CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP030982	Bacillus cereus strain ZB201708 chromosome, complete genome	1 crisprs	cas14k,csa3,WYL,c2c10_CAS-V-U3,DinG,cas3,DEDDh	0	3	13	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP030982_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP030982_2

4851965-4852081

Orphan

Consensus_repeat	Method
CTTAAACAAGCGTTTGATTAATTCTCCATTTTTCTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP030982_2

>merge|CP030982|2|4851965-4852081|CRISPRCasFinder
CTTAAACAAGCGTTTGATTAATTCTCCATTTTTCTTCGTTAACCTTTGAACTACATGAGTTTCTTTCTACCGAACATACAGCTTAAACAAACGTTTGATTAATTCTCCATTTTTCTT

>CP030982|2|2|4851965-4852081|CRISPRCasFinder
CTTAAACAAGCGTTTGATTAATTCTCCATTTTTCTT	CGTTAACCTTTGAACTACATGAGTTTCTTTCTACCGAACATACAG
CTTAAACAAACGTTTGATTAATTCTCCATTTTTCTT

Protein	Signature genes	Signature genes Name	Protein_function
CP030982.1\|AZV68784.1\|4857561_4858110_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|379115
CP030982.1\|AZV68767.1\|4844499_4845285_-\|Fe-S-cluster-assembly-ATPase-SufC	unknown	unknown	gnl\|CDD\|223473
CP030982.1\|AZV68776.1\|4851403_4851769_-\|arsenate-reductase-family-protein	unknown	unknown	gnl\|CDD\|239334
CP030982.1\|AZV68770.1\|4847237_4847903_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224922
CP030982.1\|AZV68785.1\|4858113_4858836_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293807
CP030982.1\|AZV68778.1\|4852852_4853500_+\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239481
CP030982.1\|AZV68769.1\|4846401_4847214_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224381
CP030982.1\|AZV68783.1\|4856382_4857096_-\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
CP030982.1\|AZV68771.1\|4847895_4848921_-\|methionine-import-ATP-binding-protein-MetN-3	unknown	unknown	gnl\|CDD\|224058
CP030982.1\|AZV68774.1\|4850143_4850488_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224572
CP030982.1\|AZV68768.1\|4845523_4846330_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224381
CP030982.1\|AZV68786.1\|4858974_4860777_-\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173850
CP030982.1\|AZV68782.1\|4856053_4856239_-\|hypothetical-protein	unknown	unknown	unknown
CP030982.1\|AZV68772.1\|4849334_4849679_-\|hypothetical-protein	unknown	unknown	unknown
CP030982.1\|AZV68780.1\|4854595_4855765_-\|L-lactate-dehydrogenase	unknown	unknown	gnl\|CDD\|133427
CP030982.1\|AZV68773.1\|4849831_4850131_-\|thioredoxin	unknown	unknown	gnl\|CDD\|239245
CP030982.1\|AZV68777.1\|4852180_4852708_-\|hypothetical-protein	unknown	unknown	unknown
CP030982.1\|AZV68775.1\|4850978_4851362_-\|glycine-cleavage-system-protein-H	unknown	unknown	gnl\|CDD\|234918
CP030982.1\|AZV68779.1\|4853559_4854573_-\|PTS-sugar-transporter-subunit-IIC	unknown	unknown	gnl\|CDD\|379113
CP030982.1\|AZV68781.1\|4855791_4856040_-\|spore-coat-protein	unknown	unknown	gnl\|CDD\|377935

Protein	Function_ID	Function_description	E-value
CP030982.1\|AZV68784.1\|4857561_4858110_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|379115	pfam13305, WHG, WHG domain. This presumed domain is around 80 amino acids in length. It is found to the C-terminus of a DNA-binding helix-turn-helix domain. This domain may be involved in binding to an as yet unknown ligand that allows a transcriptional regulation response to that molecule. The domain is named WHG after three conserved residues near the C-terminus of the domain.	8.86502e-26
CP030982.1\|AZV68767.1\|4844499_4845285_-\|Fe-S-cluster-assembly-ATPase-SufC	gnl\|CDD\|223473	COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones].	5.15323e-150
CP030982.1\|AZV68776.1\|4851403_4851769_-\|arsenate-reductase-family-protein	gnl\|CDD\|239334	cd03036, ArsC_like, Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC. Proteins containing a redox active CXXC motif like TRX and glutaredoxin (GRX) function as protein disulfide oxidoreductases, altering the redox state of target proteins via the reversible oxidation of the active site dithiol. ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], using reducing equivalents derived from glutathione via GRX, through a single catalytic cysteine.	6.13259e-61
CP030982.1\|AZV68770.1\|4847237_4847903_-\|ABC-transporter-permease	gnl\|CDD\|224922	COG2011, AbcD, ABC-type metal ion transport system, permease component [Inorganic ion transport and metabolism].	8.57648e-99
CP030982.1\|AZV68785.1\|4858113_4858836_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293807	cd07721, yflN-like_MBL-fold, uncharacterized subgroup which includes Bacillus subtilis yflN; MBL-fold metallo hydrolase domain. This subgroup includes the uncharacterized Bacillus subtilis yflN protein. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) from which this fold was named are only a small fraction of the activities which are included in this superfamily. Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	6.69275e-73
CP030982.1\|AZV68769.1\|4846401_4847214_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224381	COG1464, NlpA, ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism].	6.69253e-111
CP030982.1\|AZV68783.1\|4856382_4857096_-\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	4.36104e-17
CP030982.1\|AZV68771.1\|4847895_4848921_-\|methionine-import-ATP-binding-protein-MetN-3	gnl\|CDD\|224058	COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism].	2.96413e-176
CP030982.1\|AZV68774.1\|4850143_4850488_-\|hypothetical-protein	gnl\|CDD\|224572	COG1658, COG1658, Small primase-like proteins (Toprim domain) [DNA replication, recombination, and repair].	2.03274e-21
CP030982.1\|AZV68768.1\|4845523_4846330_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224381	COG1464, NlpA, ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism].	5.121e-112
CP030982.1\|AZV68786.1\|4858974_4860777_-\|acyl-CoA-dehydrogenase	gnl\|CDD\|173850	cd01161, VLCAD, Very long chain acyl-CoA dehydrogenase. VLCAD is an acyl-CoA dehydrogenase (ACAD), which is found in the mitochondria of eukaryotes and in some bacteria. It catalyzes the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. VLCAD acts as a homodimer.	0
CP030982.1\|AZV68773.1\|4849831_4850131_-\|thioredoxin	gnl\|CDD\|239245	cd02947, TRX_family, TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains. Group I TRX is a small ancient protein that alter the redox state of target proteins via the reversible oxidation of an active site dithiol, present in a CXXC motif, partially exposed at the protein's surface. TRX reduces protein disulfide bonds, resulting in a disulfide bond at its active site. Oxidized TRX is converted to the active form by TRX reductase, using reducing equivalents derived from either NADPH or ferredoxins. By altering their redox state, TRX regulates the functions of at least 30 target proteins, some of which are enzymes and transcription factors. It also plays an important role in the defense against oxidative stress by directly reducing hydrogen peroxide and certain radicals, and by serving as a reductant for peroxiredoxins. At least two major types of functional TRXs have been reported in most organisms; in eukaryotes, they are located in the cytoplasm and the mitochondria. Higher plants contain more types (at least 20 TRX genes have been detected in the genome of Arabidopsis thaliana), two of which (types f amd m) are located in the same compartment, the chloroplast. Also included in the alignment are TRX-like domains which show sequence homology to TRX but do not contain the redox active CXXC motif. Group II proteins, in addition to either a redox active TRX or a TRX-like domain, also contain additional domains, which may or may not possess homology to known proteins.	2.00054e-18
CP030982.1\|AZV68780.1\|4854595_4855765_-\|L-lactate-dehydrogenase	gnl\|CDD\|133427	cd05291, HicDH_like, L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases. L-2-hydroxyisocapronate dehydrogenase (HicDH) catalyzes the conversion of a variety of 2-oxo carboxylic acids with medium-sized aliphatic or aromatic side chains. This subfamily is composed of HicDHs and some bacterial L-lactate dehydrogenases (LDH). LDHs catalyze the last step of glycolysis in which pyruvate is converted to L-lactate. Bacterial LDHs can be non-allosteric or may be activated by an allosteric effector such as fructose-1,6-bisphosphate. Members of this subfamily with known structures such as the HicDH of Lactobacillus confusus, the non-allosteric LDH of Lactobacillus pentosus, and the allosteric LDH of Bacillus stearothermophilus, show that they exist as homotetramers. The HicDH-like subfamily is part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.	0
CP030982.1\|AZV68778.1\|4852852_4853500_+\|phosphatase-PAP2-family-protein	gnl\|CDD\|239481	cd03386, PAP2_Aur1_like, PAP2_like proteins, Aur1_like subfamily. Yeast Aur1p or Ipc1p is necessary for the addition of inositol phosphate to ceramide, an essential step in yeast sphingolipid synthesis, and is the target of several antifungal compounds such as aureobasidin.	8.02684e-16
CP030982.1\|AZV68775.1\|4850978_4851362_-\|glycine-cleavage-system-protein-H	gnl\|CDD\|234918	PRK01202, PRK01202, glycine cleavage system protein GcvH.	6.96592e-70
CP030982.1\|AZV68779.1\|4853559_4854573_-\|PTS-sugar-transporter-subunit-IIC	gnl\|CDD\|379113	pfam13303, PTS_EIIC_2, Phosphotransferase system, EIIC. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. The sugar-specific permease of the PTS consists of three domains (IIA, IIB and IIC). The IIC domain catalyzes the transfer of a phosphoryl group from IIB to the sugar substrate.	1.25572e-86
CP030982.1\|AZV68781.1\|4855791_4856040_-\|spore-coat-protein	gnl\|CDD\|377935	pfam07875, Coat_F, Coat F domain. The Coat F proteins, which contribute to the Bacillales spore coat. It occurs multiple times in the genomes it is found in.	9.62029e-15

>CP030982.1|AZV68776.1|4851403_4851769_-|arsenate-reductase-family-protein
MTVTFYSYPKCGTCQKAKKWFEANDVAYEMIHIVENPPSKEDLRNLHEKSELPLKKFFNTSGMRYRELGLKDKLKDASEDEMYELLASDGMLIKRPIVTDGTNVTLGFNEEQFESVWKKYQ
>CP030982.1|AZV68775.1|4850978_4851362_-|glycine-cleavage-system-protein-H
MSIPNNLRYSEEHEWVKTEGNEVVIGITHFAQGELGDIVFVELPEVGATIEADEPFGSVESVKTVSELYAPVSGKVVAVNEELSDQPELVNESPYEGAWMVKVELSDASQVEKLLTAEKYAEMTNQD
>CP030982.1|AZV68774.1|4850143_4850488_-|hypothetical-protein
MIYVEKVIIVEGTSDRRKIESIIREPVEIVCTNGTIGLSKMDELVDQFFDKEVYVLVDADDAGEKLRKQFRKEFPQAEHIYIDRSYREVATAPSTHLANVLWGADIDVYTEYLR
>CP030982.1|AZV68773.1|4849831_4850131_-|thioredoxin
MIDWTGAEATSLIENEEKTVLYVYTPMCGTCQLAKKMLTVVEMTIEELKIGMLDLNYAPHLAKEYGIESVPCLLVFENGTLMKKIYAFHSVEYLYTELK
>CP030982.1|AZV68772.1|4849334_4849679_-|hypothetical-protein
MRLYSLLQSFVNYANGQYHLEPLLRREEKTVNFRLGDESCSLQISRDYIELVHEERGTEQIICLDEKDIEQLVNGNVRLQMLMNDGRVQYSGTYRTMLLVESMFHICKPMSVGA
>CP030982.1|AZV68771.1|4847895_4848921_-|methionine-import-ATP-binding-protein-MetN-3
MILLENVKKIYKAKSGDVTAVDNANLKIEKGEIFGVIGYSGAGKSSLIRLFNQLEKPTSGQITIANRVISTITGSELRKARQEIGMIFQHFNLLWSRTVRENIEFPLEIAGVDKTKRRKRVDELIHLVGLEGRGDAYPSQLSGGQKQRVGIARALANNPQVLLCDEATSALDPETTDQILDLLLDINKRLGLTIVLITHEMHVIRKICNRVAVMERGKIVETGPVLDVFRNPKQDITKRFVQQLTDSEDTNETIESLIEKYPDGKVIRLQFIGEAVERPVLQRLMQRSDIEVSILQGNIAQTNNGSYGSLVVHLNGEETAIQQAIEGIHQDQVELEVIAHG
>CP030982.1|AZV68770.1|4847237_4847903_-|ABC-transporter-permease
MDKLLANVDWNQMLEATGETLYMTAIAALATFVLGLILGLLLFMTAKDNLWENKSINTVIGAFVNIFRSIPFIILIILLIPFTKILLGTILGASAALPALIIGAAPFYARMVEIALREIDKGVIEASKAMGAKTSTIILKVLIPESLPALVSGITVTTIALVGYTAMAGVVGAGGLGTLAYLEGFQRGNNDVTIVATICVLLVVFLIQWIGDSLTTRIDKR
>CP030982.1|AZV68769.1|4846401_4847214_-|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein
MKKLLLTALISTSIFGLAACGGKDKDEKKLVVGASNVPHAEILEKAKPLLEKKGIELEVKKFQDYVLPNKSLADKDLDANYFQHIPYLEKEIKDKKYDFEVAGKIHLEPIGVYSQKYKSLKELPDGATIIMSNSVADHGRGLAILQKEGILKVKDGVDPVKATPKDIADNPKNLKFKTDIEPGLLPQVYNNKEGDAVLINSNYAIDAKLNPEKDAIAIEGNDSPYANIVAVRKGDKDKKEIKALVEVLHSKEIEDFINKEYKGAVVPVKE
>CP030982.1|AZV68768.1|4845523_4846330_-|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein
MRKILLSVVTALSVFTLAACGGKEENKLVVGASNVPHAVILEKAQPILEKKGIKLEIKKFQDYVLPNKALADKEIDANYFQHIPYLDKEIQEKGYKIVNAGKIHLEPMGIYSKKYKSLKELPDGGTVIMSNNVAERGRMLALLQKGGVIKLKDGVDVVKATVKDVVENPKNLKFKTDVEPGLSPKLYENNEGDALFINSNYAIDAKLNPTKDAIAIEGSDSPYANIIAVRKGDEKKKEIKELVEVLHSKEIQDFINKEYKGAVLPISE
>CP030982.1|AZV68767.1|4844499_4845285_-|Fe-S-cluster-assembly-ATPase-SufC
MAGSTLTVKDLHVSIDGKEILKGVNLEVKGGEIHAIMGPNGTGKSTLSSAIMGHPKYEVTEGSIIIDGEDVLEMEVDERAQAGLFLAMQYPSEISGVTNADFLRSAINARREEGDEISLMKFIRTLDKNMEFLEMDPEMAQRYLNEGFSGGEKKRNEILQLMMIEPKIAILDEIDSGLDIDALKVVSKGINQMRGEEFGCLMITHYQRLLNYITPDFVHVMMNGRIVKSGGPELAQRLEAEGYDWIKKELGIEDETAEQEA
>CP030982.1|AZV68777.1|4852180_4852708_-|hypothetical-protein
MKRLSYFLFFILICLVGAGCAKDKEGEKLEYNGRALVIGVVGEKPKDTFRNVKFEEMKLEALEKKSKEVDGFLIMKDHFQEASTEQYKNVFSSLKKPVFFIGLQDKLYSIFITKGIEYNSARKDVNAMYTQGFANIGSGEGQQWAIGLSNGGNTEESIHNMYIVVFQTIADYLNR
>CP030982.1|AZV68778.1|4852852_4853500_+|phosphatase-PAP2-family-protein
MKKFKLSSFLPLSYILLLVLVSPLYDVLNKSTVHAVDVTTVVDDWIPFVKAFIIPYLLWFPYLYGALIYYCFADRKQYYVTLSSVIFGKLACFSIYYFWQTTVPRPTVVGTDVFSELVRYIYSIDQPVNCFPSIHVLTTFVIMLAAFKRREQHAFEYYILTFFGTLIILSTLFTKQHAFLDAVSGMTLASILYFGVQLLLAKEPIKVPVKQNHKM
>CP030982.1|AZV68779.1|4853559_4854573_-|PTS-sugar-transporter-subunit-IIC
MKEYIMSRVFKASAGIAQGIFVSLGIGLLIENIGRIVDIPLLITIGVVAKSLMAPAIGAGIAFMLGANGLVIFSAMVAGAIGAGSISITEAGLIIKTGEPIGALLTATLAVYIGKRLSGKTALDMMLVPFAAILGSGLVGIWLSHNITPVLNTVGAFIKDSSAGSPFIASIVIAVVWGLLLISPASSAALAIALSLDGVAGGAALAGCVAQFIGFSVISAKENNLGGILAQALCTPKVQLPNITKNPMILVPTVVASAIVGPVSALIFQLEAGKEIAGLGLSSLIAPINLISSEGWEVVPAMVITYIIIPVAVSYILYIALKKAGRIHSGDMTVPQS
>CP030982.1|AZV68780.1|4854595_4855765_-|L-lactate-dehydrogenase
MRSFYFLYVNKYIINIFPVVTNMTKMEYNNSQKGQKLCSIFHKVSMVSIVGTSIIKNVKNKRNRLYDQLGEIAMKRHTRKIAIIGTGLVGSSCAYSIVNQGICEELLLIDINHERAVGEAMDLSHCINFTNTRTKVYAGSYEDCKDMDIVIITAGPAPKPGQSRLDTLGASAKIMESVVGGVMESGFDGIFLLASNPVDIITYEVWKLSGLPRNRVIGTGTSLDSSRLRTILSDMLHVDPRSIHGYSLGEHGDSQMVAWSHVTVGGKPILQILEEQKERFGEIDLDEIVEKTAKAGWEIYKRKGTTYYGIGNSLAYIASSIFNDDHRVIAVSAILDGEYGEYDICTGVPAIITRDGIREVVELNLTEDEESRFAKSNDILRDYMKTIGY
>CP030982.1|AZV68781.1|4855791_4856040_-|spore-coat-protein
MNEKDMVNDYLAGLNASLTSYANYIAQSDNEQLHQTLIQIRNQDEMRQRNMYEYAKQKSYYKPAAPANPMIVQQLKSQLSAE
>CP030982.1|AZV68782.1|4856053_4856239_-|hypothetical-protein
MQNLTELEVENLRHLIGGHATIINKLEQYAQTCTDPQLKQMLQKDAQDARNTKQQLMTFLG
>CP030982.1|AZV68783.1|4856382_4857096_-|CPBP-family-intramembrane-metalloprotease
MRKTVLDAYNAEREVDNITYKNLVVTIASILGFSLLGGLFLALALGIFGEEVLRANLEGYYLLLFDAAVVTIVLFAYKPVLHFIKNIWDVSILKNGKTYLYLLIGFIIIALTQYVMLELFSFESAEQQRDQLGSLGLQNSLQSIIYVLSVAIITPIKEEILYRGILYRFFEKKYSFLVGIIISSFIFGILHGGFPVTAMIMGIVFAMLYKKTQSILPSIILHIVWNLLVSISMIVSL
>CP030982.1|AZV68784.1|4857561_4858110_-|TetR/AcrR-family-transcriptional-regulator
MSPRIGLTLQKIVETAAEIADTNGIQEVTLASLAQRLGIRSPSLYNHVKGLQDVRKNLGIYGIQQLHNKLEEAAEDKQMDEAIHALGEAYVAFVRKHPGLYEATFLRDEEVRKAGDGIVKLCLQVLQQYGLEGENALHATRGFRSICHGFASIEQQGGFGLPLDLDISLHVLLETFIKGLRE
>CP030982.1|AZV68785.1|4858113_4858836_-|MBL-fold-metallo-hydrolase
MRMMHEKTVYQLSFLPRAFPVNCYFVEEEDGLTLIDAALPYSAKGILQAAEKIGKPITNIVLTHAHDDHIGALDALKEVLPHVPVYISKRDAKLLEGDTTLQKDEPNTPIKGGVPKKIKTVPDVLLEDGDRVGSLLAIMTPGHTPGSMSFLDVRNKALIVGDAFQTRGGMAVSGQMKFWFPFPAMATWSKEISLQSAQKLSEYEPSLLAAGHGKMIKDPGAVIELAIQEAKRNIESKKEG
>CP030982.1|AZV68786.1|4858974_4860777_-|acyl-CoA-dehydrogenase
MKEEIFMEKTVGNAVKGGSFLVDEITIDQVFTPEDFSSEHKMIAKTTEDFIVNEVLPELEYLEQHEFDRSVRLLKEAGELGLLGADVPEEYGGIGLDKVSSALIAEKFSRAGGFAITHGAHVGIGSLPIVLFGNEEQKKKYLPLLATGEKLAAYALTEPGSGSDALGAKTTARLNAEGTHYVLNGEKQWITNSAFADVFIVYAKIDGEHFSAFIVEKEYAGVSTSPEEKKMGIKCSSTRTLILEDALVPKENLLGEIGKGHIIAFNILNIGRYKLGVGTVGSAKRAVEISAQYANQRQQFKQPIARFPLIQEKLANMAAKTYAAESSVYRTVGLFESRMSTLSEEEVKDGKAVAASIAEYAIECSLNKVFGSEVLDYTVDEGVQIHGGYGFMAEYEIERMYRDSRINRIFEGTNEINRLIVPGTFLRKAMKGELPLLQKAQKLQEELMMMMPEEVGDEPLALQKYLVTNAKKIGLMVAGLAAQKYGKALDKEQEILVNIADIVSNLYAMESAVLRTEKAIKTTGLEKNKQKVLYTEVFCQEAFNEIEADAKETLIAVENGDMLRMMLSSLRKLTRHTPLNVIPKKREIAAKILEDERYTV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP030982_1	1.1\|538744\|26\|CP030982\|CRISPRCasFinder	538744-538769	26	NZ_CP045855	Agrobacterium sp. MA01 plasmid punnamed1, complete sequence	103187-103212	5	0.808
CP030982_3	3.1\|5134692\|31\|CP030982\|CRISPRCasFinder	5134692-5134722	31	JX238501	Bacillus phage phiAGATE, complete genome	124559-124589	8	0.742
CP030982_3	3.2\|5134746\|34\|CP030982\|CRISPRCasFinder	5134746-5134779	34	NZ_CP014851	Bacillus thuringiensis strain HD12 plasmid pHD120112, complete sequence	100650-100683	8	0.765
CP030982_3	3.2\|5134746\|34\|CP030982\|CRISPRCasFinder	5134746-5134779	34	MN812210	Flavobacterium phage vB_FspS_hemulen9-1, complete genome	22854-22887	8	0.765
CP030982_3	3.2\|5134746\|34\|CP030982\|CRISPRCasFinder	5134746-5134779	34	MN812215	Flavobacterium phage vB_FspS_lillamy9-4, complete genome	22191-22224	8	0.765
CP030982_3	3.2\|5134746\|34\|CP030982\|CRISPRCasFinder	5134746-5134779	34	MN812216	Flavobacterium phage vB_FspS_lillamy9-5, complete genome	22191-22224	8	0.765
CP030982_3	3.2\|5134746\|34\|CP030982\|CRISPRCasFinder	5134746-5134779	34	NC_048835	Flavobacterium phage vB_FspS_lillamy9-1, complete genome	22191-22224	8	0.765
CP030982_3	3.2\|5134746\|34\|CP030982\|CRISPRCasFinder	5134746-5134779	34	MN812213	Flavobacterium phage vB_FspS_lillamy9-2, complete genome	22191-22224	8	0.765
CP030982_3	3.2\|5134746\|34\|CP030982\|CRISPRCasFinder	5134746-5134779	34	MN812230	Flavobacterium phage vB_FspS_sniff9-2, complete genome	21831-21864	8	0.765
CP030982_3	3.2\|5134746\|34\|CP030982\|CRISPRCasFinder	5134746-5134779	34	MN812209	Flavobacterium phage vB_FspS_hemulen6-2, complete genome	22983-23016	8	0.765
CP030982_3	3.2\|5134746\|34\|CP030982\|CRISPRCasFinder	5134746-5134779	34	MN812218	Flavobacterium phage vB_FspS_lillamy9-7, complete genome	21454-21487	8	0.765
CP030982_3	3.2\|5134746\|34\|CP030982\|CRISPRCasFinder	5134746-5134779	34	MN812233	Flavobacterium phage vB_FspS_snork9-1, complete genome	22007-22040	8	0.765
CP030982_3	3.2\|5134746\|34\|CP030982\|CRISPRCasFinder	5134746-5134779	34	MN812219	Flavobacterium phage vB_FspS_morran9-1, complete genome	22308-22341	8	0.765
CP030982_3	3.2\|5134746\|34\|CP030982\|CRISPRCasFinder	5134746-5134779	34	MN812217	Flavobacterium phage vB_FspS_lillamy9-6, complete genome	21930-21963	8	0.765
CP030982_3	3.2\|5134746\|34\|CP030982\|CRISPRCasFinder	5134746-5134779	34	NC_048840	Flavobacterium phage vB_FspS_snork6-1, complete genome	22137-22170	8	0.765
CP030982_3	3.2\|5134746\|34\|CP030982\|CRISPRCasFinder	5134746-5134779	34	NC_048839	Flavobacterium phage vB_FspS_sniff9-1, complete genome	22057-22090	8	0.765
CP030982_3	3.2\|5134746\|34\|CP030982\|CRISPRCasFinder	5134746-5134779	34	NC_048842	Flavobacterium phage vB_FspS_stinky9-1, complete genome	21673-21706	8	0.765
CP030982_3	3.2\|5134746\|34\|CP030982\|CRISPRCasFinder	5134746-5134779	34	MN812232	Flavobacterium phage vB_FspS_snork6-2, complete genome	21655-21688	8	0.765
CP030982_3	3.2\|5134746\|34\|CP030982\|CRISPRCasFinder	5134746-5134779	34	MN812208	Flavobacterium phage vB_FspS_hemulen6-1, complete genome	22983-23016	8	0.765
CP030982_3	3.2\|5134746\|34\|CP030982\|CRISPRCasFinder	5134746-5134779	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	47181-47214	11	0.676
CP030982_3	3.2\|5134746\|34\|CP030982\|CRISPRCasFinder	5134746-5134779	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	47565-47598	11	0.676
CP030982_3	3.2\|5134746\|34\|CP030982\|CRISPRCasFinder	5134746-5134779	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	47949-47982	11	0.676
CP030982_3	3.2\|5134746\|34\|CP030982\|CRISPRCasFinder	5134746-5134779	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	48333-48366	11	0.676
CP030982_3	3.2\|5134746\|34\|CP030982\|CRISPRCasFinder	5134746-5134779	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	48717-48750	11	0.676
CP030982_3	3.2\|5134746\|34\|CP030982\|CRISPRCasFinder	5134746-5134779	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	49101-49134	11	0.676
CP030982_3	3.2\|5134746\|34\|CP030982\|CRISPRCasFinder	5134746-5134779	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	49485-49518	11	0.676

1. spacer 1.1|538744|26|CP030982|CRISPRCasFinder matches to NZ_CP045855 (Agrobacterium sp. MA01 plasmid punnamed1, complete sequence) position: , mismatch: 5, identity: 0.808

tggtgggcacaatcataacggcggac	CRISPR spacer
atctgggcacaatcatagcggcggaa	Protospacer
   **************.*******

2. spacer 3.1|5134692|31|CP030982|CRISPRCasFinder matches to JX238501 (Bacillus phage phiAGATE, complete genome) position: , mismatch: 8, identity: 0.742

ttcttcttttttgtcactagttgaaccgctt	CRISPR spacer
ctaaccttttttgccactagttaaaccgccc	Protospacer
.*  .********.********.******..

3. spacer 3.2|5134746|34|CP030982|CRISPRCasFinder matches to NZ_CP014851 (Bacillus thuringiensis strain HD12 plasmid pHD120112, complete sequence) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
tttatcttcttttttattttctggtttattttcc	Protospacer
.**.****** ****************  * ..*

4. spacer 3.2|5134746|34|CP030982|CRISPRCasFinder matches to MN812210 (Flavobacterium phage vB_FspS_hemulen9-1, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

5. spacer 3.2|5134746|34|CP030982|CRISPRCasFinder matches to MN812215 (Flavobacterium phage vB_FspS_lillamy9-4, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

6. spacer 3.2|5134746|34|CP030982|CRISPRCasFinder matches to MN812216 (Flavobacterium phage vB_FspS_lillamy9-5, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

7. spacer 3.2|5134746|34|CP030982|CRISPRCasFinder matches to NC_048835 (Flavobacterium phage vB_FspS_lillamy9-1, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

8. spacer 3.2|5134746|34|CP030982|CRISPRCasFinder matches to MN812213 (Flavobacterium phage vB_FspS_lillamy9-2, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

9. spacer 3.2|5134746|34|CP030982|CRISPRCasFinder matches to MN812230 (Flavobacterium phage vB_FspS_sniff9-2, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

10. spacer 3.2|5134746|34|CP030982|CRISPRCasFinder matches to MN812209 (Flavobacterium phage vB_FspS_hemulen6-2, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

11. spacer 3.2|5134746|34|CP030982|CRISPRCasFinder matches to MN812218 (Flavobacterium phage vB_FspS_lillamy9-7, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

12. spacer 3.2|5134746|34|CP030982|CRISPRCasFinder matches to MN812233 (Flavobacterium phage vB_FspS_snork9-1, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

13. spacer 3.2|5134746|34|CP030982|CRISPRCasFinder matches to MN812219 (Flavobacterium phage vB_FspS_morran9-1, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

14. spacer 3.2|5134746|34|CP030982|CRISPRCasFinder matches to MN812217 (Flavobacterium phage vB_FspS_lillamy9-6, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

15. spacer 3.2|5134746|34|CP030982|CRISPRCasFinder matches to NC_048840 (Flavobacterium phage vB_FspS_snork6-1, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

16. spacer 3.2|5134746|34|CP030982|CRISPRCasFinder matches to NC_048839 (Flavobacterium phage vB_FspS_sniff9-1, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

17. spacer 3.2|5134746|34|CP030982|CRISPRCasFinder matches to NC_048842 (Flavobacterium phage vB_FspS_stinky9-1, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

18. spacer 3.2|5134746|34|CP030982|CRISPRCasFinder matches to MN812232 (Flavobacterium phage vB_FspS_snork6-2, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

19. spacer 3.2|5134746|34|CP030982|CRISPRCasFinder matches to MN812208 (Flavobacterium phage vB_FspS_hemulen6-1, complete genome) position: , mismatch: 8, identity: 0.765

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ********************* **   *.

20. spacer 3.2|5134746|34|CP030982|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

21. spacer 3.2|5134746|34|CP030982|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

22. spacer 3.2|5134746|34|CP030982|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

23. spacer 3.2|5134746|34|CP030982|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

24. spacer 3.2|5134746|34|CP030982|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

25. spacer 3.2|5134746|34|CP030982|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

26. spacer 3.2|5134746|34|CP030982|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttattttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

216880 : 225256

Synechococcus_phage(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV64376.1\|216880_218188_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.9e-21	25.3
AZV64377.1\|218276_218996_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	4.0e-49	44.3
AZV64378.1\|218988_219243_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
AZV64379.1\|219239_219923_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
AZV64380.1\|219906_222126_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.3e-163	41.2
AZV64381.1\|222110_223526_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	3.3e-55	35.4
AZV64382.1\|223631_224672_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	5.5e-68	46.3
AZV64383.1\|224668_225256_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	7.0e-28	37.4

DBSCAN-SWA_2

561983 : 570142

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV64671.1\|561983_562970_-	YafY family transcriptional regulator	A0A1B0RXM1	Streptococcus_phage	5.5e-17	29.4
AZV64672.1\|563045_563567_+	dihydrofolate reductase	NA	NA	NA	NA
AZV64673.1\|563732_565124_-	sensor histidine kinase	W8CYF6	Bacillus_phage	2.6e-33	29.8
AZV64674.1\|565135_565813_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	2.9e-33	35.6
AZV64675.1\|565988_567236_+	cell wall-binding repeat-containing protein	NA	NA	NA	NA
AZV64676.1\|567369_567900_+	DUF4352 domain-containing protein	A0A0S2MVG4	Bacillus_phage	2.5e-16	34.3
AZV64677.1\|567912_568257_+	DUF4064 domain-containing protein	A0A0S2MVJ2	Bacillus_phage	8.5e-42	78.1
AZV64678.1\|568690_570142_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	3.7e-139	54.0

DBSCAN-SWA_3

1153755 : 1192161

Acinetobacter_phage(33.33%)

bacteriocin,transposase,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV65219.1\|1153755_1154493_+\|coat	spore coat protein	I7I009	Enterobacteria_phage	1.0e-52	45.5
AZV65220.1\|1154501_1155047_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A218MN57	uncultured_virus	5.1e-33	46.6
AZV65221.1\|1155062_1156034_+	dTDP-glucose 4,6-dehydratase	M1HHF3	Acanthocystis_turfacea_Chlorella_virus	1.2e-64	41.3
AZV65222.1\|1156046_1156901_+	dTDP-4-dehydrorhamnose reductase	NA	NA	NA	NA
AZV65223.1\|1157009_1157780_+	enoyl-[acyl-carrier-protein] reductase FabI	NA	NA	NA	NA
AZV65224.1\|1157921_1158479_+	hypothetical protein	NA	NA	NA	NA
AZV65225.1\|1158539_1158998_-\|coat	spore coat protein Y	NA	NA	NA	NA
AZV65226.1\|1159123_1159483_+	DUF1360 domain-containing protein	NA	NA	NA	NA
AZV65227.1\|1159584_1159770_+	cytochrome C oxidase subunit III	NA	NA	NA	NA
AZV65228.1\|1159847_1160351_-	hypothetical protein	NA	NA	NA	NA
AZV65229.1\|1160518_1160989_-\|coat	spore coat protein	NA	NA	NA	NA
AZV65230.1\|1161131_1163198_-	ATP-dependent helicase	A0A068EQC7	Bacillus_phage	2.9e-76	31.3
AZV65231.1\|1163298_1163721_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AZV65232.1\|1163722_1164241_-	hypothetical protein	NA	NA	NA	NA
AZV65233.1\|1164334_1165066_-	esterase family protein	NA	NA	NA	NA
AZV65234.1\|1165270_1166182_+	DMT family transporter	NA	NA	NA	NA
AZV65235.1\|1166258_1166654_+	hypothetical protein	NA	NA	NA	NA
AZV65236.1\|1166678_1167077_-	hypothetical protein	NA	NA	NA	NA
AZV65237.1\|1167240_1168719_-	sodium/proline symporter PutP	NA	NA	NA	NA
AZV65238.1\|1169160_1169349_+	hypothetical protein	NA	NA	NA	NA
AZV65239.1\|1169752_1171171_+	anthranilate synthase component I	NA	NA	NA	NA
AZV65240.1\|1171167_1171755_+	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	4.2e-49	48.9
AZV65241.1\|1171751_1172777_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	1.0e-50	34.5
AZV65242.1\|1172778_1173540_+	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	2.4e-36	41.0
AZV65243.1\|1173536_1174151_+	phosphoribosylanthranilate isomerase	NA	NA	NA	NA
AZV65244.1\|1174147_1175341_+	tryptophan synthase subunit beta	NA	NA	NA	NA
AZV65245.1\|1175344_1176121_+	tryptophan synthase subunit alpha	NA	NA	NA	NA
AZV65246.1\|1176194_1176557_+	DUF4029 domain-containing protein	NA	NA	NA	NA
AZV65247.1\|1176667_1178167_+	L-lactate permease	NA	NA	NA	NA
AZV65248.1\|1178430_1179546_-\|transposase	transposase	A0A0P0IJS6	Lactobacillus_phage	6.7e-80	43.2
AZV65249.1\|1179794_1180478_+	DUF2278 family protein	NA	NA	NA	NA
AZV65250.1\|1180492_1181326_-	hypothetical protein	NA	NA	NA	NA
AZV65251.1\|1182317_1183553_+	YARHG domain-containing protein	NA	NA	NA	NA
AZV65252.1\|1183596_1184028_-	hypothetical protein	NA	NA	NA	NA
AZV65253.1\|1184226_1185561_+	CoA-disulfide reductase	A0A2K5B2C5	Erysipelothrix_phage	7.4e-17	27.0
AZV65254.1\|1185662_1186151_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AZV65255.1\|1186297_1186708_+	DUF3908 domain-containing protein	NA	NA	NA	NA
AZV65256.1\|1186738_1188280_-	SagB/ThcOx family dehydrogenase	NA	NA	NA	NA
AZV65257.1\|1188295_1190245_-\|bacteriocin	bacteriocin biosynthesis protein SagD	NA	NA	NA	NA
AZV65258.1\|1190241_1192161_-\|bacteriocin	putative thiazole-containing bacteriocin maturation protein	NA	NA	NA	NA

DBSCAN-SWA_4

1623341 : 1640161

Brevibacillus_phage(100.0%)

tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV65699.1\|1623341_1623794_+	hypothetical protein	A0A0K2CP30	Brevibacillus_phage	8.9e-23	43.0
AZV65700.1\|1623793_1624882_+	hypothetical protein	A0A0K2CNX7	Brevibacillus_phage	2.7e-94	55.6
AZV65701.1\|1625114_1625585_+	DNA polymerase III subunit gamma/tau	A0A0K2CPC8	Brevibacillus_phage	8.1e-35	52.9
AZV65702.1\|1625671_1625914_+	hypothetical protein	A0A0K2CP74	Brevibacillus_phage	2.7e-18	55.0
AZV65703.1\|1625986_1631338_+\|tail	phage tail tape measure protein	A0A0K2CPN3	Brevibacillus_phage	7.1e-143	26.1
AZV65704.1\|1631396_1632014_+	S-layer homology domain-containing protein	A0A0K2CPJ2	Brevibacillus_phage	1.1e-71	61.2
AZV65705.1\|1632016_1633090_+	hypothetical protein	A0A0K2CP35	Brevibacillus_phage	9.1e-74	40.3
AZV65706.1\|1633103_1636310_+	M23 family peptidase	A0A0K2CNY2	Brevibacillus_phage	3.7e-06	50.0
AZV65707.1\|1636388_1637105_+	hypothetical protein	NA	NA	NA	NA
AZV65708.1\|1637119_1637560_+	hypothetical protein	NA	NA	NA	NA
AZV65709.1\|1637575_1640161_+	hypothetical protein	A0A0K2CPJ7	Brevibacillus_phage	1.6e-31	44.2

DBSCAN-SWA_5

1653107 : 1667666

Brevibacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV65716.1\|1653107_1654229_+	hypothetical protein	A0A0K2CPP1	Brevibacillus_phage	7.3e-66	37.3
AZV65717.1\|1654240_1654972_+	hypothetical protein	NA	NA	NA	NA
AZV65718.1\|1655050_1655494_+	hypothetical protein	A0A0K2CPK2	Brevibacillus_phage	2.3e-23	40.6
AZV65719.1\|1655569_1656061_+	hypothetical protein	A0A0K2CNZ3	Brevibacillus_phage	6.9e-37	54.5
AZV65720.1\|1656101_1656713_+	hypothetical protein	A0A127AW14	Bacillus_phage	2.2e-48	51.6
AZV65721.1\|1656697_1659586_+	halomucin	A0A0K2CPK6	Brevibacillus_phage	5.7e-14	31.0
AZV65722.1\|1659628_1663984_+	hypothetical protein	A0A0K2CP88	Brevibacillus_phage	1.6e-31	23.7
AZV65723.1\|1664553_1664922_+	hypothetical protein	NA	NA	NA	NA
AZV65724.1\|1664921_1665299_+	hypothetical protein	NA	NA	NA	NA
AZV65725.1\|1665498_1666506_+	LysM peptidoglycan-binding domain-containing protein	A0A127AWA8	Bacillus_phage	7.8e-11	46.9
AZV65726.1\|1666522_1666822_+	hypothetical protein	A0A0K2CPL0	Brevibacillus_phage	8.5e-22	59.3
AZV65727.1\|1666841_1667666_+	hypothetical protein	A7KV11	Bacillus_phage	1.4e-79	71.1

DBSCAN-SWA_6

1675785 : 1685171

Brevibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV65738.1\|1675785_1676493_-	DNA polymerase I	A0A0K2CNW2	Brevibacillus_phage	1.1e-64	53.9
AZV65739.1\|1676661_1677066_-	DNA polymerase I	NA	NA	NA	NA
AZV65740.1\|1677689_1679084_-	DNA polymerase I	A0A0K2CP19	Brevibacillus_phage	1.2e-102	46.1
AZV65741.1\|1679170_1679830_-	hypothetical protein	A0A0K2CPH8	Brevibacillus_phage	4.7e-57	56.9
AZV65742.1\|1680292_1680850_-	sigma-70 family RNA polymerase sigma factor	A0A0K2CPD2	Brevibacillus_phage	2.4e-25	41.1
AZV65743.1\|1680877_1681954_-	toprim domain-containing protein	A0A0K2CNW6	Brevibacillus_phage	1.3e-104	54.0
AZV65744.1\|1681978_1683271_-	DNA helicase	A0A0K2CP24	Brevibacillus_phage	1.1e-139	57.9
AZV65745.1\|1683750_1684521_-	ATP-binding protein	A0A0K2CNX1	Brevibacillus_phage	3.3e-62	48.4
AZV65746.1\|1684580_1685171_-	helix-turn-helix domain-containing protein	A0A0K2CNS5	Brevibacillus_phage	1.0e-26	43.7

DBSCAN-SWA_7

1847713 : 1856561

Bacillus_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV65891.1\|1847713_1849000_+	peptidoglycan endopeptidase	A0A1V0DZX6	Clostridioides_phage	3.8e-10	30.6
AZV65892.1\|1849099_1849864_-	alpha/beta hydrolase	NA	NA	NA	NA
AZV65893.1\|1850100_1851861_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.5e-275	99.2
AZV69371.1\|1851901_1852579_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	3.0e-123	99.6
AZV65894.1\|1852575_1853649_+	sensor histidine kinase	W8CYF6	Bacillus_phage	1.4e-191	99.4
AZV65895.1\|1853876_1854596_+	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
AZV65896.1\|1854698_1855163_+	O-methyltransferase	W8CYT3	Bacillus_phage	7.4e-73	99.3
AZV65897.1\|1855307_1855562_+	O-methyltransferase family 3	W8CYN0	Bacillus_phage	4.5e-40	100.0
AZV65898.1\|1855691_1856561_+	aminoglycoside 6-adenylyltransferase	E4ZFP8	Streptococcus_phage	5.6e-66	44.6

DBSCAN-SWA_8

2040387 : 2047301

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV66081.1\|2040387_2040663_+	stage V sporulation protein S	J9PTX7	Bacillus_phage	2.9e-08	41.2
AZV69383.1\|2040861_2041125_+	hypothetical protein	A0A218KBU4	Bacillus_phage	4.4e-06	38.9
AZV69382.1\|2041374_2041512_+	McrA protein	NA	NA	NA	NA
AZV66082.1\|2041771_2042119_-	YolD-like family protein	A0A2H4JEH6	uncultured_Caudovirales_phage	6.6e-10	27.5
AZV66083.1\|2042309_2043383_+	tetratricopeptide repeat protein	A0A2H4J8G3	uncultured_Caudovirales_phage	6.9e-74	42.3
AZV66084.1\|2043379_2043505_+	aspartate phosphatase	NA	NA	NA	NA
AZV66085.1\|2043824_2044652_-	hypothetical protein	NA	NA	NA	NA
AZV66086.1\|2044761_2045409_+	HD domain-containing protein	S4W232	Pandoravirus	2.5e-10	28.3
AZV66087.1\|2045405_2047301_+	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	6.8e-56	29.3

DBSCAN-SWA_9

2452262 : 2514828

Bacillus_phage(67.5%)

integrase,protease,capsid,bacteriocin,head,tail,holin,tRNA,terminase,portal

attL 2478528:2478543|attR 2497754:2497769

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV66443.1\|2452262_2453816_+\|tRNA	lysine--tRNA ligase	NA	NA	NA	NA
AZV66444.1\|2453875_2454304_-	cell wall hydrolase	NA	NA	NA	NA
AZV66445.1\|2454454_2455369_+	acetamidase	NA	NA	NA	NA
AZV66446.1\|2455496_2456204_+	DNA-binding response regulator	NA	NA	NA	NA
AZV66447.1\|2456200_2457184_+	sensor histidine kinase	NA	NA	NA	NA
AZV66448.1\|2457385_2458282_+	LysR family transcriptional regulator	A0A2H4J8I9	uncultured_Caudovirales_phage	2.0e-05	33.7
AZV66449.1\|2458341_2459331_-	aldo/keto reductase	NA	NA	NA	NA
AZV69395.1\|2459849_2461478_+	ABC transporter ATP-binding protein	A0A1B0RXA0	Streptococcus_phage	4.6e-53	34.8
AZV66450.1\|2461498_2462083_+	N-acetyltransferase	NA	NA	NA	NA
AZV66451.1\|2462340_2463111_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.5e-33	40.4
AZV66452.1\|2463085_2465017_+	ABC transporter permease	NA	NA	NA	NA
AZV66453.1\|2465067_2465754_+	hypothetical protein	NA	NA	NA	NA
AZV66454.1\|2465831_2466173_-	DUF3914 domain-containing protein	NA	NA	NA	NA
AZV66455.1\|2466449_2467691_+	lipase	NA	NA	NA	NA
AZV66456.1\|2467778_2468804_+	homoserine dehydrogenase	NA	NA	NA	NA
AZV66457.1\|2468893_2470342_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
AZV69396.1\|2470346_2471261_+	D-alanine--D-alanine ligase	NA	NA	NA	NA
AZV66458.1\|2471567_2472257_+	thiaminase II	NA	NA	NA	NA
AZV66459.1\|2472654_2472918_+	DUF3937 domain-containing protein	NA	NA	NA	NA
AZV66460.1\|2473371_2473701_+\|bacteriocin	heterocycloanthracin/sonorensin family bacteriocin	NA	NA	NA	NA
AZV66461.1\|2474194_2474680_+	homoserine dehydrogenase	NA	NA	NA	NA
AZV66462.1\|2474986_2475688_+	DUF3962 domain-containing protein	NA	NA	NA	NA
AZV66463.1\|2475726_2476836_-\|integrase	site-specific integrase	A0A0U3U8Y8	Bacillus_phage	5.7e-148	79.7
AZV66464.1\|2477938_2479132_+	XRE family transcriptional regulator	A0A0S2MVK2	Bacillus_phage	2.3e-126	59.2
2478528:2478543	attL	NA	NA	NA	NA
AZV66465.1\|2479651_2480011_-	XRE family transcriptional regulator	A0A0A7AR52	Bacillus_phage	7.8e-22	43.9
AZV66466.1\|2480181_2480385_+	XRE family transcriptional regulator	A0A0A7AQV9	Bacillus_phage	4.4e-14	59.7
AZV66467.1\|2480590_2480857_+	DNA-binding protein	A0A0U3ULL9	Bacillus_phage	2.7e-35	89.4
AZV66468.1\|2481231_2481978_+	DnaD domain protein	A0A1B1P7T6	Bacillus_phage	6.9e-105	94.0
AZV66469.1\|2481946_2482750_+	AAA family ATPase	A0A1B1P7U2	Bacillus_phage	2.5e-145	98.9
AZV66470.1\|2482765_2482960_+	hypothetical protein	A0A0U3K3J8	Bacillus_phage	2.2e-26	85.9
AZV66471.1\|2482985_2483159_+	DUF3954 domain-containing protein	A0A1B1P7U5	Bacillus_phage	1.2e-25	100.0
AZV66472.1\|2483173_2483428_+	hypothetical protein	A0A0U3SU43	Bacillus_phage	1.4e-36	88.1
AZV66473.1\|2483439_2483865_+	hypothetical protein	A0A1B1P8B9	Bacillus_phage	2.1e-13	41.9
AZV66474.1\|2483880_2484336_+	nucleotide pyrophosphohydrolase	A0A0U4IBD0	Bacillus_phage	9.3e-20	46.8
AZV66475.1\|2484374_2484764_+	hypothetical protein	NA	NA	NA	NA
AZV66476.1\|2485218_2486085_-	exosporium protein D	NA	NA	NA	NA
AZV66477.1\|2486380_2487154_-	exosporium leader peptide	NA	NA	NA	NA
AZV66478.1\|2487679_2488996_-	collagen-like protein	A0A285PWR0	Cedratvirus	4.4e-38	62.6
AZV66479.1\|2490747_2491404_+	hypothetical protein	NA	NA	NA	NA
AZV66480.1\|2491760_2492243_+	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	2.5e-71	83.1
AZV66481.1\|2492242_2492785_+\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	1.5e-85	88.3
AZV66482.1\|2493059_2493518_+	hypothetical protein	NA	NA	NA	NA
AZV66483.1\|2494255_2494762_+	hypothetical protein	NA	NA	NA	NA
AZV69397.1\|2494949_2495222_+	hypothetical protein	Q2I8B8	Bacillus_phage	4.8e-32	81.0
AZV66484.1\|2495218_2495554_+	HNH endonuclease	D2XR61	Bacillus_phage	1.7e-55	94.6
AZV66485.1\|2495707_2496064_+	hypothetical protein	A0A2H4JBV9	uncultured_Caudovirales_phage	3.0e-58	98.3
AZV66486.1\|2496060_2497716_+\|terminase	terminase large subunit	A0A2H4JI41	uncultured_Caudovirales_phage	1.3e-310	95.1
AZV66487.1\|2497721_2498885_+\|portal	phage portal protein	D2XR16	Bacillus_phage	1.2e-183	89.0
2497754:2497769	attR	NA	NA	NA	NA
AZV66488.1\|2498868_2499657_+\|protease	Clp protease ClpP	A0A0A7RWX3	Clostridium_phage	3.0e-58	57.9
AZV66489.1\|2499660_2500815_+\|capsid	phage major capsid protein	A0A2H4JHU0	uncultured_Caudovirales_phage	2.3e-200	91.1
AZV66490.1\|2500820_2501114_+	hypothetical protein	D2XR19	Bacillus_phage	1.8e-45	94.8
AZV66491.1\|2501115_2501469_+\|head,tail	head-tail adaptor protein	A0A2H4JGG7	uncultured_Caudovirales_phage	1.1e-57	95.7
AZV66492.1\|2501470_2501812_+	HK97 gp10 family phage protein	D2XR21	Bacillus_phage	9.0e-52	92.9
AZV66493.1\|2501811_2502141_+	hypothetical protein	D2XR22	Bacillus_phage	3.1e-49	89.0
AZV66494.1\|2502141_2502729_+\|tail	phage tail protein	A0A2H4JDV4	uncultured_Caudovirales_phage	3.3e-86	81.0
AZV66495.1\|2502733_2503096_+	hypothetical protein	A0A2H4JAG8	uncultured_Caudovirales_phage	3.4e-57	90.8
AZV66496.1\|2503326_2504538_+	hypothetical protein	A0A2H4JAI2	uncultured_Caudovirales_phage	2.8e-188	86.4
AZV66497.1\|2504791_2505049_+	hypothetical protein	A0A1B1P763	Bacillus_phage	1.7e-34	85.9
AZV66498.1\|2505266_2507432_+\|tail	phage tail tape measure protein	A0A2H4JC82	uncultured_Caudovirales_phage	3.3e-91	81.4
AZV66499.1\|2507473_2508943_+\|tail	phage tail family protein	A0A0S2MV63	Bacillus_phage	3.8e-232	79.6
AZV66500.1\|2508939_2512779_+	hypothetical protein	A0A0S2MVB4	Bacillus_phage	0.0e+00	53.0
AZV66501.1\|2512794_2513169_+	hypothetical protein	A0A0S2MVE0	Bacillus_phage	1.2e-62	93.5
AZV66502.1\|2513296_2513521_+	hypothetical protein	A0A1B1P780	Bacillus_phage	3.2e-26	87.8
AZV66503.1\|2513596_2514022_+\|holin	holin	A0A1B1P787	Bacillus_phage	7.7e-69	94.3
AZV66504.1\|2514021_2514828_+	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	4.0e-151	89.9

DBSCAN-SWA_10

3707445 : 3712961

Bacillus_phage(71.43%)

bacteriocin,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV67618.1\|3707445_3708255_-	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	5.9e-134	82.9
AZV69433.1\|3708254_3708491_-\|bacteriocin	bacteriocin biosynthesis protein	A0A2H4JGN9	uncultured_Caudovirales_phage	1.7e-25	100.0
AZV67619.1\|3708520_3708904_-	hypothetical protein	A0A0S2MVE0	Bacillus_phage	1.7e-43	69.0
AZV67620.1\|3709328_3709640_-\|terminase	terminase	D2XR14	Bacillus_phage	7.9e-47	98.1
AZV67621.1\|3709758_3710094_-	HNH endonuclease	D2XR61	Bacillus_phage	1.8e-52	90.1
AZV67622.1\|3710080_3710359_-	hypothetical protein	A0A1B1P7X2	Bacillus_phage	1.2e-17	65.7
AZV67623.1\|3710360_3710606_-	hypothetical protein	NA	NA	NA	NA
AZV67624.1\|3710683_3710944_-	hypothetical protein	NA	NA	NA	NA
AZV67625.1\|3711202_3712063_-	hypothetical protein	NA	NA	NA	NA
AZV67626.1\|3712760_3712961_+	cold-shock protein	Q9AZD3	Lactococcus_phage	2.8e-21	74.2

DBSCAN-SWA_11

3717834 : 3727302

Bacillus_phage(88.89%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV67629.1\|3717834_3718026_-	DUF3954 domain-containing protein	A0A0S2GLF5	Bacillus_phage	4.2e-06	54.8
AZV67630.1\|3718435_3718624_-	hypothetical protein	D2XR45	Bacillus_phage	1.1e-14	86.8
AZV67631.1\|3718626_3719949_-	replicative DNA helicase	D2XR44	Bacillus_phage	1.5e-235	94.5
AZV67632.1\|3719945_3720884_-	DnaD domain protein	D2XR43	Bacillus_phage	4.1e-70	56.6
AZV67633.1\|3721163_3721448_-	hypothetical protein	D2XR42	Bacillus_phage	7.3e-23	54.3
AZV67634.1\|3721635_3721857_-	RNA polymerase subunit sigma	NA	NA	NA	NA
AZV67635.1\|3721870_3722458_-	sporulation sigma factor-processing peptidase	D2XR41	Bacillus_phage	1.0e-71	67.7
AZV67636.1\|3722548_3722797_-	hypothetical protein	NA	NA	NA	NA
AZV67637.1\|3723193_3723628_+	XRE family transcriptional regulator	D2XR39	Bacillus_phage	7.2e-30	53.9
AZV67638.1\|3723640_3724075_+	ImmA/IrrE family metallo-endopeptidase	D2XR38	Bacillus_phage	3.3e-59	77.5
AZV67639.1\|3724115_3724652_+	hypothetical protein	NA	NA	NA	NA
AZV67640.1\|3724752_3725634_+	hypothetical protein	NA	NA	NA	NA
AZV67641.1\|3725754_3727302_+	recombinase family protein	I3VYZ3	Thermoanaerobacterium_phage	3.3e-141	53.3

DBSCAN-SWA_12

4418859 : 4426547

Staphylococcus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV68350.1\|4418859_4419783_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.6e-45	43.5
AZV68351.1\|4419908_4420844_-	sensor histidine kinase	W8CYF6	Bacillus_phage	4.4e-24	26.6
AZV68352.1\|4420845_4421538_-	DNA-binding response regulator	B5LWA6	Feldmannia_species_virus	6.8e-06	26.9
AZV68353.1\|4421882_4422077_+	YwbE family protein	NA	NA	NA	NA
AZV68354.1\|4422116_4423316_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	6.1e-71	41.0
AZV68355.1\|4423610_4423934_+	heme-degrading monooxygenase	NA	NA	NA	NA
AZV68356.1\|4424006_4424771_-	SrtB family sortase	NA	NA	NA	NA
AZV68357.1\|4424803_4425574_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.7e-13	28.6
AZV68358.1\|4425563_4426547_-	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	1.9e-17	27.2

DBSCAN-SWA_13

5303254 : 5364677

Bacillus_phage(15.79%)

holin,bacteriocin,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV69196.1\|5303254_5303947_-\|holin	antiholin-like protein LrgB	NA	NA	NA	NA
AZV69197.1\|5303982_5304414_-\|holin	antiholin-like protein LrgA	NA	NA	NA	NA
AZV69198.1\|5304546_5305287_-	DNA-binding response regulator	NA	NA	NA	NA
AZV69199.1\|5305264_5307034_-	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	8.8e-66	30.6
AZV69200.1\|5307358_5308657_+	MFS transporter	NA	NA	NA	NA
AZV69201.1\|5308709_5310278_-	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	1.6e-15	23.9
AZV69202.1\|5310637_5311708_-	nitric oxide synthase	NA	NA	NA	NA
AZV69203.1\|5311924_5312551_+	Superoxide dismutase [Mn] 2	Q56AR7	Bacillus_thuringiensis_phage	2.6e-57	53.2
AZV69204.1\|5312639_5313527_-	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
AZV69205.1\|5313629_5314220_-	acetamide transporter	NA	NA	NA	NA
AZV69206.1\|5314310_5314493_-	hypothetical protein	NA	NA	NA	NA
AZV69207.1\|5314591_5314993_+	hypothetical protein	NA	NA	NA	NA
AZV69208.1\|5315561_5316578_-	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	2.3e-95	51.0
AZV69209.1\|5316763_5317411_-	hemolysin III family protein	NA	NA	NA	NA
AZV69210.1\|5317575_5318136_+	DUF1836 domain-containing protein	NA	NA	NA	NA
AZV69211.1\|5318176_5319622_-	DEAD/DEAH box helicase	A0A1V0SBR7	Catovirus	3.4e-60	34.4
AZV69212.1\|5320100_5321084_+	GMP reductase	G3MBI2	Bacillus_virus	5.8e-160	84.4
AZV69213.1\|5321220_5323038_+	oligoendopeptidase F	A0A1X9I5X5	Streptococcus_phage	1.3e-120	38.7
AZV69214.1\|5323075_5323954_-	radical SAM protein	NA	NA	NA	NA
AZV69486.1\|5324113_5325550_-	glycosyl hydrolase	NA	NA	NA	NA
AZV69215.1\|5328106_5328379_-	hypothetical protein	NA	NA	NA	NA
AZV69216.1\|5328400_5329081_-	autotransporter	NA	NA	NA	NA
AZV69217.1\|5329122_5330436_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
AZV69218.1\|5330428_5332648_-	peptidase domain-containing ABC transporter	W8CYL7	Bacillus_phage	2.2e-50	30.4
AZV69219.1\|5332847_5333057_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
AZV69220.1\|5333523_5333733_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
AZV69221.1\|5333930_5334557_-	ABC-2 transporter permease	NA	NA	NA	NA
AZV69222.1\|5334558_5335419_-	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	5.9e-07	24.8
AZV69223.1\|5335421_5335796_-	GntR family transcriptional regulator	NA	NA	NA	NA
AZV69224.1\|5336178_5336394_-	hypothetical protein	NA	NA	NA	NA
AZV69225.1\|5336601_5338170_-	recombinase family protein	A0A2P1JU08	Anoxybacillus_phage	1.6e-50	29.7
AZV69226.1\|5338357_5339134_-	recombinase family protein	A6M972	Geobacillus_virus	1.5e-17	30.1
AZV69227.1\|5339371_5340127_-	RNA replicase	NA	NA	NA	NA
AZV69228.1\|5340298_5340733_-	hypothetical protein	NA	NA	NA	NA
AZV69487.1\|5341012_5341225_+	XRE family transcriptional regulator	NA	NA	NA	NA
AZV69229.1\|5341407_5342697_+	hypothetical protein	NA	NA	NA	NA
AZV69230.1\|5342708_5344115_+	hypothetical protein	NA	NA	NA	NA
AZV69231.1\|5344299_5345220_-	hypothetical protein	NA	NA	NA	NA
AZV69488.1\|5345523_5346027_-	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
AZV69489.1\|5346062_5346248_-	CxxH/CxxC protein	NA	NA	NA	NA
AZV69232.1\|5346301_5347477_-\|protease	serine protease	W5SAB9	Pithovirus	7.7e-10	31.9
AZV69233.1\|5347540_5348335_-	MBL fold metallo-hydrolase	A0A0C5AJ83	Bacteriophage	6.1e-43	35.3
AZV69234.1\|5348318_5349161_-	hypothetical protein	NA	NA	NA	NA
AZV69235.1\|5349141_5350458_-	hypothetical protein	NA	NA	NA	NA
AZV69236.1\|5350454_5352296_-	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	2.6e-36	34.6
AZV69237.1\|5352299_5353007_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	4.5e-45	43.1
AZV69238.1\|5353801_5355091_-	adenylosuccinate synthase	L7Y4J5	Megavirus	9.5e-70	36.2
AZV69239.1\|5355306_5356656_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	2.5e-121	52.3
AZV69240.1\|5356683_5357130_-	50S ribosomal protein L9	NA	NA	NA	NA
AZV69241.1\|5357126_5359100_-	DHH family phosphoesterase	NA	NA	NA	NA
AZV69242.1\|5359178_5360114_-	DUF2232 domain-containing protein	NA	NA	NA	NA
AZV69243.1\|5360193_5360427_-	30S ribosomal protein S18	NA	NA	NA	NA
AZV69244.1\|5360472_5360994_-	single-stranded DNA-binding protein	A8ATZ7	Listeria_phage	4.0e-51	63.0
AZV69245.1\|5361020_5361311_-	30S ribosomal protein S6	NA	NA	NA	NA
AZV69246.1\|5361502_5362603_-	redox-regulated ATPase YchF	NA	NA	NA	NA
AZV69247.1\|5362718_5362916_-	DUF951 domain-containing protein	NA	NA	NA	NA
AZV69248.1\|5362939_5363821_-	mechanosensitive ion channel family protein	NA	NA	NA	NA
AZV69249.1\|5364080_5364677_+\|protease	spore protease YyaC	A0A0A8WIQ6	Clostridium_phage	1.6e-24	39.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage