CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP025345	Bordetella pertussis strain C871 chromosome, complete genome	4 crisprs	csa3,cas3,DinG,DEDDh	0	0	25	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP025345_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP025345_1

250592-250676

Orphan

Consensus_repeat	Method
GGTGCCTGTCCCCGCGGGGACAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP025345_1

>merge|CP025345|1|250592-250676|CRISPRCasFinder
GGTGCCTGTCCCCGCGGGGACAGATACCGTCTTGGCCGTCAAGCGTTCATGGCGTATGACAGGGTGCCTGTCCCCGCGGGGACAG

>CP025345|1|1|250592-250676|CRISPRCasFinder
GGTGCCTGTCCCCGCGGGGACAG	ATACCGTCTTGGCCGTCAAGCGTTCATGGCGTATGACAG
GGTGCCTGTCCCCGCGGGGACAG

Protein	Signature genes	Signature genes Name	Protein_function
CP025345.1\|AZW73724.1\|253600_254239_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|182775
CP025345.1\|AZW73729.1\|259957_260857_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176107
CP025345.1\|AZW73719.1\|247882_248581_-\|HAD-IB-family-hydrolase	unknown	unknown	gnl\|CDD\|319796
CP025345.1\|AZW73717.1\|246038_246530_-\|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase	unknown	unknown	gnl\|CDD\|172582
CP025345.1\|AZW73716.1\|245063_246020_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
CP025345.1\|AZW73712.1\|238117_238528_+\|4-carboxymuconolactone-decarboxylase	unknown	unknown	gnl\|CDD\|131478
CP025345.1\|AZW73722.1\|250686_251628_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
CP025345.1\|AZW73721.1\|249531_250581_+\|phosphoribosylformylglycinamidine-cyclo-ligase	unknown	unknown	gnl\|CDD\|235439
CP025345.1\|AZW73715.1\|241550_243653_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|129868
CP025345.1\|AZW73723.1\|251624_253514_-\|DNA-mismatch-repair-protein-MutL	unknown	unknown	gnl\|CDD\|234630
CP025345.1\|AZW73725.1\|255697_256234_-\|bifunctional-alanine-racemase/tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE	unknown	unknown	gnl\|CDD\|223873
CP025345.1\|AZW73728.1\|258909_259893_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugE	unknown	unknown	gnl\|CDD\|270295
CP025345.1\|AZW76908.1\|254381_255626_-\|N-acetylmuramoyl-L-alanine-amidase	unknown	unknown	gnl\|CDD\|182376
CP025345.1\|AZW73727.1\|257793_258774_-\|AEC-family-transporter	unknown	unknown	gnl\|CDD\|223751
CP025345.1\|AZW73720.1\|248577_249279_-\|DnaA-regulatory-inactivator-Hda	unknown	unknown	gnl\|CDD\|236347
CP025345.1\|AZW73730.1\|260963_262718_+\|gamma-glutamyltransferase	unknown	unknown	gnl\|CDD\|223482
CP025345.1\|AZW73726.1\|256385_257777_+\|class-II-fumarate-hydratase	unknown	unknown	gnl\|CDD\|234779
CP025345.1\|AZW73718.1\|246526_247882_-\|polynucleotide-adenylyltransferase-PcnB	unknown	unknown	gnl\|CDD\|130997
CP025345.1\|AZW73714.1\|240336_241380_-\|C4-dicarboxylate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270320
CP025345.1\|AZW73713.1\|239549_240293_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715

Protein	Function_ID	Function_description	E-value
CP025345.1\|AZW73724.1\|253600_254239_+\|hypothetical-protein	gnl\|CDD\|182775	PRK10847, PRK10847, DedA family protein.	1.10927e-69
CP025345.1\|AZW73729.1\|259957_260857_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176107	cd08415, PBP2_LysR_opines_like, The C-terminal substrate-domain of LysR-type transcriptional regulators involved in the catabolism of opines and that of related regulators, contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate-domain of LysR-type transcriptional regulators, OccR and NocR, involved in the catabolism of opines and that of LysR for lysine biosynthesis which clustered together in phylogenetic trees. Opines, such as octopine and nopaline, are low molecular weight compounds found in plant crown gall tumors that are produced by the parasitic bacterium Agrobacterium. There are at least 30 different opines identified so far. Opines are utilized by tumor-colonizing bacteria as a source of carbon, nitrogen, and energy. NocR and OccR belong to the family of LysR-type transcriptional regulators that positively regulates the catabolism of nopaline and octopine, respectively. Both nopaline and octopalin are arginine derivatives. In Agrobacterium tumefaciens, NocR regulates expression of the divergently transcribed nocB and nocR genes of the nopaline catabolism (noc) region. OccR protein activates the occQ operon of the Ti plasmid in response to octopine. This operon encodes proteins required for the uptake and catabolism of octopine. The occ operon also encodes the TraR protein, which is a quorum-sensing transcriptional regulator of the Ti plasmid tra regulon. LysR is the transcriptional activator of lysA gene encoding diaminopimelate decarboxylase, an enzyme that catalyses the decarboxylation of diaminopimelate to produce lysine. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.62875e-38
CP025345.1\|AZW73719.1\|247882_248581_-\|HAD-IB-family-hydrolase	gnl\|CDD\|319796	cd02612, HAD_PGPPase, phosphatidylglycerol-phosphate phosphatase, similar to Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C. This family includes Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C, PgpC (previously named yfhB) which catalyzes the dephosphorylation of phosphatidylglycerol-phosphate (PGP) to phosphatidylglycerol (PG). This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	3.91431e-64
CP025345.1\|AZW73717.1\|246038_246530_-\|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase	gnl\|CDD\|172582	PRK14092, PRK14092, 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.	2.78166e-87
CP025345.1\|AZW73716.1\|245063_246020_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	6.01101e-118
CP025345.1\|AZW73712.1\|238117_238528_+\|4-carboxymuconolactone-decarboxylase	gnl\|CDD\|131478	TIGR02425, putative_gamma-carboxymuconolactone_decarboxylase, 4-carboxymuconolactone decarboxylase. Members of this family are 4-carboxymuconolactone decarboxylase, which catalyzes the third step in the catabolism of protocatechuate (and therefore the fourth step in the catabolism of para-hydroxybenzoate, of 3-hydroxybenzoate, of vanillate, etc.). Most members of this family are encoded within protocatechuate catabolism operons. This protein is sometimes found as a fusion protein with other enzymes of the pathway, as in Rhodococcus opacus, Streptomyces avermitilis, and Caulobacter crescentus. [Energy metabolism, Other].	1.36265e-47
CP025345.1\|AZW73722.1\|250686_251628_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	4.17279e-156
CP025345.1\|AZW73721.1\|249531_250581_+\|phosphoribosylformylglycinamidine-cyclo-ligase	gnl\|CDD\|235439	PRK05385, PRK05385, phosphoribosylaminoimidazole synthetase; Provisional.	0
CP025345.1\|AZW73715.1\|241550_243653_+\|hypothetical-protein	gnl\|CDD\|129868	TIGR00786, TRAP_transporter_permease_protein_SiaT, TRAP transporter, DctM subunit. The Tripartite ATP-independent Periplasmic Transporter (TRAP-T) Family (TC 2.A.56)- DctM subunit TRAP-T family permeases generally consist of three components, and these systems have so far been found in Gram-negative bacteria, Gram-postive bacteria and archaea. Only one member of the family has been both sequenced and functionally characterized. This system is the DctPQM system of Rhodobacter capsulatus (Forward et al., 1997). DctP is a periplasmic dicarboxylate (malate, fumarate, succinate) binding receptor that is biochemically well-characterized. DctQ is an integral cytoplasmic membrane protein with 4 putative transmembrane a-helical spanners (TMSs). DctM is a second integral cytoplasmic membrane protein with 12 putative TMSs. These proteins have been shown to be both necessary and sufficient for the proton motive force-dependent uptake of dicarboxylates into R. capsulatus. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	2.77055e-96
CP025345.1\|AZW73723.1\|251624_253514_-\|DNA-mismatch-repair-protein-MutL	gnl\|CDD\|234630	PRK00095, mutL, DNA mismatch repair endonuclease MutL.	0
CP025345.1\|AZW73725.1\|255697_256234_-\|bifunctional-alanine-racemase/tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE	gnl\|CDD\|223873	COG0802, COG0802, Predicted ATPase or kinase [General function prediction only].	2.28113e-54
CP025345.1\|AZW73728.1\|258909_259893_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugE	gnl\|CDD\|270295	cd13577, PBP2_BugE_Glu, Glutamate transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	4.35876e-158
CP025345.1\|AZW76908.1\|254381_255626_-\|N-acetylmuramoyl-L-alanine-amidase	gnl\|CDD\|182376	PRK10319, PRK10319, N-acetylmuramoyl-L-alanine amidase AmiA.	7.29619e-86
CP025345.1\|AZW73727.1\|257793_258774_-\|AEC-family-transporter	gnl\|CDD\|223751	COG0679, COG0679, Predicted permeases [General function prediction only].	1.13912e-41
CP025345.1\|AZW73720.1\|248577_249279_-\|DnaA-regulatory-inactivator-Hda	gnl\|CDD\|236347	PRK08903, PRK08903, DnaA regulatory inactivator Hda; Validated.	2.81236e-100
CP025345.1\|AZW73730.1\|260963_262718_+\|gamma-glutamyltransferase	gnl\|CDD\|223482	COG0405, Ggt, Gamma-glutamyltransferase [Amino acid transport and metabolism].	0
CP025345.1\|AZW73726.1\|256385_257777_+\|class-II-fumarate-hydratase	gnl\|CDD\|234779	PRK00485, fumC, fumarate hydratase; Reviewed.	0
CP025345.1\|AZW73718.1\|246526_247882_-\|polynucleotide-adenylyltransferase-PcnB	gnl\|CDD\|130997	TIGR01942, pcnB, poly(A) polymerase. This model describes the pcnB family of poly(A) polymerases (also known as plasmid copy number protein). These enzymes sequentially add adenosine nucleotides to the 3' end of RNAs, targeting them for degradation by the cell. This was originally described for anti-sense RNAs, but was later demonstrated for mRNAs as well. Members of this family are as yet limited to the gamma- and beta-proteobacteria, with putative members in the Chlamydiacae and spirochetes. This family has homology to tRNA nucleotidyltransferase (cca).	4.58369e-147
CP025345.1\|AZW73714.1\|240336_241380_-\|C4-dicarboxylate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270320	cd13602, PBP2_TRAP_BpDctp6_7, Substrate-binding domain of a pyroglutamic acid binding DctP subfamily of the tripartite ATP-independent periplasmic transporters; contains the type 2 periplasmic binding protein fold. DctP6 and DctP7 groups of the TRAP transporters that involved in pyroglutamic acid transport. TRAP transporters are a large family of solute transporters ubiquitously found in bacteria and archaea. They are comprised of a periplasmic substrate-binding protein (SBP; often called the P subunit) and two unequally sized integral membrane components: a large transmembrane subunit involved in the translocation process (the M subunit) and a smaller membrane of unknown function (the Q subunit). The driving force of TRAP transporters is provided by electrochemical ion gradients (either protons or sodium ions) across the cytoplasmic membrane, rather than ATP hydrolysis. This substrate-binding domain belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.99378e-85
CP025345.1\|AZW73713.1\|239549_240293_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	5.58304e-45

>CP025345.1|AZW73721.1|249531_250581_+|phosphoribosylformylglycinamidine-cyclo-ligase
MTNQHSAPLTYRDAGVDIDAGDALVDRIKPLAARTMRPGVLAGIGGFGALFEVPKKFREPVLVSGTDGVGTKLRLAFDWNRHDTVGIDLVAMSVNDILVQGAEPLYFLDYFACGKLSVDTAAAVVGGIARGCELAGCALIGGETAEMPGMYPDGEYDLAGFAVGAVDKSAIIDGKSIQPGDVVLGLASSGAHSNGYSLVRKILERAGARPDQDFHGQPLVDVVMAPTRIYVKQVLAALDRHGPAIKGLAHITGGGLLDNVPRILQPGMAAQLQRDGWEMPKLFQWLQQQGSVADAEMHRVFNCGIGMVLVVAADQADAVAATLREQGEIVNRIGEIVPQQDGMAQTVVV
>CP025345.1|AZW73720.1|248577_249279_-|DnaA-regulatory-inactivator-Hda
MNRQLLLDVLPAPAPALNNYIAGPNGQALAAAHALTAGRAIYLWGPAGCGRTHLLRGLSARPEAIYIDAARAAQSLRELAEADSTAPMPRLVAVDDVHRMDDARQAGLFALYNRWRESAATGRAFALAVSGDRAPMSLPLREDLRTRLGWDLVFRLDPLSDADKLAALTAQAAERGLQLAPEVINWMLTHHERDIRKLAALLDALDRYSLATGRPITIPLLRAMLADPHSQAT
>CP025345.1|AZW73719.1|247882_248581_-|HAD-IB-family-hydrolase
MTTRRLALFDLDHTLLPLDSDYQWADFLARTGRAGDPAEARRRNDDLMERYNRGELTAEQAAEFMLGLLAAHSPVELAAWHEEFMRDVIRPSLTVQAVDVVRGHLAAGDLCALVTATNSFVTAPIARAFGVQHLIATDPEYRDGRYTGRIEGTPSFREGKVVRVNQWLAGMGLALGDFAESYFYSDSVNDVPLLEAVTRPIAANPSPGLREIAQARGWQVIDLFDHLEDAKS
>CP025345.1|AZW73718.1|246526_247882_-|polynucleotide-adenylyltransferase-PcnB
MITETIRKFVGRLFAPALRGPQRIGAERHGIDRRNVSRHAIKVCDVLRQHGYEAYIVGGAVRDLIVGLEPKDFDVATNATPEQIRPLFRRARIIGRRFQLVHVVFGQEIIETSTFRAPASDDQETDEHGRILRDNVFGSQEEDAARRDFTMNALYYDPHTEEVIDYHQGVQDLKKRQVRIIGDPVKRYREDPVRMLRAVRFAAKLNGSIDTATRQPIRTMASLIENVPASRLFDEMLKLLTCGHAMDCLRQLRNDGLHHGLLPLLDVVLEQPGGENFVELALERTDARVRAGKTISPSFLFAALLWQLVDVRWKQLRAQGEHNIPALVQAADSVLDEQTEKLAIQRRFSSDMREIWFMQPRFERRAGKTIYRMLEQPRFRAACDFLQLRAAAGEFDSVLAQWWMDLANGDDATRAEMIEETAHLPRETGDAPAQKRRRPRRRPSNRPREPQ
>CP025345.1|AZW73717.1|246038_246530_-|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase
MNGSPASTLAYVGLGASLGDAAATLRSVLAELAAAPGILACKASRLYRTAPVEAQGPDFVNAVAALDTTLAPLDLLDLLQALEQRHGRERPYRNAPRTLDLDLLLYGEQAIDHPRLSVPHPRMHERAFVLAPLCELVPALRLAQGDCAALLAALEDQAIEPLR
>CP025345.1|AZW73716.1|245063_246020_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MKKRIWGTLLAAAMTVGSGAAHAGYPDKAVRIVVPFAAGGGVDALARPFAKELGDILGQSIVVENKPSNTGQIGATDVARAAADGYTLLLSSAAFATTPAFYPQVPYDPVKDFSPVMIMAAAPQVLVASNRFKAASLPDVLAQARQSDRINFALSASTGIQALATAMLAGQGGVTFMTIPYKGAGAAFMDLISGEVDLMIDNPASSLVHVRAGKLRVLATTGSKRMAILPDVPTVAETLPGFEARNWFVLAAPQGTPPAVIQKLNEASARALNTPAMRQMLERDGIDLVADSPAHAAAFLQDEIAKWGKVVKEGNLQP
>CP025345.1|AZW73715.1|241550_243653_+|hypothetical-protein
MSSIEMPAPVMPIEPAELAGASPYPLAIDQDFCLIRWMAAISRACGALATVALLLMALSMCYEIFSRYLFNAPTAWATEISGYLLVATVFFGLAAAQASNSHVQVELWIDRLSAPVRLRVELLCQWLALLFCVVLGWQMASFNVREYLNDTRDWGLLSTPQWMPELAVSVGMVVFCMSILVDIYRLSPPAQAWRRWLTPALLALLAAALVALGANAVPMAAGGRFDWGMALIVAALLACAWAWSGVRTLAHVVLVVGGCAVLYGLARGQSLGWVAFLLVASMMLLLFLGVRIGVALGLVGLFGVYFLLSRPQLSLLAERAWSSTNTFTLTAVPMFIFMGGLLLRSGITAGMFDALVRWFGRAPGGLAHASAGASAVFAAVSGSSLATAATLGKVACPDMIERGYSPRLTYGVAAAGATLGILIPPSIPMIIYGTTVGASVTHLFLAGMLPGLLLMACFMLGALVWALAVPGSAPVARAYTLREKLSASRGMVPFVAIIGAVLGSMYTGVATPTEAAAIGAVSAFVLCLVRRQLSWRALFEIAHDSAKVTALLLLIVVGAGIFSWVFDYLRLPREVVNLIQGADLSPALIVAAMVLAYLVLGMFVESIAMMLMTLPVTYPIAMSLGLDPIWFGVFLVLMIELGLITPPVGMVLFVLRSMNEKARFTDIIRGALPFVLIILLFLCLIYIYPQIVMWLPQQVK
>CP025345.1|AZW73714.1|240336_241380_-|C4-dicarboxylate-ABC-transporter-substrate-binding-protein
MSQRFPLPRGFQAALAAAALCTASWSGAAAAQTYDLTMAVITSPGDGYSILTASVPERVAKATDGKVKVTVSDSLVPPAQIATAVREGRVDMSAALHTYLAADEPRMGIFNLPGLINNIQEYKQVCDAFWCEDTRKIWKDKWNAIVLAEGAWCTQQLFSKDPIHKVEDFKGKRLRVHNPQTAEVVNALGGKPVAMPTTEIFPALERGVIDGLFISTCVGGSLEFWRIAKNVQNWSLGPINGWAILANPDSWQKLPADVQKQVQGAMDALQQEAFGNYDTFVSNAQQEMMKKGVTFWVAPEEERAKLMQQQYIGPSYEAWNKRAKQVGFDGPAYLDRVRTTLGKSASN
>CP025345.1|AZW73713.1|239549_240293_-|GntR-family-transcriptional-regulator
MPFPFCNTNRMTSPAAPEGEFKVQRVASVLRHSVTESIRNAILVGRFRPGERLPERELCEMTGVSRTLVREALRQLESEGLIVVIPHRGPVVERLSPEQARGIYQVREELEGLACQLFAEHATEPQLAALQEAFQALKRALTRGTPLEQIAAKNAFYQQLLDGAGNEALTTTLRLLNSRVMLLRSTSMQAPGRAKHSVAELSNLLQALVARDGKAARKAGSLHVRNAASVAIAILQDSLADAAATAE
>CP025345.1|AZW73712.1|238117_238528_+|4-carboxymuconolactone-decarboxylase
MALRPEFQTEQFQKGLAVRRAVVGDAYVDKSLNSADDLTASLQKLVTEYCWGEVWTRPGLERKTRSFLNLAMLIALNRPNELRLHLRGAINNGVTKDEIVEVVLQAAIYCGVPAALDAMKAVREVVETMEKEGAFA
>CP025345.1|AZW73722.1|250686_251628_-|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MTPRAIICLAGPTAAGKSASTLALAQRWPLEIINVDSATIYRGMDIGTAKPSAAERAQVPQHLLDIRDPAQSYSAAEFRADALRLIAEIHARGRIPLLAGGTMLYYKALREGLDDLPQADPALRAELEARAARLGWPALHAELALLDPATAARLSPNDSQRIQRALEICRLAGQPMSALLQGERRGDAPSPYRYVTLSLEPSERAALHARIAQRFDAMLAAGLVEEVRGLHARPDLHPGLPSVRCVGYRQMWSYLDGDIDLDTAREQGVAATRQLAKRQLTWLRAQPERVIIDCLAGDAVARTVDAMARALPD
>CP025345.1|AZW73723.1|251624_253514_-|DNA-mismatch-repair-protein-MutL
MSDRRPIATLPDLLISQIAAGEVIERPASVLKEILENAIDAGARAIEVRLEGGGIRRIAVTDDGSGIPPEELPLALTRHATSKIRSLDELESVASMGFRGEALASIASVADLTIISRTRGAEHAWQIDGGSLQVSPASGPPGTTIDVRQLFDRVPARRKFLRSEATEFGHCVDAMERIALAHPEVAFRLFHHDRAQRQWLPADHGQRIRDVLGAEFVGHVLPVLAAAGAIALMGMVTRPTAARARADRQYLYVNGRFVRDRTVSHALRSAYADVLHGDRQPAYVLYLDIDPGAVDVNVHPAKHEVRFRDSGAVHRFVSQVVGQTLAQTGGAEAVPAGVPDGAAPDTAYAGEPAAAAPGLAEPRAPYPAAYPSPGQSPYQGSPARPHTQVPFRLHGEPAGIPATDWQSLYRPLPGDAAPAATALRAAPATPLPTADEHPLGQALAQLHGIYILAQNSRGLVLVDMHAAHERVVYEQLKRALDDRALPRQDLLVPVVFHAAEKDVALVEEHETQLNELGFEMRPSGPASIAVRSVPALLARGDIESLARAVLRDLGAVGVSRLLTEQRNELLSTMACHGSVRANRRLTLEEMNALLRQMEITERADQCNHGRPTWVQWSVNDLDKLFLRGQ
>CP025345.1|AZW73724.1|253600_254239_+|hypothetical-protein
MLDFFNMVLHIDQTLGIWVEQYGVWVYLVLFLIVFAETGLVVLPFLPGDSLLFIAGAFGATGHMDPVLTAALLIVAAISGNTVNYTIGRYIGPRVFSMNLRFLDRNALMRTHAFYEKHGGKTIVMSRFIPVIRTFAPFVAGVADMRLARFQLFNIGGALLWVISLVAAGYFFGNIPLVREHLNTIVLIGLGAAIVPVVIGALVRLLQVRRGQ
>CP025345.1|AZW76908.1|254381_255626_-|N-acetylmuramoyl-L-alanine-amidase
MRTWPADEYTRVTLELDSELKAEHFTLENPHRLVVDIEGLSVNAALNDLVSKVRHDDPYIQGLRVAQNRPNVVRLVFDLKQSVAPQVFTLKPVADYQYRLVLDLYPKVAQDPLMAILNKQSGPDVDDPLARVLDEIARNQPAPDQPAAPLARGQEPAPALPAPPIKPLPAPGRSASRKRMLTIALDPGHGGEDPGAIGRSGLREKDVVLRIARRLKTLIDAQPYMRAYLTRDDDYFVPLHVRVQKARRVRADLFVSIHADAFIKPTANGSSVFALSERGASSTQARWLADKENAADLIGGVNLGSHDRQVAKVLLDLSTTAQINDSLKVGSAFLDEIKKINRLHKNRVEQAGFAVLKAPDIPSILVETAFISNPKEEALLRSAAHQEKLAQAMMTGIDRYFTANPPLARVGDVS
>CP025345.1|AZW73725.1|255697_256234_-|bifunctional-alanine-racemase/tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE
MSAPPTTLCLHLPDEAATENLARQLAPLVDGRRGGQPGGQIHLQGDLGAGKTAFTRALLRECGIQGRIKSPSYALLESYKVSNLYFYHLDFYRFSDSREWLDAGFRDLLRDDAVVLIEWPERAAGLLPPPDLLISLAYADQGRDASLTAHTARGQTWLNAIVPPPTARSLPAPPPADA
>CP025345.1|AZW73726.1|256385_257777_+|class-II-fumarate-hydratase
MKTRTEKDTFGPIEVPEQHLWGAQTQRSLHFFAISTEKMPVPLVAAMARLKRAAAKVNAELGELDPQVADAIMRAADEVIAGKWPDEFPLSVWQTGSGTQSNMNMNEVLANRASELLGGERGEGRKVHPNDHVNRGQSSNDTFPTAMHVAAAVEVEHRVLPALKALRGTLAAKSAAFYDIVKIGRTHLQDATPLTLGQEISGYVAQLDLAEQQIRATLAGLHQLAIGGTAVGTGLNAHPQFSAKVSAELAHDTGSAFVSAPNKFQALASHEALLFAHGALKTLAAGLMKIANDVRWLASGPRSGLGEISIPENEPGSSIMPGKVNPTQCEAVTMLAAQVMGNDVAINVGGASGNFELNVFKPLVIHNFLQSVRLLADGMVSFDKHCAAGIEPNRERITELVERSLMLVTALNPHIGYDKAAQIAKKAHKENLSLKEAALALGHLTEAQFAEWVVPGDMTNARR
>CP025345.1|AZW73727.1|257793_258774_-|AEC-family-transporter
MSENSSLRRDAEAPLLSIFLPGSMSVALLVLPDFMLVALGWALRHKLGFSREFFAGTERMVYFVLFPALLFQSILRTPISAGHAMQLLQATAALMACGVALAWLAGPVLRPAPVALASAAQCGYRFNTYIGLALAASLAGGPGQTIMALIVGFAVPMANVAAVYGLARHSGNGLLRELARNPLLVSTLLSLACNLAGLSLPGPIDTVMARLGAAALALGIMCVGASLAWEGGKGHGRLIGWMLAVKLAAMPSAALGIAWALGLPALETRMLVLFSALPTASAAYVLAMRMGGDGRMVAVLISLGTLASAATIPLWLTAAAGLGAPN
>CP025345.1|AZW73728.1|258909_259893_+|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugE
MNKVRTLVQAIAVATGLVAAAGAQAADAYPSKAIRVIVPFAPGGSTDIIARLVTQRMSQELGQPMVVENKGGAGGAIGASEAARAEPDGYTLSIATVSTMAVNPACRPKDLPYDPIKDFQPVTNFANTANVVAVNPKFPAKDFKGFLEELKKNPGKYSYGSSGTCGVLHLMGESFKMATGTDIVHVPYKGSGPAVADAVGGQIELIFDNLPSSMPQIQAGKLRAMAIAWPTRIDAIKDVPTFADAGFPVLNQPVWYGLLAPKGTPMDVVNKLRDAAVVALKDPKVIKALDDQGSAPSGNTPEEFAKEIKEQYDWAQDVVKKQNIKLD
>CP025345.1|AZW73729.1|259957_260857_-|LysR-family-transcriptional-regulator
MRLRHIEIFEAIRRTGSLTEAAAALHISQPAASKLLAHAEAQLGFKLFERVKGRLVATREAEILAPEVARLNQDLGSVRRLAASLRDRPHGHLRLGCAPALGLGLLPGVVRASRDAQPGITFDIHTHHSAELVQGLLAHELDLAITFDANNHPGLTRTSLGHTELVHLSRLPGAGTTRLQELGGETLIVLDARDASGSLLQMALDAQGLAPRVAIQVQTHYVACALAEAGCGDAVVDAITARAMLRPGMALRRLEPALRVPISVMTRSQDALSTLHHDFIERLRQACSVLQAQPAPQPE
>CP025345.1|AZW73730.1|260963_262718_+|gamma-glutamyltransferase
MPLRTLLAALCAAAICQAPAWAREAPGVAREDVNPEIASARSERAQAHAQRYMIATANPLASEAGYRILRAGGSATDAIIAAQLVLNLVEPQSSGIGGGAFMVHYDRGAGELRVYDSRETAPAAARPDRFLREGKPLSYAESVNNGRAVGTPGLLRGLELAHRQHGKLPWQALFEPAIAMAEQGFAVSPRLHESIAGDKALAAQPAAARYFYGPDGQAWPVGHRLRNPEFAATLRSIAREGADAFYRGPIARDIVAAVRAHPTPGDLAEADLAGYRAVVREPVCGLYRGYRLCGAPPPSSGPLAVLQMLGELEQYPLARMRPGSVEAVHYFSEAGRLAFADRDFYVADPAFVDVPVRALLDPAYLRQRGALIRPDRSMKTALPGDPQGLLAERARDDAIEVPSTSHLVAVDAAGNVVSMTSTIEAAFGSKIFVRGFLLNNEMTDFSSSYRDPEGRLVANRVEPGKRPRSSMAPMIVFRAGKPVLALGSPGGSAIINYVAKTLVGVLDWKLDVQQAIALPNLGSRNKETELERGTALEALAPALRRMGHEVRITDFPSGIQGIVIGPHGLAGGADPRREGLALGD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP025345_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP025345_2

432035-432128

Orphan

Consensus_repeat	Method
GTGCCTGTCCCCGCCGGGACAGGCAC	CRISPRCasFinder

1 spacers

DEDDh

The CRISPR arrays of CP025345_2

>merge|CP025345|2|432035-432128|CRISPRCasFinder
GTGCCTGTCCCCGCCGGGACAGGCACCCGGGCCCAGGAAAACCCCCACGCTGCGCCCGCTGTGCGGGCGTGCCTGTCCCCGCCGGGACAGGCAC

>CP025345|2|2|432035-432128|CRISPRCasFinder
GTGCCTGTCCCCGCCGGGACAGGCAC	CCGGGCCCAGGAAAACCCCCACGCTGCGCCCGCTGTGCGGGC
GTGCCTGTCCCCGCCGGGACAGGCAC

Protein	Signature genes	Signature genes Name	Protein_function
CP025345.1\|AZW76918.1\|425051_426365_-\|short-chain-fatty-acids-transporter	unknown	unknown	gnl\|CDD\|224942
CP025345.1\|AZW73894.1\|442148_443321_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173841
CP025345.1\|AZW73891.1\|439211_439997_+\|enoyl-CoA-hydratase	unknown	unknown	gnl\|CDD\|181723
CP025345.1\|AZW73880.1\|423524_425036_+\|TRAP-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270238
CP025345.1\|AZW73878.1\|421149_422127_+\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025345.1\|AZW73893.1\|441045_442023_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176106
CP025345.1\|AZW73876.1\|419374_420433_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133030
CP025345.1\|AZW73888.1\|436406_436925_-\|methyltransferase	unknown	unknown	gnl\|CDD\|224204
CP025345.1\|AZW73884.1\|431405_431804_-\|elongation-factor-G	unknown	unknown	gnl\|CDD\|234569
CP025345.1\|AZW73889.1\|437035_437791_+\|TerC-family-protein	unknown	unknown	gnl\|CDD\|223930
CP025345.1\|AZW73877.1\|420562_421057_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
CP025345.1\|AZW73890.1\|437986_439219_+\|CoA-transferase	unknown	unknown	gnl\|CDD\|367110
CP025345.1\|AZW73882.1\|427144_427879_-\|DNA-polymerase-III-subunit-epsilon	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|235574
CP025345.1\|AZW73885.1\|432214_432685_-\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180
CP025345.1\|AZW73887.1\|433217_434618_-\|PLP-dependent-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|224089
CP025345.1\|AZW73881.1\|426555_426735_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377342
CP025345.1\|AZW73892.1\|440063_441035_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270234
CP025345.1\|AZW73886.1\|432773_433118_-\|TIGR01244-family-phosphatase	unknown	unknown	gnl\|CDD\|225984
CP025345.1\|AZW73879.1\|422322_423528_+\|sodium/glutamate-symporter	unknown	unknown	gnl\|CDD\|129314
CP025345.1\|AZW73883.1\|430323_431274_+\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234

Protein	Function_ID	Function_description	E-value
CP025345.1\|AZW76918.1\|425051_426365_-\|short-chain-fatty-acids-transporter	gnl\|CDD\|224942	COG2031, AtoE, Short chain fatty acids transporter [Lipid metabolism].	6.57351e-166
CP025345.1\|AZW73894.1\|442148_443321_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|173841	cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26. Putative acyl-CoA dehydrogenases (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha, beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	4.27565e-82
CP025345.1\|AZW73891.1\|439211_439997_+\|enoyl-CoA-hydratase	gnl\|CDD\|181723	PRK09245, PRK09245, crotonase/enoyl-CoA hydratase family protein.	5.15941e-155
CP025345.1\|AZW73880.1\|423524_425036_+\|TRAP-transporter-substrate-binding-protein	gnl\|CDD\|270238	cd13520, PBP2_TAXI_TRAP, Substrate binding domain of TAXI proteins of the tripartite ATP-independent periplasmic transporters; the type 2 periplasmic binding protein fold. This group includes Thermus thermophilus GluBP (TtGluBP) of TAXI-TRAP family and closely related proteins. TRAP transporters are ubiquitous in prokaryotes, but absent from eukaryotes. They are comprised of an SBP (substrate-binding protein) of the DctP or TAXI families and two unequally sized integral membrane components. Although TtGluBP is predicted to be an L-glutamate and/or an L-glutamine-binding protein, the substrate spectrum of TAXI proteins remains to be defined. A sequence-homology search also shows that TtGluBP shares low sequence homology with putative immunogenic proteins of uncharacterized function. The substrate-binding domain of TAXI proteins belongs to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and tworeceptor cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	9.13066e-82
CP025345.1\|AZW73878.1\|421149_422127_+\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.0826e-23
CP025345.1\|AZW73893.1\|441045_442023_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176106	cd08414, PBP2_LTTR_aromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of aromatic compounds and that of other related regulators, contains type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LTTRs involved in degradation of aromatic compounds, such as CbnR, BenM, CatM, ClcR and TfdR, as well as that of other transcriptional regulators clustered together in phylogenetic trees, including XapR, HcaR, MprR, IlvR, BudR, AlsR, LysR, and OccR. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the substrate-binding domains from ionotropic glutamate receptors, LysR-like transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	2.33368e-60
CP025345.1\|AZW73876.1\|419374_420433_-\|glycosyltransferase	gnl\|CDD\|133030	cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.	4.18053e-89
CP025345.1\|AZW73888.1\|436406_436925_-\|methyltransferase	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	1.12064e-44
CP025345.1\|AZW73884.1\|431405_431804_-\|elongation-factor-G	gnl\|CDD\|234569	PRK00007, PRK00007, elongation factor G; Reviewed.	1.37761e-90
CP025345.1\|AZW73889.1\|437035_437791_+\|TerC-family-protein	gnl\|CDD\|223930	COG0861, TerC, Membrane protein TerC, possibly involved in tellurium resistance [Inorganic ion transport and metabolism].	1.14565e-78
CP025345.1\|AZW73877.1\|420562_421057_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.34959e-07
CP025345.1\|AZW73890.1\|437986_439219_+\|CoA-transferase	gnl\|CDD\|367110	pfam02515, CoA_transf_3, CoA-transferase family III. CoA-transferases are found in organisms from all lines of descent. Most of these enzymes belong to two well-known enzyme families, but recent work on unusual biochemical pathways of anaerobic bacteria has revealed the existence of a third family of CoA-transferases. The members of this enzyme family differ in sequence and reaction mechanism from CoA-transferases of the other families. Currently known enzymes of the new family are a formyl-CoA: oxalate CoA-transferase, a succinyl-CoA: (R)-benzylsuccinate CoA-transferase, an (E)-cinnamoyl-CoA: (R)-phenyllactate CoA-transferase, and a butyrobetainyl-CoA: (R)-carnitine CoA-transferase. In addition, a large number of proteins of unknown or differently annotated function from Bacteria, Archaea and Eukarya apparently belong to this enzyme family. Properties and reaction mechanisms of the CoA-transferases of family III are described and compared to those of the previously known CoA-transferases.	8.36236e-118
CP025345.1\|AZW73882.1\|427144_427879_-\|DNA-polymerase-III-subunit-epsilon	gnl\|CDD\|235574	PRK05711, PRK05711, DNA polymerase III subunit epsilon; Provisional.	2.40573e-142
CP025345.1\|AZW73885.1\|432214_432685_-\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	9.38587e-30
CP025345.1\|AZW73887.1\|433217_434618_-\|PLP-dependent-aminotransferase-family-protein	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	3.43796e-109
CP025345.1\|AZW73881.1\|426555_426735_-\|hypothetical-protein	gnl\|CDD\|377342	pfam04391, DUF533, Protein of unknown function (DUF533). Some family members may be secreted or integral membrane proteins.	0.00323203
CP025345.1\|AZW73892.1\|440063_441035_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270234	cd07012, PBP2_Bug_TTT, Bug (Bordetella uptake gene) protein family of periplasmic solute-binding receptors; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) proteins present in a number of bacterial species, but mainly in proteobacteria. In eubacteria, at least three families of periplasmic binding-protein dependent transporters are known: the ATP-binding cassette (ABC) transporters, the tripartite ATP-independent periplasmic transporters, and the tripartite tricarboxylate transporters (TTT). Bug proteins are the PBP components of the TTT. Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	2.06741e-117
CP025345.1\|AZW73886.1\|432773_433118_-\|TIGR01244-family-phosphatase	gnl\|CDD\|225984	COG3453, COG3453, Uncharacterized protein conserved in bacteria [Function unknown].	3.40043e-35
CP025345.1\|AZW73879.1\|422322_423528_+\|sodium/glutamate-symporter	gnl\|CDD\|129314	TIGR00210, Sodium/glutamate_symport_carrier_protein, sodium--glutamate symport carrier (gltS). [Transport and binding proteins, Amino acids, peptides and amines].	1.2444e-106
CP025345.1\|AZW73883.1\|430323_431274_+\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.02206e-23

>CP025345.1|AZW73884.1|431405_431804_-|elongation-factor-G
MTRRTSIERYRNIGISAHIDAGKATTTERILFYTGITHKLGEVHEGAATMDWMEQEQGRGITITSAATTAFWRGMAGNYPEHRINIIDTPGHVDFTIEVERSMRVLDGACMVYDSVGGVQEVATVMVVLPGQ
>CP025345.1|AZW73883.1|430323_431274_+|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDKYNLLTVHS
>CP025345.1|AZW73882.1|427144_427879_-|DNA-polymerase-III-subunit-epsilon
MRQIIFDTETTGLDPAQGHRIVEIGCVEIVNRMVTGNNLHLYLNPDRDSDPEALAVHGLTTEFLADKPRFAEVAEQFLAFIADAELIAHNAAFDVKFFNAELQRIGRDPLNTHCENIVDSLLHARSLHPGKRNSLDALCDRYGISNAHRTLHGALLDSQLLAEVWLAMTRGQDALLIDVDDQGANANGALVLGKFDASVLTVLAASEAELAEHAAYLQALDKAVGGACAWRAIEPLPAESGQPG
>CP025345.1|AZW73881.1|426555_426735_-|hypothetical-protein
MHPDTNTMLIIIAAAVALMIVGFGLRDRNLGLGLLGIGLIAALATIAYKAYITFNSFYY
>CP025345.1|AZW76918.1|425051_426365_-|short-chain-fatty-acids-transporter
MFKLMSRSAVKMVERYLPDPYVFVVLLTLVAAGAAMIIEGQTPMAVVRWWGNGFWGLLTFAMQMLLVLVTGYMLASTPLVKRMLARLASLATSAGGAIILVSVVSLAASWINWGFGLVVGALFAKQIARQVRVDYRLLVASAYSGFIIWHGGLAGSIPLTIATEGHFSADKIGIIPTGDTIFAVFNLVIVVAMFILVPLVNRLMLPDEKESVYVDPARLEEASVPASDDDKRPAARLENSRLLAWLIAAGGLAYMFDYYVVRGAGLNLNVINFSFLILAILLHGTPRRLLASLDEAIKGGAGIVIQFPFYAGIMAIMMDSGLAATLSEWFVSIASAATLPFWTFISAGIVNIFIPSGGGQWAVQSPIVISAAQALGADMPRVAMAVAWGDAWTNMLQPFWALPVLAIAGLKAKDIMGYCIIQLLVTGVIISVGLSFF
>CP025345.1|AZW73880.1|423524_425036_+|TRAP-transporter-substrate-binding-protein
MTMFIRWLILSACLLLAACSRAPDTEILQRDVGQTLAATYGPDLFDIVALRRMGSATDSTAPPGQTRRVVYYDVVLGLKKDLTLGAWDQPGAAALVSLLGAGPRSISGVKSSGNAAGDQIVAHASAIYQRDAEQWVHVAPASFTATEAPSLDTGAPPPVTRQLLQTLEQITRSVPYSASSTAQHVVQQELERSVARINGRLARLQKGYPLATGPDKGEYLAFGQALAAIGRNEQVRVIPLITGGSADNMAMLRSGAAVAALSQADIAQLAYEGKGPFESQGPFSGLRALGSLYPELVHIVVRQGDGIATVGALRGKKIALGPSGSAVRTTLETVLAAHGLQPGRDYAVIDTPAAAALPQLSEGRVDAVAQVIGTPAAPLRAALTQARLALLPLDRAAIDKLVQADPTLMALDIPANTYPSQAAAIPTVGMAALLVTTADLTRDEAAHMVDVVYRAGQDLLAAGSAQGAQVSAANAGRGLSIPLHDGAVEAFEKLGAPPLPEGR
>CP025345.1|AZW73879.1|422322_423528_+|sodium/glutamate-symporter
MISLTPVQSLLACCLVLVAGRILTTRIGVLSRYSIPDPIVGGLLFAVLATALDTWGGIQISLETNIKPTLLLIFFGCIGLTADLKLLARGGPRLIAFLLALIPFLVLQNAVGLGLAWLLDMHPLMGLIGGTITLVGGHGTGAAYAARFADINNIQDVMALAMTAATIGLVLGGIIGGPVAEWLIRRHKLDPRMAGKDANQVLPEVETTAEAPTATSFITSLTAVFVTVVVGTYLAGLVEDAPISLPNFLWCLATGAIIRNFGGYVGIRLDDRVSEIIGSISLSLFLGLTMMTLDLSSVVRLAGPLALMLVAQALVCALYAGWAVFRMLKRDYEAAVMAAAFCGFAMGATATAIANMQALTRRHGPAPESFIVVPVTGAFLVDILNVIVLTSLIALPFVGGM
>CP025345.1|AZW73878.1|421149_422127_+|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHSYMVRADLAG
>CP025345.1|AZW73877.1|420562_421057_+|GNAT-family-N-acetyltransferase
MPQSYIVRTMRPADVEAVLRVQAAVYPASLLESAALFQNRIEIAPATCQVALDGQDLIGYLIAYPWDAGLPPALDRSLERLPGAADTWFVHDCAVLPAAQGGGVAAALLAGGRAQARRLGLRRASLVALAQAVGYWLRHGYQPLADSDALRAKLAGYGDGARYM
>CP025345.1|AZW73876.1|419374_420433_-|glycosyltransferase
MFMYTEFRSQLLAGAGTSAAGQSARMAVLAGDGATGVQVSCVVPGLNEAANLRVLVPALRACLEQWCASWEIIVVDDGSTDDTAELMAQWSAVEGIRYVQLSRNFGKEAALTAGLEAADGDAVICLDADMQHPPELIGDMLAAWRNGADMVYAVRRQRDDEPWFKRVGARAFYRLLSTARGVEVPPHAGDFRLMDRRVVEALVALPERTRFMKGLYAWVGFKSQAVPYTPQARRHGASHFSAWKLFRLACDGLTAFTTWPLRLVSLIGVLFALLSLSYGGYLVADYLISGNAVSGWTTIVTALLFFAGINLISLGVVGEYVARIFDEVKGRPLFIARQRRGRAKRAAKARSQ
>CP025345.1|AZW73885.1|432214_432685_-|universal-stress-protein
MFKKILIPTDGSPLSAQAANAGICFARSTGAEVVALHVTQPFAATIGFDGMAAAYAITDEDYEKASAEQAEKYLKLILDRAETAGVKAESRAVSNFNVADGIVQAAGEAGCDLIFIGSHGRSGLSRLLLGSVTAKVLSLAHTAVLVYRVKEDKDKK
>CP025345.1|AZW73886.1|432773_433118_-|TIGR01244-family-phosphatase
MSAAIKPLTENFAVAPQLGPADMADVAAAGYKSVIINRPDFEGGPDQPTAADVSQAAQALGLQVEYQPVVGSAMTAADVARFAELLRTMPGPVLAYCRTGTRCTNLFAAAQQLG
>CP025345.1|AZW73887.1|433217_434618_-|PLP-dependent-aminotransferase-family-protein
MRQADATLVTQLADDLARRIDEHGLRPGTRLPSIRRMAEQSGVSRFTVVEAYDRLVARGLVQSRHGAGFFVRARSASLTALASARVPQAAPETPVRVDVSWLLRNMFRETAAGMPGGAGLLPPEWLDPDMVAAAVRAVGRTVRGNLVSYGSPQGYAPLRQQLASMLQADGVPAHPERNLLTTNGVTHGLDIVARHLIKPGDTVLVEDPAWFVIFGRLAAFGARPVGVPRGPDGPDLAMLDRLAAEHKPRLYIINGAVHNPIGHTLSAGAAYDILRLAERHDFMVVEDDTYADLHPGGAMKLAALDRLERVILVGGFSKMLAASLRVGYIAAGAETLQRLTDLKMLAGLTSPELGERVVHRVLVEGQYQRHIERVRARVNEARLRSIQALQQLGLSVPHEPHAGMFVWADCGRDSEPVARNAAERGMLLAPGTLFSPSGAPSTMLRFSVAMVDTPGIWQSIAAVMAQ
>CP025345.1|AZW73888.1|436406_436925_-|methyltransferase
MDTVWMEIWTTVRNEFADIPDVAEATRIVLRLGMAVALGGLLGYERERSGKAAGLRTHMLVALGAALFVLVPLQGGMEVGDLSRVLQGVIAGIGFLGAGVIIKLGNEGEIRGLTTSAGIWLTAAIGVAAGMGREATALASTLIALFVLAALRRLEKRIAARDDKRVVAQPPP
>CP025345.1|AZW73889.1|437035_437791_+|TerC-family-protein
MDYLVSLAQQPAAWAALATLIAMEVVLGIDNLIFISILTNKLPPQHQTKARRIGIGMALILRLALLGTVAFIVQLTQPVFELFGHGFSWRDVILVAGGLFLVWKATKEIHHHVDPNPGDDMFGGKAATLGFAAAVAQILMLDLVFSIDSIITAVGMTEHIPIMFVAVIVAVAVMLLAAEPLARFIERNPTVVMLALAFLMMIGMTLIAEGFGAHVPKGYIYAAMAFSALVEGLNMMARRAREGRGAGAAGG
>CP025345.1|AZW73890.1|437986_439219_+|CoA-transferase
MSGPLEGVRILDVTTVLMGPYATQILGDLGADVIKVEPPAGDNVRGIGPGRHADMGGIFLHANRSKRSIALDLKNPAGREALLKVAATCDVLVYNVRPQAMARLGLSYAEVAQANPSILYVGMYGYDQRGPYAARAAYDDLIQGAVGIPSLSVEAGSDIPRYAPSAMVDRIVGISAANAVTAGLYHRARTGQGQAIDVPMFETMAHLILGDHMMGQTFEPPLGPPGYPRILNADRRPYATRNGHICVLLYADKHWKAFFELIGQPGRDAADPRFRDIGTRTQHIHAIYRLVSDAIASRTTEEWLAAFEAADIPAMPVHTMASLLRDPHLEAIGFFGMVDHPSEGAVRMMAVPSRWSGTPPQPRGHAPRLGEHSVDVLKEAGYDDEAIAALVRNGAAIAAARQLPEGTDHD
>CP025345.1|AZW73891.1|439211_439997_+|enoyl-CoA-hydratase
MTDFLRHERHGGVLLLTMDRERTRNALSDADAVEALVQACARIGADLSVRAVVLTGSHGVFSSGGNLKTLSDTVGAGLGEPVHSLQAYRSGIQRIPLALYNLEVPTIAAVNGPAIGAGCDLACMCDIRLAARQASFAESFVKLGLTPGDGGAWLLPRIVGMSRACELAFTGRSIDAARARELGLVSEVFDADALLPAALALAQEIAQHSGHALRLTKRLLREGQHTRLDTLLELSAGFQALAHHTQEHAGALDAHLSRKRG
>CP025345.1|AZW73892.1|440063_441035_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MHSRTLALALLSVAALAQGGSARAASDYPAHPVKIIVSLPPGSGADTTARFLSKHLAERFKQPFVVENRPGGNSFIAAQAVATAPPDGYTLFVASNSPMTTNAAVFKNLPYDAVKDFAPVAPIARFPMALVVPANSPYRSVADLVAAARAAPGQLNFASGTATYQVVLELFHEQNGIKATHVPYKGTSAALADVAGGVVQYSVADVSAALPLIRGGKLRPLAVTSTRRIKDLPDVPTMQESGNKGFEAYAWTAAFFPAKVDPAIVARVSDAVQALVRSQEGKAFMEQLGGEPFVGGPDTLAAFQRDELASMRRIAKLANIQQE
>CP025345.1|AZW73893.1|441045_442023_-|LysR-family-transcriptional-regulator
MWTGQYIVHIASPAHHWRRAVELRQLKQLLVLSETLNFHRAAERLHMAQPPLSTAIKKLEQELGVQLFERLPAGLQPTPAAEVVLRYARATLFYADEIQRAAQEGASGKQGMLKVGFVGSSIYSLMPQLLSAFRKDYPRVDLVIEESTTVDLLRRLDAHTLDVALVRFPVLEPSTARITLLQADHLMLAVPAGSRYAQRDDVALDELADEPFIGYSRTHVPGMHALIMYAFQQYGVVPHIAQEAIQVQTILSLVESGLGLAIVPKVACRQAGSGVRLVNVPQLAETIKVGIALAVHPDNATPTTANFVDMACRLMQTEPAAGQAR
>CP025345.1|AZW73894.1|442148_443321_+|acyl-CoA-dehydrogenase
MGAILGTIIEALQLAAIPAHDEALRPAVRAFLDEALREMPADRRARSWMGHDAEFSRALARQGWLGLTLPVEYGGAGRSNFARFVLSEELLAVGAPVSAHWVADRQTAPLILRFGSPAQRAFYLPRIIRGEAFFAIGMSEPDTGSDLASVRTRATPVADGWLLNGRKIWTTNAHRSHYMCALVRTSGAPEDRHRGLSQMIFDLALPGIEIRPIRDIAGDAHFCEVLFDNVLLPHDALVGEEGSGWRQVMAELALERSGPERIYSSMVLLDGWLAHLRCDAAPQRAQVCLAGRLAARLAVLRSMSLAVSQRLEQGADASLAAVLVKDLGTEFEQAVPELIGQALHASPQPAPDDVLMRTLAYLTLINPTFSLRGGTRHILRGIIARELGLR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP025345_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP025345_3

996330-996424

Orphan

Consensus_repeat	Method
TAAAAGGGCACCCGCAAGGGTGTCCTTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP025345_3

>merge|CP025345|3|996330-996424|CRISPRCasFinder
TAAAAGGGCACCCGCAAGGGTGTCCTTTTATTGCGAAAAGATATCTGGAAGAAAGCCTTTTCAGAGTAAAAGGGCACCCGCAAGGGTGCCTTTTT

>CP025345|3|3|996330-996424|CRISPRCasFinder
TAAAAGGGCACCCGCAAGGGTGTCCTTTT	ATTGCGAAAAGATATCTGGAAGAAAGCCTTTTCAGAG
TAAAAGGGCACCCGCAAGGGTGCCTTTTT

Protein	Signature genes	Signature genes Name	Protein_function
CP025345.1\|AZW74372.1\|997294_998245_-\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025345.1\|AZW74378.1\|1010226_1010877_-\|SCO-family-protein	unknown	unknown	gnl\|CDD\|239266
CP025345.1\|AZW74369.1\|994704_995577_-\|multidrug-DMT-transporter-permease	unknown	unknown	gnl\|CDD\|274527
CP025345.1\|AZW76944.1\|1003476_1004394_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
CP025345.1\|AZW74362.1\|981846_982776_+\|electron-transfer-flavoprotein-subunit-alpha	unknown	unknown	gnl\|CDD\|224936
CP025345.1\|AZW74376.1\|1005201_1008381_+\|multidrug-efflux-RND-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|273335
CP025345.1\|AZW74373.1\|998349_999399_+\|NADP(H)-dependent-aldo-keto-reductase	unknown	unknown	gnl\|CDD\|381320
CP025345.1\|AZW74365.1\|985759_986794_+\|sulfate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224529
CP025345.1\|AZW74371.1\|996473_997199_+\|CoA-pyrophosphatase	unknown	unknown	gnl\|CDD\|239518
CP025345.1\|AZW76943.1\|999536_1000553_-\|IS110-family-transposase-IS1663	unknown	unknown	gnl\|CDD\|376773
CP025345.1\|AZW74364.1\|984928_985570_+\|peroxiredoxin	unknown	unknown	gnl\|CDD\|239314
CP025345.1\|AZW74366.1\|988630_989695_+\|sulfate/thiosulfate-import-ATP-binding-protein-CysA	unknown	unknown	gnl\|CDD\|213263
CP025345.1\|AZW74375.1\|1002693_1003425_+\|rRNA-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|224108
CP025345.1\|AZW74367.1\|992888_994163_+\|radical-SAM-protein	unknown	unknown	gnl\|CDD\|275263
CP025345.1\|AZW74370.1\|995882_996263_+\|50S-ribosomal-protein-L19	unknown	unknown	gnl\|CDD\|235418
CP025345.1\|AZW74377.1\|1009829_1010081_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	unknown	unknown	gnl\|CDD\|225170
CP025345.1\|AZW74374.1\|1002061_1002634_-\|chorismate--pyruvate-lyase	unknown	unknown	gnl\|CDD\|225703
CP025345.1\|AZW74368.1\|994316_994697_+\|hypothetical-protein	unknown	unknown	unknown
CP025345.1\|AZW74363.1\|983019_984846_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173842
CP025345.1\|AZW76942.1\|990492_991401_+\|sulfate-adenylyltransferase-subunit-CysD	unknown	unknown	gnl\|CDD\|235375

Protein	Function_ID	Function_description	E-value
CP025345.1\|AZW74372.1\|997294_998245_-\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	8.66858e-23
CP025345.1\|AZW74378.1\|1010226_1010877_-\|SCO-family-protein	gnl\|CDD\|239266	cd02968, SCO, SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold. Members of this family are required for the proper assembly of cytochrome c oxidase (COX). They contain a metal binding motif, typically CXXXC, which is located in a flexible loop. COX, the terminal enzyme in the respiratory chain, is imbedded in the inner mitochondrial membrane of all eukaryotes and in the plasma membrane of some prokaryotes. It is composed of two subunits, COX I and COX II. It has been proposed that Sco1 specifically delivers copper to the CuA site, a dinuclear copper center, of the COX II subunit. Mutations in human Sco1 and Sco2 cause fatal infantile hepatoencephalomyopathy and cardioencephalomyopathy, respectively. Both disorders are associated with severe COX deficiency in affected tissues. More recently, it has been argued that the redox sensitivity of the copper binding properties of Sco1 implies that it participates in signaling events rather than functioning as a chaperone that transfers copper to COX II.	2.81108e-54
CP025345.1\|AZW74369.1\|994704_995577_-\|multidrug-DMT-transporter-permease	gnl\|CDD\|274527	TIGR03340, phn_DUF6, phosphonate utilization associated putative membrane protein. This family of hydrophobic proteins has some homology to families of integral membrane proteins such as (pfam00892) and may be a permease. It occurs in the vicinity of various types of operons for the catabolism of phosphonates in Vibrio, Pseudomonas, Polaromonas and Thiomicrospira.	3.74356e-26
CP025345.1\|AZW76944.1\|1003476_1004394_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.56316e-67
CP025345.1\|AZW74362.1\|981846_982776_+\|electron-transfer-flavoprotein-subunit-alpha	gnl\|CDD\|224936	COG2025, FixB, Electron transfer flavoprotein, alpha subunit [Energy production and conversion].	1.05379e-120
CP025345.1\|AZW74376.1\|1005201_1008381_+\|multidrug-efflux-RND-transporter-permease-subunit	gnl\|CDD\|273335	TIGR00915, Probable_aminoglycoside_efflux_pump, The (Largely Gram-negative Bacterial) Hydrophobe/Amphiphile Efflux-1 (HAE1) Family. Proteins scoring above the trusted cutoff (1000) form a tight clade within the RND (Resistance-Nodulation-Cell Division) superfamily. Proteins scoring greater than the noise cutoff (100) appear to form a larger clade, cleanly separated from more distant homologs that include cadmium/zinc/cobalt resistance transporters. This family is one of several subfamilies within the scope of pfam00873. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Unknown substrate].	0
CP025345.1\|AZW74373.1\|998349_999399_+\|NADP(H)-dependent-aldo-keto-reductase	gnl\|CDD\|381320	cd19094, AKR_Tas-like, Escherichia coli Tas protein and similar proteins. Escherichia coli Tas protein is the prototype of this family. It is an NADP(H)-dependent aldo-keto reductase that catalyzes the reversible reduction of ketones to the respective alcohols using NADP(H) as a hydride donor.	0
CP025345.1\|AZW74365.1\|985759_986794_+\|sulfate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224529	COG1613, Sbp, ABC-type sulfate transport system, periplasmic component [Inorganic ion transport and metabolism].	0
CP025345.1\|AZW74371.1\|996473_997199_+\|CoA-pyrophosphatase	gnl\|CDD\|239518	cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes. The need of CoAses mainly arises under conditions of oxidative stress. CoAse has a conserved Nudix fold and requires a single divalent cation for catalysis. In addition to a signature Nudix motif G[X5]E[X7]REUXEEXGU, where U is Ile, Leu, or Val, CoAse contains an additional motif upstream called the NuCoA motif (LLTXT(SA)X3RX3GX3FPGG) which is postulated to be involved in CoA recognition. CoA plays a central role in lipid metabolism. It is involved in the initial steps of fatty acid sythesis in the cytosol, in the oxidation of fatty acids and the citric acid cycle in the mitochondria, and in the oxidation of long-chain fatty acids in peroxisomes. CoA has the important role of activating fatty acids for further modification into key biological signalling molecules.	5.50907e-72
CP025345.1\|AZW76943.1\|999536_1000553_-\|IS110-family-transposase-IS1663	gnl\|CDD\|376773	pfam02371, Transposase_20, Transposase IS116/IS110/IS902 family. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS116, IS110 and IS902. This region is often found with pfam01548. The exact function of this region is uncertain. This family contains a HHH motif suggesting a DNA-binding function.	2.74666e-23
CP025345.1\|AZW74364.1\|984928_985570_+\|peroxiredoxin	gnl\|CDD\|239314	cd03016, PRX_1cys, Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine. They are homodimeric thiol-specific antioxidant (TSA) proteins that confer a protective role in cells by reducing and detoxifying hydrogen peroxide, peroxynitrite, and organic hydroperoxides. As with all other PRXs, a cysteine sulfenic acid intermediate is formed upon reaction of 1-cys PRX with its substrates. Having no resolving cysteine, the oxidized enzyme is resolved by an external small-molecule or protein reductant such as thioredoxin or glutaredoxin. Similar to typical 2-cys PRX, 1-cys PRX forms a functional dimeric unit with a B-type interface, as well as a decameric structure which is stabilized in the reduced form of the enzyme. Other oligomeric forms, tetramers and hexamers, have also been reported. Mammalian 1-cys PRX is localized cellularly in the cytosol and is expressed at high levels in brain, eye, testes and lung. The seed-specific plant 1-cys PRXs protect tissues from reactive oxygen species during desiccation and are also called rehydrins.	3.35179e-132
CP025345.1\|AZW74366.1\|988630_989695_+\|sulfate/thiosulfate-import-ATP-binding-protein-CysA	gnl\|CDD\|213263	cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter. Part of the ABC transporter complex cysAWTP involved in sulfate import. Responsible for energy coupling to the transport system. The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.	3.07125e-165
CP025345.1\|AZW74367.1\|992888_994163_+\|radical-SAM-protein	gnl\|CDD\|275263	TIGR04470, hypothetical_protein_ALIPUT_00462, radical SAM mobile pair protein B. Members of this family are the downstream member (B) of a pair of tandem-encoded radical SAM enzymes. Most of these radical SAM gene pairs have an additional upstream regulatory gene in the MarR family. Examples of high sequence identity (over 96 percent) from cassettes in several Treponema species of the oral cavity to those in multiple Firmicutes in the gut microbiome suggest recent lateral gene transfer, as might be expected for antibiotic resistance genes. The function is unknown.	4.71758e-24
CP025345.1\|AZW74370.1\|995882_996263_+\|50S-ribosomal-protein-L19	gnl\|CDD\|235418	PRK05338, rplS, 50S ribosomal protein L19; Provisional.	1.34063e-62
CP025345.1\|AZW74377.1\|1009829_1010081_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	gnl\|CDD\|225170	COG2261, COG2261, Predicted membrane protein [Function unknown].	2.42408e-12
CP025345.1\|AZW74374.1\|1002061_1002634_-\|chorismate--pyruvate-lyase	gnl\|CDD\|225703	COG3161, UbiC, 4-hydroxybenzoate synthetase (chorismate lyase) [Coenzyme metabolism].	1.05194e-17
CP025345.1\|AZW74375.1\|1002693_1003425_+\|rRNA-pseudouridine-synthase	gnl\|CDD\|224108	COG1187, RsuA, 16S rRNA uridine-516 pseudouridylate synthase and related pseudouridylate synthases [Translation, ribosomal structure and biogenesis].	7.73356e-72
CP025345.1\|AZW74363.1\|983019_984846_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|173842	cd01153, ACAD_fadE5, Putative acyl-CoA dehydrogenases similar to fadE5. Putative acyl-CoA dehydrogenase (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	6.94362e-153
CP025345.1\|AZW76942.1\|990492_991401_+\|sulfate-adenylyltransferase-subunit-CysD	gnl\|CDD\|235375	PRK05253, PRK05253, sulfate adenylyltransferase subunit CysD.	0

>CP025345.1|AZW74370.1|995882_996263_+|50S-ribosomal-protein-L19
MNLIAILEQEEIARLTGGNAVTEFAPGDTVVVSVNVVEGTRKRVQAFEGVVIAKRNRGLNSSFIVRKISSGEAVERTFQLYSPQIAGIEVKRRGDVRRAKLYYLRSRSGKSARIKEKLVLKKAKSA
>CP025345.1|AZW74369.1|994704_995577_-|multidrug-DMT-transporter-permease
MSYTSLILVVLAAMAHAAWNLLAKRAAMVGPMFVFAYGLAATILYAPWVIWVLAHDGMVWSWPVVLCILASSMLHLGYSLCLQRGYQVADLSVVYPIARGTGPLLSTMGAFTLLSEPATTTGIAGMLCVVGGVLLIATQGRLGMFRQAQAWIGVRWGVVIGLFIAAYTVVDAYGVKILLIMPVLFDWFTCATRTLMMTPHVLRRRAQYWPAMRGYWHLAIAVGVLSPLGYILVLYALRNGAPLSLVAPAREMSMMLGTLAGMFLLREKVGIGRLAGCLAILAGVVLLGSS
>CP025345.1|AZW74368.1|994316_994697_+|hypothetical-protein
MTIATTLDAATSLPTAVPGRTLGALRRLARAWAGAAVPQRKWPFPPTPPGQAQPCTPCTDSQPRSVQAVQPAQARALHAQAELSGAATQAATQVLSTKAKIIDVLLVAVWGAMIPALMWLGAAGGF
>CP025345.1|AZW74367.1|992888_994163_+|radical-SAM-protein
MASTEHSFSAGFGSPAAAPAALRGRGAVTNVPHRFQQADRVRVDDGWANPDYTAGSDAAALPSVAEALGQGGRRAIPIAVEGADASPNTCAQAPAPRTIVQAEEARKMLSRNDSPDIPFDVAANPYRGCEHGCVYCYARPTHAYLGYSPGLDFETRLVAKANAVAALRAELARPGYRASPINIGSATDAYQPIERTWRLTRGMLELLLQTRHPLTVVTKNALVERDLDLLQDLARQKLVTVFVSITTLDAAMARTLEPRASAPYRRLQTVRTLAQAGVPVGVLVAPVIPFINDESLEHILQEASAAGACYASYTVLRLPWEVKEVFETWLQAHFPDRAQRVLHRIEDLRNGRRNDTAFGSRMRGTGIWADLLRQRFALATRKLDLNRHRPELDTHRFVPPLEPGLPPARGRREARAQPGQLALF
>CP025345.1|AZW76942.1|990492_991401_+|sulfate-adenylyltransferase-subunit-CysD
MSAVMTRSHLDWLESEAIFILREVAAECARPALLFSGGKDSVVLLRLAEKAFRPGRFPFPLLHIDTGHNYDEVISFRDARAAELGETLLVRSVEDSIARGSVALRRETDSRNAAQAVTLLEAIEELGLDACIGGARRDEEKARAKERIFSFRDEFGQWDPKAQRPELWNLFNTRVHRGENMWVFPISNWTELDVWQYIQRERLALPSIYYSHTREVVRRKGLLVPVTRLTPPAEGETVEQLAVRFRTVGDISCTCPVASDAADPAAIIAETAVTDITERGATRMDDQTSEASMERRKREGYF
>CP025345.1|AZW74366.1|988630_989695_+|sulfate/thiosulfate-import-ATP-binding-protein-CysA
MSIEVRGLSKRFGAFRALDEVSLHIETGELVALLGPSGCGKTTLLRIIAGLESADAGSVLFAGEDATEVDVRQRQVGFVFQHYALFKHMTVFENVAFGLRVRHRSQRPSEARIRAKVLDLLGLVQLDWLADRYPAQLSGGQRQRIALARALAVEPRVLLLDEPFGALDAKVRKELRRWLRRLHDELHVASVFVTHDQEEALEVTDRVVLMNAGRIEQVGSPREVWERPATPFVYGFLGDVNQLHGHATRGVWRLGEVALPAPDLPEADNQRAIAYVRPHDIDLARAGTAAPGIPVRLNHVYLAGPSAYLELARQDDQAIIEAQVPEPLFRSLGLKEGEALLAQPRRARVFAVQP
>CP025345.1|AZW74365.1|985759_986794_+|sulfate-ABC-transporter-substrate-binding-protein
MPRNTAGIRGAIVALATVFSLGLPWAVQAQDKQTLLNVSYDPTRELYRAVDEAFIKEYQARAGVDLTVRQSHGGSGRQARSVIDGLDADVVTLALAYDIDAIADRGLLPQDWQKRLPRNSSPYTSTIVFLVRKGNPRQIHDWDDLVKDGVQVITPNPKTSGGARWNYLAAWAYALARNEGSEAKAREFVGQLLSHVPVLDTGARGSTTTFVERGVGDVLLAWENEAFLAREELGPDKFDIVVPSLSILAEPPVAVVDKVVDRKGTRAAAQAYLEYLYTPAAQEIIARNFYRPTDAGVAAKYASRFPKLKLVTIDDPIFGGWRKAQKDHFSDGGTFDQVYQPQRK
>CP025345.1|AZW74364.1|984928_985570_+|peroxiredoxin
MGQLRLGDTAPDFEQKSSIGPLRLYDYLGDSWGVLFSHPADFTPVCTTELGYTAKLAGEFAKRNVKVLALSVDPVDSHTKWIDDINDTQSTTVNFPILADDDRKVSELYDMIHPNANATLTVRSVFVIDPAKKVRLTITYPASTGRNFDEILRVIDSLQLTDSHSVATPVNWKDGEDVIIVPSLKDEAVIKEKFPKGYKALRPYLRITPQPNK
>CP025345.1|AZW74363.1|983019_984846_+|acyl-CoA-dehydrogenase
MTYATPLQDFRFALNELAGLEEILKLPGFEEVTPDLVDAILEENARFVQQAIAPLNVAGDTKPPVWNDGQVTTTPGFSQGFADYTAGGWQGLQHPQKWGGQGLPKVVAAPAGENIQAASLAFSLCPMLTDGVIEALLTVGSEAQRQTYVPKLIGGQWTGTMNLTEPQAGSDLAQVATRAVRQDDGSYRLSGQKIFITYGEHDLAENIIHLVLARTPDAPAGVKGISLFIVPKYLVNEDGSRGKRNDVWCASLEHKLGIHGSPTAVLLYGAGKGEVGEGAVGYLVGEANRGLEYMFIMMNAARYSVGQQGIGVSERAYQHAQAYARERVQGRAIEGSAAPVTIAHHPDVQRMLLTMRALTEAARAVSYVAAAAHDKGTHHPDAEVRARNRAFYEYLVPIVKGFSTESAVEVASLGIQVHGGMGFIEETGAAQHYRDARILPIYEGTTAIQANDLVGRKTLRDGGATAHASIAAMRDTLKAVAAEAQRADTADHTALRVLRDNFDQAIQSYEGAVEFILAHAASNVRAVYSSSVPYLMLAGVVHGGWQMARAALACRRHLAAGSGDAFHRHKLGTALFYGAHILPRALALAAAVRAGDVADSCGSMADIA
>CP025345.1|AZW74362.1|981846_982776_+|electron-transfer-flavoprotein-subunit-alpha
MTTLVIAEHDNAQLKGATLNTIAAASRLGGEVHVLVAGSGAQAVAEQAAQAARVSKVLLADAPQLAEGLAENLAAQVLAVAGGYSHILFAATASGKNVAPRVAAKLDVAQISDIIGVESADTFQRPIYAGNAIATVQSGDAVKVITVRTTGFDAVAAQGGSAAVEALDAVADSGLSRFVGREVAKSDRPELAGARVVVSGGRGLGSAENFKILDPLADKLGAALGASRAAVDAGYAPNDWQVGQTGKIVAPQLYVAVGISGAIQHLAGMKDSKVIVAINKDPEAPIFGVADYGLVGDLFQVVPELTGAL
>CP025345.1|AZW74371.1|996473_997199_+|CoA-pyrophosphatase
MSDSAPSRPRRTPVRPLFDPMAQPWETANQGLARVDERLLTPPELRSSLRPADHWRLDPLCAAEPRAPGREGSLVAAAVLIPLVMRADGVRVMLTQRAAHLHDHAGQVSFPGGRIEVSDATPVAAALREAQEETGLPVQQVEVLGSMPQYFTATGFAITPVVSLVQPDFELAPDAFEVAEVFEVPLSFLMDPANHRLYRAALPDGYVRQYYAMPWQRYFIWGATAGMLRNLYQTVREALPG
>CP025345.1|AZW74372.1|997294_998245_-|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS
>CP025345.1|AZW74373.1|998349_999399_+|NADP(H)-dependent-aldo-keto-reductase
MKYRKLGHTDLDVSLIGLGTMTWGEQNTEAQAHEQLDYALAHGINLVDAAEMYPVPPKPETQGRTESCIGSWLARTGRRHEVVLASKAAGPVRDAKRPSHIRDGKTFLDRKNLTQALDASLKRLQTDYLDLYQLHWPDRTTNTFGKLAYPWVDDAHTVPIEETLEVLQDFVRAGKVRHVGLSNETPWGVARFLQAAEKHGLPKVATIQNPYNLLNRIFEIGLAEFSHREGVGLLAYSPLAMGILSGKYLDGARPEGSRLALFTRFTRYSNPQAEAAARDYVMLARDHGLAPAQMALAWVNQRPFVSSNLMGATTLAQLKENIESVEVTLSDEVLQGIEAIHARQPNPAP
>CP025345.1|AZW76943.1|999536_1000553_-|IS110-family-transposase-IS1663
MADSSLLSAGGQVHVFIGIDVSKAKLDCTLLTAEADKCKTKVVVNTAAGVQALLAWCAKHGAQPAQLHAILEPTGLYHEQAATALPQVRVSLVNPAQARDFAKALALRSKNDALDSYVLARYGQTLSPALWHPAPLHARQLRALLTRREALSKDLLRELNRKEKSQFSPSAPLVDGSIDKAIAFLREQIKQIERAIDQHIDNHPDLKQDCELLNSIPAIGPQAGNAILAVMHNRHIDSAQSLAAYLGVVPVQRQSGSSLNSCARLSKAGPSQVRATLYMAALVGTRHNPHIRALYQRLLKAGKSKKAALGAAMRKLVHLCFGVLKNRIPYQPNYAMNG
>CP025345.1|AZW74374.1|1002061_1002634_-|chorismate--pyruvate-lyase
MTTPIPLARGWLPAAPSTLDPLRKYWLFRPGALTAGLRQLGHVRLRVLAEYPTGAPRDEADGMRIAAQSPVWVREVLMSIDGVDSVVARSLTPLRASHGVWQGMRRLLTRPLADMLYHDPGIHRSVFVCRRLAAGVPFHATAIARAPAGGPEPALWARRSAFWRAGQPLLVAECFLPAFWSLARAPVAPR
>CP025345.1|AZW74375.1|1002693_1003425_+|rRNA-pseudouridine-synthase
MEKVRISKLMSERGLCSRREADSYIERGWVRVDGVVVSELGARALPDQVITLERAAAARQTARVTILLHKPVGYVSGQAEKGYTPAVALIDARSRYAGDRAPQRFERGQLQGLAVAGRLDIDSQGLLVLTQDGRIAKKLIGEDSEVDKEYLVRVQGRLSEAGLALLNHGLSLDGKPLRPAQVRWQNADQLRFVLREGKKRQIRRMCELVGLRVVGLKRVRIGRVSLGDLPAGQWRYLRADERF
>CP025345.1|AZW76944.1|1003476_1004394_-|LysR-family-transcriptional-regulator
MELFVEVARTLSFGRAAENLAIPKSTLSRQVAELERSVGLRLLSRTTRRVELTEAGQLYFERCQRIVAEARIAHEELQNLVETPSGPLRVNMPADFGTDFLSEAFTEFSRRYPEVTFYLDLASPEHAERVFQTCDVSIEIGDLPDSTHIARLLGVLPAHLYASPDYLARHGEPQHPDDLPRHECIQFRAGTGRVTRWPLNSGERHVEITPGNRFSVNSVSMVRNLATLGAGIAILAPMGNVREDIESGRLKRILPDWLAGPFPVYAVTDTRMLPAKTRIFVEFLMERLSNKTLAGQNNPAFLNLR
>CP025345.1|AZW74376.1|1005201_1008381_+|multidrug-efflux-RND-transporter-permease-subunit
MAKFFIDRPVFAWVIAIVLMMAGALSILSLPVAQYPNIAPPAISINVTYPGASAQTVQDTVVQVIEQQMNGIDNLQYISSESNSDGSMSITLTFSQGTNPDTAQVQVQNKLAVAQPLLPLEVQQQGIRVTKATKNFLIVAGFVSTDGTMDKSDLADYVASYIQDPISRTPGVGNFQLFGAPYAMRIWISPEKLVNFGLTASDVTTAIREQNVQVSSGQLGGQPAVRGQQLNATVIGPSRLQTPEAFGRILLKVNRDGSQVRLKDVASIELGAQTYAIDSYYNGKPASGLAIKLASGANALDTAQAVRETINGLKPYFPPGMDVVYPYDTTPFVSLSIEGVVKTLFEAVLLVFLVMYLFLQNVRATLIPTLAVPVVLLGTFGVLAAFGYSINTLTMFGMVLAIGLLVDDAIVVVENVERVMAEEGLSPRQATRKSMGQITGALIGIAMVLAAVFVPMAFFGGSTGVIYRQFSITIVSSMVLSVVVAIVFTPALCATMLKPIPKGHHGSKKGFFGWFNRTFERSSQAYANNVARSMGRTKRLLLIYVVILLGMAWMFMRIPTAFLPDEDQGILFAQVQAPAGATSERTQATIDAAVKYLLEDEKESVASVFAVNGFSFGGRGQNAAILFIKLRDWNERKGAEHRAAAVAARANAKFRAELRDAQAAVFAPPAVMELGNATGFDFQLQDRAGVGHEKLLAARNQLLQEAGASPMLVAVRPNGIEDAPQYQLDIDREKARALGVSITEINNTLATAWGSSYVNDFIDRGRVKKVFVQGEASSRMLPQDLDKWYVRNNAGDMVPFSAFSSAQWTFGPQKLNRYNGVPSYNIQGQAAPGYSSGDAMAEMERLADKLPLGIGYDWTGLSFEERLSGAQAPALYAISLIVVFLCLAALYESWSIPTAVMLVVPLGVVGALLATMTRGLSNDVYFQVGLLTTIGLAAKNAILIVEFAKEHYEEGASLTEAAVHAARQRLRPILMTSLAFILGVVPLAISTGAGSGSQNAIGTGVIGGMLTGTFLAIFFVPLFFVLTLRLFKVKRASENREDDDPHGGAQPATHGGQPQ
>CP025345.1|AZW74377.1|1009829_1010081_-|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein
MNIIIMIIVGFVVGLITRAIMPGDQNMGYIMTTILGIIGSVVAGFLGQQLGWYAPGEPAGWIGSVVGAIIVLFVVGLVAKKRA
>CP025345.1|AZW74378.1|1010226_1010877_-|SCO-family-protein
MRAPRRRLAVSTMYSPLSGRAWRGLLLAMLMLLAACSERSADWSLYNVKGHLPDLKFSLPGAHGKTVSSDDLKGKTVLLFFGYASCPDVCPTTMAQLTAVLQQLGEQARDVRILFVSVDPHRDTPDILQAYVNEFNSNAIGVTGNEKQIADLARRYRVAYQIEKPKPGDDADIYDVTHSRGVYIFDNQGKARLLASDTDTIDTMVKDLRQLIAQTQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP025345_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP025345_4

3424076-3424185

Orphan

Consensus_repeat	Method
TTGACTGCCAAGACGGTATCTGTCCCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP025345_4

>merge|CP025345|4|3424076-3424185|CRISPRCasFinder
TTGACTGCCAAGACGGTATCTGTCCCCGCAGGGAGGGTGCCTGTCCCCGCCGGGACAGGCACACTGCTGTACGCCATCGACGCTTGACGGCCAAGACGGTATCTGTCCCC

>CP025345|4|4|3424076-3424185|CRISPRCasFinder
TTGACTGCCAAGACGGTATCTGTCCCC	GCAGGGAGGGTGCCTGTCCCCGCCGGGACAGGCACACTGCTGTACGCCATCGACGC
TTGACGGCCAAGACGGTATCTGTCCCC

Protein	Signature genes	Signature genes Name	Protein_function
CP025345.1\|AZW76310.1\|3418421_3418889_-\|ribonuclease-HI	unknown	unknown	gnl\|CDD\|178927
CP025345.1\|AZW76313.1\|3420533_3421943_+\|lytic-transglycosylase	unknown	unknown	gnl\|CDD\|182727
CP025345.1\|AZW76318.1\|3426468_3427419_-\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025345.1\|AZW76321.1\|3432118_3433459_-\|cytochrome-ubiquinol-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|376587
CP025345.1\|AZW76309.1\|3417474_3418425_+\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025345.1\|AZW76315.1\|3424186_3424579_-\|OsmC-family-peroxiredoxin	unknown	unknown	gnl\|CDD\|224679
CP025345.1\|AZW76323.1\|3435449_3436328_+\|septum-site-determining-protein-MinC	unknown	unknown	gnl\|CDD\|178806
CP025345.1\|AZW76324.1\|3436440_3437256_+\|septum-site-determining-protein-MinD	unknown	unknown	gnl\|CDD\|225447
CP025345.1\|AZW76317.1\|3425401_3426400_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
CP025345.1\|AZW76307.1\|3410742_3413721_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375438
CP025345.1\|AZW76312.1\|3419722_3420523_+\|hydroxyacylglutathione-hydrolase	unknown	unknown	gnl\|CDD\|274569
CP025345.1\|AZW76319.1\|3428923_3429625_+\|DNA-binding-response-regulator	unknown	unknown	gnl\|CDD\|181883
CP025345.1\|AZW76308.1\|3414647_3415526_+\|fatty-acid-desaturase	unknown	unknown	gnl\|CDD\|366126
CP025345.1\|AZW76322.1\|3433574_3435338_+\|glutamine--tRNA-ligase	unknown	unknown	gnl\|CDD\|235424
CP025345.1\|AZW76316.1\|3424716_3425397_+\|DUF533-domain-containing-protein	unknown	unknown	gnl\|CDD\|377342
CP025345.1\|AZW76320.1\|3429624_3431049_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|236531
CP025345.1\|AZW76311.1\|3418931_3419702_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369777
CP025345.1\|AZW76305.1\|3409438_3410389_-\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025345.1\|AZW76314.1\|3422037_3422823_+\|enoyl-[acyl-carrier-protein]-reductase-FabI	unknown	unknown	gnl\|CDD\|180789
CP025345.1\|AZW76306.1\|3410375_3410744_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP025345.1\|AZW76310.1\|3418421_3418889_-\|ribonuclease-HI	gnl\|CDD\|178927	PRK00203, rnhA, ribonuclease H; Reviewed.	4.07937e-102
CP025345.1\|AZW76313.1\|3420533_3421943_+\|lytic-transglycosylase	gnl\|CDD\|182727	PRK10783, mltD, membrane-bound lytic murein transglycosylase D; Provisional.	5.28635e-76
CP025345.1\|AZW76318.1\|3426468_3427419_-\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	7.3142e-23
CP025345.1\|AZW76321.1\|3432118_3433459_-\|cytochrome-ubiquinol-oxidase-subunit-I	gnl\|CDD\|376587	pfam01654, Cyt_bd_oxida_I, Cytochrome bd terminal oxidase subunit I. This family are the alternative oxidases found in many bacteria which oxidize ubiquinol and reduce oxygen as part of the electron transport chain. This family is the subunit I of the oxidase E. coli has two copies of the oxidase, bo and bd', both of which are represented here In some nitrogen fixing bacteria, e.g. Klebsiella pneumoniae this oxidase is responsible for removing oxygen in microaerobic conditions, making the oxidase required for nitrogen fixation. This subunit binds a single b-haem, through ligands at His186 and Met393 (using SW:P11026 numbering). In addition His19 is a ligand for the haem b found in subunit II.	2.21087e-123
CP025345.1\|AZW76309.1\|3417474_3418425_+\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.05216e-23
CP025345.1\|AZW76323.1\|3435449_3436328_+\|septum-site-determining-protein-MinC	gnl\|CDD\|178806	PRK00030, minC, septum site-determining protein MinC.	3.47756e-166
CP025345.1\|AZW76324.1\|3436440_3437256_+\|septum-site-determining-protein-MinD	gnl\|CDD\|225447	COG2894, MinD, Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning].	7.6448e-163
CP025345.1\|AZW76317.1\|3425401_3426400_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	7.76869e-129
CP025345.1\|AZW76307.1\|3410742_3413721_+\|hypothetical-protein	gnl\|CDD\|375438	pfam17936, Big_6, Bacterial Ig domain. This domain is found in a wide variety of extracellular bacterial proteins often in multiple tandem copies.	1.32844e-07
CP025345.1\|AZW76312.1\|3419722_3420523_+\|hydroxyacylglutathione-hydrolase	gnl\|CDD\|274569	TIGR03413, GSH_gloB, hydroxyacylglutathione hydrolase. Members of this protein family are hydroxyacylglutathione hydrolase, a detoxification enzyme known as glyoxalase II. It follows lactoylglutathione lyase, or glyoxalase I, and acts to remove the toxic metabolite methylglyoxal and related compounds. This protein belongs to the broader metallo-beta-lactamase family (pfam00753). [Cellular processes, Detoxification].	2.85848e-146
CP025345.1\|AZW76319.1\|3428923_3429625_+\|DNA-binding-response-regulator	gnl\|CDD\|181883	PRK09468, ompR, osmolarity response regulator; Provisional.	4.05363e-90
CP025345.1\|AZW76308.1\|3414647_3415526_+\|fatty-acid-desaturase	gnl\|CDD\|366126	pfam00487, FA_desaturase, Fatty acid desaturase.	2.20669e-12
CP025345.1\|AZW76322.1\|3433574_3435338_+\|glutamine--tRNA-ligase	gnl\|CDD\|235424	PRK05347, PRK05347, glutaminyl-tRNA synthetase; Provisional.	0
CP025345.1\|AZW76316.1\|3424716_3425397_+\|DUF533-domain-containing-protein	gnl\|CDD\|377342	pfam04391, DUF533, Protein of unknown function (DUF533). Some family members may be secreted or integral membrane proteins.	5.6465e-62
CP025345.1\|AZW76320.1\|3429624_3431049_+\|ATP-binding-protein	gnl\|CDD\|236531	PRK09467, envZ, osmolarity sensor protein; Provisional.	3.78414e-42
CP025345.1\|AZW76311.1\|3418931_3419702_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	9.0439e-10
CP025345.1\|AZW76305.1\|3409438_3410389_-\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	5.27808e-22
CP025345.1\|AZW76314.1\|3422037_3422823_+\|enoyl-[acyl-carrier-protein]-reductase-FabI	gnl\|CDD\|180789	PRK06997, PRK06997, enoyl-[acyl-carrier-protein] reductase FabI.	1.22848e-177
CP025345.1\|AZW76315.1\|3424186_3424579_-\|OsmC-family-peroxiredoxin	gnl\|CDD\|224679	COG1765, COG1765, Predicted redox protein, regulator of disulfide bond formation [Posttranslational modification, protein turnover, chaperones].	4.86152e-16

>CP025345.1|AZW76314.1|3422037_3422823_+|enoyl-[acyl-carrier-protein]-reductase-FabI
MGFLAGKRILMTGVLSNRSIAYGIARACRDQGADLAFTYVGDRFKERITEFAASFGSDIVLPCDVAEDSQIDAAFAELGKRWDGLDGLVHAIGFAPREAIAGDFLDGLSRENFRIAHDISAYSFPAMAKAALPLMEGRKGSVLTLSYLGSERVVANYNTMGLAKASLEASVRYLATALGPRGIRANAISAGPIKTLAASGIKDFSSILKFVEANAPLRRNVTIEDVGNVAAFMLSDLAAGITGEITHVDAGFSTVVPGMEN
>CP025345.1|AZW76313.1|3420533_3421943_+|lytic-transglycosylase
MRFLRLLLPLFLAVLAGCAGTAKQNQAAGPSSNRYIAQDTSRTVDLTSPPSDAWDRIRRGFAIPNLNTDLAQEWTDYYASHPESVQRMAERAGKYLYFIVDEINRRGLPTELALLPFVESAYNPTALSRSQASGLWQFIPTTGQHFNLKQDWWRDERRDPIASTYAALDYLEKLFEMQGDWYLALASYNWGEGSVQRAMAKNEAAGLSTDYLSLNMPDETRNYVPKLQAIKNIIANPRKFAVVLPPVENTPYFVAVQKNRDIDIELAARLAEMPLDEFKALNPAFNRPLIRGEHAPTLLLPADRADRFNANLQNYKGDLSSWKVYHTRRGESYAAIAKRFGISEAKLRASNDIGSKRKVAADQALLIPGVPSGDGAANIQLASLSPPVGALDNVGEPRAAAAPRGKAPARVASARPNVRTHKVSSGDTLFGLARKYGTSVGALRALNNLKGNNLKLGSQLRIPGTGTRG
>CP025345.1|AZW76312.1|3419722_3420523_+|hydroxyacylglutathione-hydrolase
MQTAPPLSAVVPLPAFSDNYIWALAHEGQAAVVDPGDAAPVLRWLRATGATLRAILLTHHHPDHVGGVLELVQATGATVYGPAGETLPHCDVRLAEGDRVTLPELALALEVLDVPGHTAGHIAYTGRAAGVERVLFCGDTLFAGGCGRLFEGTPAQMLDSLEKLSALPADTQVCCAHEYTLANLRWALAVEPANRTLQQWYQRAQELRNEGTPTLPSTIGQERETNPFLRTPHAAVAHAAAVWSGRSLATPVEVFAALRQWKNNFK
>CP025345.1|AZW76311.1|3418931_3419702_-|class-I-SAM-dependent-methyltransferase
MAEETPPIVELAEWFQTPPGQYVLAWEQAQFDEAVADIFGYYAWQVGLAEPNLLRANRMPFKAWVGAGVPPPELAQGWQACVAAAPEALPFESQSVDLLVLPHAFECAEAPHLVLREVERVLVPEGRVVISGFNPWSLWGARNLMPGMEAWLPLPLSAQVALPRLKDWFKLLSFEVERGRFGCYAPACRTDKWLRRWRFMERYGQRWWGLGGAVYVVTATKKVAAMRLIGPAWKTRRKRAQAASVVVNRQADDPGR
>CP025345.1|AZW76310.1|3418421_3418889_-|ribonuclease-HI
MQNLEGSGDGQQVEMWTDGACKGNPGPGGWGVLMRAGQHEKTMHGGERQTTNNRMELMAVIEGLRALKRPCRVTIHTDSQYVMKGMTEWLANWKRRGWRTADKKPVKNVELWQALDEQVGRHQVQWRWVRGHAGDPGNERADALANQGMEAARGR
>CP025345.1|AZW76309.1|3417474_3418425_+|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT
>CP025345.1|AZW76308.1|3414647_3415526_+|fatty-acid-desaturase
MVRPAEWLRHRRDWQSVLYLAALPALAAWQWVHGWHWALYAPMLFLTLGVGVIHHNHAHRRMWRPRWLNRLTDFWLTLLQGHPTFVFHAAHNANHHRYKHGPRDVARTYRFGGDTNHLAGYLLHPLQAVVVLYPLFLASLRRLRSRRPGVWRYCLRQYAAWLGLWGGLLALDPGKAFWLVIVPQLHGLHWLLATNYLQHAHADGGPGRHAALSYARNFEGWVNPLLFNIGLHTAHHENPRAHWSELRALHWQHYRDRVPSRLNERGLAPYMARVFVLGLFSRRCRTHTLMRP
>CP025345.1|AZW76307.1|3410742_3413721_+|hypothetical-protein
MQLWLPDGTATSVRANAAGGFEASSAGDMTSGLIRARATDRYGDTSQEVTYAYTDTVDKTAPVLSIAGVATDEATGRVTVTGRSEPDAQVTIRFPGGGRKTVRADANGAYRVRSDGDLPAGVIVVQAADAAGNSTQAQQAYQDTVDRTAPEPVQIALDTDAATGRLTVSGQAEPGGSVTVTWPDGTTQTVRVDADGGFRVTSAGDAAQGDVVVVVADQAGNRAAPVRAHYADPVDRTAPMTPTVRHATDAQTGRVTVMGRTEAGALVTVQFPDGSSKTVRAQNDGGYAATSDTDMVSGPIVVSAGDADGNRTPAQQVMYTDTLDKTAPASPSLTVREDAASGRATVTGQAEPGAAVRVVFPNGEAQTVTAGSDGAYSVTSTADMVAGEITVVAADASGNQSAPARTVFADAVDKTAPAAPTLALSEAADSGRLTVSGRTEPGASVRVTFPDGETVTVTAKADGTYTATSRADMIGGNVTVVATDTAGNAAAPVRAAYADTVDRTPPVLDTPVLNVASDSGRVTVTGVTEPGARVQVAIPGESLQTVTADSAGRYRAVSPGDVLQSGTVRVIATDAHGNASAPRDVPYQDAVDRTAPPLTIEAAVEQARTGVVNVSGKTEPNLMVSATFPDGQTAQARADGQGRYQLASPADVARSGRIAVSASDAAGNRAAARAEFTDQVDKTAPAVTIRAVTEQAGTGVATVSGATEPGATVSVTFPDGQVARATADRSGAYTVHSARDVTARGNISVIATDAAGNASPSVSRQFSNTVADTVPPSLTIAMVTTDPGNGRITVSGVTEAGARVHVVFPGGASDTVTADSKGGYRATSAGDVGSGAVTAQATDASANRSPLKTYAYTDAWQPRQLSAKDFSQSRYFVPLTTRGGTDNEPLLRITTNQQIPTAELRVALKPYKTEDRAGRLVREAITLKWGNAPGVGGDARALHFYVPDSAKAKLRKELTEVERSNDYKFWIEFTDTRFGGVARLYIKVISTL
>CP025345.1|AZW76306.1|3410375_3410744_-|hypothetical-protein
MHVGQGLGDAVHGNAPGGRVGANLGNAQRQDDFLAPRIEHDAVLAPDEILQACAPVEWRGRVLRAAAQLPRQGLAQIQPHAQLDASCEDSIGCMHGSSEPDLRNWKSPPPQFTQGARPDEHP
>CP025345.1|AZW76305.1|3409438_3410389_-|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIPPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT
>CP025345.1|AZW76315.1|3424186_3424579_-|OsmC-family-peroxiredoxin
MTIQVRANTPGGLQYTATAEGHELPLAMPQPQGEGPDPHDYFDTALGGCKALTLMVYAQRKGLPLQAVDVDVVRDASEERKGIYRLTAKLKLHGDLDDAQIDELLKVADKCPLHKLMTATDIQVSTIVVE
>CP025345.1|AZW76316.1|3424716_3425397_+|DUF533-domain-containing-protein
MSARQLLDQLLQSGQSLMQGAGAQAQQATQGGKGTFLAGLGGGALGAGALGLLLGSKKARKIGGKVAMYGGMAALGALAYRAYDQYQRNQAGGAAAPAPQTLDRLPPAPAEQHSNAVLVAMIGAAKADGHIGPDERQLLETELAKLSGDAGDRAWLEAELARPLDPAVIAQQARTPEMGAEMYLASLLVADEQSFMERAYLDELARQLKLPAELKQQLEAQVPAAA
>CP025345.1|AZW76317.1|3425401_3426400_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MRPVAPMTTMKSQVSILLAGCLLGAGAAAAQAPATYPDHAITIVVTFPPGGGTDLLARKLGAAMQQRLGQPVVVENRPGASGNIGARAVAEARPDGYTLLMVNSSFAVNPGVFRNLDFSPTRDFTAVINVAYVPSVIVTAEPAGDAGLPERLRQADTQSRTLAFASCGNGTPQHLAGEMLRQASGAWLQHVPYRGCGPALTDVLSRQVPLGIVTASSAAPFIHAGKLRALAVTSAQRSPLLPDVPTVAEQGAPGYELDQWHGLLAPAGTPPAVIQRLYEALSAIVAEPAMRRELESLGFNPVSEGPERFEALVQADIARFAALTARMGLRAD
>CP025345.1|AZW76318.1|3426468_3427419_-|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWQRPHQGIGRAVPISRLNLDEYNLLTVHS
>CP025345.1|AZW76319.1|3428923_3429625_+|DNA-binding-response-regulator
MDNPHTKLLVVDDDPALRQLLADYLNRHGYDTLLAPDASDLAARITRYAPDLLVLDRMLPGGDGADACRRLRDQGEDIPVILLTARDEAVDRIIGLEAGADDYLGKPFDPRELLARIEAVLRRKRGPSALTKDAPVSFGPFVFDPATRQLLRDDTPVKLTGGEINLLEALVRNAGKPLSRERLLALARDDDGGERNDRAIDIAILRLRRAIEEDPKQPRWIQTVWGIGYRFSP
>CP025345.1|AZW76320.1|3429624_3431049_+|ATP-binding-protein
MKLLRLPAPRSLRMRLILLVLGSVLLAQAATLATVSYFRHKFMEDVAIDYIATTIRTLRASLSQVPTDERAEFVRQASGNQWRLWSRSLPADARLQRWHRGPQEDEAERERMRREYERRHPPPDDIRRDLRGLVSELNERLSDGTRVALSRGPRPEIFISLAPSPSPDDAPPLREWLVIPLERLDPPVATPLIAFWVGGIGLVLLLAAWFSWHITRPLTRLADAADQLAAGQPQRVEPSGPHETRVLGERFNAMLDALAESDSVRRTLLSGLPHDLKGPLSRMWLRIEMADDPTLKEGLRKDLQDMQHMVDQFIGFVRGTDPAAYRYAPLALGEWLAERVGAWQGAGTDIRLQAPDNGALGIQADAVALGRLLDNLIGNALHHGAPPVEVSLRRDADMAVLEVSDHGPGIAPERRTEALRPFARLDDARTRTGNVGLGLALAEAIARAHGGGLELRQAPSGGLLVRITLPLAKA
>CP025345.1|AZW76321.1|3432118_3433459_-|cytochrome-ubiquinol-oxidase-subunit-I
MNIPPLLLARAQFTASLGFLALFLAISLALAWLLLFFKLRARWSGQSGWTAAYRFWVRIFALAFVLALACAVPVLIQLGSLWSGLMDKIGNLAGPLLGYGVLSIFIVKSCFLGVMLFGQRRVSDAAHTLAVLMVAIGQLVAVGWVLALFSWLQTPDGAVLIDGRYQVYDWRAVVLNPSFGWRLGLTVLGAFLTAGFLMLGVTAMQALRRPLDDGERHAFRAGLTVALLASLLLGPVAAGMGEVTARLQPAKAAAAAGFWHSGAEPELVVFGWPSARAQANLAAVSLAGAGGRWLHRDASLGYLGLDKFSGMQPPVAFTFWSLRLALGLGLLMLAASCATLALTCRRGFDPVALPRWWLRVLSLLMFAGALGVVATWCYDLAGMQPYAVNRAVTQSEVLGPVTTPALLYSLAGHIALYAVLLAAFVGMLFHAARYGVVPVRKTGGSS
>CP025345.1|AZW76322.1|3433574_3435338_+|glutamine--tRNA-ligase
MTHAPTPPAASNFLRPIIEDDLQANRFQGKLWAGKPGPAALQAQGQPDPARIRTRFPPEPNGYLHIGHAKSICVNFGLARDYGGVCHLRFDDTNPEKEEQEYVDAIIEAVHWLGFDWQADGNDNLYFASDYFEFMYEFAEALVQAGHAYVDEQSAEEIRASRGTLTEPGTDSPWRDRPADESLLRLREMRDGKHPDGSLVLRARIDMASPNINLRDPVMYRVRHATHHRTGNAWCIYPMYSWAHPVEDALEGITHSICTLEFEDQRPFYDWILARLAELGKLARPLPHQYEFARLNLTYVVTSKRKLLQLVREGYVDGWDDPRMPTLFGLRRRGYTPSSIRLFCDRTAVSKSDSRIDYSLLEQAVRDDLDPVAPRSVAVLDPLKLVITNYPEGRSETCSAPRNPHDPQAGVREFPFTRELWIEQDDFREEPPKKYFRLFPGNTVRLKYGYVVRCTGFTKDESGKVVEVQAEYLPDTKSGTPGADSVKVKGNITWVSAAHAVPAQVHLYDRLFADAHPDGGDKDFLACLNPNSKQTVQAWLEPGIEAVPGATWQFERLGYFTVDSKDSRPEAPVLNRIVTLRDSWQAA
>CP025345.1|AZW76323.1|3435449_3436328_+|septum-site-determining-protein-MinC
MNTESLALDFKSATLYAIRVVLHDADTTRLRAALDKRMADAGSFFENEPVVIDATRVDAPVDWPALLQALADHNLPPIGVVAEGANLQGARDAGLVPVELSTSVARAPQVIDTAPPNDVATPVPSVPEATAEATAKAGPQDDEADGEQADEAPAHNPESVPTRAARETTEANRPTATPPQSSSALVITKPLRSGQRVYARHTDLIVIGMVSQGAEVIADGNVHVYGPLRGKAMAGARGDTSARIFTTQLDAELLAVAGVYRVVEDKLDRALHNQPALVRLDGDTLRIEALKG
>CP025345.1|AZW76324.1|3436440_3437256_+|septum-site-determining-protein-MinD
MTRIVVVTSGKGGVGKTTTSASFSAGLAMRGHKTAVIDFDVGLRNLDLIMGCERRVVYDFVNVIQGEASLKQALIKDKQLENLFILPASQTRDKDALTQEGVEKVIDELKEMGFDYIVCDSPAGIEAGALMAAYFADDALVVTNPEVSSVRDSDRILGILAAKSRRAVQGDEPVKEYLLLTRYNPKRVNDGEMLSLSDIEDILRIKLIGVIPESEAVLQASNQGLPAIHLKDTDVSEAYKDVVARFLGEERSLRFTDYEKPGLLKRLFGGK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 122073

110

Planktothrix_phage(16.67%)

tRNA,transposase,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW73519.1\|0_1920_+\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG	NA	NA	NA	NA
AZW73520.1\|1916_2609_+	ribosomal RNA small subunit methyltransferase G	NA	NA	NA	NA
AZW73521.1\|2605_3403_+	ParA family protein	Q8JL10	Natrialba_phage	5.6e-20	34.9
AZW73522.1\|3409_4171_+	N-acetyltransferase	NA	NA	NA	NA
AZW73523.1\|4214_5132_+	chromosome partitioning protein ParB	I3NLC2	Bifidobacterium_phage	1.9e-16	38.1
AZW73524.1\|6721_7912_+	elongation factor Tu	A0A1V0SLW6	Klosneuvirus	3.1e-14	29.2
AZW73525.1\|8150_8531_+	preprotein translocase subunit SecE	NA	NA	NA	NA
AZW73526.1\|8540_9074_+	transcription termination/antitermination protein NusG	G3MAW2	Bacillus_virus	1.4e-11	30.5
AZW73527.1\|9137_9569_+	50S ribosomal protein L11	NA	NA	NA	NA
AZW73528.1\|9571_10270_+	50S ribosomal protein L1	NA	NA	NA	NA
AZW73529.1\|10512_11037_+	50S ribosomal protein L10	NA	NA	NA	NA
AZW73530.1\|11118_11502_+	50S ribosomal protein L7/L12	NA	NA	NA	NA
AZW73531.1\|11661_15774_+	DNA-directed RNA polymerase subunit beta	A0A0N9R0J7	Chrysochromulina_ericina_virus	2.4e-21	28.8
AZW73532.1\|15773_20018_+	DNA-directed RNA polymerase subunit beta'	A0A2I7QNZ7	Vibrio_phage	3.5e-68	24.7
AZW76894.1\|20126_20531_-	lipoprotein	NA	NA	NA	NA
AZW73533.1\|20771_21947_+	hypothetical protein	NA	NA	NA	NA
AZW73534.1\|24352_25459_-	peptidoglycan-binding protein	NA	NA	NA	NA
AZW73535.1\|26470_27286_+	DNA-binding response regulator	NA	NA	NA	NA
AZW73536.1\|27282_28233_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW73537.1\|28314_28650_-	CoA transferase	NA	NA	NA	NA
AZW73538.1\|28674_29109_-	hypothetical protein	NA	NA	NA	NA
AZW73539.1\|29141_30368_-	thiolase family protein	NA	NA	NA	NA
AZW73540.1\|30364_30862_-	dehydratase	NA	NA	NA	NA
AZW76895.1\|31069_31978_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW73541.1\|32163_33006_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW73542.1\|33048_34470_+	MmgE/PrpD family protein	NA	NA	NA	NA
AZW73543.1\|34625_35576_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW73544.1\|35572_36763_-	MFS transporter	NA	NA	NA	NA
AZW73545.1\|36949_37924_+\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
AZW73546.1\|37925_40064_+\|tRNA	glycine--tRNA ligase subunit beta	NA	NA	NA	NA
AZW73547.1\|40060_40600_+	D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase	NA	NA	NA	NA
AZW73548.1\|40603_41332_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
AZW73549.1\|41318_42212_+	M48 family peptidase	NA	NA	NA	NA
AZW73550.1\|42282_42678_+	lactoylglutathione lyase	NA	NA	NA	NA
AZW73551.1\|42687_43218_+	peptide deformylase	E3SLL2	Synechococcus_phage	3.7e-12	35.4
AZW73552.1\|43346_43646_-	DUF1974 domain-containing protein	NA	NA	NA	NA
AZW73553.1\|43663_44614_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW73554.1\|45113_45749_+	hypothetical protein	NA	NA	NA	NA
AZW73555.1\|45720_45957_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
AZW73556.1\|46084_46978_+	hypothetical protein	NA	NA	NA	NA
AZW73557.1\|48147_49395_+	homoserine O-acetyltransferase	NA	NA	NA	NA
AZW73558.1\|49391_50006_+	methionine biosynthesis protein MetW	NA	NA	NA	NA
AZW73559.1\|50141_51092_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW73560.1\|51134_52391_+	MFS transporter	NA	NA	NA	NA
AZW73561.1\|53622_54357_-	aspartate/glutamate racemase family protein	NA	NA	NA	NA
AZW73562.1\|54362_54953_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.2e-20	33.6
AZW73563.1\|54977_55667_-	amino acid ABC transporter permease	NA	NA	NA	NA
AZW73564.1\|55663_56425_-	amino acid ABC transporter permease	NA	NA	NA	NA
AZW73565.1\|56504_57404_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW73566.1\|57497_58448_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW73567.1\|59248_60475_-	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
AZW73568.1\|60474_60894_-	transcriptional regulator	NA	NA	NA	NA
AZW73569.1\|61077_62019_-	hypothetical protein	NA	NA	NA	NA
AZW73570.1\|62442_63279_-	hypothetical protein	NA	NA	NA	NA
AZW73571.1\|63473_64055_-\|protease	protease	NA	NA	NA	NA
AZW73572.1\|64067_64385_-	ferredoxin	NA	NA	NA	NA
AZW73573.1\|64488_65547_-	oxidoreductase	NA	NA	NA	NA
AZW73574.1\|65581_66853_-	TRAP transporter large permease	NA	NA	NA	NA
AZW73575.1\|67482_68664_-	hypothetical protein	NA	NA	NA	NA
AZW73576.1\|69085_70036_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW73577.1\|70129_70444_+\|transposase	transposase	NA	NA	NA	NA
AZW73578.1\|71636_73544_+	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	1.1e-117	37.2
AZW73579.1\|73705_74326_-	glutathione S-transferase	NA	NA	NA	NA
AZW73580.1\|74357_74939_-	1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD	A0A1W6DX33	Sphingobium_phage	1.7e-05	54.3
AZW73581.1\|75027_75279_-	hypothetical protein	NA	NA	NA	NA
AZW76896.1\|75280_76030_-	hypothetical protein	NA	NA	NA	NA
AZW73582.1\|76228_77638_+	signal recognition particle protein	NA	NA	NA	NA
AZW73583.1\|77634_78585_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW76897.1\|78659_79604_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW73584.1\|79600_81475_-	polysaccharide biosynthesis protein	A0A2P1ELS8	Moumouvirus	2.0e-23	26.9
AZW73585.1\|82822_83527_-	DUF2837 domain-containing protein	NA	NA	NA	NA
AZW73586.1\|83523_84630_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
AZW73587.1\|84891_85485_-	sugar transferase	NA	NA	NA	NA
AZW73588.1\|85481_86714_-	UDP-4-amino-4, 6-dideoxy-N-acetyl-beta-L-altrosamine transaminase	NA	NA	NA	NA
AZW73589.1\|86731_87991_-	glycosyltransferase WbuB	NA	NA	NA	NA
AZW73590.1\|88014_89103_-	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A0N9R0B2	Chrysochromulina_ericina_virus	4.8e-46	36.3
AZW73591.1\|89110_90211_-	aminotransferase DegT	A0A2K9L0G1	Tupanvirus	3.3e-31	29.7
AZW73592.1\|90214_90790_-	N-acetyltransferase	NA	NA	NA	NA
AZW73593.1\|90793_91846_-	gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
AZW73594.1\|91976_92984_+	lipopolysaccharide heptosyltransferase I	NA	NA	NA	NA
AZW73595.1\|92985_94272_+	3-deoxy-D-manno-octulosonic acid transferase	NA	NA	NA	NA
AZW73596.1\|94288_94444_-	hypothetical protein	NA	NA	NA	NA
AZW73597.1\|94468_95272_-	type III pantothenate kinase	NA	NA	NA	NA
AZW73598.1\|95268_96135_-	biotin--[acetyl-CoA-carboxylase] ligase	NA	NA	NA	NA
AZW73599.1\|96203_97340_+	ABC transporter permease	NA	NA	NA	NA
AZW73600.1\|97339_98179_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.1e-21	32.4
AZW73601.1\|99111_99714_+	hypothetical protein	NA	NA	NA	NA
AZW73602.1\|99743_100397_+	alpha/beta hydrolase	NA	NA	NA	NA
AZW73603.1\|100529_101786_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	6.2e-66	40.5
AZW73604.1\|101788_102733_+	D-amino acid aminotransferase	NA	NA	NA	NA
AZW73605.1\|102808_103084_+	DUF493 domain-containing protein	NA	NA	NA	NA
AZW73606.1\|103091_103754_+	octanoyltransferase	NA	NA	NA	NA
AZW73607.1\|103815_104817_+	lipoyl synthase	NA	NA	NA	NA
AZW73608.1\|104831_105380_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	3.7e-47	53.4
AZW73609.1\|105437_106334_-	dTDP-4-dehydrorhamnose reductase	NA	NA	NA	NA
AZW73610.1\|106330_107392_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	1.6e-78	44.8
AZW73611.1\|107427_108378_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW73612.1\|109277_110471_+	cystathionine beta-lyase	NA	NA	NA	NA
AZW73613.1\|110552_111182_-	thiol:disulfide interchange protein DsbA	NA	NA	NA	NA
AZW73614.1\|111243_111927_-	SPOR domain-containing protein	NA	NA	NA	NA
AZW73615.1\|111936_113619_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
AZW76898.1\|113906_114254_+	DUF1840 domain-containing protein	NA	NA	NA	NA
AZW73616.1\|114344_114662_+	hypothetical protein	NA	NA	NA	NA
AZW76899.1\|114944_115961_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW73617.1\|116036_116837_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
AZW73618.1\|116833_117709_-	sugar ABC transporter permease	NA	NA	NA	NA
AZW73619.1\|117719_119012_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW73620.1\|119054_120095_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.0e-22	33.7
AZW73621.1\|120200_121022_-	phosphodiesterase	NA	NA	NA	NA
AZW73622.1\|121122_122073_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

164894 : 225405

Diachasmimorpha_longicaudata_entomopoxvirus(11.11%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW73653.1\|164894_165845_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW73654.1\|167288_168191_-	hypothetical protein	NA	NA	NA	NA
AZW73655.1\|168168_168798_-	LemA family protein	NA	NA	NA	NA
AZW73656.1\|169128_170511_+	RNA helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.3e-42	29.5
AZW73657.1\|170544_171174_+	threonine transporter RhtB	NA	NA	NA	NA
AZW73658.1\|171222_172830_+	peptide chain release factor 3	A0A2K9L6L3	Tupanvirus	9.3e-14	37.8
AZW73659.1\|172854_173538_+	hypothetical protein	NA	NA	NA	NA
AZW76905.1\|173619_174096_-	bacterioferritin	NA	NA	NA	NA
AZW73660.1\|174302_175253_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW73661.1\|176368_176896_+	lipoprotein	NA	NA	NA	NA
AZW73662.1\|176987_177803_+	lipoprotein	NA	NA	NA	NA
AZW73663.1\|177863_178598_+	sulfurtransferase	NA	NA	NA	NA
AZW73664.1\|178635_180714_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	1.5e-27	23.6
AZW73665.1\|180963_181236_-	hypothetical protein	NA	NA	NA	NA
AZW73666.1\|181334_182423_+	iron-sulfur cluster carrier protein ApbC	NA	NA	NA	NA
AZW73667.1\|182426_184331_+	outer membrane protein assembly factor	NA	NA	NA	NA
AZW73668.1\|184327_188002_+	DUF490 domain-containing protein	NA	NA	NA	NA
AZW73669.1\|188062_188626_+	dCTP deaminase	S5VM63	Pseudomonas_phage	2.6e-72	75.3
AZW73670.1\|188633_189056_-	glyoxalase	NA	NA	NA	NA
AZW73671.1\|189083_189503_-	glyoxalase/bleomycin resistance/dioxygenase family protein	NA	NA	NA	NA
AZW76906.1\|189531_189978_-	N-acetyltransferase	Q9AZG4	Lactococcus_phage	1.2e-08	29.4
AZW73672.1\|190104_190602_+	hypothetical protein	NA	NA	NA	NA
AZW73673.1\|190756_193027_+	lysine decarboxylase	NA	NA	NA	NA
AZW73674.1\|193075_194308_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
AZW73675.1\|194406_195357_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW73676.1\|195402_196095_+	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	2.4e-83	73.8
AZW73677.1\|196091_196985_+	ZIP family metal transporter	NA	NA	NA	NA
AZW73678.1\|197379_198480_+	aminomethyltransferase	NA	NA	NA	NA
AZW73679.1\|198561_198936_+	glycine cleavage system protein H	NA	NA	NA	NA
AZW73680.1\|198995_201860_+	glycine dehydrogenase	E3SN07	Prochlorococcus_phage	1.2e-261	51.4
AZW73681.1\|202004_202745_-	FadR family transcriptional regulator	NA	NA	NA	NA
AZW73682.1\|202814_204026_+	CoA transferase	NA	NA	NA	NA
AZW73683.1\|204054_205023_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW73684.1\|205636_206587_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW73685.1\|206743_207067_+	PsiF repeat family protein	NA	NA	NA	NA
AZW73686.1\|207171_208221_-	cyclase	NA	NA	NA	NA
AZW73687.1\|208217_209042_-	3-oxoadipate enol-lactonase	NA	NA	NA	NA
AZW73688.1\|209042_209339_-	YciI family protein	NA	NA	NA	NA
AZW73689.1\|209364_209640_-	muconolactone delta-isomerase	NA	NA	NA	NA
AZW73690.1\|209696_210341_-	CoA transferase subunit B	NA	NA	NA	NA
AZW73691.1\|210340_211027_-	3-oxoadipate CoA-transferase	NA	NA	NA	NA
AZW76907.1\|211156_212008_+	IclR family transcriptional regulator	NA	NA	NA	NA
AZW73692.1\|212058_212784_-	short-chain dehydrogenase	NA	NA	NA	NA
AZW73693.1\|212815_214165_-	short-chain fatty acid transporter	NA	NA	NA	NA
AZW73694.1\|214276_215209_-	3-hydroxybutyryl-CoA dehydrogenase	NA	NA	NA	NA
AZW73695.1\|215666_218462_-\|protease	serine protease autotransporter SphB1	NA	NA	NA	NA
AZW73696.1\|219055_221998_-	phosphoenolpyruvate carboxylase	NA	NA	NA	NA
AZW73697.1\|222069_222789_+	7-cyano-7-deazaguanine synthase QueC	A0A0A0RPC6	Escherichia_phage	8.0e-50	43.9
AZW73698.1\|222827_223376_-	N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	1.2e-21	41.7
AZW73699.1\|223530_224430_+	virginiamycin B lyase	NA	NA	NA	NA
AZW73700.1\|224454_225405_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

233337 : 286925

Bacillus_phage(25.0%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW73708.1\|233337_234288_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW73709.1\|234374_235325_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW73710.1\|235321_236272_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW73711.1\|236370_237168_-	beta-D-hydroxybutyrate dehydrogenase	NA	NA	NA	NA
AZW73712.1\|238117_238528_+	4-carboxymuconolactone decarboxylase	NA	NA	NA	NA
AZW73713.1\|239549_240293_-	GntR family transcriptional regulator	NA	NA	NA	NA
AZW73714.1\|240336_241380_-	C4-dicarboxylate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW73715.1\|241550_243653_+	hypothetical protein	NA	NA	NA	NA
AZW73716.1\|245063_246020_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW73717.1\|246038_246530_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
AZW73718.1\|246526_247882_-	polynucleotide adenylyltransferase PcnB	A0A1B1IVF3	uncultured_Mediterranean_phage	3.4e-25	36.8
AZW73719.1\|247882_248581_-	HAD-IB family hydrolase	NA	NA	NA	NA
AZW73720.1\|248577_249279_-	DnaA regulatory inactivator Hda	NA	NA	NA	NA
AZW73721.1\|249531_250581_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	5.6e-68	43.6
AZW73722.1\|250686_251628_-\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
AZW73723.1\|251624_253514_-	DNA mismatch repair protein MutL	A0A1B2LRQ5	Wolbachia_phage	3.3e-79	32.8
AZW73724.1\|253600_254239_+	hypothetical protein	NA	NA	NA	NA
AZW76908.1\|254381_255626_-	N-acetylmuramoyl-L-alanine amidase	A0A2H4JCM7	uncultured_Caudovirales_phage	4.1e-17	30.3
AZW73725.1\|255697_256234_-\|tRNA	bifunctional alanine racemase/tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
AZW73726.1\|256385_257777_+	class II fumarate hydratase	NA	NA	NA	NA
AZW73727.1\|257793_258774_-	AEC family transporter	NA	NA	NA	NA
AZW73728.1\|258909_259893_+	tripartite tricarboxylate transporter substrate binding protein BugE	NA	NA	NA	NA
AZW73729.1\|259957_260857_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW73730.1\|260963_262718_+	gamma-glutamyltransferase	NA	NA	NA	NA
AZW73731.1\|262725_263850_-	CoA transferase	NA	NA	NA	NA
AZW73732.1\|263863_264844_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW73733.1\|265574_266525_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW73734.1\|267084_267630_+	GbsR/MarR family transcriptional regulator	NA	NA	NA	NA
AZW73735.1\|267713_269333_+	cytochrome d ubiquinol oxidase subunit I	NA	NA	NA	NA
AZW73736.1\|269348_270503_+	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
AZW73737.1\|270516_270642_+	cytochrome bd-I oxidase subunit CydX	NA	NA	NA	NA
AZW73738.1\|270638_272390_+	thiol reductant ABC exporter subunit CydD	W8CYL7	Bacillus_phage	3.4e-09	23.8
AZW73739.1\|272386_274066_+	thiol reductant ABC exporter subunit CydC	W8CYL7	Bacillus_phage	3.6e-16	27.6
AZW73740.1\|274101_274677_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	1.4e-28	43.1
AZW73741.1\|275819_276098_+	DUF4148 domain-containing protein	NA	NA	NA	NA
AZW73742.1\|277141_278092_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW73743.1\|278078_278294_-	hypothetical protein	NA	NA	NA	NA
AZW73744.1\|278369_278531_+	DUF4224 domain-containing protein	NA	NA	NA	NA
AZW73745.1\|278538_278679_+	hypothetical protein	NA	NA	NA	NA
AZW73746.1\|279197_279647_-\|protease	ClpXP protease specificity-enhancing factor	NA	NA	NA	NA
AZW73747.1\|279656_280268_-	glutathione S-transferase	NA	NA	NA	NA
AZW73748.1\|280426_281281_-	cytochrome c1	NA	NA	NA	NA
AZW73749.1\|281300_282683_-	cytochrome b	NA	NA	NA	NA
AZW73750.1\|282747_283389_-	ubiquinol-cytochrome c reductase iron-sulfur subunit	NA	NA	NA	NA
AZW73751.1\|283528_283987_+	large conductance mechanosensitive channel protein MscL	NA	NA	NA	NA
AZW73752.1\|284011_284788_-	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
AZW76909.1\|284841_285978_+	PDZ domain-containing protein	W5SAB9	Pithovirus	1.2e-07	31.2
AZW73753.1\|285974_286925_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

390858 : 448367

Orpheovirus(14.29%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW73852.1\|390858_391809_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW73853.1\|391945_392863_+	reductase	NA	NA	NA	NA
AZW73854.1\|392859_393108_+	glutaredoxin family protein	NA	NA	NA	NA
AZW73855.1\|393104_394310_+	CoA transferase	NA	NA	NA	NA
AZW73856.1\|394382_395378_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW73857.1\|395400_396621_-	CoA transferase	NA	NA	NA	NA
AZW73858.1\|396617_397262_-	hypothetical protein	NA	NA	NA	NA
AZW73859.1\|398992_399802_-	IclR family transcriptional regulator	NA	NA	NA	NA
AZW76915.1\|400019_401060_+	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	6.1e-59	42.5
AZW73860.1\|401158_402142_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW73861.1\|402068_402770_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW73862.1\|402818_403589_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
AZW73863.1\|403585_404827_-	CoA transferase	NA	NA	NA	NA
AZW73864.1\|404931_406638_-	thiamine pyrophosphate-binding protein	NA	NA	NA	NA
AZW73865.1\|406634_407531_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW73866.1\|407571_409161_-	sulfurtransferase	NA	NA	NA	NA
AZW73867.1\|409210_410203_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW73868.1\|410271_410871_-	hypothetical protein	NA	NA	NA	NA
AZW76916.1\|411331_412309_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW73869.1\|412387_413338_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW73870.1\|413426_414341_+	EamA/RhaT family transporter	NA	NA	NA	NA
AZW73871.1\|414337_414997_+	LysE family translocator	NA	NA	NA	NA
AZW73872.1\|415086_416010_+	alpha/beta hydrolase	A0A1C9C5K3	Heterosigma_akashiwo_virus	4.8e-07	27.2
AZW73873.1\|416015_416471_-	hypothetical protein	NA	NA	NA	NA
AZW73874.1\|416467_417571_-	ChbG/HpnK family deacetylase	NA	NA	NA	NA
AZW76917.1\|417490_417799_+	GtrA family protein	NA	NA	NA	NA
AZW73875.1\|417758_419378_-	phospholipid carrier-dependent glycosyltransferase	NA	NA	NA	NA
AZW73876.1\|419374_420433_-	glycosyltransferase	I1TED8	Salmonella_phage	2.8e-59	40.5
AZW73877.1\|420562_421057_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AZW73878.1\|421149_422127_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW73879.1\|422322_423528_+	sodium/glutamate symporter	NA	NA	NA	NA
AZW73880.1\|423524_425036_+	TRAP transporter substrate-binding protein	NA	NA	NA	NA
AZW76918.1\|425051_426365_-	short-chain fatty acids transporter	NA	NA	NA	NA
AZW73881.1\|426555_426735_-	hypothetical protein	NA	NA	NA	NA
AZW73882.1\|427144_427879_-	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	1.4e-41	43.8
AZW73883.1\|430323_431274_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW73884.1\|431405_431804_-	elongation factor G	E4ZFJ7	Streptococcus_phage	9.0e-19	44.3
AZW73885.1\|432214_432685_-	universal stress protein	NA	NA	NA	NA
AZW73886.1\|432773_433118_-	TIGR01244 family phosphatase	NA	NA	NA	NA
AZW73887.1\|433217_434618_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
AZW73888.1\|436406_436925_-	methyltransferase	G3MA03	Bacillus_virus	2.1e-12	38.9
AZW73889.1\|437035_437791_+	TerC family protein	A0A0R6PEZ3	Moraxella_phage	2.9e-42	40.8
AZW73890.1\|437986_439219_+	CoA transferase	NA	NA	NA	NA
AZW73891.1\|439211_439997_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW73892.1\|440063_441035_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW73893.1\|441045_442023_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW73894.1\|442148_443321_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW73895.1\|443347_444376_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW73896.1\|444441_445635_+	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
AZW73897.1\|447416_448367_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_5

620802 : 721266

111

uncultured_Caudovirales_phage(13.79%)

tail,tRNA,transposase,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW74049.1\|620802_621753_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW74050.1\|622451_622835_+	hypothetical protein	NA	NA	NA	NA
AZW74051.1\|622892_623495_+	DUF2946 domain-containing protein	NA	NA	NA	NA
AZW76924.1\|623512_623914_-	DoxX family protein	NA	NA	NA	NA
AZW76925.1\|624047_624941_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW74052.1\|624937_625519_+	NUDIX hydrolase	NA	NA	NA	NA
AZW74053.1\|626313_627048_+	arginyltransferase	NA	NA	NA	NA
AZW74054.1\|627088_628138_+	dihydroorotate dehydrogenase (quinone)	NA	NA	NA	NA
AZW74055.1\|628285_628864_-	Phasin (PHA-granule associated protein)	NA	NA	NA	NA
AZW74056.1\|629250_630228_+	tripartite tricarboxylate transporter substrate binding protein BugD	NA	NA	NA	NA
AZW74057.1\|630321_634716_-	dermonecrotic toxin	NA	NA	NA	NA
AZW74058.1\|634916_635765_-	IclR family transcriptional regulator	NA	NA	NA	NA
AZW74059.1\|635923_636736_-	competence/damage-inducible protein A	NA	NA	NA	NA
AZW74060.1\|636791_637742_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW74061.1\|637840_638641_-	hypothetical protein	NA	NA	NA	NA
AZW74062.1\|638702_639086_+	thioredoxin	NA	NA	NA	NA
AZW74063.1\|639097_640531_-	ATP-dependent helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.5e-52	34.4
AZW74064.1\|640737_641067_-	AzlD domain-containing protein	NA	NA	NA	NA
AZW76926.1\|641069_641738_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW74065.1\|642001_642922_+	branched-chain amino acid transaminase	NA	NA	NA	NA
AZW74066.1\|642968_643181_+	zinc-finger domain-containing protein	NA	NA	NA	NA
AZW74067.1\|643203_643626_+	DUF4440 domain-containing protein	NA	NA	NA	NA
AZW74068.1\|643642_644743_+	alpha/beta hydrolase	NA	NA	NA	NA
AZW74069.1\|644839_646357_-	peptidase	NA	NA	NA	NA
AZW74070.1\|646432_647272_+	UTP--glucose-1-phosphate uridylyltransferase	A0A127AW70	Bacillus_phage	1.1e-66	48.9
AZW74071.1\|647293_648175_-	cytochrome c oxidase assembly protein	NA	NA	NA	NA
AZW74072.1\|648256_649351_-	porin	NA	NA	NA	NA
AZW74073.1\|649644_650595_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW76927.1\|650669_651611_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW74074.1\|651694_652054_-	hypothetical protein	NA	NA	NA	NA
AZW74075.1\|652435_653473_-	hypothetical protein	NA	NA	NA	NA
AZW74076.1\|653789_655130_+	peptidase M24 family protein	NA	NA	NA	NA
AZW74077.1\|655139_655592_-	hypothetical protein	NA	NA	NA	NA
AZW74078.1\|655688_656870_+	monooxygenase	NA	NA	NA	NA
AZW74079.1\|656929_657961_+\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
AZW74080.1\|658001_658241_+	Fis family transcriptional regulator	NA	NA	NA	NA
AZW74081.1\|658310_659900_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase PurH	Q58MG4	Prochlorococcus_phage	8.7e-65	47.2
AZW74082.1\|659899_660448_+	crossover junction endodeoxyribonuclease RuvC	NA	NA	NA	NA
AZW74083.1\|660528_661101_+	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
AZW74084.1\|661119_662031_-	complex I NDUFA9 subunit family protein	NA	NA	NA	NA
AZW74085.1\|662104_663073_-	threonine/serine dehydratase	NA	NA	NA	NA
AZW74086.1\|663195_664269_+	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	2.3e-08	25.7
AZW74087.1\|664273_666094_-	DNA helicase RecQ	L7RCS0	Acanthamoeba_polyphaga_moumouvirus	3.1e-74	35.3
AZW74088.1\|666170_667121_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW74089.1\|667209_667545_+	ASCH domain-containing protein	NA	NA	NA	NA
AZW74090.1\|667678_668329_+	carbonic anhydrase	NA	NA	NA	NA
AZW74091.1\|668350_669769_-	amidase	NA	NA	NA	NA
AZW74092.1\|669838_670594_-	hypothetical protein	NA	NA	NA	NA
AZW76928.1\|670562_671321_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW74093.1\|671331_672213_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW74094.1\|672229_672937_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.2e-07	25.4
AZW74095.1\|672939_673698_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	4.4e-14	24.4
AZW74096.1\|673907_675650_+	sulfite reductase	NA	NA	NA	NA
AZW74097.1\|675642_676167_+	DUF934 domain-containing protein	NA	NA	NA	NA
AZW74098.1\|676206_677001_-	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW74099.1\|677168_678242_+	hypothetical protein	NA	NA	NA	NA
AZW74100.1\|678340_679291_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW74101.1\|679542_679755_-	hypothetical protein	NA	NA	NA	NA
AZW76929.1\|679820_680432_-	LexA family transcriptional repressor	NA	NA	NA	NA
AZW74102.1\|680911_681232_-	hypothetical protein	NA	NA	NA	NA
AZW74103.1\|681224_681923_-	hypothetical protein	NA	NA	NA	NA
AZW74104.1\|681937_682159_-	hypothetical protein	NA	NA	NA	NA
AZW74105.1\|682176_683127_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW76930.1\|683802_684252_+\|terminase	terminase	C7U0W1	Enterobacteria_phage	5.2e-39	61.5
AZW74106.1\|684238_685516_+\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	2.4e-150	64.7
AZW74107.1\|685518_686937_+	DUF4055 domain-containing protein	R9TF43	Synechococcus_phage	2.2e-99	42.1
AZW76931.1\|686965_688021_+	hypothetical protein	A0A0H5BBX3	Pseudomonas_phage	2.6e-97	50.6
AZW74108.1\|688026_688269_+	hypothetical protein	A0A0H5AUE5	Pseudomonas_phage	5.6e-16	53.2
AZW74109.1\|688391_688994_+	hypothetical protein	R9TF81	Synechococcus_phage	7.9e-27	43.6
AZW74110.1\|689422_690373_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW74111.1\|690390_691038_+	hypothetical protein	R9TJ64	Synechococcus_phage	2.7e-65	71.1
AZW74112.1\|691047_691299_+	hypothetical protein	NA	NA	NA	NA
AZW74113.1\|691361_691844_+	hypothetical protein	A0A2H4JE38	uncultured_Caudovirales_phage	1.8e-13	37.1
AZW74114.1\|691845_692046_+	hypothetical protein	NA	NA	NA	NA
AZW74115.1\|692045_692441_+	hypothetical protein	A0A2D2W284	Stenotrophomonas_phage	7.8e-07	35.0
AZW74116.1\|692437_692836_+	hypothetical protein	I6PCW1	Cronobacter_phage	4.2e-16	38.0
AZW74117.1\|692832_693255_+	hypothetical protein	NA	NA	NA	NA
AZW74118.1\|693262_693763_+	HNH endonuclease	A0A1I9SEX5	Klebsiella_phage	4.4e-31	45.1
AZW74119.1\|694017_694536_+\|tail	phage tail protein	A0A1S5R1H0	Pseudomonas_phage	5.4e-24	38.3
AZW74120.1\|694545_694875_+	hypothetical protein	A0A2H4J121	uncultured_Caudovirales_phage	2.9e-15	44.0
AZW74121.1\|694892_695183_+	hypothetical protein	A0A2H4JBP7	uncultured_Caudovirales_phage	3.7e-14	45.2
AZW74122.1\|695208_697821_+\|tail	phage tail tape measure protein	A0A2H4J107	uncultured_Caudovirales_phage	4.9e-105	38.6
AZW74123.1\|697830_698190_+	hypothetical protein	NA	NA	NA	NA
AZW74124.1\|698257_698791_+	DUF1833 domain-containing protein	A5A3Q9	Burkholderia_phage	1.1e-40	46.9
AZW74125.1\|698787_699177_+	hypothetical protein	A0A0G3EYJ9	Achromobacter_phage	3.0e-35	50.0
AZW74126.1\|699169_703126_+	DUF1983 domain-containing protein	A0A0B5A1N2	Achromobacter_phage	3.9e-215	40.8
AZW74127.1\|703130_703547_+	hypothetical protein	NA	NA	NA	NA
AZW74128.1\|703765_704029_+	hypothetical protein	A0A1B0V3F2	Roseobacter_phage	7.2e-09	41.8
AZW74129.1\|704028_704841_+	hypothetical protein	NA	NA	NA	NA
AZW74130.1\|704845_705088_+	hypothetical protein	NA	NA	NA	NA
AZW74131.1\|705066_705618_+	lysozyme	NA	NA	NA	NA
AZW74132.1\|705599_706133_+	DUF2514 domain-containing protein	NA	NA	NA	NA
AZW74133.1\|706129_706411_-	hypothetical protein	NA	NA	NA	NA
AZW74134.1\|706753_706954_+	hypothetical protein	NA	NA	NA	NA
AZW74135.1\|706960_707632_-	SOS response-associated peptidase	Q5QF62	Pseudomonas_virus	4.7e-36	39.9
AZW74136.1\|707987_708674_-	DNA-binding response regulator	NA	NA	NA	NA
AZW74137.1\|708654_709227_-	RNA pyrophosphohydrolase	NA	NA	NA	NA
AZW74138.1\|709292_711023_+\|tRNA	proline--tRNA ligase	A0A2K9L3R9	Tupanvirus	4.6e-11	29.4
AZW74139.1\|711075_711504_+	tol-pal system-associated acyl-CoA thioesterase	NA	NA	NA	NA
AZW74140.1\|711506_712187_+	protein TolQ	NA	NA	NA	NA
AZW74141.1\|712186_712645_+	protein TolR	NA	NA	NA	NA
AZW74142.1\|712681_713656_+	cell envelope integrity protein TolA	NA	NA	NA	NA
AZW74143.1\|713672_714989_+	protein TolB	NA	NA	NA	NA
AZW74144.1\|715020_715518_+	peptidoglycan-associated lipoprotein Pal	NA	NA	NA	NA
AZW74145.1\|715604_716294_+	tol-pal system protein YbgF	NA	NA	NA	NA
AZW74146.1\|716293_717343_+	iron ABC transporter permease	NA	NA	NA	NA
AZW74147.1\|717339_718134_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.4e-15	30.6
AZW74148.1\|718302_718653_+	hypothetical protein	NA	NA	NA	NA
AZW74149.1\|718628_719186_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW74150.1\|720110_720329_+	hypothetical protein	NA	NA	NA	NA
AZW74151.1\|720315_721266_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_6

748191 : 821353

Streptococcus_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW74172.1\|748191_749142_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW74173.1\|749796_750894_+	carboxynorspermidine decarboxylase	NA	NA	NA	NA
AZW74174.1\|750927_752193_+	saccharopine dehydrogenase	NA	NA	NA	NA
AZW74175.1\|752350_753301_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW74176.1\|753544_754135_+	polyisoprenoid-binding protein	NA	NA	NA	NA
AZW76933.1\|754150_756595_-	TonB-dependent siderophore receptor	NA	NA	NA	NA
AZW74177.1\|756714_757686_-	hypothetical protein	NA	NA	NA	NA
AZW74178.1\|757817_758342_+	RNA polymerase subunit sigma	NA	NA	NA	NA
AZW74179.1\|758301_759252_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW74180.1\|759473_761669_-	DNA methylase	NA	NA	NA	NA
AZW74181.1\|761741_762149_-	XRE family transcriptional regulator	NA	NA	NA	NA
AZW74182.1\|762271_763222_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW74183.1\|763337_763781_-	transcriptional regulator	NA	NA	NA	NA
AZW74184.1\|763843_764638_+	DNA-binding response regulator	NA	NA	NA	NA
AZW74185.1\|764803_765940_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	5.8e-63	44.8
AZW74186.1\|766010_767144_-	GTPase ObgE	NA	NA	NA	NA
AZW74187.1\|767293_767554_-	50S ribosomal protein L27	NA	NA	NA	NA
AZW74188.1\|767587_767899_-	50S ribosomal protein L21	NA	NA	NA	NA
AZW74189.1\|768323_769472_+	fumarylacetoacetate hydrolase	NA	NA	NA	NA
AZW74190.1\|769586_770552_+	octaprenyl diphosphate synthase	NA	NA	NA	NA
AZW74191.1\|770820_771687_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW74192.1\|771817_773866_+	hydantoinase/oxoprolinase family protein	NA	NA	NA	NA
AZW74193.1\|773883_775881_+	hydantoin utilization protein B	NA	NA	NA	NA
AZW74194.1\|775915_777253_+	FAD-binding oxidoreductase	NA	NA	NA	NA
AZW74195.1\|777515_779369_+	hypothetical protein	NA	NA	NA	NA
AZW74196.1\|779423_780905_+	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
AZW74197.1\|780920_781508_-	cyclolysin-activating lysine-acyltransferase CyaC	NA	NA	NA	NA
AZW76934.1\|781590_781770_+	hypothetical protein	NA	NA	NA	NA
AZW74198.1\|781956_787077_+	bifunctional adenylate cyclase toxin/hemolysin CyaA	NA	NA	NA	NA
AZW74199.1\|787154_789293_+	cyclolysin secretion/processing ATP-binding protein CyaB	W8CYL7	Bacillus_phage	2.7e-45	29.2
AZW74200.1\|789289_790612_+	protein CyaD	NA	NA	NA	NA
AZW74201.1\|790613_792038_+	protein CyaE	NA	NA	NA	NA
AZW74202.1\|792128_793037_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW74203.1\|793101_794016_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW74204.1\|794853_795537_+	amino acid ABC transporter permease	NA	NA	NA	NA
AZW74205.1\|795553_796297_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.5e-32	42.4
AZW74206.1\|796326_797187_+	aminotransferase	NA	NA	NA	NA
AZW74207.1\|797194_797761_-	hypothetical protein	NA	NA	NA	NA
AZW74208.1\|797849_798806_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW74209.1\|798850_799603_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AZW74210.1\|799599_801345_-	acetolactate synthase catalytic subunit	NA	NA	NA	NA
AZW74211.1\|801429_802164_+	GntR family transcriptional regulator	NA	NA	NA	NA
AZW74212.1\|802480_803503_+	autotransporter domain-containing protein	NA	NA	NA	NA
AZW74213.1\|803518_804241_-	GntR family transcriptional regulator	NA	NA	NA	NA
AZW74214.1\|804385_805393_-	zinc-binding dehydrogenase	NA	NA	NA	NA
AZW74215.1\|805433_806966_-	long-chain fatty acid--CoA ligase	NA	NA	NA	NA
AZW74216.1\|806962_808081_-	DUF2817 domain-containing protein	NA	NA	NA	NA
AZW74217.1\|808077_808860_-	ABC transporter permease	NA	NA	NA	NA
AZW74218.1\|808871_809735_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.6e-34	38.9
AZW76935.1\|809753_810851_-	hypothetical protein	NA	NA	NA	NA
AZW74219.1\|810919_811846_-	VOC family protein	NA	NA	NA	NA
AZW74220.1\|811880_813575_-	thiamine pyrophosphate-binding protein	NA	NA	NA	NA
AZW74221.1\|813774_814710_-	mechanosensitive ion channel family protein	NA	NA	NA	NA
AZW74222.1\|814815_815766_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW74223.1\|815864_816521_-	DUF4136 domain-containing protein	NA	NA	NA	NA
AZW74224.1\|816668_819377_+	aminopeptidase N	A0A0P0IY26	Acinetobacter_phage	2.8e-15	24.0
AZW74225.1\|819386_820406_+	fructose 1,6-bisphosphatase	A0A1V0SKX4	Klosneuvirus	1.5e-49	35.7
AZW74226.1\|820402_821353_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_7

854100 : 903342

Vibrio_phage(33.33%)

transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW74255.1\|854100_855051_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW76936.1\|855023_855623_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW74256.1\|855624_856059_+	PaaI family thioesterase	NA	NA	NA	NA
AZW74257.1\|856055_856490_+	hypothetical protein	NA	NA	NA	NA
AZW74258.1\|856473_857277_-	phosphatase PAP2 family protein	NA	NA	NA	NA
AZW74259.1\|857293_858109_-	DNA repair exonuclease	NA	NA	NA	NA
AZW74260.1\|858105_858921_-	diacylglycerol kinase	NA	NA	NA	NA
AZW74261.1\|859067_859769_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW74262.1\|859796_861755_-\|holin	choline transporter	A0A2I7QNT1	Vibrio_phage	8.0e-28	30.3
AZW74263.1\|861837_862788_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW74264.1\|863008_863677_+	transcriptional regulator	NA	NA	NA	NA
AZW74265.1\|863800_864907_+	MexH family multidrug efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
AZW74266.1\|864919_868033_+	MexW/MexI family multidrug efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	4.5e-57	21.5
AZW74267.1\|868029_869523_+	RND transporter	NA	NA	NA	NA
AZW74268.1\|869537_870209_+	transcriptional regulator	NA	NA	NA	NA
AZW74269.1\|870252_870747_-	azurin	NA	NA	NA	NA
AZW74270.1\|870887_871535_-	transcriptional regulator	NA	NA	NA	NA
AZW76937.1\|871638_873687_+	hydantoinase/oxoprolinase family protein	NA	NA	NA	NA
AZW74271.1\|873683_875696_+	hydantoin utilization protein B	NA	NA	NA	NA
AZW74272.1\|875721_877056_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
AZW74273.1\|877164_878157_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW74274.1\|878223_880308_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
AZW74275.1\|880332_881304_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW74276.1\|881432_882434_-	peptidase M14	NA	NA	NA	NA
AZW74277.1\|882467_883709_-	cystathionine beta-lyase	NA	NA	NA	NA
AZW74278.1\|883789_884713_+	transcriptional regulator LrhA	NA	NA	NA	NA
AZW74279.1\|884790_885615_+	3-oxoacyl-ACP reductase	NA	NA	NA	NA
AZW76938.1\|885811_886828_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW74280.1\|887024_888008_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW74281.1\|889606_890995_-	MmgE/PrpD family protein	NA	NA	NA	NA
AZW74282.1\|891025_892015_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW74283.1\|892125_893358_-	methylaspartate ammonia-lyase	NA	NA	NA	NA
AZW74284.1\|893617_894418_+	IclR family transcriptional regulator	NA	NA	NA	NA
AZW74285.1\|894440_896672_-\|holin	high-affinity choline transporter BetT	NA	NA	NA	NA
AZW74286.1\|897459_897906_-	preprotein translocase subunit SecG	NA	NA	NA	NA
AZW74287.1\|897927_898674_-	triose-phosphate isomerase	NA	NA	NA	NA
AZW74288.1\|898817_899795_-	NAD(P)H-quinone oxidoreductase	NA	NA	NA	NA
AZW74289.1\|900428_901040_+	PIN domain-containing protein	K4HZX4	Acidithiobacillus_phage	3.3e-12	32.5
AZW74290.1\|901033_902251_-	threonine ammonia-lyase	NA	NA	NA	NA
AZW74291.1\|902391_903342_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_8

912954 : 977894

Bacillus_phage(18.18%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW74300.1\|912954_913905_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW74301.1\|913901_915752_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.3e-27	26.4
AZW74302.1\|916132_916792_+	thiopurine S-methyltransferase	NA	NA	NA	NA
AZW74303.1\|916879_917032_+	hypothetical protein	NA	NA	NA	NA
AZW74304.1\|917140_917308_+	hypothetical protein	NA	NA	NA	NA
AZW74305.1\|917319_918000_-	DUF3313 domain-containing protein	NA	NA	NA	NA
AZW74306.1\|918281_918998_+	flagellar brake protein	NA	NA	NA	NA
AZW74307.1\|919012_920314_-	phospholipase	NA	NA	NA	NA
AZW74308.1\|922458_925347_+	metal-dependent phosphohydrolase	NA	NA	NA	NA
AZW74309.1\|925570_926923_+	MmgE/PrpD family protein	NA	NA	NA	NA
AZW74310.1\|926951_927473_+	acetyl-CoA carboxylase biotin carboxyl carrier protein	NA	NA	NA	NA
AZW74311.1\|927469_928924_+	carboxylase	NA	NA	NA	NA
AZW74312.1\|928958_929207_+	hypothetical protein	NA	NA	NA	NA
AZW74313.1\|929312_930188_+	hypothetical protein	NA	NA	NA	NA
AZW74314.1\|930213_931269_+	hypothetical protein	NA	NA	NA	NA
AZW74315.1\|931281_932073_+	GntR family transcriptional regulator	NA	NA	NA	NA
AZW74316.1\|932105_933476_+	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
AZW74317.1\|934652_935603_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW74318.1\|935655_935877_+	hypothetical protein	NA	NA	NA	NA
AZW74319.1\|936036_936249_+	hypothetical protein	NA	NA	NA	NA
AZW74320.1\|936368_937487_+	mannose-6-phosphate isomerase	NA	NA	NA	NA
AZW74321.1\|937583_937799_+	hypothetical protein	NA	NA	NA	NA
AZW74322.1\|937992_938244_+	hypothetical protein	NA	NA	NA	NA
AZW74323.1\|938356_939307_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW74324.1\|939303_939687_-	ferredoxin	NA	NA	NA	NA
AZW74325.1\|939741_941559_-	ABC transporter ATP-binding protein/permease	W8CYL7	Bacillus_phage	5.7e-44	27.9
AZW76940.1\|941705_942533_+	oxidoreductase	A0A2H4PQR8	Staphylococcus_phage	1.7e-67	47.4
AZW74326.1\|942578_943559_+	aldo/keto reductase	NA	NA	NA	NA
AZW74327.1\|943555_943768_-	hypothetical protein	NA	NA	NA	NA
AZW74328.1\|943764_944946_-	PepSY domain-containing protein	NA	NA	NA	NA
AZW74329.1\|945109_945844_+	serine/threonine protein phosphatase	A0A2H4J0P0	uncultured_Caudovirales_phage	1.9e-62	49.2
AZW74330.1\|945845_948458_-	penicillin-binding protein	NA	NA	NA	NA
AZW74331.1\|948593_950507_-	S9 family peptidase	NA	NA	NA	NA
AZW74332.1\|951122_951533_-	PaaI family thioesterase	NA	NA	NA	NA
AZW74333.1\|951630_952716_+	DNA polymerase IV	NA	NA	NA	NA
AZW74334.1\|952814_953765_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW74335.1\|953761_954736_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW74336.1\|954860_955772_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	4.4e-05	27.6
AZW76941.1\|956048_956441_-	type II toxin-antitoxin system HicB family antitoxin	A0A0R6PJ17	Moraxella_phage	4.8e-25	45.0
AZW74337.1\|956570_957521_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW74338.1\|957550_957733_-	addiction module toxin, HicA family	A0A1L2JY37	Aeribacillus_phage	3.7e-12	56.1
AZW74339.1\|957771_958029_-	hypothetical protein	NA	NA	NA	NA
AZW74340.1\|958505_959687_-	MFS transporter	NA	NA	NA	NA
AZW74341.1\|959902_960580_-	phosphoglycolate phosphatase	NA	NA	NA	NA
AZW74342.1\|960576_961350_-	bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG	NA	NA	NA	NA
AZW74343.1\|961427_962009_-	OmpA family protein	NA	NA	NA	NA
AZW74344.1\|962379_965061_+	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	3.2e-104	33.5
AZW74345.1\|965060_966194_+	phosphoserine aminotransferase	M1Q1P2	Streptococcus_phage	6.4e-78	44.0
AZW74346.1\|966186_967272_+	prephenate dehydratase	NA	NA	NA	NA
AZW74347.1\|967358_968258_+	prephenate dehydrogenase/arogenate dehydrogenase family protein	NA	NA	NA	NA
AZW74348.1\|968254_969583_+	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
AZW74349.1\|969597_970269_+	cytidylate kinase	NA	NA	NA	NA
AZW74350.1\|970441_972172_+	30S ribosomal protein S1	NA	NA	NA	NA
AZW74351.1\|972173_972533_+	integration host factor subunit beta	NA	NA	NA	NA
AZW74352.1\|972724_973039_+	DUF1049 domain-containing protein	NA	NA	NA	NA
AZW74353.1\|973081_974302_+	lipopolysaccharide assembly protein LapB	NA	NA	NA	NA
AZW74354.1\|974298_975240_+	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	1.5e-16	28.1
AZW74355.1\|975236_976226_+	ADP-L-glycero-D-mannoheptose-6-epimerase	E3SJ87	Synechococcus_phage	2.2e-26	34.4
AZW74356.1\|976260_976845_+	DUF655 domain-containing protein	NA	NA	NA	NA
AZW74357.1\|976943_977894_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_9

997294 : 1048259

Enterococcus_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW74372.1\|997294_998245_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW74373.1\|998349_999399_+	NADP(H)-dependent aldo-keto reductase	NA	NA	NA	NA
AZW76943.1\|999536_1000553_-\|transposase	IS110 family transposase IS1663	NA	NA	NA	NA
AZW74374.1\|1002061_1002634_-	chorismate--pyruvate lyase	NA	NA	NA	NA
AZW74375.1\|1002693_1003425_+	rRNA pseudouridine synthase	NA	NA	NA	NA
AZW76944.1\|1003476_1004394_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW74376.1\|1005201_1008381_+	multidrug efflux RND transporter permease subunit	NA	NA	NA	NA
AZW74377.1\|1009829_1010081_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
AZW74378.1\|1010226_1010877_-	SCO family protein	NA	NA	NA	NA
AZW74379.1\|1011027_1013142_-	M3 family peptidase	NA	NA	NA	NA
AZW74380.1\|1013217_1014069_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase	A0A249XZQ2	Enterococcus_phage	2.1e-33	39.8
AZW74381.1\|1014065_1014692_-	DNA-binding response regulator	NA	NA	NA	NA
AZW74382.1\|1014688_1016443_-	PAS domain-containing sensor histidine kinase	NA	NA	NA	NA
AZW74383.1\|1016735_1019441_+	pyruvate dehydrogenase (acetyl-transferring), homodimeric type	NA	NA	NA	NA
AZW74384.1\|1019453_1021115_+	dihydrolipoyllysine-residue acetyltransferase	NA	NA	NA	NA
AZW74385.1\|1021127_1022918_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	2.4e-39	25.2
AZW74386.1\|1023139_1024315_-	flagellin FliC	NA	NA	NA	NA
AZW74387.1\|1024357_1025308_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW74388.1\|1025406_1026147_-	16S rRNA (uracil(1498)-N(3))-methyltransferase	NA	NA	NA	NA
AZW74389.1\|1026341_1028378_+	transketolase	NA	NA	NA	NA
AZW74390.1\|1028395_1029406_+	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
AZW74391.1\|1029523_1030717_+	phosphoglycerate kinase	NA	NA	NA	NA
AZW74392.1\|1030746_1031520_-	enoyl-[acyl-carrier-protein] reductase FabI	NA	NA	NA	NA
AZW74393.1\|1031516_1032707_-	acetate kinase	NA	NA	NA	NA
AZW74394.1\|1032732_1033671_-	phosphate acetyltransferase	NA	NA	NA	NA
AZW76945.1\|1033667_1036016_-	DUF3141 domain-containing protein	NA	NA	NA	NA
AZW74395.1\|1036170_1036878_-	glutathione S-transferase	NA	NA	NA	NA
AZW74396.1\|1036915_1038049_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW74397.1\|1038325_1038874_-	damage-inducible protein DinB	NA	NA	NA	NA
AZW74398.1\|1038892_1039378_-	N-acetyltransferase	NA	NA	NA	NA
AZW74399.1\|1039555_1040494_+	curved DNA-binding protein	A0A0P0YMJ9	Yellowstone_lake_phycodnavirus	5.6e-11	24.1
AZW74400.1\|1040496_1040814_+	MerR family transcriptional regulator	NA	NA	NA	NA
AZW74401.1\|1040859_1041804_+	hypothetical protein	NA	NA	NA	NA
AZW74402.1\|1043484_1044135_+	molybdopterin adenylyltransferase	NA	NA	NA	NA
AZW74403.1\|1044188_1044524_+	hypothetical protein	NA	NA	NA	NA
AZW74404.1\|1044520_1045381_+	M23 family peptidase	A0A292GJG6	Xanthomonas_phage	2.6e-15	36.1
AZW74405.1\|1045397_1045679_-	hypothetical protein	NA	NA	NA	NA
AZW74406.1\|1045752_1046016_-	translation initiation factor IF-1	NA	NA	NA	NA
AZW74407.1\|1046259_1047210_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW74408.1\|1047308_1048259_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_10

1060477 : 1126492

uncultured_Mediterranean_phage(33.33%)

tRNA,transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW76946.1\|1060477_1061494_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW76947.1\|1062324_1063332_+	aldo/keto reductase	NA	NA	NA	NA
AZW74421.1\|1063328_1064972_-	apolipoprotein N-acyltransferase	NA	NA	NA	NA
AZW74422.1\|1064968_1065871_-	magnesium/cobalt efflux protein	NA	NA	NA	NA
AZW74423.1\|1065996_1066470_-	endoribonuclease YbeY	NA	NA	NA	NA
AZW74424.1\|1066459_1067482_-	PhoH family protein	A0A0S0MVD6	Pseudomonas_phage	8.7e-50	45.4
AZW74425.1\|1067478_1068906_-\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
AZW76948.1\|1069843_1070860_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW74426.1\|1071192_1072128_-	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	3.0e-41	35.5
AZW74427.1\|1072177_1074058_-	protein translocase subunit SecD	NA	NA	NA	NA
AZW74428.1\|1074124_1074469_-	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	1.0e-10	40.4
AZW74429.1\|1074613_1075750_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.9e-85	44.4
AZW74430.1\|1075746_1076820_-\|tRNA	S-adenosylmethionine:tRNA ribosyltransferase-isomerase	NA	NA	NA	NA
AZW74431.1\|1076977_1078414_+	D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase	NA	NA	NA	NA
AZW76949.1\|1078504_1079146_+	uracil phosphoribosyltransferase	NA	NA	NA	NA
AZW76950.1\|1079481_1080498_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW74432.1\|1080830_1083578_+	pertactin autotransporter	NA	NA	NA	NA
AZW76951.1\|1083644_1085066_-	siroheme synthase	NA	NA	NA	NA
AZW74433.1\|1085329_1086046_+	hypothetical protein	NA	NA	NA	NA
AZW74434.1\|1086130_1086448_+	DUF883 domain-containing protein	NA	NA	NA	NA
AZW74435.1\|1086488_1086902_+\|holin	phage holin family protein	NA	NA	NA	NA
AZW74436.1\|1086903_1087263_+	hypothetical protein	NA	NA	NA	NA
AZW74437.1\|1087305_1088850_-	4-hydroxy-3-polyprenylbenzoate decarboxylase	NA	NA	NA	NA
AZW74438.1\|1088933_1089764_+	transglycosylase	NA	NA	NA	NA
AZW74439.1\|1089798_1090953_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
AZW74440.1\|1090995_1091868_+	hypothetical protein	NA	NA	NA	NA
AZW74441.1\|1091984_1094273_+	NADP-dependent malic enzyme	NA	NA	NA	NA
AZW74442.1\|1095479_1095944_+	barstar family protein 2	NA	NA	NA	NA
AZW74443.1\|1095970_1096921_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW76952.1\|1097288_1098065_-	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.3e-17	28.7
AZW74444.1\|1098109_1098967_-	phosphate ABC transporter, permease protein PstA	NA	NA	NA	NA
AZW74445.1\|1098988_1100005_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
AZW74446.1\|1100139_1101180_-	phosphate ABC transporter substrate-binding protein PstS	M4QHS4	Cyanophage	2.1e-51	40.2
AZW74447.1\|1101374_1103456_-	polyphosphate kinase 1	NA	NA	NA	NA
AZW74448.1\|1103691_1105185_+	exopolyphosphatase	NA	NA	NA	NA
AZW74449.1\|1105415_1106210_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AZW74450.1\|1106430_1107789_-	phosphoglucosamine mutase	NA	NA	NA	NA
AZW74451.1\|1107785_1108628_-	dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	3.2e-26	32.5
AZW74452.1\|1108646_1110533_-	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	M4QMW8	Micromonas_pusilla_virus	1.4e-109	41.5
AZW74453.1\|1110770_1111403_-	ribosomal RNA large subunit methyltransferase E	NA	NA	NA	NA
AZW74454.1\|1111421_1112024_+	hypothetical protein	NA	NA	NA	NA
AZW74455.1\|1112175_1113126_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW74456.1\|1113928_1114729_-	hypothetical protein	NA	NA	NA	NA
AZW74457.1\|1114772_1115759_-	homoserine kinase	NA	NA	NA	NA
AZW74458.1\|1115898_1116912_+\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
AZW74459.1\|1116908_1117859_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW74460.1\|1117971_1118430_-	CBS domain-containing protein	NA	NA	NA	NA
AZW74461.1\|1118466_1119780_-	hypothetical protein	NA	NA	NA	NA
AZW74462.1\|1119797_1120169_+	DUF2069 domain-containing protein	NA	NA	NA	NA
AZW74463.1\|1120165_1121629_+	YdiU family protein	A0A075BSJ0	Microcystis_phage	1.7e-43	32.5
AZW74464.1\|1121721_1122498_+	DNA-binding response regulator	NA	NA	NA	NA
AZW74465.1\|1122479_1125359_-	diguanylate phosphodiesterase	NA	NA	NA	NA
AZW74466.1\|1125541_1126492_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_11

1316881 : 1385368

Planktothrix_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW74615.1\|1316881_1317832_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW74616.1\|1318600_1319239_-	glutathione S-transferase	NA	NA	NA	NA
AZW76963.1\|1320128_1320575_+	glutamate racemase	NA	NA	NA	NA
AZW74617.1\|1320656_1321358_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-17	30.4
AZW74618.1\|1321358_1322126_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.2e-14	26.4
AZW74619.1\|1322122_1323361_-	high-affinity branched-chain amino acid ABC transporter permease LivM	NA	NA	NA	NA
AZW74620.1\|1323360_1324287_-	high-affinity branched-chain amino acid ABC transporter permease LivH	NA	NA	NA	NA
AZW74621.1\|1324389_1325505_-	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW74622.1\|1325520_1326471_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW74623.1\|1326824_1327406_-	hypothetical protein	A0A2I7SAW6	Vibrio_phage	9.4e-17	37.3
AZW74624.1\|1327402_1328236_-	pyrroline-5-carboxylate reductase	NA	NA	NA	NA
AZW76964.1\|1328446_1329760_+	sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB	NA	NA	NA	NA
AZW74625.1\|1329936_1330818_+	sn-glycerol-3-phosphate ABC transporter permease UgpA	NA	NA	NA	NA
AZW74626.1\|1330837_1331689_+	sn-glycerol-3-phosphate ABC transporter permease UgpE	NA	NA	NA	NA
AZW74627.1\|1331741_1332830_+	sn-glycerol-3-phosphate import ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	2.2e-19	31.2
AZW74628.1\|1332940_1334068_-	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW76965.1\|1334302_1334914_+	alpha/beta hydrolase	NA	NA	NA	NA
AZW74629.1\|1335012_1335963_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW74630.1\|1336184_1336562_-	DUF423 domain-containing protein	NA	NA	NA	NA
AZW76966.1\|1336709_1337207_+	DUF2384 domain-containing protein	NA	NA	NA	NA
AZW74631.1\|1337203_1337731_+	RES domain-containing protein	NA	NA	NA	NA
AZW74632.1\|1337864_1338680_+	iron ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW74633.1\|1338692_1339874_-	alpha-hydroxy-acid oxidizing protein	NA	NA	NA	NA
AZW74634.1\|1339921_1340815_-	phosphatidylserine decarboxylase proenzyme	NA	NA	NA	NA
AZW76967.1\|1340941_1341412_-	hypothetical protein	NA	NA	NA	NA
AZW74635.1\|1341537_1342365_-	DUF3298 domain-containing protein	NA	NA	NA	NA
AZW74636.1\|1342393_1343170_-	lipoate--protein ligase family protein	NA	NA	NA	NA
AZW74637.1\|1343166_1343460_-	biotin--protein ligase	NA	NA	NA	NA
AZW74638.1\|1343456_1343921_-	N-acetyltransferase	NA	NA	NA	NA
AZW74639.1\|1343932_1344718_-	thiol:disulfide oxidoreductase	NA	NA	NA	NA
AZW74640.1\|1344743_1345244_-	glutathione peroxidase	Q6VZR0	Canarypox_virus	4.7e-25	38.4
AZW74641.1\|1345326_1346505_-	DUF1501 domain-containing protein	NA	NA	NA	NA
AZW74642.1\|1348132_1348468_+	tetratricopeptide repeat protein	NA	NA	NA	NA
AZW74643.1\|1348655_1350104_+	CoA transferase	NA	NA	NA	NA
AZW74644.1\|1350161_1350506_+	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	3.0e-31	58.4
AZW74645.1\|1350612_1351152_-	peroxiredoxin	NA	NA	NA	NA
AZW74646.1\|1351244_1352195_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW74647.1\|1352181_1352664_-	hypothetical protein	NA	NA	NA	NA
AZW74648.1\|1352933_1353365_-	hypothetical protein	NA	NA	NA	NA
AZW74649.1\|1353546_1353951_-	DoxX family protein	NA	NA	NA	NA
AZW74650.1\|1355187_1355511_+	hypothetical protein	NA	NA	NA	NA
AZW74651.1\|1355513_1356401_-	aldo/keto reductase	NA	NA	NA	NA
AZW74652.1\|1356433_1356859_-	universal stress protein	NA	NA	NA	NA
AZW74653.1\|1356930_1357284_-	hypothetical protein	NA	NA	NA	NA
AZW74654.1\|1357523_1358030_-	hypothetical protein	NA	NA	NA	NA
AZW74655.1\|1358068_1359400_-	transcriptional regulator PtsJ	NA	NA	NA	NA
AZW74656.1\|1359459_1360275_+	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
AZW74657.1\|1360271_1361126_+	pyridoxine/pyridoxal/pyridoxamine kinase	NA	NA	NA	NA
AZW76968.1\|1364188_1366732_-	malto-oligosyltrehalose synthase	NA	NA	NA	NA
AZW74658.1\|1368098_1369853_-	malto-oligosyltrehalose trehalohydrolase	NA	NA	NA	NA
AZW74659.1\|1369849_1371970_-	glycogen debranching enzyme GlgX	NA	NA	NA	NA
AZW74660.1\|1371974_1374170_-	1,4-alpha-glucan-branching protein	NA	NA	NA	NA
AZW76969.1\|1374166_1377508_-	maltose alpha-D-glucosyltransferase	NA	NA	NA	NA
AZW74661.1\|1380310_1381261_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW74662.1\|1381326_1381506_-	hypothetical protein	NA	NA	NA	NA
AZW76970.1\|1381622_1382345_-	alpha/beta hydrolase	NA	NA	NA	NA
AZW74663.1\|1382364_1383510_-	DUF3182 domain-containing protein	NA	NA	NA	NA
AZW74664.1\|1384417_1385368_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_12

1445859 : 1501347

Mollivirus(16.67%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW74710.1\|1445859_1446810_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW74711.1\|1448011_1448458_-	flagellar export protein FliJ	NA	NA	NA	NA
AZW74712.1\|1448450_1449926_-	flagellar protein export ATPase FliI	NA	NA	NA	NA
AZW74713.1\|1449922_1450678_-	flagellar assembly protein FliH	NA	NA	NA	NA
AZW74714.1\|1450670_1451681_-	flagellar motor switch protein FliG	NA	NA	NA	NA
AZW74715.1\|1451670_1453347_-	flagellar basal body M-ring protein FliF	NA	NA	NA	NA
AZW74716.1\|1453659_1453992_+	flagellar hook-basal body complex protein FliE	NA	NA	NA	NA
AZW74717.1\|1454005_1454401_-	hypothetical protein	NA	NA	NA	NA
AZW74718.1\|1454410_1454737_-	flagellar biosynthesis protein FlhB	NA	NA	NA	NA
AZW74719.1\|1454733_1455060_-	flagellar hook-length control protein FliK	NA	NA	NA	NA
AZW74720.1\|1454986_1456009_-	flagellar hook-length control protein FliK	NA	NA	NA	NA
AZW74721.1\|1456005_1456386_-	flagellar protein FliT	NA	NA	NA	NA
AZW74722.1\|1456403_1456832_-	flagellar export chaperone FliS	NA	NA	NA	NA
AZW74723.1\|1456839_1458213_-	flagellar hook protein FliD	NA	NA	NA	NA
AZW76976.1\|1458353_1458731_-	flagellar protein	NA	NA	NA	NA
AZW74724.1\|1458993_1460301_+	bifunctional tetrahydrofolate synthase/dihydrofolate synthase	NA	NA	NA	NA
AZW74725.1\|1460361_1461192_+	SPOR domain-containing protein	NA	NA	NA	NA
AZW74726.1\|1461188_1461677_+	colicin V synthesis protein	NA	NA	NA	NA
AZW74727.1\|1461718_1463239_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	4.8e-97	43.7
AZW76977.1\|1463282_1463759_-	disulfide bond formation protein B	NA	NA	NA	NA
AZW74728.1\|1464562_1467160_-	bifunctional uridylyltransferase/uridylyl-removing protein	NA	NA	NA	NA
AZW74729.1\|1467189_1468011_-	type I methionyl aminopeptidase	NA	NA	NA	NA
AZW74730.1\|1468737_1469487_+	30S ribosomal protein S2	NA	NA	NA	NA
AZW74731.1\|1469619_1470549_+	elongation factor Ts	NA	NA	NA	NA
AZW74732.1\|1470646_1471363_+	UMP kinase	NA	NA	NA	NA
AZW74733.1\|1471377_1471938_+	ribosome-recycling factor	NA	NA	NA	NA
AZW74734.1\|1471975_1472869_+	di-trans,poly-cis-decaprenylcistransferase	R9W0U9	Flavobacterium_phage	2.0e-18	36.1
AZW74735.1\|1472888_1473746_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
AZW74736.1\|1473742_1474942_+	1-deoxy-D-xylulose-5-phosphate reductoisomerase	NA	NA	NA	NA
AZW74737.1\|1474981_1476316_+\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
AZW74738.1\|1476368_1478705_+	outer membrane protein assembly factor BamA	NA	NA	NA	NA
AZW76978.1\|1478830_1479394_+	outer membrane protein chaperone	NA	NA	NA	NA
AZW74739.1\|1479402_1480494_+	UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase	NA	NA	NA	NA
AZW74740.1\|1480565_1481021_+	beta-hydroxyacyl-ACP dehydratase	NA	NA	NA	NA
AZW74741.1\|1481021_1481816_+	acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase	NA	NA	NA	NA
AZW74742.1\|1481812_1482994_+	lipid-A-disaccharide synthase	NA	NA	NA	NA
AZW74743.1\|1482980_1483586_+	ribonuclease HII	G9E3X7	Emiliania_huxleyi_virus	8.8e-26	40.2
AZW74744.1\|1483582_1484356_+	RNA methyltransferase	NA	NA	NA	NA
AZW74745.1\|1484367_1485195_-	phosphoenolpyruvate synthase regulatory protein	NA	NA	NA	NA
AZW74746.1\|1485356_1487720_+	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	2.2e-165	35.9
AZW74747.1\|1487787_1488507_-	GMP synthase	NA	NA	NA	NA
AZW74748.1\|1488630_1489056_+	NfeD-like family protein 1	NA	NA	NA	NA
AZW74749.1\|1489090_1490041_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW74750.1\|1490158_1491085_+	paraslipin	NA	NA	NA	NA
AZW74751.1\|1491150_1492308_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.3e-14	36.2
AZW74752.1\|1492288_1492756_-	SsrA-binding protein	W5RAM5	Staphylococcus_phage	6.2e-27	45.1
AZW74753.1\|1492903_1493854_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW74754.1\|1493870_1494305_+	ubiquinone-binding protein	NA	NA	NA	NA
AZW74755.1\|1494294_1494645_+	RnfH family protein	NA	NA	NA	NA
AZW74756.1\|1494841_1495996_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW74757.1\|1495992_1497165_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
AZW74758.1\|1497212_1498106_+	3-hydroxyisobutyrate dehydrogenase	NA	NA	NA	NA
AZW74759.1\|1498151_1498589_+	PaaI family thioesterase	NA	NA	NA	NA
AZW74760.1\|1498648_1499338_+	VIT family protein	NA	NA	NA	NA
AZW74761.1\|1499347_1500298_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW74762.1\|1500396_1501347_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_13

1914635 : 1969871

Lake_Baikal_phage(25.0%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW75101.1\|1914635_1915586_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75102.1\|1915786_1916596_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW75103.1\|1916720_1917671_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75104.1\|1917667_1918561_-	methylglyoxal synthase	NA	NA	NA	NA
AZW75105.1\|1918685_1918880_-	Fe-S assembly protein IscX	NA	NA	NA	NA
AZW75106.1\|1918879_1919221_-	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
AZW75107.1\|1919230_1921093_-	chaperone protein HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	3.0e-101	42.4
AZW75108.1\|1921222_1921735_-	co-chaperone protein HscB	NA	NA	NA	NA
AZW75109.1\|1921737_1922061_-	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	6.8e-25	52.8
AZW75110.1\|1922062_1922473_-	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	7.5e-53	79.0
AZW75111.1\|1922510_1923722_-	IscS subfamily cysteine desulfurase	NA	NA	NA	NA
AZW75112.1\|1923739_1924252_-	Fe-S cluster assembly transcriptional regulator IscR	NA	NA	NA	NA
AZW75113.1\|1924467_1924959_-	low molecular weight phosphotyrosine protein phosphatase	NA	NA	NA	NA
AZW75114.1\|1925211_1927248_-	UvrABC system protein B	NA	NA	NA	NA
AZW75115.1\|1927325_1928528_+	aspartate/tyrosine/aromatic aminotransferase	NA	NA	NA	NA
AZW75116.1\|1928578_1929307_+	transcriptional repressor LexA	A0A2H4JG58	uncultured_Caudovirales_phage	2.8e-10	50.7
AZW75117.1\|1930864_1931815_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75118.1\|1932385_1932598_-	hypothetical protein	NA	NA	NA	NA
AZW75119.1\|1932615_1933347_-	hypothetical protein	NA	NA	NA	NA
AZW75120.1\|1933381_1934023_-	CoA transferase subunit B	NA	NA	NA	NA
AZW75121.1\|1934015_1934732_-	3-oxoadipate CoA-transferase	NA	NA	NA	NA
AZW75122.1\|1936896_1937673_-	3-oxoacyl-ACP reductase	NA	NA	NA	NA
AZW75123.1\|1937694_1938852_-	thiolase	NA	NA	NA	NA
AZW75124.1\|1938848_1939280_-	hypothetical protein	NA	NA	NA	NA
AZW75125.1\|1939276_1940080_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
AZW75126.1\|1940093_1940549_-	MaoC family dehydratase	NA	NA	NA	NA
AZW75127.1\|1940561_1941533_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW75128.1\|1941598_1942822_-	CoA transferase	NA	NA	NA	NA
AZW75129.1\|1943049_1944000_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW75130.1\|1944123_1946577_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	1.5e-220	52.0
AZW75131.1\|1946765_1948070_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	3.2e-129	53.8
AZW75132.1\|1948174_1948828_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	6.8e-56	57.5
AZW75133.1\|1948830_1950141_-	trigger factor	NA	NA	NA	NA
AZW75134.1\|1950319_1950898_+	TIGR00645 family protein	K4K6D8	Caulobacter_phage	1.0e-23	33.7
AZW75135.1\|1951009_1951210_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	7.4e-14	64.4
AZW75136.1\|1951555_1952122_-	DUF924 domain-containing protein	NA	NA	NA	NA
AZW75137.1\|1952205_1952409_-	cold-shock protein CspA	A0A2H4N7Y6	Lake_Baikal_phage	1.6e-16	62.1
AZW75138.1\|1952715_1953036_-	hypothetical protein	NA	NA	NA	NA
AZW75139.1\|1953077_1953359_-	hypothetical protein	NA	NA	NA	NA
AZW75140.1\|1953433_1954690_-	autotransporter Phg	NA	NA	NA	NA
AZW75141.1\|1955072_1955402_+	DUF4148 domain-containing protein	NA	NA	NA	NA
AZW75142.1\|1956972_1957794_+	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	NA	NA	NA	NA
AZW75143.1\|1957793_1958933_+	succinyl-diaminopimelate desuccinylase	NA	NA	NA	NA
AZW75144.1\|1958939_1959836_+	50S ribosomal protein L3 N(5)-glutamine methyltransferase	NA	NA	NA	NA
AZW75145.1\|1959832_1961758_+	ABC transporter ATP-binding protein	A0A2K9L0W2	Tupanvirus	1.1e-66	31.8
AZW75146.1\|1962117_1964730_+	TonB-dependent receptor	NA	NA	NA	NA
AZW75147.1\|1964782_1967083_-	DNA helicase II	A7KV33	Bacillus_phage	9.9e-110	35.9
AZW75148.1\|1967079_1968288_-	acyl-CoA desaturase	NA	NA	NA	NA
AZW75149.1\|1968549_1968924_+	hypothetical protein	NA	NA	NA	NA
AZW75150.1\|1968920_1969871_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_14

2294788 : 2356136

Yellowstone_lake_phycodnavirus(12.5%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW75402.1\|2294788_2295739_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75403.1\|2295855_2296575_+	FadR family transcriptional regulator	NA	NA	NA	NA
AZW75404.1\|2296747_2297734_+	C4-dicarboxylate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW75405.1\|2297734_2298217_+	TRAP transporter small permease	NA	NA	NA	NA
AZW75406.1\|2298220_2299504_+	TRAP transporter large permease	NA	NA	NA	NA
AZW75407.1\|2299500_2300439_+	CoA ester lyase	NA	NA	NA	NA
AZW75408.1\|2300435_2302145_+	thiamine pyrophosphate-binding protein	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	5.9e-35	27.3
AZW75409.1\|2302154_2303402_+	Zn-dependent hydrolase	NA	NA	NA	NA
AZW77012.1\|2305012_2306302_-	Glu/Leu/Phe/Val dehydrogenase	NA	NA	NA	NA
AZW75410.1\|2307439_2308213_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.1e-31	37.7
AZW75411.1\|2308874_2309618_-	glutamine ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW75412.1\|2309692_2310433_-	IclR family transcriptional regulator	NA	NA	NA	NA
AZW75413.1\|2310628_2311465_-	hypothetical protein	NA	NA	NA	NA
AZW75414.1\|2311515_2312286_-	TatD family deoxyribonuclease	NA	NA	NA	NA
AZW75415.1\|2312335_2313388_-	DNA polymerase III subunit delta'	NA	NA	NA	NA
AZW75416.1\|2313384_2314011_-	thymidylate kinase	A0A1L2BX49	Bacteriophage	1.6e-22	35.1
AZW75417.1\|2314007_2315054_-	endolytic transglycosylase MltG	NA	NA	NA	NA
AZW75418.1\|2315220_2316237_+	folate-binding protein	NA	NA	NA	NA
AZW77013.1\|2316335_2317286_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75419.1\|2320026_2321316_-	D-amino acid dehydrogenase	NA	NA	NA	NA
AZW75420.1\|2321434_2321905_-	DNA-binding protein	NA	NA	NA	NA
AZW75421.1\|2321915_2323124_-	flavohemoprotein	NA	NA	NA	NA
AZW75422.1\|2323270_2323735_+	GatB/YqeY domain-containing protein	A0A0K2FLI9	Brevibacillus_phage	3.9e-05	32.4
AZW75423.1\|2323758_2324709_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75424.1\|2325693_2326467_-	ABC transporter permease	NA	NA	NA	NA
AZW75425.1\|2326463_2327462_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW75426.1\|2327546_2328323_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-30	34.2
AZW75427.1\|2328478_2330146_-	ABC-F family ATPase	A0A1V0SKJ1	Klosneuvirus	1.6e-53	28.9
AZW75428.1\|2330463_2331588_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW75429.1\|2331714_2332338_+	hypothetical protein	NA	NA	NA	NA
AZW75430.1\|2332334_2334236_+	C4-dicarboxylate ABC transporter	NA	NA	NA	NA
AZW75431.1\|2334284_2335079_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW75432.1\|2335091_2336093_-	muramoyltetrapeptide carboxypeptidase	NA	NA	NA	NA
AZW75433.1\|2336089_2336596_-\|tRNA	tRNA adenosine(34) deaminase TadA	S4VYT2	Pandoravirus	3.4e-07	38.4
AZW75434.1\|2336588_2337437_-	hydrolase	NA	NA	NA	NA
AZW75435.1\|2337534_2338077_-	hypothetical protein	NA	NA	NA	NA
AZW75436.1\|2338120_2339071_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75437.1\|2339226_2339553_-	cation:proton antiporter	NA	NA	NA	NA
AZW75438.1\|2339549_2339834_-	K+/H+ antiporter subunit F	NA	NA	NA	NA
AZW75439.1\|2339830_2340310_-	Na+/H+ antiporter subunit E	NA	NA	NA	NA
AZW75440.1\|2340306_2341935_-	monovalent cation/H+ antiporter subunit D	NA	NA	NA	NA
AZW75441.1\|2341931_2342276_-	Na+/H+ antiporter subunit C	NA	NA	NA	NA
AZW75442.1\|2342275_2345209_-	monovalent cation/H+ antiporter subunit A	NA	NA	NA	NA
AZW75443.1\|2346367_2347318_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75444.1\|2347416_2347713_-	hypothetical protein	NA	NA	NA	NA
AZW75445.1\|2347819_2348737_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW75446.1\|2348741_2349455_-	NAD-dependent oxidoreductase	NA	NA	NA	NA
AZW75447.1\|2349468_2350440_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW75448.1\|2352159_2352540_+	ArsR family transcriptional regulator	NA	NA	NA	NA
AZW75449.1\|2352543_2353731_+	MFS transporter	NA	NA	NA	NA
AZW77014.1\|2354169_2354892_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	1.3e-87	68.2
AZW75450.1\|2355185_2356136_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_15

2376927 : 2448081

Tetraselmis_virus(10.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW75465.1\|2376927_2377878_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75466.1\|2378430_2380056_-	arylsulfatase	A0A2P0VMN7	Tetraselmis_virus	2.0e-149	52.2
AZW77019.1\|2380105_2381140_-	haloacid dehalogenase-like hydrolase	NA	NA	NA	NA
AZW75467.1\|2381142_2382489_-	hypothetical protein	NA	NA	NA	NA
AZW77020.1\|2382485_2384000_-	VWA domain-containing protein	NA	NA	NA	NA
AZW75468.1\|2383990_2385001_-	hypothetical protein	NA	NA	NA	NA
AZW75469.1\|2385474_2386416_-	DUF58 domain-containing protein	NA	NA	NA	NA
AZW75470.1\|2386424_2387393_-	AAA family ATPase	NA	NA	NA	NA
AZW75471.1\|2388932_2389901_+	transporter	NA	NA	NA	NA
AZW75472.1\|2390078_2391068_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW75473.1\|2391114_2391873_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AZW75474.1\|2392062_2392800_+	hypothetical protein	A0A0S4KZH7	Pseudomonas_phage	4.1e-41	46.6
AZW75475.1\|2392898_2393849_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75476.1\|2394033_2394816_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.0e-09	25.8
AZW75477.1\|2394809_2395511_+	ABC transporter ATP-binding protein	NA	NA	NA	NA
AZW75478.1\|2395750_2396353_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW75479.1\|2397679_2398630_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75480.1\|2398626_2400183_-	LTA synthase family protein	NA	NA	NA	NA
AZW75481.1\|2400175_2400949_-	oxidoreductase	NA	NA	NA	NA
AZW75482.1\|2401007_2401958_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75483.1\|2402039_2403215_-	capsule biosynthesis protein CapA	NA	NA	NA	NA
AZW75484.1\|2403228_2405286_-	capsular polysaccharide export protein	NA	NA	NA	NA
AZW75485.1\|2405282_2406308_-	Vi polysaccharide biosynthesis UDP-N-acetylglucosaminuronic acid C-4 epimerase TviC	A0A2K9L4U8	Tupanvirus	4.7e-72	44.2
AZW75486.1\|2406319_2407609_-	nucleotide sugar dehydrogenase	NA	NA	NA	NA
AZW75487.1\|2407631_2408729_-	capsular polysaccharide export protein	NA	NA	NA	NA
AZW75488.1\|2408725_2409616_-	capsular biosynthesis protein	NA	NA	NA	NA
AZW75489.1\|2409612_2411697_-	Vi polysaccharide biosynthesis protein TviE	NA	NA	NA	NA
AZW75490.1\|2411728_2412898_-	capsule biosynthesis protein	NA	NA	NA	NA
AZW75491.1\|2412939_2413680_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
AZW75492.1\|2413679_2414450_-	polyhydroxyalkanoate biosynthesis repressor PhaR	NA	NA	NA	NA
AZW75493.1\|2415305_2416091_+	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	1.1e-12	32.0
AZW75494.1\|2416117_2418202_+	hypothetical protein	NA	NA	NA	NA
AZW75495.1\|2418369_2420325_+	capsular biosynthesis protein	NA	NA	NA	NA
AZW77021.1\|2420648_2421149_-	DNA starvation/stationary phase protection protein	W5S6G8	Pithovirus	6.4e-14	35.5
AZW75496.1\|2421247_2422774_-	methylmalonate-semialdehyde dehydrogenase (CoA acylating)	NA	NA	NA	NA
AZW77022.1\|2422911_2423799_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW75497.1\|2423813_2424767_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	7.2e-14	26.5
AZW75498.1\|2424818_2426909_-	DNA helicase RecG	NA	NA	NA	NA
AZW75499.1\|2426924_2427311_-	reactive intermediate/imine deaminase	NA	NA	NA	NA
AZW75500.1\|2430004_2430808_-	2,5-didehydrogluconate reductase DkgB	A0A2H4PQR8	Staphylococcus_phage	2.0e-33	32.4
AZW75501.1\|2432101_2433004_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW75502.1\|2433068_2433845_-	ferredoxin--NADP reductase	NA	NA	NA	NA
AZW75503.1\|2434166_2435216_+	iron ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW75504.1\|2435339_2437010_+	iron ABC transporter permease	NA	NA	NA	NA
AZW75505.1\|2437014_2437809_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.3e-16	29.4
AZW75506.1\|2437907_2438858_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75507.1\|2438877_2439783_-	pirin family protein	NA	NA	NA	NA
AZW75508.1\|2439860_2440559_-	pirin family protein	NA	NA	NA	NA
AZW75509.1\|2440718_2441663_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW75510.1\|2441672_2443163_-	nitrogen regulation protein NR(I)	NA	NA	NA	NA
AZW75511.1\|2443159_2444227_-	PAS domain-containing sensor histidine kinase	Q8QKV7	Ectocarpus_siliculosus_virus	1.1e-05	23.5
AZW75512.1\|2444290_2445703_-	type I glutamate--ammonia ligase	NA	NA	NA	NA
AZW75513.1\|2445888_2447109_-	oxygen-independent coproporphyrinogen III oxidase-like protein	NA	NA	NA	NA
AZW75514.1\|2447130_2448081_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_16

2489022 : 2550869

Planktothrix_phage(14.29%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW75553.1\|2489022_2489973_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75554.1\|2490071_2490680_-	recombination protein RecR	NA	NA	NA	NA
AZW75555.1\|2490730_2491057_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
AZW75556.1\|2491103_2493329_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	1.2e-43	38.5
AZW75557.1\|2493996_2497401_-	nuclease	NA	NA	NA	NA
AZW75558.1\|2497413_2500074_-	hypothetical protein	NA	NA	NA	NA
AZW75559.1\|2500277_2501480_-	MFS transporter	NA	NA	NA	NA
AZW75560.1\|2502166_2503279_+	D-alanyl-D-alanine endopeptidase	NA	NA	NA	NA
AZW75561.1\|2503285_2504236_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75562.1\|2504334_2504736_-	aryl-sulfate sulfotransferase	NA	NA	NA	NA
AZW75563.1\|2504808_2505387_-\|protease	protease	NA	NA	NA	NA
AZW77025.1\|2505504_2505993_-\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
AZW75564.1\|2506006_2506939_-	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	2.3e-25	29.5
AZW75565.1\|2506976_2507864_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	3.4e-18	28.7
AZW75566.1\|2508021_2509716_+	thiamine pyrophosphate-binding protein	E5ERI2	Ostreococcus_lucimarinus_virus	3.8e-26	24.5
AZW75567.1\|2509732_2510989_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW75568.1\|2511126_2511672_-	acyl dehydratase	NA	NA	NA	NA
AZW75569.1\|2511703_2513263_-	acetolactate synthase large subunit	NA	NA	NA	NA
AZW75570.1\|2513391_2514144_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.8e-29	39.7
AZW75571.1\|2514165_2514858_-	amino acid ABC transporter permease	NA	NA	NA	NA
AZW75572.1\|2514880_2515672_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW75573.1\|2515698_2516604_-	agmatinase	NA	NA	NA	NA
AZW75574.1\|2516796_2517633_-	IclR family transcriptional regulator	NA	NA	NA	NA
AZW75575.1\|2517724_2518747_-	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	1.6e-67	40.7
AZW75576.1\|2518883_2519936_-	threonylcarbamoyl-AMP synthase	S4VW33	Pandoravirus	4.8e-35	37.8
AZW75577.1\|2519940_2521131_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
AZW75578.1\|2521133_2521613_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	6.5e-16	42.5
AZW75579.1\|2521798_2522278_-	disulfide bond formation protein B	NA	NA	NA	NA
AZW75580.1\|2522285_2522522_-	hypothetical protein	NA	NA	NA	NA
AZW75581.1\|2522541_2522943_-	type II toxin-antitoxin system MqsA family antitoxin	NA	NA	NA	NA
AZW75582.1\|2522945_2523197_-	type II toxin-antitoxin system MqsR family toxin	NA	NA	NA	NA
AZW75583.1\|2523251_2524133_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0M4JBD3	Mollivirus	1.8e-51	36.1
AZW75584.1\|2524357_2524804_+	GFA family protein	NA	NA	NA	NA
AZW75585.1\|2524888_2525953_-	fructose-bisphosphate aldolase class II	NA	NA	NA	NA
AZW75586.1\|2526089_2526671_-	MOSC domain-containing protein	NA	NA	NA	NA
AZW75587.1\|2526905_2528036_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
AZW75588.1\|2528213_2529440_+	acetamidase/formamidase family protein	A0A1V0S8X7	Catovirus	5.2e-134	58.8
AZW75589.1\|2529498_2530014_+	transporter	NA	NA	NA	NA
AZW75590.1\|2530036_2530363_+	zinc ribbon domain-containing protein	NA	NA	NA	NA
AZW75591.1\|2530396_2531587_+	formate dehydrogenase	NA	NA	NA	NA
AZW75592.1\|2531660_2532065_+	GFA family protein	NA	NA	NA	NA
AZW75593.1\|2532281_2533232_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75594.1\|2533330_2534101_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.3e-29	39.5
AZW75595.1\|2534097_2534769_-	ectoine/hydroxyectoine ABC transporter permease subunit EhuD	NA	NA	NA	NA
AZW75596.1\|2534765_2535407_-	ectoine/hydroxyectoine ABC transporter permease subunit EhuC	NA	NA	NA	NA
AZW75597.1\|2535419_2536340_-	ectoine/hydroxyectoine ABC transporter substrate-binding protein EhuB	NA	NA	NA	NA
AZW75598.1\|2536500_2537661_-	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW75599.1\|2537702_2538653_-	ornithine cyclodeaminase	NA	NA	NA	NA
AZW75600.1\|2539251_2539476_+	hypothetical protein	NA	NA	NA	NA
AZW75601.1\|2539640_2541335_-	phosphoenolpyruvate--protein phosphotransferase	NA	NA	NA	NA
AZW75602.1\|2541456_2541726_-	HPr family phosphocarrier protein	NA	NA	NA	NA
AZW75603.1\|2541841_2542240_-	PTS mannose transporter subunit IIA	NA	NA	NA	NA
AZW75604.1\|2542250_2543207_-	glutathione synthetase	NA	NA	NA	NA
AZW75605.1\|2543343_2543889_-	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	9.1e-14	29.9
AZW75606.1\|2543909_2545859_-\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	4.1e-125	36.0
AZW75607.1\|2546246_2547023_+	DNA-binding response regulator	NA	NA	NA	NA
AZW75608.1\|2547028_2547421_+	hypothetical protein	NA	NA	NA	NA
AZW75609.1\|2547842_2548793_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75610.1\|2548789_2549887_-	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	3.5e-20	37.3
AZW75611.1\|2549918_2550869_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_17

2681748 : 2722417

Salmonella_phage(33.33%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW75722.1\|2681748_2682699_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75723.1\|2682809_2682992_+	hypothetical protein	NA	NA	NA	NA
AZW75724.1\|2683091_2683688_-	lipoprotein	NA	NA	NA	NA
AZW75725.1\|2683871_2684963_+	hypothetical protein	NA	NA	NA	NA
AZW75726.1\|2685462_2685873_-	MerR family transcriptional regulator	NA	NA	NA	NA
AZW75727.1\|2685931_2686273_-	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	2.8e-13	42.2
AZW75728.1\|2686278_2688696_-\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
AZW75729.1\|2688708_2689731_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	1.0e-26	38.6
AZW75730.1\|2689805_2690165_-	50S ribosomal protein L20	NA	NA	NA	NA
AZW75731.1\|2690180_2690378_-	50S ribosomal protein L35	NA	NA	NA	NA
AZW75732.1\|2690713_2691664_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75733.1\|2691650_2691839_-	hypothetical protein	NA	NA	NA	NA
AZW75734.1\|2691858_2692308_+	dUTP diphosphatase	S4TNT3	Salmonella_phage	3.7e-45	67.2
AZW75735.1\|2692304_2693255_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75736.1\|2693365_2694814_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
AZW75737.1\|2694928_2695210_-	hypothetical protein	NA	NA	NA	NA
AZW75738.1\|2695313_2696264_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75739.1\|2696508_2697222_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AZW75740.1\|2697344_2697572_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AZW75741.1\|2697866_2698505_-	DedA family protein	NA	NA	NA	NA
AZW75742.1\|2698577_2699648_+	metal-dependent hydrolase	NA	NA	NA	NA
AZW75743.1\|2699644_2700595_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75744.1\|2701010_2701535_-	DNA-binding protein	J9Q7G7	Salmonella_phage	6.5e-09	32.9
AZW75745.1\|2701538_2701808_-	hypothetical protein	NA	NA	NA	NA
AZW75746.1\|2702006_2703068_-	LacI family transcriptional regulator	NA	NA	NA	NA
AZW75747.1\|2703151_2704786_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.9e-15	31.1
AZW75748.1\|2704787_2705591_-	ABC transporter permease	NA	NA	NA	NA
AZW75749.1\|2705619_2706579_-	ABC transporter permease	NA	NA	NA	NA
AZW75750.1\|2706582_2708097_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW75751.1\|2708133_2709138_-	peptidase M20	NA	NA	NA	NA
AZW75752.1\|2709569_2710040_-	DUF1801 domain-containing protein	NA	NA	NA	NA
AZW75753.1\|2710075_2710687_-	LysE family translocator	NA	NA	NA	NA
AZW75754.1\|2710717_2711341_-	FMN-binding negative transcriptional regulator	NA	NA	NA	NA
AZW75755.1\|2711421_2712954_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
AZW75756.1\|2712988_2714230_-	MFS transporter	NA	NA	NA	NA
AZW75757.1\|2714273_2715305_-	alcohol dehydrogenase	A0A2K9L339	Tupanvirus	1.8e-26	27.8
AZW75758.1\|2715301_2716471_-	amine oxidase	NA	NA	NA	NA
AZW75759.1\|2716464_2717145_-	anti-sigma factor	NA	NA	NA	NA
AZW75760.1\|2717306_2718149_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW75761.1\|2718311_2719283_-	AraC family transcriptional regulator	NA	NA	NA	NA
AZW75762.1\|2719454_2720333_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
AZW75763.1\|2720355_2721426_-	FUSC family protein	NA	NA	NA	NA
AZW75764.1\|2721466_2722417_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_18

2777882 : 2850752

Moraxella_phage(16.67%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW75808.1\|2777882_2778299_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
AZW75809.1\|2778409_2779042_+	7-carboxy-7-deazaguanine synthase	NA	NA	NA	NA
AZW75810.1\|2779070_2779514_+	6-carboxytetrahydropterin synthase QueD	NA	NA	NA	NA
AZW75811.1\|2779535_2780627_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW75812.1\|2780681_2781482_-	aldolase	NA	NA	NA	NA
AZW75813.1\|2781617_2782238_+	XRE family transcriptional regulator	NA	NA	NA	NA
AZW75814.1\|2782377_2782851_+	MarR family transcriptional regulator	NA	NA	NA	NA
AZW75815.1\|2783990_2784941_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75816.1\|2784937_2792599_-	adhesin	A0A0R6PJK4	Moraxella_phage	7.3e-24	30.9
AZW75817.1\|2792839_2796886_-	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	6.3e-160	67.4
AZW75818.1\|2797198_2797780_+	TRAP transporter small permease	NA	NA	NA	NA
AZW75819.1\|2797776_2799075_+	TRAP transporter large permease	NA	NA	NA	NA
AZW75820.1\|2799154_2800183_+	C4-dicarboxylate ABC transporter	NA	NA	NA	NA
AZW75821.1\|2800106_2800457_+	hypothetical protein	NA	NA	NA	NA
AZW75822.1\|2800443_2801394_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75823.1\|2801390_2802341_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75824.1\|2802657_2803263_+	fimbrial protein FimX	NA	NA	NA	NA
AZW75825.1\|2803316_2804630_-	phenylacetate--CoA ligase	NA	NA	NA	NA
AZW75826.1\|2804704_2805175_-	phenylacetic acid degradation protein PaaD	NA	NA	NA	NA
AZW75827.1\|2805174_2805963_-	2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase	NA	NA	NA	NA
AZW75828.1\|2805973_2807626_-	phenylacetic acid degradation protein PaaN	NA	NA	NA	NA
AZW75829.1\|2807713_2808664_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77036.1\|2809825_2810332_-	phenylacetate-CoA oxygenase subunit PaaJ	NA	NA	NA	NA
AZW75830.1\|2810328_2811093_-	phenylacetate-CoA oxygenase subunit PaaI	NA	NA	NA	NA
AZW75831.1\|2811108_2811393_-	1,2-phenylacetyl-CoA epoxidase subunit B	NA	NA	NA	NA
AZW75832.1\|2811457_2812447_-	1,2-phenylacetyl-CoA epoxidase subunit A	NA	NA	NA	NA
AZW75833.1\|2812618_2813548_+	phenylacetic acid degradation operon negative regulatory protein PaaX	NA	NA	NA	NA
AZW75834.1\|2813519_2814206_-	NAD(P)H-hydrate epimerase	NA	NA	NA	NA
AZW75835.1\|2814239_2814785_-	oligoribonuclease	Q8B5Y0	Diachasmimorpha_longicaudata_entomopoxvirus	2.1e-26	37.7
AZW75836.1\|2814829_2816095_+	peptidase M48	NA	NA	NA	NA
AZW75837.1\|2816091_2816994_+	ribosome biogenesis GTPase	NA	NA	NA	NA
AZW75838.1\|2818175_2819120_-	ABC transporter permease	NA	NA	NA	NA
AZW75839.1\|2819214_2820732_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW75840.1\|2820773_2822402_-	gamma-glutamyltransferase	NA	NA	NA	NA
AZW75841.1\|2822509_2823391_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW75842.1\|2826503_2826878_+	endonuclease	F4YXR7	Roseobacter_phage	2.1e-25	54.4
AZW75843.1\|2826902_2827241_-	P-II family nitrogen regulator	NA	NA	NA	NA
AZW75844.1\|2827284_2828919_-	NAD+ synthase	A0A2L0UZF5	Agrobacterium_phage	8.3e-87	36.6
AZW75845.1\|2828957_2830304_-	mechanosensitive ion channel protein MscS	NA	NA	NA	NA
AZW77037.1\|2830411_2831833_+	argininosuccinate lyase	NA	NA	NA	NA
AZW75846.1\|2831902_2832487_-	nitroreductase	NA	NA	NA	NA
AZW75847.1\|2832589_2833540_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75848.1\|2833674_2834781_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW75849.1\|2834791_2835889_+	GTP 3',8-cyclase MoaA	NA	NA	NA	NA
AZW75850.1\|2836033_2837239_-	molybdopterin molybdenumtransferase MoeA	NA	NA	NA	NA
AZW75851.1\|2837245_2837767_-	molybdenum cofactor biosynthesis protein B	NA	NA	NA	NA
AZW75852.1\|2837763_2838255_-	molybdenum cofactor biosynthesis protein MoaE	NA	NA	NA	NA
AZW75853.1\|2838251_2838503_-	MoaD/ThiS family protein	NA	NA	NA	NA
AZW75854.1\|2838483_2838969_-	cyclic pyranopterin monophosphate synthase MoaC	NA	NA	NA	NA
AZW75855.1\|2839104_2842566_+	hypothetical protein	NA	NA	NA	NA
AZW75856.1\|2842562_2843468_+	dienelactone hydrolase family protein	NA	NA	NA	NA
AZW75857.1\|2843477_2843909_-	lipoprotein	NA	NA	NA	NA
AZW77038.1\|2844155_2844659_+	peroxiredoxin	M1I839	Pelagibacter_phage	1.8e-24	44.1
AZW75858.1\|2844670_2846137_+	MFS transporter	NA	NA	NA	NA
AZW75859.1\|2846211_2847087_-	hypothetical protein	NA	NA	NA	NA
AZW77039.1\|2847083_2848091_-	biotin synthase	NA	NA	NA	NA
AZW75860.1\|2848558_2848864_+	DUF4148 domain-containing protein	NA	NA	NA	NA
AZW75861.1\|2848954_2849545_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW77040.1\|2849735_2850752_-\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_19

2853895 : 2920707

uncultured_Mediterranean_phage(28.57%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW75864.1\|2853895_2854846_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75865.1\|2854944_2855895_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75866.1\|2855891_2856686_-	N-formylglutamate deformylase	NA	NA	NA	NA
AZW75867.1\|2856717_2857422_-	oxidoreductase	NA	NA	NA	NA
AZW75868.1\|2857496_2858297_-	SURF1 family protein	NA	NA	NA	NA
AZW75869.1\|2858293_2858701_-	cytochrome o ubiquinol oxidase subunit IV	NA	NA	NA	NA
AZW75870.1\|2858697_2859339_-	cytochrome o ubiquinol oxidase subunit III	NA	NA	NA	NA
AZW75871.1\|2859331_2861353_-	cytochrome o ubiquinol oxidase subunit I	NA	NA	NA	NA
AZW75872.1\|2862592_2863924_+	MFS transporter	NA	NA	NA	NA
AZW75873.1\|2863920_2864871_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75874.1\|2866577_2866883_-	hypothetical protein	NA	NA	NA	NA
AZW75875.1\|2867551_2867890_+	transcriptional regulator	NA	NA	NA	NA
AZW75876.1\|2872444_2873047_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW75877.1\|2873143_2874433_+	MFS transporter	NA	NA	NA	NA
AZW75878.1\|2874490_2875222_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-12	31.0
AZW75879.1\|2875218_2876022_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.9e-14	23.5
AZW75880.1\|2876018_2877107_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
AZW75881.1\|2877103_2878033_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW75882.1\|2878181_2879327_-	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW75883.1\|2879348_2880299_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75884.1\|2880629_2884451_-	trifunctional transcriptional regulator/proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
AZW75885.1\|2884607_2885276_-	lipoprotein	NA	NA	NA	NA
AZW75886.1\|2885280_2886954_-	MCE family protein	NA	NA	NA	NA
AZW75887.1\|2886972_2888292_-	paraquat-inducible membrane protein A	NA	NA	NA	NA
AZW75888.1\|2888296_2890648_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	4.2e-164	41.9
AZW77041.1\|2890667_2892836_-	penicillin-binding protein 1C	NA	NA	NA	NA
AZW75889.1\|2892832_2898022_-	alpha-2-macroglobulin family protein	NA	NA	NA	NA
AZW75890.1\|2898111_2898426_-\|protease	ATP-dependent Clp protease adaptor ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	1.2e-10	43.8
AZW75891.1\|2898653_2898899_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	1.3e-20	76.6
AZW75892.1\|2898993_2899512_+	hypothetical protein	A0A1B1IUW8	uncultured_Mediterranean_phage	5.1e-14	42.2
AZW75893.1\|2899611_2900817_-	3-oxoadipyl-CoA thiolase	NA	NA	NA	NA
AZW75894.1\|2900932_2902330_-	chloride channel protein EriC	NA	NA	NA	NA
AZW75895.1\|2902446_2903025_-	superoxide dismutase [Fe]	NA	NA	NA	NA
AZW75896.1\|2903097_2904489_-	exodeoxyribonuclease VII large subunit	A0A1V0SD82	Indivirus	1.4e-29	32.0
AZW75897.1\|2904656_2905607_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75898.1\|2905887_2906508_+	MotA/TolQ/ExbB proton channel family protein	NA	NA	NA	NA
AZW75899.1\|2906504_2906918_+	biopolymer transporter ExbD	NA	NA	NA	NA
AZW75900.1\|2906914_2907958_+	tetraacyldisaccharide 4'-kinase	NA	NA	NA	NA
AZW75901.1\|2908013_2908202_+	hypothetical protein	NA	NA	NA	NA
AZW75902.1\|2908211_2908976_+	3-deoxy-manno-octulosonate cytidylyltransferase	NA	NA	NA	NA
AZW75903.1\|2909066_2909723_+	adenylate kinase	NA	NA	NA	NA
AZW75904.1\|2909814_2910573_+	3-hydroxyacyl-CoA dehydrogenase	NA	NA	NA	NA
AZW75905.1\|2910598_2912200_+	murein biosynthesis integral membrane protein MurJ	NA	NA	NA	NA
AZW75906.1\|2912400_2913405_+	DUF4880 domain-containing protein	NA	NA	NA	NA
AZW75907.1\|2913505_2913769_+	30S ribosomal protein S20	NA	NA	NA	NA
AZW75908.1\|2913886_2914663_-	2-dehydro-3-deoxyglucarate aldolase	NA	NA	NA	NA
AZW75909.1\|2915253_2916204_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75910.1\|2918587_2919700_-	malate dehydrogenase	NA	NA	NA	NA
AZW75911.1\|2919756_2920707_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_20

2951093 : 2990282

Planktothrix_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW75940.1\|2951093_2952044_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75941.1\|2952030_2952276_-	hypothetical protein	NA	NA	NA	NA
AZW75942.1\|2952164_2953061_-	inositol monophosphatase	NA	NA	NA	NA
AZW75943.1\|2955338_2957564_+	glycosyl hydrolase	NA	NA	NA	NA
AZW75944.1\|2957728_2958817_+	methionine import ATP-binding protein MetN	G9BWD6	Planktothrix_phage	8.7e-32	36.4
AZW75945.1\|2958773_2959427_+	ABC transporter permease	NA	NA	NA	NA
AZW75946.1\|2959474_2960272_+	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW75947.1\|2960803_2961754_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75948.1\|2961834_2962983_+	alcohol dehydrogenase	NA	NA	NA	NA
AZW75949.1\|2963039_2963990_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75950.1\|2963976_2964195_-	hypothetical protein	NA	NA	NA	NA
AZW75951.1\|2964088_2964394_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
AZW75952.1\|2964422_2964857_-	DUF126 domain-containing protein	NA	NA	NA	NA
AZW75953.1\|2964858_2966103_-	DUF521 domain-containing protein	NA	NA	NA	NA
AZW75954.1\|2966099_2966810_-	FadR family transcriptional regulator	NA	NA	NA	NA
AZW77043.1\|2966824_2967736_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW75955.1\|2968098_2968503_+	hypothetical protein	NA	NA	NA	NA
AZW75956.1\|2968499_2968958_+	hypothetical protein	NA	NA	NA	NA
AZW75957.1\|2968964_2969873_+	hypothetical protein	NA	NA	NA	NA
AZW77044.1\|2969869_2970736_+	sugar ABC transporter permease	NA	NA	NA	NA
AZW75958.1\|2970722_2971550_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
AZW75959.1\|2971560_2972688_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-23	32.3
AZW75960.1\|2973765_2975004_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75961.1\|2975045_2976308_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW75962.1\|2976314_2977067_+	DNA-binding protein	NA	NA	NA	NA
AZW75963.1\|2977118_2977304_-	hypothetical protein	NA	NA	NA	NA
AZW77045.1\|2977579_2978044_+	redox-sensitive transcriptional activator SoxR	NA	NA	NA	NA
AZW75964.1\|2978075_2978735_+	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
AZW75965.1\|2978879_2980988_+	AsmA family protein	NA	NA	NA	NA
AZW75966.1\|2980984_2981935_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75967.1\|2982038_2982659_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW77046.1\|2982762_2983503_+	oxidoreductase	NA	NA	NA	NA
AZW75968.1\|2984637_2985762_-	hypothetical protein	NA	NA	NA	NA
AZW75969.1\|2985807_2986176_-	hypothetical protein	NA	NA	NA	NA
AZW75970.1\|2986417_2987368_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW75971.1\|2988403_2988946_-	hypothetical protein	NA	NA	NA	NA
AZW75972.1\|2989150_2989345_+	hypothetical protein	NA	NA	NA	NA
AZW75973.1\|2989331_2990282_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_21

3228294 : 3272961

Erwinia_phage(16.67%)

transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW76159.1\|3228294_3229245_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW76160.1\|3229689_3230001_-	cell division protein ZapA	NA	NA	NA	NA
AZW76161.1\|3230000_3230531_-	hypothetical protein	NA	NA	NA	NA
AZW76162.1\|3230693_3231644_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW76163.1\|3231933_3232398_+	tripartite tricarboxylate transporter TctB family protein	NA	NA	NA	NA
AZW76164.1\|3232412_3233918_+	tripartite tricarboxylate transporter permease	NA	NA	NA	NA
AZW76165.1\|3234171_3235779_+	gamma-glutamyltransferase family protein	NA	NA	NA	NA
AZW76166.1\|3235834_3236740_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AZW76167.1\|3237180_3238131_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW76168.1\|3238212_3238794_-	ATP:cob(I)alamin adenosyltransferase	NA	NA	NA	NA
AZW77064.1\|3239218_3239524_+	RND transporter	NA	NA	NA	NA
AZW76169.1\|3239537_3240872_-	HslU--HslV peptidase ATPase subunit	A0A191ZC11	Erwinia_phage	3.5e-43	29.6
AZW76170.1\|3240893_3241433_-	HslU--HslV peptidase proteolytic subunit	NA	NA	NA	NA
AZW76171.1\|3241580_3242045_-	RNA polymerase-binding protein DksA	NA	NA	NA	NA
AZW76172.1\|3242187_3243303_-	GTP-binding protein	NA	NA	NA	NA
AZW76173.1\|3243579_3244083_-	transcriptional repressor	NA	NA	NA	NA
AZW76174.1\|3244220_3244421_+	hypothetical protein	NA	NA	NA	NA
AZW76175.1\|3244411_3245134_+	metal ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.1e-11	30.0
AZW76176.1\|3245130_3246027_+	metal ABC transporter permease	NA	NA	NA	NA
AZW76177.1\|3246023_3246959_+	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW77065.1\|3246964_3247588_+	DUF1007 domain-containing protein	NA	NA	NA	NA
AZW76178.1\|3247578_3248547_+	nickel transporter	NA	NA	NA	NA
AZW76179.1\|3248595_3250737_+	TonB-dependent receptor	NA	NA	NA	NA
AZW76180.1\|3250749_3251730_-	tyrosine recombinase XerC	A0A166YH27	Gordonia_phage	3.3e-14	30.5
AZW76181.1\|3251744_3252437_-	DUF484 domain-containing protein	NA	NA	NA	NA
AZW76182.1\|3252463_3253375_-	diaminopimelate epimerase	NA	NA	NA	NA
AZW76183.1\|3253417_3254308_-	acyltransferase	NA	NA	NA	NA
AZW76184.1\|3254304_3255159_-	lipid A biosynthesis lauroyl acyltransferase	NA	NA	NA	NA
AZW76185.1\|3255307_3256606_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	1.6e-125	60.9
AZW76186.1\|3256716_3256968_+	DUF1289 domain-containing protein	NA	NA	NA	NA
AZW76187.1\|3257047_3258088_+	glycosyltransferase family 1 protein	NA	NA	NA	NA
AZW76188.1\|3258367_3259786_+	adenosylhomocysteinase	S4VPF6	Pandoravirus	8.7e-40	29.4
AZW76189.1\|3259856_3260192_+\|holin	phage holin family protein	NA	NA	NA	NA
AZW76190.1\|3260191_3261034_+	methylenetetrahydrofolate reductase [NAD(P)H]	NA	NA	NA	NA
AZW76191.1\|3261132_3262083_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW76192.1\|3262098_3262602_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
AZW77066.1\|3264808_3265234_+	hypothetical protein	NA	NA	NA	NA
AZW76193.1\|3265385_3265685_+	DUF4148 domain-containing protein	NA	NA	NA	NA
AZW76194.1\|3265730_3265853_+	hypothetical protein	NA	NA	NA	NA
AZW76195.1\|3265945_3266527_-	hypothetical protein	NA	NA	NA	NA
AZW77067.1\|3266614_3267499_+	alpha/beta hydrolase	NA	NA	NA	NA
AZW76196.1\|3267634_3268390_+	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW76197.1\|3268411_3269092_+	molybdate ABC transporter permease subunit	NA	NA	NA	NA
AZW76198.1\|3269103_3270213_+	molybdenum import ATP-binding protein ModC	G9BWD6	Planktothrix_phage	7.5e-23	34.5
AZW77068.1\|3270219_3271698_-	phospholipase D family protein	NA	NA	NA	NA
AZW76199.1\|3272010_3272961_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_22

3284790 : 3324791

Mycobacterium_phage(50.0%)

tRNA,integrase,transposase,protease

attL 3307587:3307605|attR 3327475:3327493

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW76208.1\|3284790_3285741_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW76209.1\|3285727_3285925_-	hypothetical protein	NA	NA	NA	NA
AZW76210.1\|3286268_3287042_-	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW76211.1\|3287174_3288185_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW76212.1\|3288336_3289992_-	gamma-glutamyltransferase family protein	NA	NA	NA	NA
AZW76213.1\|3290046_3290388_-	cupin domain-containing protein	NA	NA	NA	NA
AZW76214.1\|3290401_3291841_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
AZW76215.1\|3291973_3292789_-	MerR family transcriptional regulator	NA	NA	NA	NA
AZW76216.1\|3292807_3292996_+	hypothetical protein	NA	NA	NA	NA
AZW76217.1\|3292982_3293933_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW76218.1\|3295320_3296268_+	hypothetical protein	NA	NA	NA	NA
AZW76219.1\|3296494_3297235_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW76220.1\|3297320_3298271_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW76221.1\|3299712_3301284_-	winged helix family transcriptional regulator	NA	NA	NA	NA
AZW76222.1\|3301616_3303470_+	hypothetical protein	NA	NA	NA	NA
AZW76223.1\|3303514_3306079_+	autotransporter outer membrane beta-barrel domain-containing protein	NA	NA	NA	NA
AZW76224.1\|3306497_3307448_+\|transposase	IS481 family transposase	NA	NA	NA	NA
3307587:3307605	attL	NA	NA	NA	NA
AZW76225.1\|3310313_3310808_-	DUF4276 domain-containing protein	NA	NA	NA	NA
AZW76226.1\|3310824_3311775_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW76227.1\|3311761_3311962_-	hypothetical protein	NA	NA	NA	NA
AZW76228.1\|3311958_3313170_-	chromosome segregation protein SMC	NA	NA	NA	NA
AZW76229.1\|3313185_3316137_-	restriction endonuclease subunit M	G8I4P9	Mycobacterium_phage	2.9e-21	25.1
AZW76230.1\|3316138_3319258_-	restriction endonuclease	NA	NA	NA	NA
AZW77070.1\|3319254_3319395_-	DEAD/DEAH box helicase	NA	NA	NA	NA
AZW76231.1\|3319405_3320452_-	Fic family protein	NA	NA	NA	NA
AZW76232.1\|3320793_3321921_-\|integrase	site-specific integrase	A0A1B0VMI6	Pseudomonas_phage	1.4e-48	33.6
AZW76233.1\|3322200_3323292_-	redox-regulated ATPase YchF	NA	NA	NA	NA
AZW76234.1\|3323364_3324147_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AZW76235.1\|3324143_3324791_-\|tRNA	peptidyl-tRNA hydrolase	NA	NA	NA	NA
3327475:3327493	attR	NA	NA	NA	NA

DBSCAN-SWA_23

3373678 : 3427419

Staphylococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW76272.1\|3373678_3374629_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW76273.1\|3375033_3375678_-	urease accessory protein UreG	NA	NA	NA	NA
AZW76274.1\|3375702_3376287_-	urease accessory protein UreF	NA	NA	NA	NA
AZW76275.1\|3376387_3377005_-	urease accessory protein UreE	NA	NA	NA	NA
AZW76276.1\|3377007_3378723_-	urease subunit alpha	NA	NA	NA	NA
AZW76277.1\|3378719_3379028_-	urease subunit beta	NA	NA	NA	NA
AZW76278.1\|3379044_3379680_-	urease accessory protein UreJ	NA	NA	NA	NA
AZW76279.1\|3379706_3380009_-	urease subunit gamma	NA	NA	NA	NA
AZW76280.1\|3380109_3380964_-	urease accessory protein UreD	NA	NA	NA	NA
AZW76281.1\|3381545_3381818_+	MerR family DNA-binding transcriptional regulator	NA	NA	NA	NA
AZW76282.1\|3382235_3382643_-	GFA family protein	NA	NA	NA	NA
AZW76283.1\|3383012_3383807_-	GntR family transcriptional regulator	NA	NA	NA	NA
AZW76284.1\|3383907_3385143_+	methylaspartate ammonia-lyase	NA	NA	NA	NA
AZW76285.1\|3385211_3386228_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW76286.1\|3386224_3387616_+	MmgE/PrpD family protein	NA	NA	NA	NA
AZW76287.1\|3387612_3388809_+	MFS transporter	NA	NA	NA	NA
AZW76288.1\|3388805_3390344_-	SpoVR family protein	NA	NA	NA	NA
AZW76289.1\|3390340_3391600_-	hypothetical protein	NA	NA	NA	NA
AZW76290.1\|3393540_3394491_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW76291.1\|3395257_3396352_-	CoA transferase	NA	NA	NA	NA
AZW76292.1\|3396344_3397679_-	CoA ligase	NA	NA	NA	NA
AZW76293.1\|3397632_3398316_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW76294.1\|3398341_3399505_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW76295.1\|3399501_3400503_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW76296.1\|3400502_3401375_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW76297.1\|3401371_3402121_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.9e-09	27.8
AZW76298.1\|3402117_3402909_-	ABC transporter ATP-binding protein	A0A1M7XV31	Cedratvirus	1.7e-08	29.4
AZW76299.1\|3402905_3404045_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW76300.1\|3404353_3405106_+	3-hydroxyacyl-CoA dehydrogenase	NA	NA	NA	NA
AZW76301.1\|3405139_3405922_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW76302.1\|3405925_3406315_+	DNA-binding protein	NA	NA	NA	NA
AZW76303.1\|3407454_3408318_+	3-alpha,7-alpha, 12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase	NA	NA	NA	NA
AZW76304.1\|3408353_3409442_+	hypothetical protein	NA	NA	NA	NA
AZW76305.1\|3409438_3410389_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW76306.1\|3410375_3410744_-	hypothetical protein	NA	NA	NA	NA
AZW76307.1\|3410742_3413721_+	hypothetical protein	NA	NA	NA	NA
AZW76308.1\|3414647_3415526_+	fatty acid desaturase	NA	NA	NA	NA
AZW76309.1\|3417474_3418425_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW76310.1\|3418421_3418889_-	ribonuclease HI	J9Q745	Salmonella_phage	5.6e-36	50.7
AZW76311.1\|3418931_3419702_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AZW76312.1\|3419722_3420523_+	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
AZW76313.1\|3420533_3421943_+	lytic transglycosylase	NA	NA	NA	NA
AZW76314.1\|3422037_3422823_+	enoyl-[acyl-carrier-protein] reductase FabI	NA	NA	NA	NA
AZW77073.1\|3423062_3424079_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW76315.1\|3424186_3424579_-	OsmC family peroxiredoxin	NA	NA	NA	NA
AZW76316.1\|3424716_3425397_+	DUF533 domain-containing protein	NA	NA	NA	NA
AZW76317.1\|3425401_3426400_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW76318.1\|3426468_3427419_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_24

3433574 : 3492874

Acinetobacter_phage(27.27%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW76322.1\|3433574_3435338_+\|tRNA	glutamine--tRNA ligase	A0A222YZ70	Escherichia_phage	5.0e-162	50.0
AZW76323.1\|3435449_3436328_+	septum site-determining protein MinC	NA	NA	NA	NA
AZW76324.1\|3436440_3437256_+	septum site-determining protein MinD	NA	NA	NA	NA
AZW76325.1\|3437259_3437511_+	cell division topological specificity factor	NA	NA	NA	NA
AZW77074.1\|3437595_3438612_-\|transposase	IS110 family transposase IS1663	NA	NA	NA	NA
AZW76326.1\|3438942_3439164_-	hypothetical protein	NA	NA	NA	NA
AZW76327.1\|3441524_3442442_-	EamA/RhaT family transporter	NA	NA	NA	NA
AZW76328.1\|3442939_3444148_-	ABC transporter permease	NA	NA	NA	NA
AZW76329.1\|3444227_3445799_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW76330.1\|3445916_3446852_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
AZW76331.1\|3447040_3447985_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	8.4e-07	23.2
AZW76332.1\|3448053_3448269_-	hypothetical protein	NA	NA	NA	NA
AZW76333.1\|3448552_3454270_+	excinuclease ABC subunit A	A0A1B1IVR3	uncultured_Mediterranean_phage	1.0e-195	39.5
AZW76334.1\|3454275_3455403_+	aminodeoxychorismate synthase, component I	S4VT78	Pandoravirus	3.8e-38	37.8
AZW76335.1\|3455458_3456085_+	aminotransferase	NA	NA	NA	NA
AZW77075.1\|3456356_3457373_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW76336.1\|3457468_3458179_-	oxidoreductase	NA	NA	NA	NA
AZW77076.1\|3458175_3459165_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW76337.1\|3459296_3460892_+	acyl-CoA synthetase	NA	NA	NA	NA
AZW76338.1\|3460894_3461632_+	GntR family transcriptional regulator	NA	NA	NA	NA
AZW76339.1\|3461787_3462660_-\|tRNA	tRNA threonylcarbamoyladenosine dehydratase	NA	NA	NA	NA
AZW76340.1\|3462928_3464149_+	MFS transporter	NA	NA	NA	NA
AZW76341.1\|3464145_3464805_+	gamma-glutamylcyclotransferase	NA	NA	NA	NA
AZW76342.1\|3464876_3465509_+	pyridoxine/pyridoxamine 5'-phosphate oxidase	NA	NA	NA	NA
AZW76343.1\|3465538_3466057_+	flavin reductase	NA	NA	NA	NA
AZW76344.1\|3466067_3467177_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
AZW76345.1\|3467223_3468078_+	formyltetrahydrofolate deformylase	NA	NA	NA	NA
AZW76346.1\|3468079_3468982_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW76347.1\|3470204_3471155_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW76348.1\|3472911_3473901_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW76349.1\|3474076_3474865_-	indole-3-glycerol-phosphate synthase	A0A0P0IR83	Acinetobacter_phage	5.1e-66	53.0
AZW76350.1\|3474861_3475893_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	7.4e-73	42.7
AZW76351.1\|3475911_3476475_-	type 1 glutamine amidotransferase	A0A0P0IKJ1	Acinetobacter_phage	1.1e-65	62.1
AZW76352.1\|3476530_3478051_-	anthranilate synthase component I	S4VT78	Pandoravirus	9.0e-43	32.1
AZW76353.1\|3478314_3479019_-	phosphoglycolate phosphatase	NA	NA	NA	NA
AZW76354.1\|3479026_3479764_-	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
AZW76355.1\|3479869_3480244_+	Co2+/Mg2+ efflux protein ApaG	NA	NA	NA	NA
AZW76356.1\|3480286_3481576_+	hypothetical protein	NA	NA	NA	NA
AZW76357.1\|3481572_3482742_+	ubiquinone biosynthesis protein UbiH	NA	NA	NA	NA
AZW76358.1\|3482738_3483578_+	thiol:disulfide interchange protein DsbC	NA	NA	NA	NA
AZW76359.1\|3483637_3484573_+	hydroxyacid dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	6.4e-15	27.7
AZW76360.1\|3484585_3485536_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW76361.1\|3485634_3486597_-\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	4.6e-93	64.5
AZW76362.1\|3486628_3486988_-	dihydroneopterin aldolase	NA	NA	NA	NA
AZW76363.1\|3487112_3488015_+	NAD(P)/FAD-dependent oxidoreductase	G3MA85	Bacillus_virus	1.9e-08	24.0
AZW76364.1\|3488016_3489789_-	PDZ domain-containing protein	NA	NA	NA	NA
AZW76365.1\|3489823_3490600_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW76366.1\|3491923_3492874_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_25

3507812 : 3565885

Planktothrix_phage(12.5%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW76378.1\|3507812_3508763_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW76379.1\|3508891_3510025_-	peptidase	NA	NA	NA	NA
AZW76380.1\|3510068_3510974_-	alpha/beta hydrolase	NA	NA	NA	NA
AZW76381.1\|3510976_3512677_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-15	32.7
AZW76382.1\|3512673_3513594_-	ABC transporter permease	NA	NA	NA	NA
AZW76383.1\|3513601_3514579_-	ABC transporter permease	NA	NA	NA	NA
AZW76384.1\|3514637_3515672_-	succinylglutamate desuccinylase	NA	NA	NA	NA
AZW76385.1\|3517646_3517883_-	hypothetical protein	NA	NA	NA	NA
AZW76386.1\|3518009_3518873_-	NAD(P)H-hydrate dehydratase	NA	NA	NA	NA
AZW76387.1\|3518961_3519783_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW76388.1\|3519862_3520600_-	enoyl-CoA hydratase	NA	NA	NA	NA
AZW76389.1\|3520596_3521589_-	nitronate monooxygenase	NA	NA	NA	NA
AZW76390.1\|3521702_3522365_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW76391.1\|3522409_3523558_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW76392.1\|3525881_3526832_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW76393.1\|3527172_3528123_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW76394.1\|3528221_3529172_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW76395.1\|3529468_3529966_+	hypothetical protein	NA	NA	NA	NA
AZW76396.1\|3530008_3531784_+	copper resistance system multicopper oxidase	NA	NA	NA	NA
AZW77079.1\|3531830_3532658_+	copper resistance protein B	NA	NA	NA	NA
AZW76397.1\|3532664_3533399_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
AZW76398.1\|3534568_3535363_-	IclR family transcriptional regulator	NA	NA	NA	NA
AZW76399.1\|3535652_3536243_+	cysteine dioxygenase	NA	NA	NA	NA
AZW76400.1\|3536276_3537605_-	amidase	NA	NA	NA	NA
AZW76401.1\|3537679_3538825_-	transporter	NA	NA	NA	NA
AZW76402.1\|3538936_3539935_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW76403.1\|3539897_3540332_+	carbon monoxide dehydrogenase	NA	NA	NA	NA
AZW76404.1\|3541848_3542733_+	EamA/RhaT family transporter	NA	NA	NA	NA
AZW76405.1\|3542729_3543935_-	cardiolipin synthase ClsB	NA	NA	NA	NA
AZW76406.1\|3543931_3544792_-	endonuclease	NA	NA	NA	NA
AZW76407.1\|3544904_3546695_-\|tRNA	aspartate--tRNA ligase	A0A1V0SAC0	Catovirus	6.5e-08	25.5
AZW76408.1\|3546735_3547401_-	DUF502 domain-containing protein	A0A2I7S9X1	Vibrio_phage	6.7e-11	28.4
AZW76409.1\|3547401_3547710_-	FmdB family transcriptional regulator	NA	NA	NA	NA
AZW77080.1\|3547875_3549162_-	hypothetical protein	NA	NA	NA	NA
AZW76410.1\|3550595_3551546_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW76411.1\|3553497_3554712_-	phosphoribosylglycinamide formyltransferase 2	NA	NA	NA	NA
AZW76412.1\|3554817_3555807_+	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	4.3e-38	37.7
AZW76413.1\|3555803_3556412_+	hydrolase	E3T535	Cafeteria_roenbergensis_virus	5.2e-10	26.1
AZW76414.1\|3556424_3557054_+	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
AZW76415.1\|3557050_3557671_+	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
AZW76416.1\|3557702_3558494_+	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	9.5e-20	27.4
AZW76417.1\|3559336_3559801_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
AZW76418.1\|3559819_3560746_+	HPr kinase/phosphorylase	NA	NA	NA	NA
AZW76419.1\|3560799_3562086_-	cytochrome c	NA	NA	NA	NA
AZW76420.1\|3563016_3563889_+	RNase adaptor protein RapZ	A0A1P8D5W0	Corynebacterium_phage	2.4e-08	34.5
AZW76421.1\|3563885_3564836_+	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	6.9e-17	47.2
AZW76422.1\|3564934_3565885_+\|transposase	IS481 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP025345

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection