	NA
AZW59195.1\|42687_43218_+	peptide deformylase	E3SLL2	Synechococcus_phage	3.7e-12	35.4
AZW59196.1\|43346_43646_-	DUF1974 domain-containing protein	NA	NA	NA	NA
AZW59197.1\|43663_44614_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59198.1\|45113_45749_+	hypothetical protein	NA	NA	NA	NA
AZW59199.1\|45720_45957_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
AZW59200.1\|46084_46978_+	hypothetical protein	NA	NA	NA	NA
AZW59201.1\|48147_49395_+	homoserine O-acetyltransferase	NA	NA	NA	NA
AZW59202.1\|49391_50006_+	methionine biosynthesis protein MetW	NA	NA	NA	NA
AZW59203.1\|50141_51092_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59204.1\|51134_52391_+	MFS transporter	NA	NA	NA	NA
AZW59205.1\|53622_54357_-	aspartate/glutamate racemase family protein	NA	NA	NA	NA
AZW59206.1\|54362_54953_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.2e-20	33.6
AZW59207.1\|54977_55667_-	amino acid ABC transporter permease	NA	NA	NA	NA
AZW59208.1\|55663_56425_-	amino acid ABC transporter permease	NA	NA	NA	NA
AZW59209.1\|56504_57404_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW59210.1\|57497_58448_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59211.1\|59248_60475_-	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
AZW59212.1\|60474_60894_-	transcriptional regulator	NA	NA	NA	NA
AZW59213.1\|61077_62019_-	hypothetical protein	NA	NA	NA	NA
AZW59214.1\|62442_63279_-	hypothetical protein	NA	NA	NA	NA
AZW59215.1\|63473_64055_-\|protease	protease	NA	NA	NA	NA
AZW59216.1\|64067_64385_-	ferredoxin	NA	NA	NA	NA
AZW59217.1\|64488_65547_-	oxidoreductase	NA	NA	NA	NA
AZW59218.1\|65581_66853_-	TRAP transporter large permease	NA	NA	NA	NA
AZW59219.1\|67482_68664_-	hypothetical protein	NA	NA	NA	NA
AZW59220.1\|69085_70036_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59221.1\|70129_70444_+\|transposase	transposase	NA	NA	NA	NA
AZW59222.1\|71636_73544_+	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	1.1e-117	37.2
AZW59223.1\|73705_74326_-	glutathione S-transferase	NA	NA	NA	NA
AZW59224.1\|74357_74939_-	1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD	A0A1W6DX33	Sphingobium_phage	1.7e-05	54.3
AZW59225.1\|75027_75279_-	hypothetical protein	NA	NA	NA	NA
AZW62565.1\|75280_76030_-	hypothetical protein	NA	NA	NA	NA
AZW59226.1\|76228_77638_+	signal recognition particle protein	NA	NA	NA	NA
AZW59227.1\|77634_78585_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW62566.1\|78659_79604_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59228.1\|79600_81475_-	polysaccharide biosynthesis protein	A0A2P1ELS8	Moumouvirus	2.0e-23	26.9
AZW59229.1\|82822_83527_-	DUF2837 domain-containing protein	NA	NA	NA	NA
AZW59230.1\|83523_84630_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
AZW59231.1\|84891_85485_-	sugar transferase	NA	NA	NA	NA
AZW59232.1\|85481_86714_-	UDP-4-amino-4, 6-dideoxy-N-acetyl-beta-L-altrosamine transaminase	NA	NA	NA	NA
AZW59233.1\|86731_87991_-	glycosyltransferase WbuB	NA	NA	NA	NA
AZW59234.1\|88014_89103_-	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A0N9R0B2	Chrysochromulina_ericina_virus	4.8e-46	36.3
AZW59235.1\|89110_90211_-	aminotransferase DegT	A0A2K9L0G1	Tupanvirus	3.3e-31	29.7
AZW59236.1\|90214_90790_-	N-acetyltransferase	NA	NA	NA	NA
AZW59237.1\|90793_91846_-	gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
AZW59238.1\|91976_92984_+	lipopolysaccharide heptosyltransferase I	NA	NA	NA	NA
AZW59239.1\|92985_94272_+	3-deoxy-D-manno-octulosonic acid transferase	NA	NA	NA	NA
AZW59240.1\|94288_94444_-	hypothetical protein	NA	NA	NA	NA
AZW59241.1\|94468_95272_-	type III pantothenate kinase	NA	NA	NA	NA
AZW59242.1\|95268_96135_-	biotin--[acetyl-CoA-carboxylase] ligase	NA	NA	NA	NA
AZW59243.1\|96203_97340_+	ABC transporter permease	NA	NA	NA	NA
AZW59244.1\|97339_98179_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.1e-21	32.4
AZW59245.1\|99111_99714_+	hypothetical protein	NA	NA	NA	NA
AZW59246.1\|99743_100397_+	alpha/beta hydrolase	NA	NA	NA	NA
AZW59247.1\|100529_101786_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	6.2e-66	40.5
AZW59248.1\|101788_102733_+	D-amino acid aminotransferase	NA	NA	NA	NA
AZW59249.1\|102808_103084_+	DUF493 domain-containing protein	NA	NA	NA	NA
AZW59250.1\|103091_103754_+	octanoyltransferase	NA	NA	NA	NA
AZW59251.1\|103815_104817_+	lipoyl synthase	NA	NA	NA	NA
AZW59252.1\|104831_105380_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	3.7e-47	53.4
AZW59253.1\|105437_106334_-	dTDP-4-dehydrorhamnose reductase	NA	NA	NA	NA
AZW59254.1\|106330_107392_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	1.6e-78	44.8
AZW59255.1\|107427_108378_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59256.1\|109277_110471_+	cystathionine beta-lyase	NA	NA	NA	NA
AZW59257.1\|110552_111182_-	thiol:disulfide interchange protein DsbA	NA	NA	NA	NA
AZW59258.1\|111243_111927_-	SPOR domain-containing protein	NA	NA	NA	NA
AZW59259.1\|111936_113619_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
AZW62567.1\|113906_114254_+	DUF1840 domain-containing protein	NA	NA	NA	NA
AZW59260.1\|114344_114662_+	hypothetical protein	NA	NA	NA	NA
AZW59261.1\|114944_115961_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW59262.1\|116036_116837_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
AZW59263.1\|116833_117709_-	sugar ABC transporter permease	NA	NA	NA	NA
AZW59264.1\|117719_119012_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW59265.1\|119054_120095_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.0e-22	33.7
AZW59266.1\|120200_121022_-	phosphodiesterase	NA	NA	NA	NA
AZW59267.1\|121122_122073_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59268.1\|122171_123122_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

165941 : 302544

117

Klosneuvirus(10.53%)

transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW59300.1\|165941_166892_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59301.1\|168335_169238_-	hypothetical protein	NA	NA	NA	NA
AZW59302.1\|169215_169845_-	LemA family protein	NA	NA	NA	NA
AZW59303.1\|170127_171594_+	RNA helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	6.0e-44	29.8
AZW59304.1\|171590_172220_+	threonine transporter RhtB	NA	NA	NA	NA
AZW59305.1\|172268_173876_+	peptide chain release factor 3	A0A2K9L6L3	Tupanvirus	9.3e-14	37.8
AZW59306.1\|173900_174584_+	hypothetical protein	NA	NA	NA	NA
AZW62572.1\|174665_175142_-	bacterioferritin	NA	NA	NA	NA
AZW59307.1\|175348_176299_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59308.1\|177414_177942_+	lipoprotein	NA	NA	NA	NA
AZW59309.1\|178033_178849_+	lipoprotein	NA	NA	NA	NA
AZW59310.1\|178909_179644_+	sulfurtransferase	NA	NA	NA	NA
AZW59311.1\|179681_181760_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	1.5e-27	23.6
AZW59312.1\|182009_182282_-	hypothetical protein	NA	NA	NA	NA
AZW59313.1\|182380_183469_+	iron-sulfur cluster carrier protein ApbC	NA	NA	NA	NA
AZW59314.1\|183472_185377_+	outer membrane protein assembly factor	NA	NA	NA	NA
AZW59315.1\|185373_189048_+	DUF490 domain-containing protein	NA	NA	NA	NA
AZW59316.1\|189108_189672_+	dCTP deaminase	S5VM63	Pseudomonas_phage	2.6e-72	75.3
AZW59317.1\|189679_190102_-	glyoxalase	NA	NA	NA	NA
AZW59318.1\|190129_190549_-	glyoxalase/bleomycin resistance/dioxygenase family protein	NA	NA	NA	NA
AZW62573.1\|190577_191024_-	N-acetyltransferase	Q9AZG4	Lactococcus_phage	1.2e-08	29.4
AZW59319.1\|191150_191648_+	hypothetical protein	NA	NA	NA	NA
AZW59320.1\|191802_194073_+	lysine decarboxylase	NA	NA	NA	NA
AZW59321.1\|194116_195349_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
AZW59322.1\|196442_197135_+	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	2.4e-83	73.8
AZW59323.1\|197131_198025_+	ZIP family metal transporter	NA	NA	NA	NA
AZW59324.1\|198419_199520_+	aminomethyltransferase	NA	NA	NA	NA
AZW59325.1\|199601_199976_+	glycine cleavage system protein H	NA	NA	NA	NA
AZW59326.1\|200035_202900_+	glycine dehydrogenase	E3SN07	Prochlorococcus_phage	1.2e-261	51.4
AZW59327.1\|203044_203785_-	FadR family transcriptional regulator	NA	NA	NA	NA
AZW59328.1\|203854_205066_+	CoA transferase	NA	NA	NA	NA
AZW59329.1\|205094_206063_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW59330.1\|206676_207627_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59331.1\|207783_208107_+	PsiF repeat family protein	NA	NA	NA	NA
AZW59332.1\|208211_209261_-	cyclase	NA	NA	NA	NA
AZW59333.1\|209257_210082_-	3-oxoadipate enol-lactonase	NA	NA	NA	NA
AZW59334.1\|210082_210379_-	hypothetical protein	NA	NA	NA	NA
AZW59335.1\|210404_210680_-	muconolactone delta-isomerase	NA	NA	NA	NA
AZW59336.1\|210736_211381_-	CoA transferase subunit B	NA	NA	NA	NA
AZW59337.1\|211380_212067_-	3-oxoadipate CoA-transferase	NA	NA	NA	NA
AZW62574.1\|212196_213048_+	IclR family transcriptional regulator	NA	NA	NA	NA
AZW59338.1\|213098_213824_-	short-chain dehydrogenase	NA	NA	NA	NA
AZW59339.1\|213855_215205_-	short-chain fatty acid transporter	NA	NA	NA	NA
AZW59340.1\|215316_216249_-	3-hydroxybutyryl-CoA dehydrogenase	NA	NA	NA	NA
AZW59341.1\|216706_219502_-\|protease	serine protease autotransporter SphB1	NA	NA	NA	NA
AZW59342.1\|220095_223038_-	phosphoenolpyruvate carboxylase	NA	NA	NA	NA
AZW59343.1\|223109_223829_+	7-cyano-7-deazaguanine synthase QueC	A0A0A0RPC6	Escherichia_phage	8.0e-50	43.9
AZW59344.1\|223867_224416_-	N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	1.2e-21	41.7
AZW59345.1\|224570_225470_+	virginiamycin B lyase	NA	NA	NA	NA
AZW59346.1\|225494_226445_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59347.1\|226431_226611_-	hypothetical protein	NA	NA	NA	NA
AZW59348.1\|226663_227359_+	FadR family transcriptional regulator	NA	NA	NA	NA
AZW59349.1\|227375_228788_+	FAD-binding oxidoreductase	NA	NA	NA	NA
AZW59350.1\|228900_230331_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
AZW59351.1\|230372_232286_-	phosphomethylpyrimidine synthase	NA	NA	NA	NA
AZW59352.1\|232604_233171_+	preprotein translocase subunit SecD	NA	NA	NA	NA
AZW59353.1\|233261_234263_+	HindIII family type II restriction endonuclease	NA	NA	NA	NA
AZW59354.1\|234377_235328_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59355.1\|235414_236365_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59356.1\|236361_237312_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59357.1\|237410_238208_-	beta-D-hydroxybutyrate dehydrogenase	NA	NA	NA	NA
AZW59358.1\|239157_239568_+	4-carboxymuconolactone decarboxylase	NA	NA	NA	NA
AZW59359.1\|240589_241333_-	GntR family transcriptional regulator	NA	NA	NA	NA
AZW59360.1\|241376_242420_-	C4-dicarboxylate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW59361.1\|242590_244693_+	hypothetical protein	NA	NA	NA	NA
AZW59362.1\|246103_247060_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW59363.1\|247078_247570_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
AZW59364.1\|247566_248922_-	polynucleotide adenylyltransferase PcnB	A0A1B1IVF3	uncultured_Mediterranean_phage	3.4e-25	36.8
AZW59365.1\|248922_249621_-	HAD-IB family hydrolase	NA	NA	NA	NA
AZW59366.1\|249617_250319_-	DnaA regulatory inactivator Hda	NA	NA	NA	NA
AZW59367.1\|250571_251621_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	5.6e-68	43.6
AZW59368.1\|251726_252668_-\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
AZW59369.1\|252664_254554_-	DNA mismatch repair protein MutL	A0A1B2LRQ5	Wolbachia_phage	3.3e-79	32.8
AZW59370.1\|254640_255279_+	hypothetical protein	NA	NA	NA	NA
AZW62575.1\|255421_256666_-	N-acetylmuramoyl-L-alanine amidase	A0A2H4JCM7	uncultured_Caudovirales_phage	4.1e-17	30.3
AZW59371.1\|256737_257274_-\|tRNA	bifunctional alanine racemase/tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
AZW59372.1\|257425_258817_+	class II fumarate hydratase	NA	NA	NA	NA
AZW59373.1\|258833_259814_-	AEC family transporter	NA	NA	NA	NA
AZW59374.1\|259949_260933_+	tripartite tricarboxylate transporter substrate binding protein BugE	NA	NA	NA	NA
AZW59375.1\|260997_261897_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW59376.1\|262003_263758_+	gamma-glutamyltransferase	NA	NA	NA	NA
AZW59377.1\|263765_264890_-	CoA transferase	NA	NA	NA	NA
AZW59378.1\|264903_265884_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW59379.1\|266614_267565_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59380.1\|268124_268670_+	GbsR/MarR family transcriptional regulator	NA	NA	NA	NA
AZW59381.1\|268753_270373_+	cytochrome d ubiquinol oxidase subunit I	NA	NA	NA	NA
AZW59382.1\|270388_271543_+	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
AZW59383.1\|271556_271682_+	cytochrome bd-I oxidase subunit CydX	NA	NA	NA	NA
AZW59384.1\|271678_273430_+	thiol reductant ABC exporter subunit CydD	W8CYL7	Bacillus_phage	3.4e-09	23.8
AZW59385.1\|273426_275106_+	thiol reductant ABC exporter subunit CydC	W8CYL7	Bacillus_phage	3.6e-16	27.6
AZW59386.1\|275141_275717_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	1.4e-28	43.1
AZW59387.1\|276859_277138_+	DUF4148 domain-containing protein	NA	NA	NA	NA
AZW59388.1\|278181_279132_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59389.1\|279118_279334_-	hypothetical protein	NA	NA	NA	NA
AZW59390.1\|279409_279571_+	DUF4224 domain-containing protein	NA	NA	NA	NA
AZW59391.1\|279578_279719_+	hypothetical protein	NA	NA	NA	NA
AZW59392.1\|280237_280687_-\|protease	ClpXP protease specificity-enhancing factor	NA	NA	NA	NA
AZW59393.1\|280696_281308_-	glutathione S-transferase	NA	NA	NA	NA
AZW59394.1\|281466_282321_-	cytochrome c1	NA	NA	NA	NA
AZW59395.1\|282340_283723_-	cytochrome b	NA	NA	NA	NA
AZW59396.1\|283787_284429_-	ubiquinol-cytochrome c reductase iron-sulfur subunit	NA	NA	NA	NA
AZW59397.1\|284568_285027_+	large conductance mechanosensitive channel protein MscL	NA	NA	NA	NA
AZW59398.1\|285051_285828_-	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
AZW62576.1\|285881_287018_+	2-alkenal reductase	W5SAB9	Pithovirus	1.2e-07	31.2
AZW59399.1\|287014_287965_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59400.1\|288063_288690_-	FMN-binding negative transcriptional regulator	NA	NA	NA	NA
AZW59401.1\|288712_289639_-	glyoxylate/hydroxypyruvate reductase A	NA	NA	NA	NA
AZW59402.1\|289647_291234_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW59403.1\|291230_292235_-	alpha/beta hydrolase	A0A2L2DMU8	Acanthamoeba_polyphaga_mimivirus	7.5e-30	31.5
AZW59404.1\|292434_293295_+	AraC family transcriptional regulator	NA	NA	NA	NA
AZW59405.1\|293326_294328_-	hypothetical protein	NA	NA	NA	NA
AZW59406.1\|294398_295208_+	AraC family transcriptional regulator	NA	NA	NA	NA
AZW59407.1\|295285_297145_+	dihydroxy-acid dehydratase	NA	NA	NA	NA
AZW59408.1\|297273_298476_-	MFS transporter	NA	NA	NA	NA
AZW59409.1\|298589_299471_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW59410.1\|300973_301534_-	5'-3'-deoxyribonucleotidase	A0A1E1EUN3	Acanthamoeba_castellanii_mimivirus	3.2e-14	30.8
AZW59411.1\|301593_302544_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

391898 : 449407

Orpheovirus(14.29%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW59498.1\|391898_392849_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59499.1\|392985_393903_+	reductase	NA	NA	NA	NA
AZW59500.1\|393899_394148_+	glutaredoxin family protein	NA	NA	NA	NA
AZW59501.1\|394144_395350_+	CoA transferase	NA	NA	NA	NA
AZW59502.1\|395422_396418_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW59503.1\|396440_397661_-	CoA transferase	NA	NA	NA	NA
AZW59504.1\|397657_398302_-	hypothetical protein	NA	NA	NA	NA
AZW59505.1\|400032_400842_-	IclR family transcriptional regulator	NA	NA	NA	NA
AZW62582.1\|401059_402100_+	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	6.1e-59	42.5
AZW59506.1\|402198_403182_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59507.1\|403108_403810_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW59508.1\|403858_404629_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
AZW59509.1\|404625_405867_-	CoA transferase	NA	NA	NA	NA
AZW59510.1\|405971_407678_-	thiamine pyrophosphate-binding protein	NA	NA	NA	NA
AZW59511.1\|407674_408571_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW59512.1\|408611_410201_-	sulfurtransferase	NA	NA	NA	NA
AZW59513.1\|410250_411243_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW59514.1\|411311_411911_-	hypothetical protein	NA	NA	NA	NA
AZW62583.1\|412371_413349_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW59515.1\|413427_414378_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59516.1\|414466_415381_+	EamA/RhaT family transporter	NA	NA	NA	NA
AZW59517.1\|415377_416037_+	LysE family translocator	NA	NA	NA	NA
AZW59518.1\|416126_417050_+	alpha/beta hydrolase	A0A1C9C5K3	Heterosigma_akashiwo_virus	4.8e-07	27.2
AZW59519.1\|417055_417511_-	hypothetical protein	NA	NA	NA	NA
AZW59520.1\|417507_418611_-	ChbG/HpnK family deacetylase	NA	NA	NA	NA
AZW62584.1\|418530_418839_+	GtrA family protein	NA	NA	NA	NA
AZW59521.1\|418798_420418_-	phospholipid carrier-dependent glycosyltransferase	NA	NA	NA	NA
AZW59522.1\|420414_421473_-	glycosyltransferase	I1TED8	Salmonella_phage	2.8e-59	40.5
AZW59523.1\|421602_422097_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AZW59524.1\|422189_423167_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59525.1\|423362_424568_+	sodium/glutamate symporter	NA	NA	NA	NA
AZW59526.1\|424564_426076_+	TRAP transporter substrate-binding protein	NA	NA	NA	NA
AZW62585.1\|426091_427405_-	short-chain fatty acids transporter	NA	NA	NA	NA
AZW59527.1\|427595_427775_-	hypothetical protein	NA	NA	NA	NA
AZW59528.1\|428184_428919_-	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	1.4e-41	43.8
AZW59529.1\|431363_432314_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59530.1\|432445_432844_-	elongation factor G	E4ZFJ7	Streptococcus_phage	9.0e-19	44.3
AZW59531.1\|433254_433725_-	universal stress protein	NA	NA	NA	NA
AZW59532.1\|433813_434158_-	TIGR01244 family phosphatase	NA	NA	NA	NA
AZW59533.1\|434257_435658_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
AZW59534.1\|437446_437965_-	methyltransferase	G3MA03	Bacillus_virus	2.1e-12	38.9
AZW59535.1\|438075_438831_+	hypothetical protein	A0A0R6PEZ3	Moraxella_phage	2.9e-42	40.8
AZW59536.1\|439026_440259_+	CoA transferase	NA	NA	NA	NA
AZW59537.1\|440251_441037_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW59538.1\|441103_442075_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW59539.1\|442085_443063_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW59540.1\|443188_444361_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW59541.1\|444387_445416_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW59542.1\|445481_446675_+	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
AZW59543.1\|448456_449407_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

622892 : 670260

Bacillus_phage(40.0%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW59696.1\|622892_623843_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59697.1\|624541_624925_+	hypothetical protein	NA	NA	NA	NA
AZW59698.1\|624982_625585_+	DUF2946 domain-containing protein	NA	NA	NA	NA
AZW62591.1\|625602_626004_-	DoxX family protein	NA	NA	NA	NA
AZW59699.1\|626137_627031_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW59700.1\|627027_627609_+	NUDIX hydrolase	NA	NA	NA	NA
AZW59701.1\|628403_629138_+	arginyltransferase	NA	NA	NA	NA
AZW59702.1\|629178_630228_+	dihydroorotate dehydrogenase (quinone)	NA	NA	NA	NA
AZW59703.1\|630375_630954_-	Phasin (PHA-granule associated protein)	NA	NA	NA	NA
AZW59704.1\|631340_632318_+	tripartite tricarboxylate transporter substrate binding protein BugD	NA	NA	NA	NA
AZW59705.1\|632411_636806_-	dermonecrotic toxin	NA	NA	NA	NA
AZW59706.1\|637006_637855_-	IclR family transcriptional regulator	NA	NA	NA	NA
AZW59707.1\|638013_638826_-	competence/damage-inducible protein A	NA	NA	NA	NA
AZW59708.1\|638881_639832_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59709.1\|639930_640731_-	hypothetical protein	NA	NA	NA	NA
AZW59710.1\|640792_641176_+	thioredoxin	NA	NA	NA	NA
AZW59711.1\|641187_642621_-	ATP-dependent helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.5e-52	34.4
AZW59712.1\|642827_643157_-	hypothetical protein	NA	NA	NA	NA
AZW62592.1\|643159_643828_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW59713.1\|644091_645012_+	branched-chain amino acid transaminase	NA	NA	NA	NA
AZW59714.1\|645058_645271_+	zinc-finger domain-containing protein	NA	NA	NA	NA
AZW59715.1\|645293_645716_+	DUF4440 domain-containing protein	NA	NA	NA	NA
AZW59716.1\|645732_646833_+	alpha/beta hydrolase	NA	NA	NA	NA
AZW59717.1\|646929_648447_-	peptidase	NA	NA	NA	NA
AZW59718.1\|648522_649362_+	UTP--glucose-1-phosphate uridylyltransferase	A0A127AW70	Bacillus_phage	1.1e-66	48.9
AZW59719.1\|649383_650265_-	cytochrome c oxidase assembly protein	NA	NA	NA	NA
AZW59720.1\|650346_651441_-	porin	NA	NA	NA	NA
AZW59721.1\|651734_652685_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW62593.1\|652759_653701_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59722.1\|653784_654144_-	hypothetical protein	NA	NA	NA	NA
AZW59723.1\|654525_655563_-	hypothetical protein	NA	NA	NA	NA
AZW59724.1\|655879_657220_+	peptidase M24 family protein	NA	NA	NA	NA
AZW59725.1\|657229_657682_-	hypothetical protein	NA	NA	NA	NA
AZW59726.1\|657778_658960_+	monooxygenase	NA	NA	NA	NA
AZW59727.1\|659019_660051_+\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
AZW59728.1\|660091_660331_+	Fis family transcriptional regulator	NA	NA	NA	NA
AZW59729.1\|660400_661990_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase PurH	Q58MG4	Prochlorococcus_phage	8.7e-65	47.2
AZW59730.1\|661989_662538_+	crossover junction endodeoxyribonuclease RuvC	NA	NA	NA	NA
AZW59731.1\|662618_663191_+	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
AZW59732.1\|663209_664121_-	complex I NDUFA9 subunit family protein	NA	NA	NA	NA
AZW59733.1\|664194_665163_-	threonine/serine dehydratase	NA	NA	NA	NA
AZW59734.1\|665285_666359_+	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	2.3e-08	25.7
AZW59735.1\|666363_668184_-	DNA helicase RecQ	L7RCS0	Acanthamoeba_polyphaga_moumouvirus	3.1e-74	35.3
AZW59736.1\|668260_669211_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59737.1\|669309_670260_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_5

681479 : 714162

uncultured_Caudovirales_phage(19.05%)

terminase,transposase,tRNA,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW59749.1\|681479_682430_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59750.1\|682681_682894_-	hypothetical protein	NA	NA	NA	NA
AZW62595.1\|682959_683571_-	LexA family transcriptional repressor	NA	NA	NA	NA
AZW59751.1\|684050_684371_-	hypothetical protein	NA	NA	NA	NA
AZW59752.1\|684363_685062_-	hypothetical protein	NA	NA	NA	NA
AZW59753.1\|685076_685298_-	hypothetical protein	NA	NA	NA	NA
AZW59754.1\|685315_686266_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW62596.1\|686941_687391_+\|terminase	terminase	C7U0W1	Enterobacteria_phage	5.2e-39	61.5
AZW59755.1\|687377_688655_+\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	2.4e-150	64.7
AZW59756.1\|688657_690076_+	DUF4055 domain-containing protein	R9TF43	Synechococcus_phage	2.2e-99	42.1
AZW62597.1\|690104_691160_+	hypothetical protein	A0A0H5BBX3	Pseudomonas_phage	2.6e-97	50.6
AZW59757.1\|691165_691408_+	hypothetical protein	A0A0H5AUE5	Pseudomonas_phage	5.6e-16	53.2
AZW59758.1\|691530_692133_+	hypothetical protein	R9TF81	Synechococcus_phage	7.9e-27	43.6
AZW59759.1\|692561_693512_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59760.1\|693529_694177_+	hypothetical protein	R9TJ64	Synechococcus_phage	2.7e-65	71.1
AZW59761.1\|694186_694438_+	hypothetical protein	NA	NA	NA	NA
AZW59762.1\|694500_694983_+	hypothetical protein	A0A2H4JE38	uncultured_Caudovirales_phage	1.8e-13	37.1
AZW59763.1\|694984_695185_+	hypothetical protein	NA	NA	NA	NA
AZW59764.1\|695184_695580_+	hypothetical protein	A0A2D2W284	Stenotrophomonas_phage	7.8e-07	35.0
AZW59765.1\|695576_695975_+	hypothetical protein	I6PCW1	Cronobacter_phage	4.2e-16	38.0
AZW59766.1\|695971_696394_+	hypothetical protein	NA	NA	NA	NA
AZW59767.1\|696401_696902_+	HNH endonuclease	A0A1I9SEX5	Klebsiella_phage	4.4e-31	45.1
AZW59768.1\|697156_697675_+\|tail	phage tail protein	A0A1S5R1H0	Pseudomonas_phage	5.4e-24	38.3
AZW59769.1\|697684_698014_+	hypothetical protein	A0A2H4J121	uncultured_Caudovirales_phage	2.9e-15	44.0
AZW59770.1\|698031_698322_+	hypothetical protein	A0A2H4JBP7	uncultured_Caudovirales_phage	3.7e-14	45.2
AZW59771.1\|698347_700960_+\|tail	phage tail tape measure protein	A0A2H4J107	uncultured_Caudovirales_phage	4.9e-105	38.6
AZW59772.1\|700969_701329_+	hypothetical protein	NA	NA	NA	NA
AZW59773.1\|701396_701930_+	DUF1833 domain-containing protein	A5A3Q9	Burkholderia_phage	1.1e-40	46.9
AZW59774.1\|701926_702316_+	hypothetical protein	A0A0G3EYJ9	Achromobacter_phage	3.0e-35	50.0
AZW59775.1\|702308_706265_+	hypothetical protein	A0A0B5A1N2	Achromobacter_phage	3.9e-215	40.8
AZW59776.1\|706269_706686_+	hypothetical protein	NA	NA	NA	NA
AZW59777.1\|706904_707168_+	hypothetical protein	A0A1B0V3F2	Roseobacter_phage	7.2e-09	41.8
AZW59778.1\|707167_707980_+	hypothetical protein	NA	NA	NA	NA
AZW59779.1\|707984_708227_+	hypothetical protein	NA	NA	NA	NA
AZW59780.1\|708205_708757_+	lysozyme	NA	NA	NA	NA
AZW59781.1\|708738_709272_+	DUF2514 domain-containing protein	NA	NA	NA	NA
AZW59782.1\|709268_709550_-	hypothetical protein	NA	NA	NA	NA
AZW59783.1\|709892_710093_+	hypothetical protein	NA	NA	NA	NA
AZW59784.1\|710099_710771_-	SOS response-associated peptidase	Q5QF62	Pseudomonas_virus	4.7e-36	39.9
AZW59785.1\|711126_711813_-	DNA-binding response regulator	NA	NA	NA	NA
AZW59786.1\|711793_712366_-	RNA pyrophosphohydrolase	NA	NA	NA	NA
AZW59787.1\|712431_714162_+\|tRNA	proline--tRNA ligase	A0A2K9L3R9	Tupanvirus	4.6e-11	29.4

DBSCAN-SWA_6

858287 : 907551

Vibrio_phage(33.33%)

transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW59903.1\|858287_859238_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW62602.1\|859210_859810_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW59904.1\|859811_860246_+	PaaI family thioesterase	NA	NA	NA	NA
AZW59905.1\|860242_860677_+	hypothetical protein	NA	NA	NA	NA
AZW59906.1\|860660_861464_-	phosphatase PAP2 family protein	NA	NA	NA	NA
AZW59907.1\|861480_862296_-	DNA repair exonuclease	NA	NA	NA	NA
AZW59908.1\|862292_863108_-	diacylglycerol kinase	NA	NA	NA	NA
AZW59909.1\|863254_863956_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW59910.1\|863983_865942_-\|holin	choline transporter	A0A2I7QNT1	Vibrio_phage	8.0e-28	30.3
AZW59911.1\|866024_866975_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59912.1\|867195_867864_+	transcriptional regulator	NA	NA	NA	NA
AZW59913.1\|867987_869094_+	MexH family multidrug efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
AZW59914.1\|869106_872220_+	MexW/MexI family multidrug efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	4.5e-57	21.5
AZW59915.1\|872216_873710_+	RND transporter	NA	NA	NA	NA
AZW59916.1\|873724_874396_+	transcriptional regulator	NA	NA	NA	NA
AZW59917.1\|874439_874934_-	azurin	NA	NA	NA	NA
AZW59918.1\|875074_875722_-	transcriptional regulator	NA	NA	NA	NA
AZW62603.1\|875825_877874_+	hydantoinase/oxoprolinase family protein	NA	NA	NA	NA
AZW59919.1\|877870_879883_+	hydantoin utilization protein B	NA	NA	NA	NA
AZW59920.1\|879908_881243_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
AZW59921.1\|881351_882344_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW59922.1\|882410_884495_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
AZW59923.1\|884519_885491_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW59924.1\|885619_886621_-	peptidase M14	NA	NA	NA	NA
AZW59925.1\|886654_887896_-	cystathionine beta-lyase	NA	NA	NA	NA
AZW59926.1\|887976_888900_+	transcriptional regulator LrhA	NA	NA	NA	NA
AZW59927.1\|888977_889802_+	3-oxoacyl-ACP reductase	NA	NA	NA	NA
AZW59928.1\|889998_891015_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW59929.1\|891211_892195_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW59930.1\|893793_895182_-	MmgE/PrpD family protein	NA	NA	NA	NA
AZW59931.1\|895212_896202_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW59932.1\|896312_897545_-	methylaspartate ammonia-lyase	NA	NA	NA	NA
AZW59933.1\|897826_898627_+	IclR family transcriptional regulator	NA	NA	NA	NA
AZW59934.1\|898649_900881_-\|holin	high-affinity choline transporter BetT	NA	NA	NA	NA
AZW59935.1\|901668_902115_-	preprotein translocase subunit SecG	NA	NA	NA	NA
AZW59936.1\|902136_902883_-	triose-phosphate isomerase	NA	NA	NA	NA
AZW59937.1\|903026_904004_-	NAD(P)H-quinone oxidoreductase	NA	NA	NA	NA
AZW59938.1\|904637_905249_+	PIN domain-containing protein	K4HZX4	Acidithiobacillus_phage	3.3e-12	32.5
AZW59939.1\|905242_906460_-	threonine ammonia-lyase	NA	NA	NA	NA
AZW59940.1\|906600_907551_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_7

938861 : 1004739

Bacillus_virus(15.38%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW59966.1\|938861_939812_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59967.1\|939864_940086_+	hypothetical protein	NA	NA	NA	NA
AZW59968.1\|940245_940458_+	hypothetical protein	NA	NA	NA	NA
AZW59969.1\|940577_941696_+	mannose-6-phosphate isomerase	NA	NA	NA	NA
AZW59970.1\|941792_942008_+	hypothetical protein	NA	NA	NA	NA
AZW59971.1\|942201_942453_+	hypothetical protein	NA	NA	NA	NA
AZW59972.1\|943489_943873_-	ferredoxin	NA	NA	NA	NA
AZW59973.1\|943927_945745_-	ABC transporter ATP-binding protein/permease	W8CYL7	Bacillus_phage	5.7e-44	27.9
AZW62605.1\|945891_946719_+	oxidoreductase	A0A2H4PQR8	Staphylococcus_phage	1.7e-67	47.4
AZW59974.1\|946764_947745_+	aldo/keto reductase	NA	NA	NA	NA
AZW59975.1\|947741_947954_-	hypothetical protein	NA	NA	NA	NA
AZW59976.1\|947950_949132_-	PepSY domain-containing protein	NA	NA	NA	NA
AZW59977.1\|949295_950030_+	serine/threonine protein phosphatase	A0A2H4J0P0	uncultured_Caudovirales_phage	1.9e-62	49.2
AZW59978.1\|950031_952644_-	penicillin-binding protein	NA	NA	NA	NA
AZW59979.1\|952779_954693_-	S9 family peptidase	NA	NA	NA	NA
AZW59980.1\|955308_955719_-	PaaI family thioesterase	NA	NA	NA	NA
AZW59981.1\|955816_956902_+	DNA polymerase IV	NA	NA	NA	NA
AZW59982.1\|957000_957951_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59983.1\|957947_958922_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW59984.1\|959046_959958_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	4.4e-05	27.6
AZW62606.1\|960234_960627_-	type II toxin-antitoxin system HicB family antitoxin	A0A0R6PJ17	Moraxella_phage	4.8e-25	45.0
AZW59985.1\|960756_961707_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW59986.1\|961736_961919_-	addiction module toxin, HicA family	A0A1L2JY37	Aeribacillus_phage	3.7e-12	56.1
AZW59987.1\|961957_962215_-	hypothetical protein	NA	NA	NA	NA
AZW59988.1\|962691_963873_-	MFS transporter	NA	NA	NA	NA
AZW59989.1\|964088_964766_-	phosphoglycolate phosphatase	NA	NA	NA	NA
AZW59990.1\|964762_965536_-	bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG	NA	NA	NA	NA
AZW59991.1\|965613_966195_-	OmpA family protein	NA	NA	NA	NA
AZW59992.1\|966565_969247_+	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	3.2e-104	33.5
AZW59993.1\|969246_970380_+	phosphoserine aminotransferase	M1Q1P2	Streptococcus_phage	6.4e-78	44.0
AZW59994.1\|970372_971458_+	chorismate mutase	NA	NA	NA	NA
AZW59995.1\|971544_972444_+	prephenate dehydrogenase/arogenate dehydrogenase family protein	NA	NA	NA	NA
AZW59996.1\|972440_973769_+	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
AZW59997.1\|973783_974455_+	cytidylate kinase	NA	NA	NA	NA
AZW59998.1\|974627_976358_+	30S ribosomal protein S1	NA	NA	NA	NA
AZW59999.1\|976359_976719_+	integration host factor subunit beta	NA	NA	NA	NA
AZW60000.1\|976910_977225_+	DUF1049 domain-containing protein	NA	NA	NA	NA
AZW60001.1\|977267_978488_+	lipopolysaccharide assembly protein LapB	NA	NA	NA	NA
AZW60002.1\|978484_979426_+	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	1.5e-16	28.1
AZW60003.1\|979422_980412_+	ADP-L-glycero-D-mannoheptose-6-epimerase	E3SJ87	Synechococcus_phage	2.2e-26	34.4
AZW60004.1\|980446_981031_+	DUF655 domain-containing protein	NA	NA	NA	NA
AZW60005.1\|981129_982080_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60006.1\|982160_983072_+	cysteine synthase CysM	A0A1X9I5K7	Streptococcus_phage	8.0e-47	38.8
AZW60007.1\|983132_984278_-	lytic murein transglycosylase B	NA	NA	NA	NA
AZW60008.1\|984297_985212_+	deacetylase	A0A2K9KZC4	Tupanvirus	9.8e-45	34.7
AZW60009.1\|985283_986033_+	electron transfer flavoprotein subunit beta/FixA family protein	NA	NA	NA	NA
AZW60010.1\|986032_986962_+	electron transfer flavoprotein subunit alpha	NA	NA	NA	NA
AZW60011.1\|987205_989032_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW60012.1\|989114_989756_+	peroxiredoxin	NA	NA	NA	NA
AZW60013.1\|989945_990980_+	sulfate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW60014.1\|992816_993881_+	sulfate/thiosulfate import ATP-binding protein CysA	G3M9Y6	Bacillus_virus	3.8e-24	30.3
AZW62607.1\|994678_995587_+	sulfate adenylyltransferase subunit CysD	NA	NA	NA	NA
AZW60015.1\|997074_998349_+	radical SAM protein	NA	NA	NA	NA
AZW60016.1\|998502_998883_+	hypothetical protein	NA	NA	NA	NA
AZW60017.1\|998890_999763_-	multidrug DMT transporter permease	NA	NA	NA	NA
AZW60018.1\|1000068_1000449_+	50S ribosomal protein L19	NA	NA	NA	NA
AZW60019.1\|1000659_1001385_+	CoA pyrophosphatase	NA	NA	NA	NA
AZW60020.1\|1001480_1002431_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60021.1\|1002535_1003585_+	NADP(H)-dependent aldo-keto reductase	NA	NA	NA	NA
AZW60022.1\|1003722_1004739_-\|transposase	IS110 family transposase IS1663	NA	NA	NA	NA

DBSCAN-SWA_8

1028543 : 1083635

uncultured_Mediterranean_phage(37.5%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW60037.1\|1028543_1029494_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60038.1\|1029592_1030333_-	16S rRNA (uracil(1498)-N(3))-methyltransferase	NA	NA	NA	NA
AZW60039.1\|1030527_1032564_+	transketolase	NA	NA	NA	NA
AZW60040.1\|1032581_1033592_+	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
AZW60041.1\|1033709_1034903_+	phosphoglycerate kinase	NA	NA	NA	NA
AZW60042.1\|1034932_1035706_-	enoyl-[acyl-carrier-protein] reductase FabI	NA	NA	NA	NA
AZW60043.1\|1035702_1036893_-	acetate kinase	NA	NA	NA	NA
AZW60044.1\|1036918_1037857_-	phosphate acetyltransferase	NA	NA	NA	NA
AZW62609.1\|1037853_1040202_-	DUF3141 domain-containing protein	NA	NA	NA	NA
AZW60045.1\|1040356_1041064_-	glutathione S-transferase	NA	NA	NA	NA
AZW60046.1\|1041101_1042235_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60047.1\|1042511_1043060_-	damage-inducible protein DinB	NA	NA	NA	NA
AZW60048.1\|1043078_1043564_-	N-acetyltransferase	NA	NA	NA	NA
AZW60049.1\|1043741_1044680_+	curved DNA-binding protein	A0A0P0YMJ9	Yellowstone_lake_phycodnavirus	5.6e-11	24.1
AZW60050.1\|1044682_1045000_+	MerR family transcriptional regulator	NA	NA	NA	NA
AZW60051.1\|1045045_1045990_+	hypothetical protein	NA	NA	NA	NA
AZW60052.1\|1047670_1048321_+	molybdopterin adenylyltransferase	NA	NA	NA	NA
AZW60053.1\|1048374_1048710_+	hypothetical protein	NA	NA	NA	NA
AZW60054.1\|1048706_1049567_+	M23 family peptidase	A0A292GJG6	Xanthomonas_phage	2.6e-15	36.1
AZW60055.1\|1049583_1049865_-	hypothetical protein	NA	NA	NA	NA
AZW60056.1\|1049938_1050202_-	translation initiation factor IF-1	NA	NA	NA	NA
AZW60057.1\|1050445_1051396_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60058.1\|1051694_1052432_-	RNA polymerase sigma factor FliA	NA	NA	NA	NA
AZW60059.1\|1052867_1053191_+	flagellar transcriptional activator FlhD	NA	NA	NA	NA
AZW60060.1\|1053225_1053786_+	flagellar transcriptional regulator FlhC	NA	NA	NA	NA
AZW60061.1\|1053906_1054782_+	flagellar motor stator protein MotA	NA	NA	NA	NA
AZW60062.1\|1054794_1055742_+	motility protein MotB	NA	NA	NA	NA
AZW60063.1\|1055843_1056137_+	response regulator	NA	NA	NA	NA
AZW60064.1\|1056163_1058221_+	chemotaxis protein CheA	NA	NA	NA	NA
AZW60065.1\|1058235_1058736_+	chemotaxis protein CheW	NA	NA	NA	NA
AZW60066.1\|1058809_1060516_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.4e-12	41.7
AZW60067.1\|1061379_1062432_+	chemotaxis response regulator protein-glutamate methylesterase	NA	NA	NA	NA
AZW60068.1\|1062484_1062874_+	chemotaxis protein CheY	Q56AR1	Bacillus_thuringiensis_phage	5.7e-10	33.3
AZW60069.1\|1062882_1063515_+	protein phosphatase CheZ	NA	NA	NA	NA
AZW60070.1\|1063614_1064631_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW62610.1\|1065461_1066469_+	aldo/keto reductase	NA	NA	NA	NA
AZW60071.1\|1066465_1068109_-	apolipoprotein N-acyltransferase	NA	NA	NA	NA
AZW60072.1\|1068105_1069008_-	magnesium/cobalt efflux protein	NA	NA	NA	NA
AZW60073.1\|1069133_1069607_-	endoribonuclease YbeY	NA	NA	NA	NA
AZW60074.1\|1069596_1070619_-	PhoH family protein	A0A0S0MVD6	Pseudomonas_phage	8.7e-50	45.4
AZW60075.1\|1070615_1072043_-\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
AZW60076.1\|1072980_1073997_-\|transposase	IS110 family transposase IS1663	NA	NA	NA	NA
AZW60077.1\|1074329_1075265_-	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	3.0e-41	35.5
AZW60078.1\|1075314_1077195_-	protein translocase subunit SecD	NA	NA	NA	NA
AZW60079.1\|1077261_1077606_-	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	1.0e-10	40.4
AZW60080.1\|1077750_1078887_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.9e-85	44.4
AZW60081.1\|1078883_1079957_-\|tRNA	S-adenosylmethionine:tRNA ribosyltransferase-isomerase	NA	NA	NA	NA
AZW60082.1\|1080114_1081551_+	D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase	NA	NA	NA	NA
AZW62611.1\|1081641_1082283_+	uracil phosphoribosyltransferase	NA	NA	NA	NA
AZW60083.1\|1082618_1083635_+\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_9

1089625 : 1161645

Planktothrix_phage(18.18%)

transposase,tRNA,protease,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW60087.1\|1089625_1090039_+\|holin	phage holin family protein	NA	NA	NA	NA
AZW60088.1\|1090040_1090400_+	hypothetical protein	NA	NA	NA	NA
AZW60089.1\|1090442_1091987_-	4-hydroxy-3-polyprenylbenzoate decarboxylase	NA	NA	NA	NA
AZW60090.1\|1092070_1092901_+	transglycosylase	NA	NA	NA	NA
AZW60091.1\|1092935_1094090_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
AZW60092.1\|1094132_1095005_+	hypothetical protein	NA	NA	NA	NA
AZW60093.1\|1095121_1097410_+	NADP-dependent malic enzyme	NA	NA	NA	NA
AZW60094.1\|1098616_1099081_+	barstar family protein 2	NA	NA	NA	NA
AZW60095.1\|1099107_1100058_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW62613.1\|1100425_1101202_-	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.3e-17	28.7
AZW60096.1\|1101246_1102104_-	phosphate ABC transporter, permease protein PstA	NA	NA	NA	NA
AZW60097.1\|1102125_1103142_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
AZW60098.1\|1103276_1104317_-	phosphate ABC transporter substrate-binding protein PstS	M4QHS4	Cyanophage	2.1e-51	40.2
AZW60099.1\|1104511_1106593_-	polyphosphate kinase 1	NA	NA	NA	NA
AZW60100.1\|1106828_1108322_+	exopolyphosphatase	NA	NA	NA	NA
AZW60101.1\|1108552_1109347_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AZW60102.1\|1109567_1110926_-	phosphoglucosamine mutase	NA	NA	NA	NA
AZW60103.1\|1110922_1111765_-	dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	3.2e-26	32.5
AZW60104.1\|1111783_1113670_-\|protease	ATP-dependent zinc metalloprotease FtsH	M4QMW8	Micromonas_pusilla_virus	1.4e-109	41.5
AZW60105.1\|1113907_1114540_-	ribosomal RNA large subunit methyltransferase E	NA	NA	NA	NA
AZW60106.1\|1114558_1115161_+	hypothetical protein	NA	NA	NA	NA
AZW60107.1\|1115312_1116263_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60108.1\|1117065_1117866_-	hypothetical protein	NA	NA	NA	NA
AZW60109.1\|1117909_1118896_-	homoserine kinase	NA	NA	NA	NA
AZW60110.1\|1119035_1120049_+\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
AZW60111.1\|1120045_1120996_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60112.1\|1121108_1121567_-	CBS domain-containing protein	NA	NA	NA	NA
AZW60113.1\|1121603_1122917_-	hypothetical protein	NA	NA	NA	NA
AZW60114.1\|1122934_1123306_+	DUF2069 domain-containing protein	NA	NA	NA	NA
AZW60115.1\|1123302_1124766_+	YdiU family protein	A0A075BSJ0	Microcystis_phage	1.7e-43	32.5
AZW60116.1\|1124858_1125635_+	DNA-binding response regulator	NA	NA	NA	NA
AZW60117.1\|1125616_1128496_-	diguanylate phosphodiesterase	NA	NA	NA	NA
AZW60118.1\|1129795_1130620_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.0e-08	22.7
AZW60119.1\|1130619_1131498_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW60120.1\|1132402_1133518_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW60121.1\|1133525_1134341_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	7.5e-12	23.7
AZW60122.1\|1134337_1136203_+	long-chain fatty acid--CoA ligase	A0A1V0SBX8	Catovirus	9.3e-50	23.3
AZW60123.1\|1136281_1136914_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW60124.1\|1136910_1137213_-	hypothetical protein	NA	NA	NA	NA
AZW60125.1\|1137255_1138776_-\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	1.2e-82	36.0
AZW60126.1\|1138782_1139538_-	short-chain dehydrogenase	NA	NA	NA	NA
AZW60127.1\|1139567_1140672_-	peptide chain release factor 2	NA	NA	NA	NA
AZW62614.1\|1140774_1142475_-	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	1.3e-50	28.3
AZW60128.1\|1142456_1143434_-	hypothetical protein	NA	NA	NA	NA
AZW60129.1\|1143443_1144724_+	lipoprotein-releasing system transmembrane subunit LolC	NA	NA	NA	NA
AZW60130.1\|1144716_1145412_+	lipoprotein-releasing system ATP-binding protein LolD	G9BWD6	Planktothrix_phage	7.0e-35	38.6
AZW60131.1\|1145445_1146273_+	TatD family deoxyribonuclease	NA	NA	NA	NA
AZW60132.1\|1146554_1149785_+	autotransporter SphB3	NA	NA	NA	NA
AZW60133.1\|1150053_1150230_+	hypothetical protein	NA	NA	NA	NA
AZW60134.1\|1150520_1154447_+	inverse autotransporter beta-barrel domain-containing protein	NA	NA	NA	NA
AZW60135.1\|1156346_1158143_+	hypothetical protein	NA	NA	NA	NA
AZW60136.1\|1158142_1159111_+	alpha/beta hydrolase	NA	NA	NA	NA
AZW60137.1\|1159180_1160026_+	PHP domain-containing protein	NA	NA	NA	NA
AZW60138.1\|1160093_1160648_+	transcription elongation factor GreB	NA	NA	NA	NA
AZW60139.1\|1160694_1161645_-\|transposase	IS481 family transposase IS481v2	NA	NA	NA	NA

DBSCAN-SWA_10

1321070 : 1390605

Planktothrix_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW60268.1\|1321070_1322021_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60269.1\|1322789_1323428_-	glutathione S-transferase	NA	NA	NA	NA
AZW62623.1\|1324317_1324764_+	glutamate racemase	NA	NA	NA	NA
AZW60270.1\|1324845_1325547_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-17	30.4
AZW60271.1\|1325547_1326315_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.2e-14	26.4
AZW60272.1\|1326311_1327550_-	high-affinity branched-chain amino acid ABC transporter permease LivM	NA	NA	NA	NA
AZW60273.1\|1327549_1328476_-	high-affinity branched-chain amino acid ABC transporter permease LivH	NA	NA	NA	NA
AZW60274.1\|1328578_1329694_-	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW60275.1\|1329709_1330660_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60276.1\|1331013_1331595_-	hypothetical protein	A0A2I7SAW6	Vibrio_phage	9.4e-17	37.3
AZW60277.1\|1331591_1332425_-	pyrroline-5-carboxylate reductase	NA	NA	NA	NA
AZW62624.1\|1332635_1333949_+	sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB	NA	NA	NA	NA
AZW60278.1\|1334125_1335007_+	sn-glycerol-3-phosphate ABC transporter permease UgpA	NA	NA	NA	NA
AZW60279.1\|1335026_1335878_+	sn-glycerol-3-phosphate ABC transporter permease UgpE	NA	NA	NA	NA
AZW60280.1\|1335930_1337019_+	sn-glycerol-3-phosphate import ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	2.2e-19	31.2
AZW60281.1\|1337129_1338257_-	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW62625.1\|1338491_1339103_+	alpha/beta hydrolase	NA	NA	NA	NA
AZW60282.1\|1340372_1340750_-	DUF423 domain-containing protein	NA	NA	NA	NA
AZW62626.1\|1340897_1341395_+	hypothetical protein	NA	NA	NA	NA
AZW60283.1\|1341391_1341919_+	RES domain-containing protein	NA	NA	NA	NA
AZW60284.1\|1342052_1342868_+	iron ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW60285.1\|1342880_1344062_-	alpha-hydroxy-acid oxidizing protein	NA	NA	NA	NA
AZW60286.1\|1344109_1345003_-	phosphatidylserine decarboxylase proenzyme	NA	NA	NA	NA
AZW62627.1\|1345129_1345600_-	hypothetical protein	NA	NA	NA	NA
AZW60287.1\|1345725_1346553_-	DUF3298 domain-containing protein	NA	NA	NA	NA
AZW60288.1\|1346581_1347358_-	lipoate--protein ligase family protein	NA	NA	NA	NA
AZW60289.1\|1347354_1347648_-	biotin--protein ligase	NA	NA	NA	NA
AZW60290.1\|1347644_1348109_-	N-acetyltransferase	NA	NA	NA	NA
AZW60291.1\|1348120_1348906_-	thiol:disulfide oxidoreductase	NA	NA	NA	NA
AZW60292.1\|1348931_1349432_-	glutathione peroxidase	Q6VZR0	Canarypox_virus	4.7e-25	38.4
AZW60293.1\|1349514_1350693_-	DUF1501 domain-containing protein	NA	NA	NA	NA
AZW60294.1\|1352320_1352656_+	tetratricopeptide repeat protein	NA	NA	NA	NA
AZW60295.1\|1352843_1354292_+	CoA transferase	NA	NA	NA	NA
AZW62628.1\|1354349_1354694_+	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	3.0e-31	58.4
AZW60296.1\|1354800_1355340_-	peroxiredoxin	NA	NA	NA	NA
AZW60297.1\|1355432_1356383_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60298.1\|1356481_1357432_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60299.1\|1357418_1357901_-	hypothetical protein	NA	NA	NA	NA
AZW60300.1\|1358170_1358602_-	hypothetical protein	NA	NA	NA	NA
AZW60301.1\|1358783_1359188_-	DoxX family protein	NA	NA	NA	NA
AZW60302.1\|1360424_1360748_+	hypothetical protein	NA	NA	NA	NA
AZW60303.1\|1360750_1361638_-	aldo/keto reductase	NA	NA	NA	NA
AZW60304.1\|1361670_1362096_-	universal stress protein	NA	NA	NA	NA
AZW60305.1\|1362167_1362521_-	hypothetical protein	NA	NA	NA	NA
AZW60306.1\|1362760_1363267_-	hypothetical protein	NA	NA	NA	NA
AZW60307.1\|1363305_1364637_-	transcriptional regulator PtsJ	NA	NA	NA	NA
AZW60308.1\|1364696_1365512_+	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
AZW60309.1\|1365508_1366363_+	pyridoxine/pyridoxal/pyridoxamine kinase	NA	NA	NA	NA
AZW62629.1\|1369425_1371969_-	malto-oligosyltrehalose synthase	NA	NA	NA	NA
AZW60310.1\|1373335_1375090_-	malto-oligosyltrehalose trehalohydrolase	NA	NA	NA	NA
AZW60311.1\|1375086_1377207_-	glycogen debranching enzyme GlgX	NA	NA	NA	NA
AZW60312.1\|1377211_1379407_-	1,4-alpha-glucan-branching protein	NA	NA	NA	NA
AZW62630.1\|1379403_1382745_-	maltose alpha-D-glucosyltransferase	NA	NA	NA	NA
AZW60313.1\|1385547_1386498_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60314.1\|1386563_1386743_-	hypothetical protein	NA	NA	NA	NA
AZW62631.1\|1386859_1387582_-	alpha/beta hydrolase	NA	NA	NA	NA
AZW60315.1\|1387601_1388747_-	DUF3182 domain-containing protein	NA	NA	NA	NA
AZW60316.1\|1389654_1390605_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_11

1451095 : 1506583

Mollivirus(16.67%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW60364.1\|1451095_1452046_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60365.1\|1453247_1453694_-	flagellar export protein FliJ	NA	NA	NA	NA
AZW60366.1\|1453686_1455162_-	flagellar protein export ATPase FliI	NA	NA	NA	NA
AZW60367.1\|1455158_1455914_-	flagellar assembly protein FliH	NA	NA	NA	NA
AZW60368.1\|1455906_1456917_-	flagellar motor switch protein FliG	NA	NA	NA	NA
AZW60369.1\|1456906_1458583_-	flagellar basal body M-ring protein FliF	NA	NA	NA	NA
AZW60370.1\|1458895_1459228_+	flagellar hook-basal body complex protein FliE	NA	NA	NA	NA
AZW60371.1\|1459241_1459637_-	hypothetical protein	NA	NA	NA	NA
AZW60372.1\|1459646_1459973_-	flagellar biosynthesis protein FlhB	NA	NA	NA	NA
AZW60373.1\|1459969_1460296_-	flagellar hook-length control protein FliK	NA	NA	NA	NA
AZW60374.1\|1460222_1461245_-	flagellar hook-length control protein FliK	NA	NA	NA	NA
AZW60375.1\|1461241_1461622_-	flagellar protein FliT	NA	NA	NA	NA
AZW60376.1\|1461639_1462068_-	flagellar export chaperone FliS	NA	NA	NA	NA
AZW60377.1\|1462075_1463449_-	flagellar hook protein FliD	NA	NA	NA	NA
AZW62634.1\|1463589_1463967_-	flagellar protein	NA	NA	NA	NA
AZW60378.1\|1464229_1465537_+	bifunctional tetrahydrofolate synthase/dihydrofolate synthase	NA	NA	NA	NA
AZW60379.1\|1465597_1466428_+	SPOR domain-containing protein	NA	NA	NA	NA
AZW60380.1\|1466424_1466913_+	colicin V synthesis protein	NA	NA	NA	NA
AZW60381.1\|1466954_1468475_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	4.8e-97	43.7
AZW62635.1\|1468518_1468995_-	disulfide bond formation protein B	NA	NA	NA	NA
AZW60382.1\|1469798_1472396_-	bifunctional uridylyltransferase/uridylyl-removing protein	NA	NA	NA	NA
AZW60383.1\|1472425_1473247_-	type I methionyl aminopeptidase	NA	NA	NA	NA
AZW60384.1\|1473973_1474723_+	30S ribosomal protein S2	NA	NA	NA	NA
AZW60385.1\|1474855_1475785_+	elongation factor Ts	NA	NA	NA	NA
AZW60386.1\|1475882_1476599_+	UMP kinase	NA	NA	NA	NA
AZW60387.1\|1476613_1477174_+	ribosome-recycling factor	NA	NA	NA	NA
AZW60388.1\|1477211_1478105_+	di-trans,poly-cis-decaprenylcistransferase	R9W0U9	Flavobacterium_phage	2.0e-18	36.1
AZW60389.1\|1478124_1478982_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
AZW60390.1\|1478978_1480178_+	1-deoxy-D-xylulose-5-phosphate reductoisomerase	NA	NA	NA	NA
AZW60391.1\|1480217_1481552_+\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
AZW60392.1\|1481604_1483941_+	outer membrane protein assembly factor BamA	NA	NA	NA	NA
AZW62636.1\|1484066_1484630_+	outer membrane protein chaperone	NA	NA	NA	NA
AZW60393.1\|1484638_1485730_+	UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase	NA	NA	NA	NA
AZW60394.1\|1485801_1486257_+	beta-hydroxyacyl-ACP dehydratase	NA	NA	NA	NA
AZW60395.1\|1486257_1487052_+	acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase	NA	NA	NA	NA
AZW60396.1\|1487048_1488230_+	lipid-A-disaccharide synthase	NA	NA	NA	NA
AZW60397.1\|1488216_1488822_+	ribonuclease HII	G9E3X7	Emiliania_huxleyi_virus	8.8e-26	40.2
AZW60398.1\|1488818_1489592_+	RNA methyltransferase	NA	NA	NA	NA
AZW60399.1\|1489603_1490431_-	phosphoenolpyruvate synthase regulatory protein	NA	NA	NA	NA
AZW60400.1\|1490592_1492956_+	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	2.2e-165	35.9
AZW60401.1\|1493023_1493743_-	GMP synthase	NA	NA	NA	NA
AZW60402.1\|1493866_1494292_+	NfeD-like family protein 1	NA	NA	NA	NA
AZW60403.1\|1494326_1495277_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60404.1\|1495394_1496321_+	paraslipin	NA	NA	NA	NA
AZW60405.1\|1496386_1497544_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.3e-14	36.2
AZW60406.1\|1497524_1497992_-	SsrA-binding protein	W5RAM5	Staphylococcus_phage	6.2e-27	45.1
AZW60407.1\|1498139_1499090_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60408.1\|1499106_1499541_+	ubiquinone-binding protein	NA	NA	NA	NA
AZW60409.1\|1499530_1499881_+	RnfH family protein	NA	NA	NA	NA
AZW60410.1\|1500077_1501232_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW60411.1\|1501228_1502401_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
AZW60412.1\|1502448_1503342_+	3-hydroxyisobutyrate dehydrogenase	NA	NA	NA	NA
AZW60413.1\|1503387_1503825_+	PaaI family thioesterase	NA	NA	NA	NA
AZW60414.1\|1503884_1504574_+	VIT family protein	NA	NA	NA	NA
AZW60415.1\|1504583_1505534_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60416.1\|1505632_1506583_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_12

1686898 : 1761086

Bacillus_phage(10.0%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW60567.1\|1686898_1687849_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60568.1\|1688131_1688857_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
AZW62641.1\|1688864_1689986_+	transferase	NA	NA	NA	NA
AZW60569.1\|1690110_1690383_-	YkgJ family cysteine cluster protein	NA	NA	NA	NA
AZW60570.1\|1690387_1691152_-	YdcF family protein	NA	NA	NA	NA
AZW60571.1\|1691164_1692130_-	heptosyltransferase II	NA	NA	NA	NA
AZW60572.1\|1692241_1694017_+	lipid A export permease/ATP-binding protein MsbA	W8CYL7	Bacillus_phage	4.0e-50	29.5
AZW60573.1\|1693989_1695489_-	MFS transporter	NA	NA	NA	NA
AZW60574.1\|1695572_1696118_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW60575.1\|1696114_1697017_+	prephenate dehydratase	NA	NA	NA	NA
AZW60576.1\|1697050_1698514_-	ribonuclease G	NA	NA	NA	NA
AZW60577.1\|1698557_1699508_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60578.1\|1699494_1699710_-	hypothetical protein	NA	NA	NA	NA
AZW60579.1\|1705986_1708734_+	autotransporter Vag8	NA	NA	NA	NA
AZW60580.1\|1708754_1709378_-	septum formation inhibitor Maf	NA	NA	NA	NA
AZW60581.1\|1709389_1709860_-	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
AZW60582.1\|1709871_1710258_-	ribosome silencing factor	NA	NA	NA	NA
AZW60583.1\|1710319_1710913_-	nicotinate-nicotinamide nucleotide adenylyltransferase	NA	NA	NA	NA
AZW60584.1\|1710903_1711815_-	coproporphyrinogen III oxidase	NA	NA	NA	NA
AZW60585.1\|1711830_1713204_-	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
AZW60586.1\|1713238_1713970_-	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
AZW60587.1\|1714046_1715645_+	DUF853 domain-containing protein	A0A248XCZ8	Klebsiella_phage	1.8e-78	44.9
AZW60588.1\|1715705_1717061_+	sodium:alanine symporter family protein	NA	NA	NA	NA
AZW60589.1\|1717095_1718421_-	aspartate aminotransferase family protein	A0A1C9EHH3	Mycobacterium_phage	1.8e-07	22.5
AZW60590.1\|1718602_1719535_+	glyoxylate/hydroxypyruvate reductase A	NA	NA	NA	NA
AZW60591.1\|1719545_1721039_-	aldehyde dehydrogenase	NA	NA	NA	NA
AZW60592.1\|1721035_1721959_-	EamA/RhaT family transporter	NA	NA	NA	NA
AZW60593.1\|1721961_1723224_-	Zn-dependent hydrolase	NA	NA	NA	NA
AZW62642.1\|1723243_1724257_-	histone deacetylase family protein	A0A2K9L4C2	Tupanvirus	1.7e-42	35.2
AZW60594.1\|1724329_1724653_-	cupin domain-containing protein	NA	NA	NA	NA
AZW60595.1\|1724649_1725924_-	4-aminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	1.6e-24	27.9
AZW60596.1\|1726066_1727017_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60597.1\|1727013_1728651_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.6e-21	30.6
AZW60598.1\|1728655_1729495_-	ABC transporter permease	NA	NA	NA	NA
AZW60599.1\|1729491_1730508_-	ABC transporter permease	NA	NA	NA	NA
AZW60600.1\|1730615_1732190_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW60601.1\|1732609_1734154_+	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	3.1e-14	25.4
AZW60602.1\|1734258_1735326_+	tartrate dehydrogenase	NA	NA	NA	NA
AZW60603.1\|1735344_1736931_-	multidrug resistance protein	NA	NA	NA	NA
AZW60604.1\|1736927_1738142_-	EmrA/EmrK family multidrug efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
AZW60605.1\|1739690_1740179_-	MarR family transcriptional regulator	NA	NA	NA	NA
AZW60606.1\|1740238_1741096_-	EamA/RhaT family transporter	NA	NA	NA	NA
AZW60607.1\|1741158_1742109_+	EamA/RhaT family transporter	NA	NA	NA	NA
AZW60608.1\|1742171_1743161_+	quinone oxidoreductase	NA	NA	NA	NA
AZW60609.1\|1743235_1744117_-\|protease	protease HtpX	NA	NA	NA	NA
AZW60610.1\|1745174_1746026_+	sulfurtransferase	NA	NA	NA	NA
AZW60611.1\|1746042_1746612_-	phosphohydrolase	NA	NA	NA	NA
AZW60612.1\|1746642_1747506_-	transcriptional regulator	NA	NA	NA	NA
AZW60613.1\|1747665_1748742_+	putative 2-aminoethylphosphonate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-28	35.8
AZW62643.1\|1748806_1750504_+	putative 2-aminoethylphosphonate ABC transporter permease subunit	NA	NA	NA	NA
AZW60614.1\|1750520_1751351_+	phosphonoacetaldehyde hydrolase	NA	NA	NA	NA
AZW60615.1\|1751379_1752402_+	putative 2-aminoethylphosphonate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW60616.1\|1752931_1753882_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60617.1\|1753878_1755201_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW60618.1\|1755301_1755619_-	hypothetical protein	NA	NA	NA	NA
AZW60619.1\|1755752_1757066_+	pyrimidine utilization transport protein G	Q9KX94	Enterobacteria_phage	2.1e-149	67.1
AZW60620.1\|1757096_1758734_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	8.8e-12	30.2
AZW60621.1\|1759357_1759834_+	transcription elongation factor GreA	NA	NA	NA	NA
AZW60622.1\|1760135_1761086_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_13

1800199 : 1848214

Moraxella_phage(16.67%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW60660.1\|1800199_1801150_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60661.1\|1801248_1803849_-	DUF3394 domain-containing protein	NA	NA	NA	NA
AZW60662.1\|1803955_1804960_-	C4-dicarboxylate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW60663.1\|1805068_1806409_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	8.8e-18	22.8
AZW60664.1\|1806449_1807478_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
AZW60665.1\|1807673_1808219_+	MarR family transcriptional regulator	NA	NA	NA	NA
AZW60666.1\|1808215_1808776_+	diaminobutyrate acetyltransferase	NA	NA	NA	NA
AZW60667.1\|1808874_1809825_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60668.1\|1809862_1810450_+	DUF1949 domain-containing protein	A0A1X9I5T8	Streptococcus_phage	4.7e-16	35.8
AZW60669.1\|1810467_1810851_-	thioredoxin	V9SJ74	Achromobacter_phage	8.1e-09	25.8
AZW60670.1\|1812210_1813503_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	1.7e-66	36.0
AZW60671.1\|1813637_1814678_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	6.1e-91	51.3
AZW60672.1\|1814775_1815792_-\|transposase	IS110 family transposase IS1663	NA	NA	NA	NA
AZW60673.1\|1816059_1816707_-	glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
AZW60674.1\|1816832_1817591_+	5'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.4e-68	51.2
AZW62648.1\|1817665_1818355_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	4.2e-32	46.9
AZW60675.1\|1818372_1819257_+	peptidase	A0A292GJG6	Xanthomonas_phage	4.6e-15	49.5
AZW60676.1\|1819253_1820033_+	3'-5' exonuclease	NA	NA	NA	NA
AZW60677.1\|1820059_1820737_+	hypothetical protein	NA	NA	NA	NA
AZW62649.1\|1821025_1821778_+	hypothetical protein	NA	NA	NA	NA
AZW60678.1\|1821896_1823297_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	7.3e-31	26.5
AZW60679.1\|1823320_1823719_-	Cu(I)-responsive transcriptional regulator	NA	NA	NA	NA
AZW60680.1\|1823894_1824095_+	copper chaperone	NA	NA	NA	NA
AZW60681.1\|1824233_1824962_+	glutaredoxin	A0A1D8KSL1	Synechococcus_phage	9.6e-43	56.8
AZW60682.1\|1825095_1826511_+	dihydrolipoyl dehydrogenase	NA	NA	NA	NA
AZW60683.1\|1826514_1827378_-	23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ	NA	NA	NA	NA
AZW60684.1\|1827390_1828140_-	glycerophosphodiester phosphodiesterase	A0A2H4PGQ5	Escherichia_phage	1.5e-14	27.8
AZW60685.1\|1828322_1830338_+	peptidylprolyl isomerase	NA	NA	NA	NA
AZW62650.1\|1830319_1830868_-	arylesterase	NA	NA	NA	NA
AZW60686.1\|1830944_1831664_+	ABC transporter	G9BWD6	Planktothrix_phage	1.4e-22	36.6
AZW60687.1\|1831762_1832713_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60688.1\|1832811_1833762_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60689.1\|1833910_1834249_-	phospholipid-binding protein	NA	NA	NA	NA
AZW60690.1\|1834306_1834468_-	DUF1328 domain-containing protein	NA	NA	NA	NA
AZW60691.1\|1834499_1834700_-	CsbD family protein	NA	NA	NA	NA
AZW60692.1\|1834965_1837539_-	cyanophycin synthetase	NA	NA	NA	NA
AZW60693.1\|1837609_1840183_-	cyanophycin synthetase	NA	NA	NA	NA
AZW60694.1\|1842709_1843198_+	DUF1854 domain-containing protein	NA	NA	NA	NA
AZW60695.1\|1843289_1844441_-	N-acetyltransferase	NA	NA	NA	NA
AZW60696.1\|1844494_1845316_+	DUF455 domain-containing protein	NA	NA	NA	NA
AZW60697.1\|1845354_1846584_+	lytic murein transglycosylase	NA	NA	NA	NA
AZW60698.1\|1846712_1847153_+	DUF937 domain-containing protein	NA	NA	NA	NA
AZW60699.1\|1847097_1847277_+	hypothetical protein	NA	NA	NA	NA
AZW60700.1\|1847263_1848214_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_14

1851607 : 1912812

Lake_Baikal_phage(21.43%)

transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW60705.1\|1851607_1854469_-\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	1.0e-71	25.5
AZW60706.1\|1854458_1855424_-	bifunctional riboflavin kinase/FAD synthetase	NA	NA	NA	NA
AZW60707.1\|1855483_1857478_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	4.4e-21	33.3
AZW60708.1\|1857576_1858527_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60709.1\|1858523_1858898_-	hypothetical protein	NA	NA	NA	NA
AZW60710.1\|1859159_1860368_+	acyl-CoA desaturase	NA	NA	NA	NA
AZW60711.1\|1860364_1862665_+	DNA helicase II	A7KV33	Bacillus_phage	9.9e-110	35.9
AZW60712.1\|1862717_1865330_-	TonB-dependent receptor	NA	NA	NA	NA
AZW60713.1\|1865689_1867615_-	ABC transporter ATP-binding protein	A0A2K9L0W2	Tupanvirus	1.1e-66	31.8
AZW60714.1\|1867611_1868508_-	50S ribosomal protein L3 N(5)-glutamine methyltransferase	NA	NA	NA	NA
AZW60715.1\|1868514_1869654_-	succinyl-diaminopimelate desuccinylase	NA	NA	NA	NA
AZW60716.1\|1869653_1870475_-	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	NA	NA	NA	NA
AZW60717.1\|1872045_1872375_-	DUF4148 domain-containing protein	NA	NA	NA	NA
AZW60718.1\|1872757_1874014_+	autotransporter Phg	NA	NA	NA	NA
AZW60719.1\|1874088_1874370_+	hypothetical protein	NA	NA	NA	NA
AZW60720.1\|1874411_1874732_+	hypothetical protein	NA	NA	NA	NA
AZW60721.1\|1875038_1875242_+	cold-shock protein CspA	A0A2H4N7Y6	Lake_Baikal_phage	1.6e-16	62.1
AZW60722.1\|1875325_1875892_+	DUF924 domain-containing protein	NA	NA	NA	NA
AZW60723.1\|1876237_1876438_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	7.4e-14	64.4
AZW60724.1\|1876549_1877128_-	TIGR00645 family protein	K4K6D8	Caulobacter_phage	1.0e-23	33.7
AZW60725.1\|1877306_1878617_+	trigger factor	NA	NA	NA	NA
AZW60726.1\|1878619_1879273_+\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	6.8e-56	57.5
AZW60727.1\|1879377_1880682_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	3.2e-129	53.8
AZW60728.1\|1880870_1883324_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	1.5e-220	52.0
AZW60729.1\|1883447_1884398_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW60730.1\|1884625_1885849_+	CoA transferase	NA	NA	NA	NA
AZW60731.1\|1885914_1886886_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW60732.1\|1886898_1887354_+	MaoC family dehydratase	NA	NA	NA	NA
AZW60733.1\|1887367_1888171_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
AZW60734.1\|1888167_1888599_+	hypothetical protein	NA	NA	NA	NA
AZW60735.1\|1888595_1889753_+	thiolase	NA	NA	NA	NA
AZW60736.1\|1889774_1890551_+	3-oxoacyl-ACP reductase	NA	NA	NA	NA
AZW60737.1\|1892715_1893432_+	3-oxoadipate CoA-transferase	NA	NA	NA	NA
AZW60738.1\|1893424_1894066_+	CoA transferase subunit B	NA	NA	NA	NA
AZW60739.1\|1894100_1894832_+	hypothetical protein	NA	NA	NA	NA
AZW60740.1\|1894849_1895062_+	hypothetical protein	NA	NA	NA	NA
AZW60741.1\|1895632_1896583_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60742.1\|1898140_1898869_-	transcriptional repressor LexA	A0A2H4JG58	uncultured_Caudovirales_phage	2.8e-10	50.7
AZW60743.1\|1898919_1900122_-	aspartate/tyrosine/aromatic aminotransferase	NA	NA	NA	NA
AZW60744.1\|1900199_1902236_+	UvrABC system protein B	NA	NA	NA	NA
AZW60745.1\|1902488_1902980_+	low molecular weight phosphotyrosine protein phosphatase	NA	NA	NA	NA
AZW60746.1\|1903195_1903708_+	Fe-S cluster assembly transcriptional regulator IscR	NA	NA	NA	NA
AZW60747.1\|1903725_1904937_+	IscS subfamily cysteine desulfurase	NA	NA	NA	NA
AZW60748.1\|1904974_1905385_+	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	7.5e-53	79.0
AZW60749.1\|1905386_1905710_+	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	6.8e-25	52.8
AZW60750.1\|1905712_1906225_+	co-chaperone protein HscB	NA	NA	NA	NA
AZW60751.1\|1906354_1908217_+	chaperone protein HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	3.0e-101	42.4
AZW60752.1\|1908226_1908568_+	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
AZW60753.1\|1908567_1908762_+	Fe-S assembly protein IscX	NA	NA	NA	NA
AZW60754.1\|1908886_1909780_+	methylglyoxal synthase	NA	NA	NA	NA
AZW60755.1\|1909776_1910727_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60756.1\|1910851_1911661_-	enoyl-CoA hydratase	NA	NA	NA	NA
AZW60757.1\|1911861_1912812_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_15

1940595 : 1992392

Klosneuvirus(22.22%)

transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW60777.1\|1940595_1943220_+\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.7e-81	39.4
AZW60778.1\|1943206_1943461_+	sulfurtransferase TusA family protein	NA	NA	NA	NA
AZW60779.1\|1943527_1944109_-	hypothetical protein	NA	NA	NA	NA
AZW60780.1\|1944412_1944673_+	30S ribosomal protein S16	NA	NA	NA	NA
AZW60781.1\|1944838_1945462_+	ribosome maturation factor RimM	NA	NA	NA	NA
AZW60782.1\|1945461_1946235_+\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
AZW60783.1\|1946231_1947440_-	aminotransferase class V-fold PLP-dependent enzyme	NA	NA	NA	NA
AZW60784.1\|1947465_1947939_-	RidA family protein	NA	NA	NA	NA
AZW60785.1\|1948012_1948963_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60786.1\|1949061_1950012_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60787.1\|1950110_1951460_-	two-component sensor histidine kinase	NA	NA	NA	NA
AZW60788.1\|1952225_1952981_+	MipA/OmpV family protein	NA	NA	NA	NA
AZW60789.1\|1953073_1955956_-\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	3.7e-138	37.1
AZW60790.1\|1956278_1956704_+	nucleoside-diphosphate kinase	D2E8E1	Anguillid_herpesvirus	2.1e-21	43.2
AZW60791.1\|1956731_1957880_+	23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN	NA	NA	NA	NA
AZW60792.1\|1957876_1958383_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AZW60793.1\|1958389_1959685_+	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin)	NA	NA	NA	NA
AZW60794.1\|1959725_1961030_+\|tRNA	histidine--tRNA ligase	NA	NA	NA	NA
AZW60795.1\|1961031_1961670_+	hypothetical protein	NA	NA	NA	NA
AZW60796.1\|1961672_1962833_+	outer membrane protein assembly factor BamB	NA	NA	NA	NA
AZW60797.1\|1962859_1964215_+	ribosome biogenesis GTPase Der	NA	NA	NA	NA
AZW60798.1\|1964218_1965289_+	histidinol-phosphate aminotransferase 1	A0A1X6WGT4	Pacmanvirus	2.5e-15	25.7
AZW60799.1\|1965427_1965664_+	RNA-binding protein Hfq	NA	NA	NA	NA
AZW60800.1\|1965751_1966858_+	GTPase HflX	NA	NA	NA	NA
AZW60801.1\|1966823_1968128_+\|protease	FtsH protease activity modulator HflK	NA	NA	NA	NA
AZW60802.1\|1968146_1969046_+\|protease	protease modulator HflC	NA	NA	NA	NA
AZW60803.1\|1969229_1970387_+	ATP phosphoribosyltransferase regulatory subunit	NA	NA	NA	NA
AZW60804.1\|1970451_1971759_+	adenylosuccinate synthetase	A0A160ER07	Powai_lake_megavirus	3.0e-63	33.5
AZW60805.1\|1971872_1972412_+	phosphoribosyltransferase	NA	NA	NA	NA
AZW60806.1\|1972689_1972902_+	30S ribosomal protein S21	NA	NA	NA	NA
AZW60807.1\|1972921_1974952_+	DNA primase	A0A0K1LMQ9	Caulobacter_phage	1.0e-65	41.9
AZW62652.1\|1975751_1977920_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	3.1e-36	30.1
AZW60808.1\|1978329_1978629_-	hypothetical protein	NA	NA	NA	NA
AZW60809.1\|1978913_1979327_+	transcriptional regulator	A0A222YXG1	Escherichia_phage	3.8e-36	59.0
AZW60810.1\|1979286_1980237_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60811.1\|1980223_1980424_-	hypothetical protein	NA	NA	NA	NA
AZW60812.1\|1980436_1981522_+	AI-2E family transporter	NA	NA	NA	NA
AZW60813.1\|1981537_1982299_-	ABC transporter permease	NA	NA	NA	NA
AZW60814.1\|1982295_1983219_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.6e-23	33.6
AZW60815.1\|1983317_1983842_-	N-acetyltransferase	NA	NA	NA	NA
AZW60816.1\|1983850_1984594_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
AZW60817.1\|1984689_1984929_-	hypothetical protein	NA	NA	NA	NA
AZW60818.1\|1984942_1985095_-	lipoprotein	NA	NA	NA	NA
AZW60819.1\|1985180_1986671_-	cytochrome c oxidase accessory protein CcoG	NA	NA	NA	NA
AZW60820.1\|1986762_1987701_-	cytochrome-c oxidase, cbb3-type subunit III	NA	NA	NA	NA
AZW60821.1\|1987697_1987874_-	CcoQ/FixQ family Cbb3-type cytochrome c oxidase assembly chaperone	NA	NA	NA	NA
AZW60822.1\|1987876_1988539_-	cytochrome-c oxidase, cbb3-type subunit II	NA	NA	NA	NA
AZW62653.1\|1990160_1990304_-	cbb3-type cytochrome oxidase assembly protein CcoS	NA	NA	NA	NA
AZW60823.1\|1990300_1991275_-	hypothetical protein	NA	NA	NA	NA
AZW60824.1\|1991441_1992392_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_16

1998362 : 2054456

uncultured_Caudovirales_phage(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW60830.1\|1998362_1999313_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60831.1\|2000358_2002224_-	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
AZW62654.1\|2002481_2004002_+	aldehyde dehydrogenase	NA	NA	NA	NA
AZW60832.1\|2004089_2004740_-	flavodoxin family protein	NA	NA	NA	NA
AZW60833.1\|2005688_2006984_+	DUF445 domain-containing protein	NA	NA	NA	NA
AZW60834.1\|2007005_2007890_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW62655.1\|2007988_2008864_+	PhzF family phenazine biosynthesis protein	NA	NA	NA	NA
AZW60835.1\|2008853_2009210_-	DUF1428 domain-containing protein	NA	NA	NA	NA
AZW60836.1\|2009283_2010315_+	AraC family transcriptional regulator	NA	NA	NA	NA
AZW60837.1\|2010444_2010624_-	DUF3008 domain-containing protein	NA	NA	NA	NA
AZW60838.1\|2010721_2011246_+	DUF302 domain-containing protein	NA	NA	NA	NA
AZW60839.1\|2011256_2012093_-	alpha/beta hydrolase	NA	NA	NA	NA
AZW60840.1\|2012205_2012577_+	transcriptional regulator	NA	NA	NA	NA
AZW60841.1\|2012573_2013125_+	ATPase	NA	NA	NA	NA
AZW60842.1\|2013140_2014832_-	sodium-independent anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	5.0e-42	27.3
AZW60843.1\|2014880_2015561_-	GntR family transcriptional regulator	NA	NA	NA	NA
AZW60844.1\|2015808_2016273_-	hypothetical protein	NA	NA	NA	NA
AZW60845.1\|2016442_2017372_+	ZIP family metal transporter	NA	NA	NA	NA
AZW60846.1\|2017384_2018032_-	hypothetical protein	NA	NA	NA	NA
AZW60847.1\|2018105_2019923_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.3e-37	27.4
AZW60848.1\|2020006_2020957_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60849.1\|2021609_2022560_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60850.1\|2022578_2022926_-	GFA family protein	NA	NA	NA	NA
AZW60851.1\|2022954_2024394_-	MFS transporter	A0A0M3UL24	Mycobacterium_phage	7.4e-55	37.4
AZW60852.1\|2024412_2024808_-	VOC family protein	NA	NA	NA	NA
AZW60853.1\|2024982_2025591_+	peptidase S16	NA	NA	NA	NA
AZW60854.1\|2025603_2026422_+	hypothetical protein	A0A1B1INV8	uncultured_Mediterranean_phage	2.3e-16	28.8
AZW60855.1\|2026373_2027348_-	AraC family transcriptional regulator	NA	NA	NA	NA
AZW60856.1\|2027376_2028438_-	hypothetical protein	NA	NA	NA	NA
AZW60857.1\|2028434_2030651_-	xanthine dehydrogenase family protein molybdopterin-binding subunit	NA	NA	NA	NA
AZW60858.1\|2030664_2031123_-	(2Fe-2S)-binding protein	NA	NA	NA	NA
AZW60859.1\|2031280_2031625_-	hypothetical protein	NA	NA	NA	NA
AZW60860.1\|2031781_2032687_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW62656.1\|2032773_2033787_+	flavin-nucleotide-binding protein	NA	NA	NA	NA
AZW60861.1\|2035766_2036783_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW60862.1\|2036925_2038278_-	glutathione-disulfide reductase	A0A2K5B2C5	Erysipelothrix_phage	2.9e-45	27.6
AZW60863.1\|2038452_2038749_+	hypothetical protein	NA	NA	NA	NA
AZW60864.1\|2039886_2040837_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60865.1\|2041322_2041499_-	hypothetical protein	NA	NA	NA	NA
AZW60866.1\|2041470_2042109_+	hypothetical protein	NA	NA	NA	NA
AZW60867.1\|2042183_2043155_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW60868.1\|2043158_2044013_+	polysaccharide deacetylase	NA	NA	NA	NA
AZW60869.1\|2044031_2044853_+	alpha/beta hydrolase	NA	NA	NA	NA
AZW60870.1\|2044884_2045679_+	amidase	NA	NA	NA	NA
AZW60871.1\|2045727_2046333_+	hypothetical protein	NA	NA	NA	NA
AZW62657.1\|2046329_2047124_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AZW60872.1\|2047409_2048915_-	microcystin degradation protein MlrC	NA	NA	NA	NA
AZW60873.1\|2048956_2049739_-	exodeoxyribonuclease III	NA	NA	NA	NA
AZW60874.1\|2049808_2050255_-	hypothetical protein	NA	NA	NA	NA
AZW60875.1\|2050251_2051478_-	NnrS family protein	NA	NA	NA	NA
AZW60876.1\|2051470_2051875_-	preprotein translocase subunit TatC	NA	NA	NA	NA
AZW60877.1\|2052034_2052337_+	SelT/selW/selH domain protein	NA	NA	NA	NA
AZW60878.1\|2052333_2053284_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW60879.1\|2053270_2053462_-	hypothetical protein	NA	NA	NA	NA
AZW60880.1\|2053505_2054456_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_17

2344468 : 2407009

Pandoravirus(20.0%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW61094.1\|2344468_2344975_-\|tRNA	tRNA adenosine(34) deaminase TadA	S4VYT2	Pandoravirus	3.4e-07	38.4
AZW61095.1\|2344967_2345816_-	hydrolase	NA	NA	NA	NA
AZW61096.1\|2345913_2346456_-	hypothetical protein	NA	NA	NA	NA
AZW61097.1\|2346499_2347450_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61098.1\|2347605_2347932_-	cation:proton antiporter	NA	NA	NA	NA
AZW61099.1\|2347928_2348213_-	K+/H+ antiporter subunit F	NA	NA	NA	NA
AZW61100.1\|2348209_2348689_-	Na+/H+ antiporter subunit E	NA	NA	NA	NA
AZW61101.1\|2348685_2350314_-	monovalent cation/H+ antiporter subunit D	NA	NA	NA	NA
AZW61102.1\|2350310_2350655_-	Na+/H+ antiporter subunit C	NA	NA	NA	NA
AZW61103.1\|2350654_2353588_-	monovalent cation/H+ antiporter subunit A	NA	NA	NA	NA
AZW61104.1\|2354746_2355697_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61105.1\|2355795_2356092_-	hypothetical protein	NA	NA	NA	NA
AZW61106.1\|2356198_2357116_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW61107.1\|2357120_2357834_-	NAD-dependent oxidoreductase	NA	NA	NA	NA
AZW61108.1\|2357847_2358819_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW61109.1\|2360538_2360919_+	ArsR family transcriptional regulator	NA	NA	NA	NA
AZW61110.1\|2360922_2362110_+	MFS transporter	NA	NA	NA	NA
AZW62668.1\|2362548_2363271_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	1.3e-87	68.2
AZW61111.1\|2363564_2364515_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61112.1\|2364511_2364940_-	hypothetical protein	NA	NA	NA	NA
AZW62669.1\|2366341_2367304_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW61113.1\|2367419_2368373_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW61114.1\|2368382_2369375_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW61115.1\|2369426_2370182_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AZW61116.1\|2370246_2370936_-	short-chain dehydrogenase	NA	NA	NA	NA
AZW61117.1\|2371157_2372108_+	hydrolase	NA	NA	NA	NA
AZW61118.1\|2372138_2373335_+	alpha-hydroxy-acid oxidizing protein	NA	NA	NA	NA
AZW62670.1\|2373331_2374105_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AZW62671.1\|2374172_2375144_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW61119.1\|2375229_2376174_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW61120.1\|2376151_2377021_-	TauD/TfdA family dioxygenase	NA	NA	NA	NA
AZW62672.1\|2377264_2377888_+	glutathione S-transferase	NA	NA	NA	NA
AZW61121.1\|2378202_2378502_+	transcriptional regulator	NA	NA	NA	NA
AZW61122.1\|2378515_2381590_-	autotransporter SphB2	NA	NA	NA	NA
AZW61123.1\|2381719_2382394_+	DNA-binding response regulator	NA	NA	NA	NA
AZW61124.1\|2382386_2384201_+	histidine kinase	NA	NA	NA	NA
AZW61125.1\|2384254_2385202_-	hypothetical protein	NA	NA	NA	NA
AZW61126.1\|2385306_2386257_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61127.1\|2386809_2388435_-	arylsulfatase	A0A2P0VMN7	Tetraselmis_virus	2.0e-149	52.2
AZW62673.1\|2388484_2389519_-	haloacid dehalogenase-like hydrolase	NA	NA	NA	NA
AZW61128.1\|2389521_2390868_-	hypothetical protein	NA	NA	NA	NA
AZW62674.1\|2390864_2392379_-	hypothetical protein	NA	NA	NA	NA
AZW61129.1\|2392369_2393380_-	hypothetical protein	NA	NA	NA	NA
AZW61130.1\|2393853_2394795_-	DUF58 domain-containing protein	NA	NA	NA	NA
AZW61131.1\|2394803_2395772_-	AAA family ATPase	NA	NA	NA	NA
AZW61132.1\|2397311_2398280_+	transporter	NA	NA	NA	NA
AZW61133.1\|2398457_2399447_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW61134.1\|2399493_2400252_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AZW61135.1\|2400441_2401179_+	hypothetical protein	A0A0S4KZH7	Pseudomonas_phage	4.1e-41	46.6
AZW61136.1\|2401277_2402228_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61137.1\|2402412_2403195_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.0e-09	25.8
AZW61138.1\|2403188_2403890_+	ABC transporter ATP-binding protein	NA	NA	NA	NA
AZW61139.1\|2404129_2404732_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW61140.1\|2406058_2407009_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_18

2446286 : 2565079

113

Planktothrix_phage(13.04%)

transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW61167.1\|2446286_2447237_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61168.1\|2447256_2448162_-	pirin family protein	NA	NA	NA	NA
AZW61169.1\|2448239_2448938_-	pirin family protein	NA	NA	NA	NA
AZW61170.1\|2449097_2450042_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW61171.1\|2450051_2451542_-	nitrogen regulation protein NR(I)	NA	NA	NA	NA
AZW61172.1\|2451538_2452606_-	PAS domain-containing sensor histidine kinase	Q8QKV7	Ectocarpus_siliculosus_virus	1.1e-05	23.5
AZW61173.1\|2452669_2454082_-	type I glutamate--ammonia ligase	NA	NA	NA	NA
AZW61174.1\|2454267_2455488_-	oxygen-independent coproporphyrinogen III oxidase-like protein	NA	NA	NA	NA
AZW61175.1\|2455509_2456460_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61176.1\|2456558_2457209_-	non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family	NA	NA	NA	NA
AZW61177.1\|2457326_2459129_+	GGDEF domain-containing protein	NA	NA	NA	NA
AZW61178.1\|2459006_2460746_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.0e-10	27.1
AZW61179.1\|2460780_2461686_-	transcriptional regulator	NA	NA	NA	NA
AZW61180.1\|2461867_2463244_+	MmgE/PrpD family protein	NA	NA	NA	NA
AZW61181.1\|2463410_2464151_-	ribonuclease PH	NA	NA	NA	NA
AZW61182.1\|2464287_2465214_+	YicC family protein	NA	NA	NA	NA
AZW61183.1\|2465486_2465642_+	hypothetical protein	NA	NA	NA	NA
AZW61184.1\|2465654_2465783_+	hypothetical protein	NA	NA	NA	NA
AZW61185.1\|2465779_2466064_+	transcriptional regulator	NA	NA	NA	NA
AZW61186.1\|2466122_2467613_-	AMP nucleosidase	NA	NA	NA	NA
AZW61187.1\|2467857_2468457_+	NlpC/P60 family protein	A0A0A8WF62	Clostridium_phage	1.4e-20	41.6
AZW61188.1\|2468461_2469232_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AZW61189.1\|2469469_2470183_+	cytochrome C	NA	NA	NA	NA
AZW61190.1\|2470179_2471097_+	cytochrome C	NA	NA	NA	NA
AZW61191.1\|2471217_2471865_+	guanylate kinase	A0A218KC48	Bacillus_phage	3.1e-13	33.9
AZW61192.1\|2471906_2472110_+	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
AZW61193.1\|2472134_2474414_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A1B1IUF0	uncultured_Mediterranean_phage	5.9e-06	32.1
AZW61194.1\|2474426_2475155_-	glutamine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.3e-35	39.3
AZW61195.1\|2475151_2475811_-	glutamine ABC transporter permease GlnP	NA	NA	NA	NA
AZW61196.1\|2475879_2476632_-	glutamine ABC transporter substrate-binding protein GlnH	NA	NA	NA	NA
AZW61197.1\|2476813_2477764_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61198.1\|2478656_2479562_+	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
AZW61199.1\|2479573_2480701_+	lipoprotein	NA	NA	NA	NA
AZW61200.1\|2480789_2481404_-	serotype 3 fimbrial subunit	NA	NA	NA	NA
AZW61201.1\|2482060_2483248_-	cupin	NA	NA	NA	NA
AZW62677.1\|2483244_2485842_-	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	1.5e-21	22.6
AZW61202.1\|2486096_2486312_+	dodecin domain-containing protein	NA	NA	NA	NA
AZW61203.1\|2486767_2487322_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	1.7e-15	32.0
AZW61204.1\|2487589_2488150_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
AZW61205.1\|2488261_2489566_+	peptidase	NA	NA	NA	NA
AZW61206.1\|2489562_2491074_+	thiol oxidoreductase	NA	NA	NA	NA
AZW61207.1\|2491179_2492181_+	aminopeptidase	NA	NA	NA	NA
AZW61208.1\|2492161_2493283_+	DUF1513 domain-containing protein	NA	NA	NA	NA
AZW61209.1\|2493206_2493395_+	hypothetical protein	NA	NA	NA	NA
AZW61210.1\|2493381_2494332_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61211.1\|2494328_2494955_-	threonylcarbamoyl-AMP synthase	NA	NA	NA	NA
AZW62678.1\|2495020_2495866_+	hypothetical protein	A0A1I9SA48	Rhodococcus_phage	7.0e-37	35.3
AZW61212.1\|2495969_2496569_+	hypothetical protein	NA	NA	NA	NA
AZW61213.1\|2496565_2497330_+	DUF1828 domain-containing protein	NA	NA	NA	NA
AZW61214.1\|2497399_2498350_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61215.1\|2498448_2499057_-	recombination protein RecR	NA	NA	NA	NA
AZW61216.1\|2499107_2499434_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
AZW61217.1\|2499480_2501706_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	1.2e-43	38.5
AZW61218.1\|2502373_2505778_-	nuclease	NA	NA	NA	NA
AZW61219.1\|2505790_2508451_-	hypothetical protein	NA	NA	NA	NA
AZW61220.1\|2508654_2509857_-	MFS transporter	NA	NA	NA	NA
AZW61221.1\|2510543_2511656_+	D-alanyl-D-alanine endopeptidase	NA	NA	NA	NA
AZW61222.1\|2511662_2512613_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61223.1\|2512711_2513113_-	aryl-sulfate sulfotransferase	NA	NA	NA	NA
AZW61224.1\|2513185_2513764_-\|protease	protease	NA	NA	NA	NA
AZW62679.1\|2513881_2514370_-\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
AZW61225.1\|2514383_2515316_-	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	2.3e-25	29.5
AZW61226.1\|2515353_2516241_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	3.4e-18	28.7
AZW61227.1\|2516398_2518093_+	thiamine pyrophosphate-binding protein	E5ERI2	Ostreococcus_lucimarinus_virus	3.8e-26	24.5
AZW61228.1\|2518109_2519366_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW61229.1\|2519503_2520049_-	acyl dehydratase	NA	NA	NA	NA
AZW61230.1\|2520080_2521640_-	acetolactate synthase large subunit	NA	NA	NA	NA
AZW61231.1\|2521768_2522521_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.8e-29	39.7
AZW61232.1\|2522542_2523235_-	amino acid ABC transporter permease	NA	NA	NA	NA
AZW61233.1\|2523257_2524049_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW61234.1\|2524075_2524981_-	agmatinase	NA	NA	NA	NA
AZW61235.1\|2525173_2526010_-	IclR family transcriptional regulator	NA	NA	NA	NA
AZW61236.1\|2526101_2527124_-	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	1.6e-67	40.7
AZW61237.1\|2527260_2528313_-	threonylcarbamoyl-AMP synthase	S4VW33	Pandoravirus	4.8e-35	37.8
AZW61238.1\|2528317_2529508_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
AZW61239.1\|2529510_2529990_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	6.5e-16	42.5
AZW61240.1\|2530175_2530655_-	disulfide bond formation protein B	NA	NA	NA	NA
AZW61241.1\|2530662_2530899_-	hypothetical protein	NA	NA	NA	NA
AZW61242.1\|2530918_2531320_-	type II toxin-antitoxin system MqsA family antitoxin	NA	NA	NA	NA
AZW61243.1\|2531322_2531574_-	type II toxin-antitoxin system MqsR family toxin	NA	NA	NA	NA
AZW61244.1\|2531628_2532510_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0M4JBD3	Mollivirus	1.8e-51	36.1
AZW61245.1\|2532734_2533181_+	GFA family protein	NA	NA	NA	NA
AZW61246.1\|2533265_2534330_-	fructose-bisphosphate aldolase class II	NA	NA	NA	NA
AZW61247.1\|2534466_2535048_-	MOSC domain-containing protein	NA	NA	NA	NA
AZW61248.1\|2535282_2536413_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
AZW61249.1\|2536590_2537817_+	acetamidase/formamidase family protein	A0A1V0S8X7	Catovirus	5.2e-134	58.8
AZW61250.1\|2537875_2538391_+	transporter	NA	NA	NA	NA
AZW61251.1\|2538413_2538740_+	zinc ribbon domain-containing protein	NA	NA	NA	NA
AZW61252.1\|2538773_2539964_+	formate dehydrogenase	NA	NA	NA	NA
AZW61253.1\|2540037_2540442_+	GFA family protein	NA	NA	NA	NA
AZW61254.1\|2540658_2541609_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61255.1\|2541707_2542478_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.3e-29	39.5
AZW61256.1\|2542474_2543146_-	ectoine/hydroxyectoine ABC transporter permease subunit EhuD	NA	NA	NA	NA
AZW61257.1\|2543142_2543784_-	ectoine/hydroxyectoine ABC transporter permease subunit EhuC	NA	NA	NA	NA
AZW61258.1\|2543796_2544717_-	ectoine/hydroxyectoine ABC transporter substrate-binding protein EhuB	NA	NA	NA	NA
AZW61259.1\|2544877_2546038_-	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW61260.1\|2546079_2547030_-	ornithine cyclodeaminase	NA	NA	NA	NA
AZW61261.1\|2547628_2547853_+	hypothetical protein	NA	NA	NA	NA
AZW61262.1\|2548017_2549712_-	phosphoenolpyruvate--protein phosphotransferase	NA	NA	NA	NA
AZW61263.1\|2549833_2550103_-	HPr family phosphocarrier protein	NA	NA	NA	NA
AZW61264.1\|2550218_2550617_-	PTS mannose transporter subunit IIA	NA	NA	NA	NA
AZW61265.1\|2550627_2551584_-	glutathione synthetase	NA	NA	NA	NA
AZW61266.1\|2551720_2552266_-	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	9.1e-14	29.9
AZW61267.1\|2552286_2554236_-\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	4.1e-125	36.0
AZW61268.1\|2554623_2555400_+	DNA-binding response regulator	NA	NA	NA	NA
AZW61269.1\|2555405_2555798_+	hypothetical protein	NA	NA	NA	NA
AZW61270.1\|2556219_2557170_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61271.1\|2557267_2558218_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61272.1\|2558214_2559312_-	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	3.5e-20	37.3
AZW61273.1\|2559343_2560294_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61274.1\|2562075_2563317_-	MFS transporter	NA	NA	NA	NA
AZW61275.1\|2563328_2564102_-	peroxide stress protein YaaA	NA	NA	NA	NA
AZW61276.1\|2564128_2565079_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_19

2691172 : 2731840

Salmonella_phage(33.33%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW61383.1\|2691172_2692123_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61384.1\|2692233_2692416_+	hypothetical protein	NA	NA	NA	NA
AZW61385.1\|2692515_2693112_-	lipoprotein	NA	NA	NA	NA
AZW61386.1\|2693295_2694387_+	hypothetical protein	NA	NA	NA	NA
AZW61387.1\|2694886_2695297_-	MerR family transcriptional regulator	NA	NA	NA	NA
AZW61388.1\|2695355_2695697_-	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	2.8e-13	42.2
AZW61389.1\|2695702_2698120_-\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
AZW61390.1\|2698132_2699155_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	1.0e-26	38.6
AZW61391.1\|2699229_2699589_-	50S ribosomal protein L20	NA	NA	NA	NA
AZW61392.1\|2699604_2699802_-	50S ribosomal protein L35	NA	NA	NA	NA
AZW61393.1\|2700137_2701088_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61394.1\|2701074_2701263_-	hypothetical protein	NA	NA	NA	NA
AZW61395.1\|2701282_2701732_+	dUTP diphosphatase	S4TNT3	Salmonella_phage	3.7e-45	67.2
AZW61396.1\|2701728_2702679_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61397.1\|2702789_2704238_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
AZW61398.1\|2704352_2704634_-	hypothetical protein	NA	NA	NA	NA
AZW61399.1\|2704737_2705688_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61400.1\|2705932_2706646_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AZW61401.1\|2706768_2706996_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AZW61402.1\|2707290_2707929_-	DedA family protein	NA	NA	NA	NA
AZW61403.1\|2708001_2709072_+	metal-dependent hydrolase	NA	NA	NA	NA
AZW61404.1\|2709068_2710019_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61405.1\|2710434_2710959_-	DNA-binding protein	J9Q7G7	Salmonella_phage	6.5e-09	32.9
AZW61406.1\|2710962_2711232_-	hypothetical protein	NA	NA	NA	NA
AZW61407.1\|2711430_2712492_-	LacI family transcriptional regulator	NA	NA	NA	NA
AZW61408.1\|2712575_2714210_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.9e-15	31.1
AZW61409.1\|2714211_2715015_-	ABC transporter permease	NA	NA	NA	NA
AZW61410.1\|2715043_2716003_-	ABC transporter permease	NA	NA	NA	NA
AZW61411.1\|2716006_2717521_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW61412.1\|2717557_2718562_-	peptidase M20	NA	NA	NA	NA
AZW61413.1\|2718569_2718818_-	hypothetical protein	NA	NA	NA	NA
AZW61414.1\|2718992_2719463_-	DUF1801 domain-containing protein	NA	NA	NA	NA
AZW61415.1\|2719498_2720110_-	LysE family translocator	NA	NA	NA	NA
AZW61416.1\|2720140_2720764_-	FMN-binding negative transcriptional regulator	NA	NA	NA	NA
AZW61417.1\|2720844_2722377_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
AZW61418.1\|2722411_2723653_-	MFS transporter	NA	NA	NA	NA
AZW61419.1\|2723696_2724728_-	alcohol dehydrogenase	A0A2K9L339	Tupanvirus	1.8e-26	27.8
AZW61420.1\|2724724_2725894_-	amine oxidase	NA	NA	NA	NA
AZW61421.1\|2725887_2726568_-	anti-sigma factor	NA	NA	NA	NA
AZW61422.1\|2726729_2727572_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW61423.1\|2727734_2728706_-	AraC family transcriptional regulator	NA	NA	NA	NA
AZW61424.1\|2728877_2729756_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
AZW61425.1\|2729778_2730849_-	FUSC family protein	NA	NA	NA	NA
AZW61426.1\|2730889_2731840_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_20

2793413 : 2865316

Moraxella_phage(14.29%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW61477.1\|2793413_2794364_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61478.1\|2794360_2802022_-	adhesin	A0A0R6PJK4	Moraxella_phage	7.3e-24	30.9
AZW61479.1\|2802262_2806309_-	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	6.3e-160	67.4
AZW61480.1\|2806621_2807203_+	TRAP transporter small permease	NA	NA	NA	NA
AZW61481.1\|2807199_2808498_+	TRAP transporter large permease	NA	NA	NA	NA
AZW61482.1\|2808577_2809606_+	C4-dicarboxylate ABC transporter	NA	NA	NA	NA
AZW61483.1\|2809529_2809880_+	hypothetical protein	NA	NA	NA	NA
AZW61484.1\|2810812_2811763_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61485.1\|2812079_2812685_+	fimbrial protein FimX	NA	NA	NA	NA
AZW61486.1\|2812738_2814052_-	phenylacetate--CoA ligase	NA	NA	NA	NA
AZW61487.1\|2814126_2814597_-	phenylacetic acid degradation protein PaaD	NA	NA	NA	NA
AZW61488.1\|2814596_2815385_-	2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase	NA	NA	NA	NA
AZW61489.1\|2815395_2817048_-	phenylacetic acid degradation protein PaaN	NA	NA	NA	NA
AZW62690.1\|2819246_2819753_-	phenylacetate-CoA oxygenase subunit PaaJ	NA	NA	NA	NA
AZW61490.1\|2819749_2820514_-	phenylacetate-CoA oxygenase subunit PaaI	NA	NA	NA	NA
AZW61491.1\|2820529_2820814_-	1,2-phenylacetyl-CoA epoxidase subunit B	NA	NA	NA	NA
AZW61492.1\|2820878_2821868_-	1,2-phenylacetyl-CoA epoxidase subunit A	NA	NA	NA	NA
AZW61493.1\|2822039_2822969_+	phenylacetic acid degradation operon negative regulatory protein PaaX	NA	NA	NA	NA
AZW61494.1\|2822940_2823627_-	NAD(P)H-hydrate epimerase	NA	NA	NA	NA
AZW61495.1\|2823660_2824206_-	oligoribonuclease	Q8B5Y0	Diachasmimorpha_longicaudata_entomopoxvirus	2.1e-26	37.7
AZW61496.1\|2824250_2825516_+	peptidase M48	NA	NA	NA	NA
AZW61497.1\|2825512_2826415_+	ribosome biogenesis GTPase	NA	NA	NA	NA
AZW61498.1\|2827596_2828541_-	ABC transporter permease	NA	NA	NA	NA
AZW61499.1\|2828635_2830153_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW61500.1\|2830194_2831823_-	gamma-glutamyltransferase	NA	NA	NA	NA
AZW61501.1\|2831930_2832812_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW61502.1\|2835924_2836299_+	endonuclease	F4YXR7	Roseobacter_phage	2.1e-25	54.4
AZW61503.1\|2836323_2836662_-	P-II family nitrogen regulator	NA	NA	NA	NA
AZW61504.1\|2836705_2838340_-	NAD+ synthase	A0A2L0UZF5	Agrobacterium_phage	8.3e-87	36.6
AZW61505.1\|2838378_2839725_-	mechanosensitive ion channel protein MscS	NA	NA	NA	NA
AZW62691.1\|2839832_2841254_+	argininosuccinate lyase	NA	NA	NA	NA
AZW61506.1\|2841323_2841908_-	nitroreductase	NA	NA	NA	NA
AZW61507.1\|2842010_2842961_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61508.1\|2843095_2844202_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW61509.1\|2844212_2845310_+	GTP 3',8-cyclase MoaA	NA	NA	NA	NA
AZW61510.1\|2845454_2846660_-	molybdopterin molybdenumtransferase MoeA	NA	NA	NA	NA
AZW61511.1\|2846666_2847188_-	molybdenum cofactor biosynthesis protein B	NA	NA	NA	NA
AZW61512.1\|2847184_2847676_-	molybdenum cofactor biosynthesis protein MoaE	NA	NA	NA	NA
AZW61513.1\|2847672_2847924_-	MoaD/ThiS family protein	NA	NA	NA	NA
AZW61514.1\|2847904_2848390_-	cyclic pyranopterin monophosphate synthase MoaC	NA	NA	NA	NA
AZW61515.1\|2848525_2851987_+	hypothetical protein	NA	NA	NA	NA
AZW61516.1\|2851983_2852889_+	dienelactone hydrolase family protein	NA	NA	NA	NA
AZW61517.1\|2852898_2853330_-	lipoprotein	NA	NA	NA	NA
AZW62692.1\|2853576_2854080_+	peroxiredoxin	M1I839	Pelagibacter_phage	1.8e-24	44.1
AZW61518.1\|2854091_2855558_+	MFS transporter	NA	NA	NA	NA
AZW61519.1\|2855632_2856508_-	hypothetical protein	NA	NA	NA	NA
AZW62693.1\|2856504_2857512_-	biotin synthase	NA	NA	NA	NA
AZW61520.1\|2857979_2858285_+	DUF4148 domain-containing protein	NA	NA	NA	NA
AZW61521.1\|2858375_2858966_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW61522.1\|2859156_2860173_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW61523.1\|2860364_2862701_-	copper-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	3.2e-124	42.8
AZW61524.1\|2862783_2863218_+	Cd(II)/Pb(II)-responsive transcriptional regulator	NA	NA	NA	NA
AZW61525.1\|2863316_2864267_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61526.1\|2864365_2865316_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_21

2873341 : 2930126

uncultured_Mediterranean_phage(28.57%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW61534.1\|2873341_2874292_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61535.1\|2875998_2876304_-	hypothetical protein	NA	NA	NA	NA
AZW61536.1\|2876972_2877311_+	transcriptional regulator	NA	NA	NA	NA
AZW61537.1\|2881863_2882466_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW61538.1\|2882562_2883852_+	MFS transporter	NA	NA	NA	NA
AZW61539.1\|2883909_2884641_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-12	31.0
AZW61540.1\|2884637_2885441_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.9e-14	23.5
AZW61541.1\|2885437_2886526_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
AZW61542.1\|2886522_2887452_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW61543.1\|2887600_2888746_-	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW61544.1\|2888767_2889718_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61545.1\|2890048_2893870_-	trifunctional transcriptional regulator/proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
AZW61546.1\|2894026_2894695_-	lipoprotein	NA	NA	NA	NA
AZW61547.1\|2894699_2896373_-	MCE family protein	NA	NA	NA	NA
AZW61548.1\|2896391_2897711_-	paraquat-inducible membrane protein A	NA	NA	NA	NA
AZW61549.1\|2897715_2900067_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	4.2e-164	41.9
AZW62694.1\|2900086_2902255_-	penicillin-binding protein 1C	NA	NA	NA	NA
AZW61550.1\|2902251_2907441_-	alpha-2-macroglobulin family protein	NA	NA	NA	NA
AZW61551.1\|2907530_2907845_-\|protease	ATP-dependent Clp protease adaptor ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	1.2e-10	43.8
AZW61552.1\|2908072_2908318_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	1.3e-20	76.6
AZW61553.1\|2908412_2908931_+	hypothetical protein	A0A1B1IUW8	uncultured_Mediterranean_phage	5.1e-14	42.2
AZW61554.1\|2909030_2910236_-	3-oxoadipyl-CoA thiolase	NA	NA	NA	NA
AZW61555.1\|2910351_2911749_-	chloride channel protein EriC	NA	NA	NA	NA
AZW61556.1\|2911865_2912444_-	superoxide dismutase [Fe]	NA	NA	NA	NA
AZW61557.1\|2912516_2913908_-	exodeoxyribonuclease VII large subunit	A0A1V0SD82	Indivirus	1.4e-29	32.0
AZW61558.1\|2914075_2915026_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61559.1\|2915306_2915927_+	MotA/TolQ/ExbB proton channel family protein	NA	NA	NA	NA
AZW61560.1\|2915923_2916337_+	biopolymer transporter ExbD	NA	NA	NA	NA
AZW61561.1\|2916333_2917377_+	tetraacyldisaccharide 4'-kinase	NA	NA	NA	NA
AZW61562.1\|2917432_2917621_+	hypothetical protein	NA	NA	NA	NA
AZW61563.1\|2917630_2918395_+	3-deoxy-manno-octulosonate cytidylyltransferase	NA	NA	NA	NA
AZW61564.1\|2918485_2919142_+	adenylate kinase	NA	NA	NA	NA
AZW61565.1\|2919233_2919992_+	3-hydroxyacyl-CoA dehydrogenase	NA	NA	NA	NA
AZW61566.1\|2920017_2921619_+	murein biosynthesis integral membrane protein MurJ	NA	NA	NA	NA
AZW61567.1\|2921819_2922824_+	iron dicitrate transport regulator FecR	NA	NA	NA	NA
AZW61568.1\|2922924_2923188_+	30S ribosomal protein S20	NA	NA	NA	NA
AZW61569.1\|2923305_2924082_-	2-dehydro-3-deoxyglucarate aldolase	NA	NA	NA	NA
AZW61570.1\|2924672_2925623_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61571.1\|2928006_2929119_-	malate dehydrogenase	NA	NA	NA	NA
AZW61572.1\|2929175_2930126_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_22

2960512 : 3004203

Planktothrix_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW61601.1\|2960512_2961463_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61602.1\|2961449_2961695_-	hypothetical protein	NA	NA	NA	NA
AZW61603.1\|2961583_2962480_-	inositol monophosphatase	NA	NA	NA	NA
AZW61604.1\|2964757_2966983_+	glycosyl hydrolase	NA	NA	NA	NA
AZW61605.1\|2967147_2968236_+	methionine import ATP-binding protein MetN	G9BWD6	Planktothrix_phage	8.7e-32	36.4
AZW61606.1\|2968192_2968846_+	ABC transporter permease	NA	NA	NA	NA
AZW61607.1\|2968893_2969691_+	MetQ/NlpA family lipoprotein	NA	NA	NA	NA
AZW61608.1\|2970222_2971173_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61609.1\|2971253_2972402_+	alcohol dehydrogenase	NA	NA	NA	NA
AZW61610.1\|2972458_2973409_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61611.1\|2973395_2973614_-	hypothetical protein	NA	NA	NA	NA
AZW61612.1\|2973507_2973813_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
AZW61613.1\|2973841_2974276_-	DUF126 domain-containing protein	NA	NA	NA	NA
AZW61614.1\|2974277_2975522_-	DUF521 domain-containing protein	NA	NA	NA	NA
AZW61615.1\|2975518_2976229_-	FadR family transcriptional regulator	NA	NA	NA	NA
AZW62696.1\|2976243_2977155_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW61616.1\|2977517_2977922_+	hypothetical protein	NA	NA	NA	NA
AZW61617.1\|2977918_2978377_+	hypothetical protein	NA	NA	NA	NA
AZW61618.1\|2978383_2979292_+	hypothetical protein	NA	NA	NA	NA
AZW62697.1\|2979288_2980155_+	sugar ABC transporter permease	NA	NA	NA	NA
AZW61619.1\|2980141_2980969_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
AZW61620.1\|2980979_2982107_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-23	32.3
AZW61621.1\|2983184_2984423_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61622.1\|2984464_2985727_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW61623.1\|2985733_2986486_+	DNA-binding protein	NA	NA	NA	NA
AZW61624.1\|2986537_2986723_-	hypothetical protein	NA	NA	NA	NA
AZW61625.1\|2986998_2987463_+	redox-sensitive transcriptional activator SoxR	NA	NA	NA	NA
AZW61626.1\|2987494_2988154_+	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
AZW61627.1\|2988298_2990407_+	AsmA family protein	NA	NA	NA	NA
AZW61628.1\|2990403_2991354_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61629.1\|2991457_2992078_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW62698.1\|2992181_2992922_+	oxidoreductase	NA	NA	NA	NA
AZW61630.1\|2994056_2995181_-	hypothetical protein	NA	NA	NA	NA
AZW61631.1\|2995226_2995595_-	hypothetical protein	NA	NA	NA	NA
AZW61632.1\|2995836_2996787_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61633.1\|2997822_2998365_-	hypothetical protein	NA	NA	NA	NA
AZW61634.1\|2998569_2998764_+	hypothetical protein	NA	NA	NA	NA
AZW61635.1\|2998750_2999701_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61636.1\|2999697_3000663_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW61637.1\|3000732_3001569_+	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0P0BXC9	Ostreococcus_lucimarinus_virus	1.6e-33	33.3
AZW61638.1\|3002045_3003191_+	porin	NA	NA	NA	NA
AZW61639.1\|3003252_3004203_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_23

3188617 : 3249646

Xanthomonas_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW61785.1\|3188617_3189568_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61786.1\|3189576_3190125_+	phospholipid:lipid A palmitoyltransferase	NA	NA	NA	NA
AZW61787.1\|3190121_3190730_-	gamma-glutamylcyclotransferase	NA	NA	NA	NA
AZW61788.1\|3190912_3191383_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
AZW61789.1\|3191389_3192649_-	D-amino acid dehydrogenase	NA	NA	NA	NA
AZW61790.1\|3192701_3193514_-	oxidoreductase	NA	NA	NA	NA
AZW61791.1\|3193628_3194183_+	cysteine dioxygenase	NA	NA	NA	NA
AZW61792.1\|3194192_3195182_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW61793.1\|3195361_3196081_-	VOC family protein	NA	NA	NA	NA
AZW61794.1\|3196097_3198833_-	protein translocase subunit SecA	NA	NA	NA	NA
AZW61795.1\|3199012_3199999_-	M23 family peptidase	A0A292GJG6	Xanthomonas_phage	3.4e-27	51.8
AZW61796.1\|3200040_3200535_+	DUF721 domain-containing protein	NA	NA	NA	NA
AZW61797.1\|3200646_3201570_-	UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase	NA	NA	NA	NA
AZW61798.1\|3201798_3202983_-	cell division protein FtsZ	NA	NA	NA	NA
AZW61799.1\|3203171_3204398_-	cell division protein FtsA	NA	NA	NA	NA
AZW61800.1\|3204402_3205224_-	cell division protein FtsQ	NA	NA	NA	NA
AZW61801.1\|3205236_3206187_-	D-alanine--D-alanine ligase	NA	NA	NA	NA
AZW61802.1\|3206183_3207590_-	UDP-N-acetylmuramate--L-alanine ligase	NA	NA	NA	NA
AZW61803.1\|3207586_3208660_-	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase	NA	NA	NA	NA
AZW61804.1\|3208656_3209850_-	putative lipid II flippase FtsW	NA	NA	NA	NA
AZW61805.1\|3209846_3211379_-	UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase	NA	NA	NA	NA
AZW61806.1\|3211375_3212545_-	phospho-N-acetylmuramoyl-pentapeptide- transferase	NA	NA	NA	NA
AZW61807.1\|3212534_3215372_-	Mur ligase family protein	NA	NA	NA	NA
AZW62714.1\|3215368_3217069_-	penicillin-binding protein 2	NA	NA	NA	NA
AZW61808.1\|3217095_3217374_-	cell division protein FtsL	NA	NA	NA	NA
AZW61809.1\|3217373_3218468_-	ribosomal RNA small subunit methyltransferase H	NA	NA	NA	NA
AZW61810.1\|3218476_3218968_-	transcriptional regulator MraZ	NA	NA	NA	NA
AZW61811.1\|3219707_3221516_+	ABC transporter ATP-binding protein	A0A1B0RXA0	Streptococcus_phage	1.6e-43	28.6
AZW61812.1\|3221555_3222635_-	dihydroorotase	NA	NA	NA	NA
AZW61813.1\|3222631_3223825_-	amidohydrolase	NA	NA	NA	NA
AZW61814.1\|3223974_3224253_+	DNA topoisomerase III	NA	NA	NA	NA
AZW61815.1\|3224581_3224974_-	hypothetical protein	NA	NA	NA	NA
AZW62715.1\|3231698_3232175_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
AZW61816.1\|3232327_3233440_+	4-hydroxyphenylpyruvate dioxygenase	NA	NA	NA	NA
AZW61817.1\|3233507_3234068_-	peptide-methionine (S)-S-oxide reductase	NA	NA	NA	NA
AZW61818.1\|3234091_3234424_-	cytochrome C	NA	NA	NA	NA
AZW61819.1\|3234407_3236096_-	dihydroxy-acid dehydratase	NA	NA	NA	NA
AZW61820.1\|3236215_3237004_+	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
AZW61821.1\|3237711_3238662_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61822.1\|3239106_3239418_-	cell division protein ZapA	NA	NA	NA	NA
AZW61823.1\|3239417_3239948_-	hypothetical protein	NA	NA	NA	NA
AZW61824.1\|3240110_3241061_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61825.1\|3241159_3242110_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61826.1\|3242399_3242864_+	tripartite tricarboxylate transporter TctB family protein	NA	NA	NA	NA
AZW61827.1\|3242878_3244384_+	tripartite tricarboxylate transporter permease	NA	NA	NA	NA
AZW61828.1\|3244637_3246245_+	gamma-glutamyltransferase family protein	NA	NA	NA	NA
AZW61829.1\|3246300_3247206_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AZW61830.1\|3247646_3248597_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61831.1\|3248695_3249646_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_24

3271371 : 3309786

Tupanvirus(16.67%)

transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW61853.1\|3271371_3271707_+\|holin	phage holin family protein	NA	NA	NA	NA
AZW61854.1\|3271706_3272549_+	methylenetetrahydrofolate reductase [NAD(P)H]	NA	NA	NA	NA
AZW61855.1\|3272647_3273598_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61856.1\|3273662_3274634_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW61857.1\|3274697_3275717_-	histone deacetylase family protein	A0A2K9L473	Tupanvirus	3.4e-22	31.7
AZW62718.1\|3275718_3277092_-	MFS transporter	NA	NA	NA	NA
AZW61858.1\|3277369_3278050_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
AZW61859.1\|3278062_3280189_+	lytic transglycosylase	A0A0S2SXL7	Bacillus_phage	5.5e-14	36.6
AZW61860.1\|3280185_3281280_+	CCA-adding enzyme	A0A0F6YPT7	Sinorhizobium_phage	2.4e-50	50.5
AZW61861.1\|3281294_3282554_-	SAM-dependent methyltransferase	NA	NA	NA	NA
AZW61862.1\|3282573_3284298_-	ATP-dependent helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	9.5e-49	32.9
AZW61863.1\|3284536_3285289_-	uracil-DNA glycosylase	A0A1Y0B680	Bovine_alphaherpesvirus	2.5e-46	47.5
AZW61864.1\|3285427_3286378_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW62719.1\|3286690_3288169_+	phospholipase D family protein	NA	NA	NA	NA
AZW61865.1\|3288175_3289285_-	molybdenum import ATP-binding protein ModC	G9BWD6	Planktothrix_phage	7.5e-23	34.5
AZW61866.1\|3289296_3289977_-	molybdate ABC transporter permease subunit	NA	NA	NA	NA
AZW61867.1\|3289998_3290754_-	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW62720.1\|3290889_3291774_-	alpha/beta hydrolase	NA	NA	NA	NA
AZW61868.1\|3291861_3292443_+	hypothetical protein	NA	NA	NA	NA
AZW61869.1\|3292535_3292658_-	hypothetical protein	NA	NA	NA	NA
AZW61870.1\|3292703_3293003_-	DUF4148 domain-containing protein	NA	NA	NA	NA
AZW62721.1\|3293154_3293580_-	hypothetical protein	NA	NA	NA	NA
AZW61871.1\|3295786_3296290_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
AZW61872.1\|3296305_3297256_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61873.1\|3297242_3297440_-	hypothetical protein	NA	NA	NA	NA
AZW61874.1\|3297783_3298557_-	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW61875.1\|3298689_3299700_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW61876.1\|3299851_3301507_-	gamma-glutamyltransferase family protein	NA	NA	NA	NA
AZW61877.1\|3301561_3301903_-	cupin domain-containing protein	NA	NA	NA	NA
AZW61878.1\|3301916_3303356_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
AZW61879.1\|3303488_3304304_-	MerR family transcriptional regulator	NA	NA	NA	NA
AZW61880.1\|3304322_3304511_+	hypothetical protein	NA	NA	NA	NA
AZW61881.1\|3304497_3305448_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61882.1\|3306835_3307783_+	hypothetical protein	NA	NA	NA	NA
AZW61883.1\|3308009_3308750_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW61884.1\|3308835_3309786_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_25

3385193 : 3438934

Staphylococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW61936.1\|3385193_3386144_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61937.1\|3386548_3387193_-	urease accessory protein UreG	NA	NA	NA	NA
AZW61938.1\|3387217_3387802_-	urease accessory protein UreF	NA	NA	NA	NA
AZW61939.1\|3387902_3388520_-	urease accessory protein UreE	NA	NA	NA	NA
AZW61940.1\|3388522_3390238_-	urease subunit alpha	NA	NA	NA	NA
AZW61941.1\|3390234_3390543_-	urease subunit beta	NA	NA	NA	NA
AZW61942.1\|3390559_3391195_-	urease accessory protein UreJ	NA	NA	NA	NA
AZW61943.1\|3391221_3391524_-	urease subunit gamma	NA	NA	NA	NA
AZW61944.1\|3391624_3392479_-	urease accessory protein UreD	NA	NA	NA	NA
AZW61945.1\|3393060_3393333_+	MerR family DNA-binding transcriptional regulator	NA	NA	NA	NA
AZW61946.1\|3393750_3394158_-	GFA family protein	NA	NA	NA	NA
AZW61947.1\|3394527_3395322_-	GntR family transcriptional regulator	NA	NA	NA	NA
AZW61948.1\|3395422_3396658_+	methylaspartate ammonia-lyase	NA	NA	NA	NA
AZW61949.1\|3396726_3397743_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW61950.1\|3397739_3399131_+	MmgE/PrpD family protein	NA	NA	NA	NA
AZW61951.1\|3399127_3400324_+	MFS transporter	NA	NA	NA	NA
AZW61952.1\|3400320_3401859_-	SpoVR family protein	NA	NA	NA	NA
AZW61953.1\|3401855_3403115_-	hypothetical protein	NA	NA	NA	NA
AZW61954.1\|3405055_3406006_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61955.1\|3406772_3407867_-	CoA transferase	NA	NA	NA	NA
AZW61956.1\|3407859_3409194_-	CoA ligase	NA	NA	NA	NA
AZW61957.1\|3409147_3409831_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW61958.1\|3409856_3411020_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW61959.1\|3411016_3412018_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW61960.1\|3412017_3412890_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW61961.1\|3412886_3413636_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.9e-09	27.8
AZW61962.1\|3413632_3414424_-	ABC transporter ATP-binding protein	A0A1M7XV31	Cedratvirus	1.7e-08	29.4
AZW61963.1\|3414420_3415560_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW61964.1\|3415868_3416621_+	3-hydroxyacyl-CoA dehydrogenase	NA	NA	NA	NA
AZW61965.1\|3416654_3417437_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW61966.1\|3417440_3417830_+	DNA-binding protein	NA	NA	NA	NA
AZW61967.1\|3418969_3419833_+	3-alpha,7-alpha, 12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase	NA	NA	NA	NA
AZW61968.1\|3419868_3420957_+	hypothetical protein	NA	NA	NA	NA
AZW61969.1\|3420953_3421904_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61970.1\|3421890_3422259_-	hypothetical protein	NA	NA	NA	NA
AZW61971.1\|3422257_3425236_+	hypothetical protein	NA	NA	NA	NA
AZW61972.1\|3426162_3427041_+	fatty acid desaturase	NA	NA	NA	NA
AZW61973.1\|3428989_3429940_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW61974.1\|3429936_3430404_-	ribonuclease HI	J9Q745	Salmonella_phage	5.6e-36	50.7
AZW61975.1\|3430446_3431217_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AZW61976.1\|3431237_3432038_+	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
AZW61977.1\|3432048_3433458_+	lytic transglycosylase	NA	NA	NA	NA
AZW61978.1\|3433552_3434338_+	enoyl-[acyl-carrier-protein] reductase FabI	NA	NA	NA	NA
AZW61979.1\|3434577_3435594_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW61980.1\|3435701_3436094_-	OsmC family peroxiredoxin	NA	NA	NA	NA
AZW61981.1\|3436231_3436912_+	DUF533 domain-containing protein	NA	NA	NA	NA
AZW61982.1\|3436916_3437915_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW61983.1\|3437983_3438934_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_26

3445089 : 3504389

Acinetobacter_phage(27.27%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW61987.1\|3445089_3446853_+\|tRNA	glutamine--tRNA ligase	A0A222YZ70	Escherichia_phage	5.0e-162	50.0
AZW61988.1\|3446964_3447843_+	septum site-determining protein MinC	NA	NA	NA	NA
AZW61989.1\|3447955_3448771_+	septum site-determining protein MinD	NA	NA	NA	NA
AZW61990.1\|3448774_3449026_+	cell division topological specificity factor	NA	NA	NA	NA
AZW61991.1\|3449110_3450127_-\|transposase	IS110 family transposase IS1663	NA	NA	NA	NA
AZW61992.1\|3450457_3450679_-	hypothetical protein	NA	NA	NA	NA
AZW61993.1\|3453039_3453957_-	EamA/RhaT family transporter	NA	NA	NA	NA
AZW61994.1\|3454454_3455663_-	ABC transporter permease	NA	NA	NA	NA
AZW61995.1\|3455742_3457314_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW61996.1\|3457431_3458367_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
AZW61997.1\|3458555_3459500_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	8.4e-07	23.2
AZW61998.1\|3459568_3459784_-	hypothetical protein	NA	NA	NA	NA
AZW61999.1\|3460067_3465785_+	excinuclease ABC subunit A	A0A1B1IVR3	uncultured_Mediterranean_phage	1.0e-195	39.5
AZW62000.1\|3465790_3466918_+	aminodeoxychorismate synthase, component I	S4VT78	Pandoravirus	3.8e-38	37.8
AZW62001.1\|3466973_3467600_+	aminotransferase	NA	NA	NA	NA
AZW62002.1\|3467871_3468888_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW62003.1\|3468983_3469694_-	oxidoreductase	NA	NA	NA	NA
AZW62725.1\|3469690_3470680_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW62004.1\|3470811_3472407_+	acyl-CoA synthetase	NA	NA	NA	NA
AZW62005.1\|3472409_3473147_+	GntR family transcriptional regulator	NA	NA	NA	NA
AZW62006.1\|3473302_3474175_-\|tRNA	tRNA threonylcarbamoyladenosine dehydratase	NA	NA	NA	NA
AZW62007.1\|3474443_3475664_+	MFS transporter	NA	NA	NA	NA
AZW62008.1\|3475660_3476320_+	gamma-glutamylcyclotransferase	NA	NA	NA	NA
AZW62009.1\|3476391_3477024_+	pyridoxine/pyridoxamine 5'-phosphate oxidase	NA	NA	NA	NA
AZW62010.1\|3477053_3477572_+	flavin reductase	NA	NA	NA	NA
AZW62011.1\|3477582_3478692_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
AZW62012.1\|3478738_3479593_+	formyltetrahydrofolate deformylase	NA	NA	NA	NA
AZW62013.1\|3479594_3480497_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW62014.1\|3481719_3482670_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW62015.1\|3484426_3485416_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW62016.1\|3485591_3486380_-	indole-3-glycerol-phosphate synthase	A0A0P0IR83	Acinetobacter_phage	5.1e-66	53.0
AZW62017.1\|3486376_3487408_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	7.4e-73	42.7
AZW62018.1\|3487426_3487990_-	type 1 glutamine amidotransferase	A0A0P0IKJ1	Acinetobacter_phage	1.1e-65	62.1
AZW62019.1\|3488045_3489566_-	anthranilate synthase component I	S4VT78	Pandoravirus	9.0e-43	32.1
AZW62020.1\|3489829_3490534_-	phosphoglycolate phosphatase	NA	NA	NA	NA
AZW62021.1\|3490541_3491279_-	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
AZW62022.1\|3491384_3491759_+	Co2+/Mg2+ efflux protein ApaG	NA	NA	NA	NA
AZW62023.1\|3491801_3493091_+	hypothetical protein	NA	NA	NA	NA
AZW62024.1\|3493087_3494257_+	ubiquinone biosynthesis protein UbiH	NA	NA	NA	NA
AZW62025.1\|3494253_3495093_+	thiol:disulfide interchange protein DsbC	NA	NA	NA	NA
AZW62026.1\|3495152_3496088_+	hydroxyacid dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	6.4e-15	27.7
AZW62027.1\|3496100_3497051_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW62028.1\|3497149_3498112_-\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	4.6e-93	64.5
AZW62029.1\|3498143_3498503_-	dihydroneopterin aldolase	NA	NA	NA	NA
AZW62030.1\|3498627_3499530_+	NAD(P)/FAD-dependent oxidoreductase	G3MA85	Bacillus_virus	1.9e-08	24.0
AZW62031.1\|3499531_3501304_-	peptidase M61	NA	NA	NA	NA
AZW62032.1\|3501338_3502115_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW62033.1\|3503438_3504389_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_27

3519327 : 3577400

Planktothrix_phage(12.5%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW62045.1\|3519327_3520278_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW62046.1\|3520406_3521540_-	peptidase	NA	NA	NA	NA
AZW62047.1\|3521583_3522489_-	alpha/beta hydrolase	NA	NA	NA	NA
AZW62048.1\|3522491_3524192_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-15	32.7
AZW62049.1\|3524188_3525109_-	ABC transporter permease	NA	NA	NA	NA
AZW62050.1\|3525116_3526094_-	ABC transporter permease	NA	NA	NA	NA
AZW62051.1\|3526152_3527187_-	succinylglutamate desuccinylase	NA	NA	NA	NA
AZW62052.1\|3529161_3529398_-	hypothetical protein	NA	NA	NA	NA
AZW62053.1\|3529524_3530388_-	NAD(P)H-hydrate dehydratase	NA	NA	NA	NA
AZW62054.1\|3530476_3531298_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW62055.1\|3531377_3532115_-	enoyl-CoA hydratase	NA	NA	NA	NA
AZW62056.1\|3532111_3533104_-	nitronate monooxygenase	NA	NA	NA	NA
AZW62057.1\|3533217_3533880_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW62058.1\|3533924_3535073_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW62059.1\|3537396_3538347_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW62060.1\|3538687_3539638_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW62061.1\|3539736_3540687_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW62062.1\|3540983_3541481_+	hypothetical protein	NA	NA	NA	NA
AZW62063.1\|3541523_3543299_+	copper resistance system multicopper oxidase	NA	NA	NA	NA
AZW62728.1\|3543345_3544173_+	copper resistance protein B	NA	NA	NA	NA
AZW62064.1\|3544179_3544914_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
AZW62065.1\|3546083_3546878_-	IclR family transcriptional regulator	NA	NA	NA	NA
AZW62066.1\|3547167_3547758_+	cysteine dioxygenase	NA	NA	NA	NA
AZW62067.1\|3547791_3549120_-	amidase	NA	NA	NA	NA
AZW62068.1\|3549194_3550340_-	transporter	NA	NA	NA	NA
AZW62069.1\|3550451_3551450_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW62070.1\|3551412_3551847_+	carbon monoxide dehydrogenase	NA	NA	NA	NA
AZW62071.1\|3553363_3554248_+	EamA/RhaT family transporter	NA	NA	NA	NA
AZW62072.1\|3554244_3555450_-	cardiolipin synthase ClsB	NA	NA	NA	NA
AZW62073.1\|3555446_3556307_-	endonuclease	NA	NA	NA	NA
AZW62074.1\|3556419_3558210_-\|tRNA	aspartate--tRNA ligase	A0A1V0SAC0	Catovirus	6.5e-08	25.5
AZW62075.1\|3558250_3558916_-	DUF502 domain-containing protein	A0A2I7S9X1	Vibrio_phage	6.7e-11	28.4
AZW62076.1\|3558916_3559225_-	FmdB family transcriptional regulator	NA	NA	NA	NA
AZW62729.1\|3559390_3560677_-	hypothetical protein	NA	NA	NA	NA
AZW62077.1\|3562110_3563061_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW62078.1\|3565012_3566227_-	phosphoribosylglycinamide formyltransferase 2	NA	NA	NA	NA
AZW62079.1\|3566332_3567322_+	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	4.3e-38	37.7
AZW62080.1\|3567318_3567927_+	hydrolase	E3T535	Cafeteria_roenbergensis_virus	5.2e-10	26.1
AZW62081.1\|3567939_3568569_+	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
AZW62082.1\|3568565_3569186_+	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
AZW62083.1\|3569217_3570009_+	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	9.5e-20	27.4
AZW62084.1\|3570851_3571316_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
AZW62085.1\|3571334_3572261_+	HPr kinase/phosphorylase	NA	NA	NA	NA
AZW62086.1\|3572314_3573601_-	cytochrome c	NA	NA	NA	NA
AZW62087.1\|3574531_3575404_+	RNase adaptor protein RapZ	A0A1P8D5W0	Corynebacterium_phage	2.4e-08	34.5
AZW62088.1\|3575400_3576351_+	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	6.9e-17	47.2
AZW62089.1\|3576449_3577400_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_28

4009611 : 4074523

Planktothrix_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW62478.1\|4009611_4010097_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW62479.1\|4010315_4011296_+	protein BugT	NA	NA	NA	NA
AZW62480.1\|4011562_4012372_+	Pertussis toxin subunit 1	NA	NA	NA	NA
AZW62481.1\|4012411_4013092_+	Pertussis toxin subunit 2	NA	NA	NA	NA
AZW62482.1\|4013085_4013544_+	pertussis toxin subunit 4	NA	NA	NA	NA
AZW62483.1\|4013555_4013918_+	Pertussis toxin subunit 5	NA	NA	NA	NA
AZW62484.1\|4014000_4014684_+	Pertussis toxin subunit 3	NA	NA	NA	NA
AZW62485.1\|4014739_4015048_+	type IV secretion protein A	NA	NA	NA	NA
AZW62486.1\|4015066_4015381_+	type IV secretion protein B	NA	NA	NA	NA
AZW62487.1\|4015377_4017852_+	type IV secretion system protein PtlC	NA	NA	NA	NA
AZW62488.1\|4017859_4019251_+	type IV secretion system protein PtlD	NA	NA	NA	NA
AZW62489.1\|4019247_4019433_+	type IV secretion protein I	NA	NA	NA	NA
AZW62490.1\|4019411_4020113_+	type IV secretion protein E	NA	NA	NA	NA
AZW62491.1\|4020109_4020931_+	type IV secretion system protein PtlF	NA	NA	NA	NA
AZW62750.1\|4020911_4022036_+	type IV secretion system protein PtlG	NA	NA	NA	NA
AZW62492.1\|4022028_4023048_+	type IV secretion protein H	NA	NA	NA	NA
AZW62493.1\|4023253_4024288_-	EamA/RhaT family transporter	NA	NA	NA	NA
AZW62751.1\|4024388_4025180_+	AraC family transcriptional regulator	NA	NA	NA	NA
AZW62494.1\|4025262_4025637_+	DUF1232 domain-containing protein	NA	NA	NA	NA
AZW62495.1\|4025614_4027024_+	DUF2868 domain-containing protein	NA	NA	NA	NA
AZW62496.1\|4027016_4028399_+	DUF3482 domain-containing protein	A0A0R6PHS5	Moraxella_phage	9.9e-57	38.9
AZW62497.1\|4028733_4030338_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW62498.1\|4030373_4031387_+	ABC transporter permease	NA	NA	NA	NA
AZW62499.1\|4031397_4032324_+	ABC transporter permease	NA	NA	NA	NA
AZW62500.1\|4032714_4033665_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW62501.1\|4033834_4035061_+	bifunctional glutamate N-acetyltransferase/amino-acid N-acetyltransferase	NA	NA	NA	NA
AZW62502.1\|4035260_4036127_+	DUF815 domain-containing protein	NA	NA	NA	NA
AZW62503.1\|4036119_4037082_+	NUDIX hydrolase	A0A221LFJ1	Barns_Ness_breadcrumb_sponge_sobemo-like_virus	1.9e-06	53.4
AZW62504.1\|4037182_4038133_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW62505.1\|4038231_4039182_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW62506.1\|4039280_4040231_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW62507.1\|4040227_4041721_-	RND transporter	NA	NA	NA	NA
AZW62508.1\|4041717_4044825_-	multidrug transporter subunit MdtC	NA	NA	NA	NA
AZW62509.1\|4044821_4047890_-	multidrug transporter subunit MdtB	NA	NA	NA	NA
AZW62510.1\|4047886_4049137_-	multidrug transporter subunit MdtA	NA	NA	NA	NA
AZW62511.1\|4049317_4050079_-	cell division protein ZapD	NA	NA	NA	NA
AZW62512.1\|4050111_4050762_-	dephospho-CoA kinase	NA	NA	NA	NA
AZW62513.1\|4050764_4051604_-	prepilin peptidase	NA	NA	NA	NA
AZW62514.1\|4051844_4052588_+	hypothetical protein	NA	NA	NA	NA
AZW62515.1\|4052670_4053018_-	LuxR family transcriptional regulator	NA	NA	NA	NA
AZW62516.1\|4053115_4053958_-	pantoate--beta-alanine ligase	NA	NA	NA	NA
AZW62517.1\|4054002_4054890_-	segregation/condensation protein A	NA	NA	NA	NA
AZW62518.1\|4054916_4055105_-	DUF3460 domain-containing protein	NA	NA	NA	NA
AZW62519.1\|4055202_4056660_+	MFS transporter	NA	NA	NA	NA
AZW62520.1\|4056646_4058173_+	glycerol kinase	NA	NA	NA	NA
AZW62521.1\|4058191_4058659_-	hypothetical protein	NA	NA	NA	NA
AZW62522.1\|4058658_4059681_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW62523.1\|4059801_4060542_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.4e-35	39.7
AZW62524.1\|4060596_4061697_-	amino acid ABC transporter permease	NA	NA	NA	NA
AZW62525.1\|4061698_4062889_-	amino acid ABC transporter permease	NA	NA	NA	NA
AZW62526.1\|4063008_4064025_-	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	1.0e-71	42.1
AZW62527.1\|4064343_4065015_+	cell division ATP-binding protein FtsE	G9BWD6	Planktothrix_phage	9.5e-29	38.2
AZW62528.1\|4065011_4065920_+	ABC transporter permease	NA	NA	NA	NA
AZW62529.1\|4066131_4066779_+	chemoreceptor glutamine deamidase CheD	NA	NA	NA	NA
AZW62530.1\|4070630_4071707_+	A/G-specific adenine glycosylase	NA	NA	NA	NA
AZW62531.1\|4071717_4072527_-	transcriptional regulator	NA	NA	NA	NA
AZW62532.1\|4072616_4073390_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AZW62533.1\|4073572_4074523_+\|transposase	IS481 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP025073

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection