CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
AP018797	Escherichia coli E2855 plasmid pE2855-1 DNA, complete genome	0 crisprs	NA	0	0	1	0
AP018798	Escherichia coli E2855 plasmid pE2855-2 DNA, complete genome	1 crisprs	NA	1	0	1	0
AP018801	Escherichia coli E2855 plasmid pE2855-5 DNA, complete genome	0 crisprs	DinG	0	0	1	0
AP018799	Escherichia coli E2855 plasmid pE2855-3 DNA, complete genome	0 crisprs	NA	0	0	1	0
AP018800	Escherichia coli E2855 plasmid pE2855-4 DNA, complete genome	0 crisprs	NA	0	0	2	1
AP018796	Escherichia coli E2855 DNA, complete genome	2 crisprs	DinG,PrimPol,cas3,c2c9_V-U4,DEDDh,csa3,cas2,cas1,cas6e,cas5,cas7,cse2gr11,cas8e,PD-DExK,cas14i	0	4	29	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: AP018798_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

AP018798_1

54017-54124

Orphan

Consensus_repeat	Method
ACAGTCAACATAAAATCGCGTACAGTCAATGTT	PILER-CR

2 spacers

The CRISPR arrays of AP018798_1

>merge|AP018798|1|54017-54124|PILER-CR
TAAAATCGCGTACAGTCAATGTTTCTGTCGCATATAGTCAACAATAAATCGCGTGCAGTCAACAATAAATCGTGCACAGTCAACATAAAATCGCGTATAGTCAATGTT

>AP018798|1|1|54017-54124|PILER-CR
TAAAATCGCGTACAGTCAATGTTTCTGTCGCAT	ATAGTCAACA
ATAAATCGCGTGCAGTCAACAATAAATCGTGCA	CAGTCAACATAAA
ATCGCGTATAGTCAATGTT

Protein	Signature genes	Signature genes Name	Protein_function
AP018798.1\|BBF51191.1\|58664_59570_+\|recombination-associated-protein-rdgC	unknown	unknown	gnl\|CDD\|234726
AP018798.1\|BBF51179.1\|49571_50573_-\|plasmid-partition-protein-B	unknown	unknown	gnl\|CDD\|370113
AP018798.1\|BBF51183.1\|53056_53941_-\|replication-protein-RepFIB	unknown	unknown	unknown
AP018798.1\|BBF51189.1\|57244_57925_-\|hypothetical-protein	unknown	unknown	unknown
AP018798.1\|BBF51187.1\|56029_56845_-\|IS91-transposase	unknown	unknown	gnl\|CDD\|379554
AP018798.1\|BBF51175.1\|44842_45013_-\|hypothetical-protein	unknown	unknown	unknown
AP018798.1\|BBF51181.1\|51954_52326_-\|hypothetical-protein	unknown	unknown	unknown
AP018798.1\|BBF51176.1\|45165_45981_-\|hypothetical-protein	unknown	unknown	unknown
AP018798.1\|BBF51184.1\|54274_54667_-\|hypothetical-protein	unknown	unknown	unknown
AP018798.1\|BBF51174.1\|44549_44900_-\|hypothetical-protein	unknown	unknown	unknown
AP018798.1\|BBF51186.1\|55656_56064_-\|IS91-transposase	unknown	unknown	gnl\|CDD\|377437
AP018798.1\|BBF51180.1\|50589_51786_-\|plasmid-partition-protein-A	unknown	unknown	gnl\|CDD\|376033
AP018798.1\|BBF51177.1\|45990_47580_-\|hypothetical-protein	unknown	unknown	unknown
AP018798.1\|BBF51188.1\|56844_57210_-\|IS91-transposase	unknown	unknown	unknown
AP018798.1\|BBF51182.1\|52428_52764_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378444
AP018798.1\|BBF51185.1\|54844_55267_-\|hypothetical-protein	unknown	unknown	unknown
AP018798.1\|BBF51178.1\|47640_49347_-\|hypothetical-protein	unknown	unknown	unknown
AP018798.1\|BBF51193.1\|64009_64138_+\|hypothetical-protein	unknown	unknown	unknown
AP018798.1\|BBF51192.1\|59566_62854_+\|DNA-adenine-methyltransferase	unknown	unknown	gnl\|CDD\|273146
AP018798.1\|BBF51190.1\|58387_58672_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
AP018798.1\|BBF51179.1\|49571_50573_-\|plasmid-partition-protein-B	gnl\|CDD\|370113	pfam08775, ParB, ParB family. ParB is a component of the par system which mediates accurate DNA partition during cell division. It recognizes A-box and B-box DNA motifs. ParB forms an asymmetric dimer with 2 extended helix-turn-helix (HTH) motifs that bind to A-boxes. The HTH motifs emanate from a beta sheet coiled coil DNA binding module. Both DNA binding elements are free to rotate around a flexible linker, this enables them to bind to complex arrays of A- and B-box elements on adjacent DNA arms of the looped partition site.	7.53921e-44
AP018798.1\|BBF51191.1\|58664_59570_+\|recombination-associated-protein-rdgC	gnl\|CDD\|234726	PRK00321, rdgC, recombination associated protein; Reviewed.	4.51676e-134
AP018798.1\|BBF51187.1\|56029_56845_-\|IS91-transposase	gnl\|CDD\|379554	pfam14319, Zn_Tnp_IS91, Transposase zinc-binding domain. This domain is likely to be a zinc-binding domain. It is found at the N-terminus of transposases belonging to the IS91 family.	2.30973e-26
AP018798.1\|BBF51182.1\|52428_52764_-\|hypothetical-protein	gnl\|CDD\|378444	pfam10544, T5orf172, T5orf172 domain. This domain was identified by Iyer and colleagues.	3.19371e-05
AP018798.1\|BBF51192.1\|59566_62854_+\|DNA-adenine-methyltransferase	gnl\|CDD\|273146	TIGR00571, DNA_adenine_methylase, DNA adenine methylase (dam). All proteins in this family for which functions are known are DNA-adenine methyltransferases. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). The DNA adenine methylase (dam) of E. coli and related species is instrumental in distinguishing the newly synthesized strand during DNA replication for methylation-directed mismatch repair. This family includes several phage methylases and a number of different restriction enzyme chromosomal site-specific modification systems. [DNA metabolism, DNA replication, recombination, and repair].	1.37817e-75
AP018798.1\|BBF51180.1\|50589_51786_-\|plasmid-partition-protein-A	gnl\|CDD\|376033	pfam18607, HTH_54, ParA helix turn helix domain. The accurate segregation of DNA is essential for the faithful inheritance of genetic information. Segregation of the prototypical P1 plasmid par system requires two proteins, ParA and ParB, and a centromere. When bound to ATP, ParA mediates segregation by interacting with centromere-bound ParB, but when bound to ADP, ParA fulfills a different function: DNA-binding transcription autoregulation. ParA consists of an elongated N-terminal alpha-helix which mediates dimerization, a winged-HTH and a Walker-box containing C-domain. This entry describes the N-terminal alpha helix domain combined with the winged HTH region.	3.86485e-53
AP018798.1\|BBF51186.1\|55656_56064_-\|IS91-transposase	gnl\|CDD\|377437	pfam04986, Y2_Tnp, Putative transposase. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases IS1294 and IS801. This is a rolling-circle transposase.	8.14508e-15

>AP018798.1|BBF51183.1|53056_53941_-|replication-protein-RepFIB
MLEENKGFLSVEEVAGNTGEIHSLKPNNNSTIQPIALLRLGVFVPTLKSTNVALRRGSSVTTNTTNATEELSSLKIVEQEGYEGIEIHGPRLDMDTDFKVWVGITSALFDYAPDDDGIITLPFSEFADRCGYPRKRLSKAFRKSIDDSLTRIQQTVVKFRFPAAKGHLNNINVNLLAYSSLNTELDVIEIQPQKQLSELYYVDYKRILKLKMLDKLGRKETAKVLYTFFEALPANPAPVSIERLRARLNLKSSVSVQNSVIRKAMKDLEAIEYLKFSEIKNGRKIGFQIHKRNP
>AP018798.1|BBF51182.1|52428_52764_-|hypothetical-protein
MQEEKQHYLYVLVPENGDTFKIGISCGPLARFKGLQVSPDFALSRVYRGTRLAMVNLERALHATFFPWNAPWEKSAGGGHTEWFTRECLDKVLAHIEYLNDMWGGILERIK
>AP018798.1|BBF51181.1|51954_52326_-|hypothetical-protein
MAYVSISGYEPDAIRAQCELLKAMFMLRTKYPWETGRVCFPMEELTATIDSQLYHDNPEKFFSLLAGNGLNCVSGLGRSRIQHASLFGPFFYDRHGYFEAELPALTRAIDTIDFERLFAALSK
>AP018798.1|BBF51180.1|50589_51786_-|plasmid-partition-protein-A
MSDSSQLHKVAQRANRMLNVLTEQVQLQKDELHANEFYQVYAKAALAKLPLLTRANVDYAVSEMEEKGYVFDKRPAGSSMKYAMSIQNIIDIYEHRGVPKYRDRYSEAYVIFISNLKGGVSKTVSTVSLAHAMRAHPHLLMEDLRILVIDLDPQSSATMFLSHKHSIGIVNATSAQAMLQNVSREELLEEFIVPSVVPGVDVMPASIDDAFIASDWRELCNEHLPGQNIHAVLKENVIDKLKSDYDFILVDSGPHLDAFLKNALASANILFTPLPPATVDFHSSLKYVARLPELVKLISDEGCECQLATNIGFMSKLSNKADHKYCHSLAKEVFGGDMLDVVLPRLDGFERCGESFDTVISANPATYVGSADALKNARIAAEDFAKAVFDRIEFIRSN
>AP018798.1|BBF51179.1|49571_50573_-|plasmid-partition-protein-B
MSKKNRPTIGRTLNPSILSGFDSSSASGDRVEQVFKLSTGRQATFIEEVIPPNQVESDTFVDQHNNGRDQASLTPKSLKSIRSTIKHQQFYPAIGVRRGTGKIEILDGSRRRASAILENVGLRVLVTDQEISVQEAQNLAKDVQTALQHSIREIGLRLMRMKNDGMSQKDIAAKEGLSQAKVTRALQAASAPEELVALFPVQSELTFSDYKTLCAVGDEMGNKNLEFDQLIQNISPEINDILSIEEMAEDEVKNKILRLITKEASLLTDKGSKDKSVVTELWKFEDKDRFARKRVKGRAFSYEFNRLSKELQEELDRMIGHILRKSLDKKPKP
>AP018798.1|BBF51178.1|47640_49347_-|hypothetical-protein
MSNLREYQNRIADIAKRSKAVLGWASTAQFGTDNQFIKDDAARAASILEAARKDPVFAGISDNATAQIATAWASALADYAAAHKSMPRPEILASCHQTLENCLIESTRNSMDATNKAMLESVAAEMMSVSDGVMRLPLFLAMILPVQLGAATADACTFIPVTRDQSDIYEVFNVAGSSFGSYAAGDVLDMQSVGVYSQLRRRYVLVASSDGTSKTATFKMEDFEGQNVPIRKGRTNIYVNRIKSVVDNGSGSLLHSFTNAAGEQITVTCSLNYNIGQIALSFSKAPDKGTEIAIETEINIEAAPELIPLINHEMKKYTLFPSQFVIAAEHTVQAAYEAQREFGLDLGSLQFRTLKEYLSHEQDMLRLRIMIWRTLATDTFDIALPVNQSFNVWATIIRGKFQTVYRDIIERVKSSGAMGMFAGADAASFFKQLPKDFFQPAEDYIQTPYVHYIGTLFGNVKVYEVPAGICKNLTTENIQFSSMDVLCYVRDENPGKAGFVTGDAVPAIPFQHPTTPALVNRTTLWGSAINDMHPRNGADYFTRVTLTMAKKGGLNFISGDTIDAGDSE
>AP018798.1|BBF51177.1|45990_47580_-|hypothetical-protein
MSQYSIQQSLGNASGVAVSPINADATLSTGVALNSSLWAGIGVFARGKPFTVLAVTESNYKDVLGEPLKPSSGSQFEPIRHVYEAIQQTSGYVVRAVPDDAKFPIIMFDESGEPAYSALPYGSEIELDSGEAFAIYVDDGDPCISPTRELTIETATADSAGNERFLLKLTQTTSLGVVTTLETHTVSLAEEAKDDMGRLCYLPTALEARSKYLRAVVNEELISTAKVTNKKSLAFTGGTNGDQSKISTAAYLRAVKVLNNAPYMYTAVLGLGCYDNAAITALGNICSDRLIDGFFDVKPTLTYTEALSAVEDTGLLGTDYVSCAVYHYPFSCKDKWTQSRVVFGLSGVAYAAKARGVKKNSDVGGWHYSPAGEERAVIARASIQPLYPEDTPDEEAMVKGRLNKVSVGTSGQMIIDDALTCCTQDNYLHFQHVPSLMNAISRFFVQLARQMKHSPDGITAAGLTKGMTKLLDRFVASGALVAPRDPDADGTEPYVLKVTQAEFDKWEVVWACCPTGVARRIQGVPLLIK
>AP018798.1|BBF51176.1|45165_45981_-|hypothetical-protein
MSKNFFQSGAFLGNGLSRFALNSDPVQLMESARASAEQPTDPVINNNPEPAAQTNDNVPSAPAPEQILEGKDGKEWTVEQAHQMILEAANRSAMQNALSDAADAVFAWADSGDLTFDSLDGFVQAIAGISDDDDSEVTEEQDDAYNEAWANVADFLAACGVDDDLIEALADDEDDDAAADVGASIAGLDSDDRDELEAAFVVAGTSDEMLTEAFKKVVRNGEIKLIRKRLRKKRLTAAQKSALKKARRKAQTGAAKLARKKSMKLRRKRLG
>AP018798.1|BBF51175.1|44842_45013_-|hypothetical-protein
MNMAQNWEAPFTGMSMGSVAGAFSGFAQVGTETTSVARWNSLMVWEGEHRQLSRCQ
>AP018798.1|BBF51174.1|44549_44900_-|hypothetical-protein
MEQLNGLGGGTPPTFTLPVTFIALFDPFTEVSGAIAALSAMISPELKDASIGGRIPERVTLNIGRQINIIDVAIQDISFDLDAPRDSNGHFLKNTVNLQLTGSSIYNSSDIVRAFQ
>AP018798.1|BBF51184.1|54274_54667_-|hypothetical-protein
MSDKVTVKQTINKATSIYKIEHITVGKPGSEQYRHAFELADQLGLKHPDCIEHVFPTYADEQCTHVLTEEDFFSTEEREGVDRCIGVICSSVSYELFPNVHENGGIGYQFLYEGDELKCYEHGLLIESVE
>AP018798.1|BBF51185.1|54844_55267_-|hypothetical-protein
MSFFSTLKTALSLKEKLAATGVLVLICALVGAGFAWERHQLKQAMEKIGSLDQAVKERDKSIMDLNQTIETMNKAEQHFHSQEVKNESEQAKYADRQMERKAEVQKQLVAAGNVRQRIPADTQRLLRESISEFNADADKG
>AP018798.1|BBF51186.1|55656_56064_-|IS91-transposase
MSRLEHYAGQDEIGLRYNSHRTKREEYLVMSGDEFMERFSWHVADKGFRMVRYYGFLSPVKRRLLEDVVYVITETVRKTAMQIRWRGMYQRLLKVDPLKCILCGGQMRFTGLKRGYRLTELVLMHEPLAQQRVCG
>AP018798.1|BBF51187.1|56029_56845_-|IS91-transposase
MLPRFADIFQQGNRWLNWLEKQPEGSVRPVVIESVTKIMACGTTLMGYTQWCCSSPDCSHIKKICFRCKSRSCPHCGVKAGAQWIQYLLSLVPDCPWQHIVFTLPCQYWSLVFHNRWLLAEMSRIAADVIQEICRQADVVPGIFTVIHTWGRDQQWHPHIHLSTTTGGVTSDHTWKNLHFYARKVMSMWRYRITRLLSRKYPDLVIPDALAAEGSSKRDWNRFLDSHYRRGWNVNVSRVMDNATHVAVYFGSYLKKTAGADEPSGALCWSG
>AP018798.1|BBF51188.1|56844_57210_-|IS91-transposase
MSRSAKPRKRKPAPQRSKLPRYVVKLHDDDFFDEEDAEALRFDNFDDAVECCADLNIPFFVDAGNKKLVFWFVRVDDEGYPEIARCTEREFATILAGISAGGMYCPECGTVHWPDGVPPPF
>AP018798.1|BBF51189.1|57244_57925_-|hypothetical-protein
MLEKDYQLSAYKKLAAAGGMKTPGAITSARNSANTAKLLAEELTGLILDTIVYPDTITSYVSTIRTTTTGLTNIGELATKHADLLAGYADLSMLLQLDIGWDVYCRANEREVSELPISIAIGDVNITKSLEDAVNALNTSSLVAAMGEINQALNTGSESSSGSGSGGGTATPPPALTEEQIESLKVATEQFGVVFNQTTAPTTALQQQYRVGSLAAAACHGLKLPL
>AP018798.1|BBF51190.1|58387_58672_+|hypothetical-protein
MQMELISRKEFDSRVTSGELDNLQAIKVKEGFCLIGNQSGINRVFMLRRTDLKPFVWKNEIGPSSYAQTRGCHNLAFFYKDELSVVDIQGLQHV
>AP018798.1|BBF51191.1|58664_59570_+|recombination-associated-protein-rdgC
MFKHWKNITIYKLSREADLTDLEDKKKMILFTPCGSQDMAKFGFVSPFGDNSEVIAMHGNGFILVEAKRETKILPPPVIQRAIQEKIEKLEQEQARKLKKTEKDSLKDEVLHSLLPRAFSKFSVIQAIYDGSTKRIYINASARQAEDMLALMRKSLGSLPAVPLSVENPIELTLTDWVRDGSAPQGFQMGDAAELKAVLEDGGIARVKKQDLGSDEISTHLEAGKLVTKLALDWQNRIKFTLDHNFSLTSVKFADELLEQNSDIDSEDVAQRLDADFFLLTSEISCLVDALVNALGGEAKQ
>AP018798.1|BBF51192.1|59566_62854_+|DNA-adenine-methyltransferase
MKELCYGSVCSGIEAASIAWEPLGMRPAWFAEIEPFPSAVLALRWPHVANLGDMKKLAKKVLAGEIESPDVLVGGTPCFTAGHMVLCKNGYKPIENVCPGDYVVSHLGRLQQVKRVGSKIANTGLLNAVGQPLGIRTTNDHPFLAVRWKAQNTRKNGTYFKRELLSEPEWRAACDMPGYQWCALTNFNIAFPDICSRFLSEEQAMYLAGAYVGDGYIRRWRGKSKKAVVFGINCQKLRKFHCRIPENIFSVASEIRGSIKVTLNDTCYANWLNEHFGELSHAKRIPAWVMSHPLRHVFLQGYLDTDGTPSGKAGFRINSVSSALAWGVAGLSQTCGYVSSVSFIEVEPKKVIEDRVVNQRNYYQVTICPQKLSRKSRLAHGMLLRTVKEFKSVGLDTVYNIEVEGDHSYILNGAVVHNCQAFSIAGLRGGLDDERGALTLKYVELANAIDDKRAESFLKPAVIVWENVPGVLSSADNAFGCFLAGLAGEDVPFEPGDRPESGKSNAFWRWDGKTGCHVPKWPQCGCIYGPQRKVAWRILDAQYFGVAQRRRRVFVVASARTDLDPATVLFEFEGVRRNIAPSRKKKEIASAIIANGAAISGESLNPCLHADMPPGMKSTKAVNAFRMAAFGEYIDDETASTVKARDFKDATDLAVFSSTGAGFWSEGHGTLRAREQESHEHLVTLAFPERMSGTQHAATKNTSPSLMAKNPTDVCYEVRNAEVAVRRLTPVECERLQGFPEGHTLIPTEKRKKVSSDELAYLRNHYPDLSEEEAAMLAADGPRYKAIGNSMAIPVMRWIGDRITKAVCRQKEGSETKERKVKPAAEFERSIFKWAGGKFGVLEQIFRYLPEGKRLIEPFVGGGAVFMNAGYQENLLNDVNADLINFYKTLQREAHSLITLAHRFFQDYNTQEGYLAVRNAFNKQVYDDLHRAAAFLFLNRHCFNGLTRYNQAGEFNVGYGKYKTPYFPLQEMEAFLGAEGRSEFVCGDFAAVIEAAGEGDVIFCDPPYEPLPNTEGFTNYSGHDFKFEEQKRLVSLLTDAHRRGAKVLITNSGAPNIRELYHDSGFRVEPLFARRSVSCKGDTRGVAHDVLGILL
>AP018798.1|BBF51193.1|64009_64138_+|hypothetical-protein
MWAFNGIRVVTAIINGELKYSRFETNERDGKCIGVRLVREYA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
AP018798_1	1.2\|54093\|13\|AP018798\|PILER-CR	54093-54105	13	AP018797.1	29997-30009	1	0.923
AP018798_1	1.2\|54093\|13\|AP018798\|PILER-CR	54093-54105	13	AP018799.1	86030-86042	1	0.923
AP018798_1	1.2\|54093\|13\|AP018798\|PILER-CR	54093-54105	13	AP018800.1	13479-13491	1	0.923
AP018798_1	1.2\|54093\|13\|AP018798\|PILER-CR	54093-54105	13	AP018801.1	62280-62292	1	0.923

1. spacer 1.2|54093|13|AP018798|PILER-CR matches to position: 29997-30009, mismatch: 1, identity: 0.923

caataaatcgtgc	CRISPR spacer
caataaatcgggc	Protospacer
********** **

2. spacer 1.2|54093|13|AP018798|PILER-CR matches to position: 86030-86042, mismatch: 1, identity: 0.923

caataaatcgtgc	CRISPR spacer
caataaaccgtgc	Protospacer
*******.*****

3. spacer 1.2|54093|13|AP018798|PILER-CR matches to position: 13479-13491, mismatch: 1, identity: 0.923

caataaatcgtgc	CRISPR spacer
caataaaccgtgc	Protospacer
*******.*****

4. spacer 1.2|54093|13|AP018798|PILER-CR matches to position: 62280-62292, mismatch: 1, identity: 0.923

caataaatcgtgc	CRISPR spacer
caataaaccgtgc	Protospacer
*******.*****

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

206 : 94048

116

Escherichia_phage(67.29%)

transposase,lysis,tail

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBF51130.1\|206_428_+	hypothetical protein	Q5QBN7	Enterobacteria_phage	1.0e-32	94.5
BBF51131.1\|447_843_+	hypothetical protein	NA	NA	NA	NA
BBF51132.1\|839_1871_+	recombinase	A0A077SLE7	Escherichia_phage	5.4e-193	98.8
BBF51133.1\|1921_2233_+	hypothetical protein	Q5XLQ4	Enterobacteria_phage	3.1e-43	92.2
BBF51134.1\|2473_3532_-	hypothetical protein	A0A077SLI1	Escherichia_phage	6.5e-141	76.6
BBF51135.1\|3528_3750_-	ash family protein	Q38557	Escherichia_phage	1.3e-30	82.2
BBF51136.1\|4343_4985_+	hypothetical protein	Q71TG2	Escherichia_phage	6.3e-115	98.6
BBF51137.1\|5060_7985_-	hypothetical protein	Q71TG1	Escherichia_phage	0.0e+00	93.5
BBF51138.1\|7987_9973_-	adenine-specific DNA-methyltransferase	Q1MVP0	Enterobacteria_phage	3.8e-203	60.2
BBF51139.1\|10117_10366_-	hypothetical protein	Q71TG0	Escherichia_phage	1.8e-41	100.0
BBF51140.1\|10649_12389_+	hypothetical protein	A0A1B0V850	Salmonella_phage	0.0e+00	99.3
BBF51141.1\|12381_13401_+	hypothetical protein	Q1MVN5	Enterobacteria_phage	3.9e-183	100.0
BBF51142.1\|13692_14250_-\|lysis	phage lysis protein	Q71TF3	Escherichia_phage	1.6e-106	99.5
BBF51143.1\|14419_14908_+	single-stranded DNA-binding protein	Q1MVN2	Enterobacteria_phage	2.5e-87	98.8
BBF51144.1\|15141_16254_-	outer membrane porin protein	Q1MVN1	Enterobacteria_phage	4.6e-198	96.0
BBF51145.1\|16995_17307_-	hypothetical protein	A0A077SLG5	Escherichia_phage	1.8e-46	100.0
BBF51146.1\|17296_20284_-	hypothetical protein	A0A1B0VFX4	Salmonella_phage	0.0e+00	99.3
BBF51147.1\|20296_20662_-	hypothetical protein	A0A077SK35	Escherichia_phage	7.9e-46	100.0
BBF51148.1\|20658_22578_-	hypothetical protein	A0A1B0V7H1	Salmonella_phage	0.0e+00	95.8
BBF51149.1\|22579_23182_-	hypothetical protein	Q1MVM6	Enterobacteria_phage	5.4e-100	100.0
BBF51150.1\|23168_23612_-	hypothetical protein	A0A077SK09	Escherichia_phage	1.3e-82	100.0
BBF51151.1\|23608_23938_-	hypothetical protein	Q37876	Escherichia_phage	1.3e-52	100.0
BBF51152.1\|23966_24203_+\|tail	phage tail fiber assembly protein	A0A222YXY8	Escherichia_phage	4.9e-25	80.8
BBF51153.1\|24692_25265_+	hypothetical protein	NA	NA	NA	NA
BBF51154.1\|25308_25887_-\|tail	phage tail fiber assembly protein	K7PMH7	Enterobacteria_phage	7.7e-96	89.0
BBF51155.1\|25886_28736_-\|tail	phage tail fiber protein	Q71TP5	Escherichia_phage	0.0e+00	93.9
BBF51156.1\|28747_29182_-	hypothetical protein	A0A077SLL3	Escherichia_phage	3.3e-75	100.0
BBF51157.1\|29260_30097_-	hypothetical protein	A0A077SLH5	Escherichia_phage	1.7e-152	98.9
BBF51158.1\|30096_31530_-	hypothetical protein	A0A1B0VAD6	Salmonella_phage	3.7e-272	100.0
BBF51159.1\|31526_31883_-	hypothetical protein	Q71TP1	Escherichia_phage	1.0e-61	100.0
BBF51160.1\|31882_35215_-	DNA transfer protein	A0A077SK38	Escherichia_phage	0.0e+00	89.9
BBF51161.1\|35296_36178_-	hypothetical protein	A0A1B0VBL3	Salmonella_phage	3.7e-174	99.7
BBF51162.1\|36192_36804_-	hypothetical protein	A0A1B0VFV3	Salmonella_phage	2.1e-107	98.5
BBF51163.1\|36814_37381_-	hypothetical protein	Q1MVL0	Enterobacteria_phage	1.6e-98	97.9
BBF51164.1\|37497_37917_-	hypothetical protein	NA	NA	NA	NA
BBF51165.1\|37968_38616_-	hypothetical protein	Q71TC4	Escherichia_phage	6.3e-14	90.5
BBF51166.1\|39043_39265_+	ash family protein	A0A077SLM6	Escherichia_phage	1.1e-37	98.6
BBF51167.1\|39261_40305_+	hypothetical protein	Q71TN2	Escherichia_phage	2.7e-176	93.1
BBF51168.1\|40468_41269_+	hypothetical protein	A0A077SL47	Escherichia_phage	1.4e-148	100.0
BBF51169.1\|41334_42144_+	hypothetical protein	Q71TB9	Escherichia_phage	1.2e-142	97.8
BBF51170.1\|42312_43017_+	hypothetical protein	Q71TB8	Escherichia_phage	7.9e-135	99.6
BBF51171.1\|43016_43481_+	hypothetical protein	Q71TB7	Escherichia_phage	1.5e-86	97.4
BBF51172.1\|43647_43944_-	hypothetical protein	Q71TM6	Escherichia_phage	8.9e-48	91.8
BBF51173.1\|44028_44538_-	hypothetical protein	Q1MVJ9	Enterobacteria_phage	1.1e-90	99.4
BBF51174.1\|44549_44900_-	hypothetical protein	Q1MVJ8	Enterobacteria_phage	9.2e-52	96.3
BBF51175.1\|44842_45013_-	hypothetical protein	Q1MVJ8	Enterobacteria_phage	1.3e-19	97.9
BBF51176.1\|45165_45981_-	hypothetical protein	A0A1B0V835	Salmonella_phage	9.8e-113	99.3
BBF51177.1\|45990_47580_-	hypothetical protein	A0A1B0V7E4	Salmonella_phage	6.2e-305	99.2
BBF51178.1\|47640_49347_-	hypothetical protein	Q71TM1	Escherichia_phage	0.0e+00	99.8
BBF51179.1\|49571_50573_-	plasmid partition protein B	Q38420	Escherichia_phage	3.7e-178	99.7
BBF51180.1\|50589_51786_-	plasmid partition protein A	A0A077SL49	Escherichia_phage	1.6e-225	100.0
BBF51181.1\|51954_52326_-	hypothetical protein	A0A077SK46	Escherichia_phage	1.6e-65	97.6
BBF51182.1\|52428_52764_-	hypothetical protein	A0A077SK46	Escherichia_phage	1.1e-62	99.1
BBF51183.1\|53056_53941_-	replication protein RepFIB	A0A1B0VDL5	Salmonella_phage	1.4e-160	99.7
BBF51184.1\|54274_54667_-	hypothetical protein	A0A077SLJ1	Escherichia_phage	2.0e-71	99.2
BBF51185.1\|54844_55267_-	hypothetical protein	A0A1B0VCB0	Salmonella_phage	2.7e-58	100.0
BBF51186.1\|55656_56064_-\|transposase	IS91 transposase	NA	NA	NA	NA
BBF51187.1\|56029_56845_-\|transposase	IS91 transposase	NA	NA	NA	NA
BBF51188.1\|56844_57210_-\|transposase	IS91 transposase	NA	NA	NA	NA
BBF51189.1\|57244_57925_-	hypothetical protein	A0A1B0V830	Salmonella_phage	4.0e-91	96.2
BBF51190.1\|58387_58672_+	hypothetical protein	Q71TA2	Escherichia_phage	1.7e-48	98.9
BBF51191.1\|58664_59570_+	recombination-associated protein rdgC	A0A077SK17	Escherichia_phage	5.9e-159	99.3
BBF51192.1\|59566_62854_+	DNA adenine methyltransferase	A0A077SL51	Escherichia_phage	0.0e+00	98.6
BBF51193.1\|64009_64138_+	hypothetical protein	NA	NA	NA	NA
BBF51194.1\|64646_64772_+	hypothetical protein	NA	NA	NA	NA
BBF51195.1\|64811_65699_-\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	1.6e-169	100.0
BBF51196.1\|65698_66025_-\|transposase	IS629 transposase OrfA	A0A0N7BVE9	Escherichia_phage	1.3e-55	100.0
BBF51197.1\|66030_66210_-	hypothetical protein	Q71T91	Escherichia_phage	1.3e-17	100.0
BBF51198.1\|66211_66997_-	hypothetical protein	A0A077SLJ8	Escherichia_phage	3.0e-143	98.9
BBF51199.1\|66983_67712_-	hypothetical protein	A0A077SK19	Escherichia_phage	9.3e-139	100.0
BBF51200.1\|67715_68933_-	hypothetical protein	A0A077SL53	Escherichia_phage	1.1e-224	100.0
BBF51201.1\|68942_69203_-	hypothetical protein	Q38620	Escherichia_phage	1.6e-45	100.0
BBF51202.1\|69466_69712_+	hypothetical protein	Q71T86	Escherichia_phage	5.7e-40	100.0
BBF51203.1\|69714_70293_+	hypothetical protein	Q71T85	Escherichia_phage	4.4e-107	99.5
BBF51204.1\|70359_70515_+	hypothetical protein	Q71TJ4	Escherichia_phage	2.7e-19	96.1
BBF51205.1\|71016_71643_+	hypothetical protein	Q71T82	Escherichia_phage	6.1e-123	100.0
BBF51206.1\|71639_72317_+	serine/threonine-specific protein phosphatase 1	A0A077SLQ6	Escherichia_phage	7.6e-135	99.6
BBF51207.1\|72313_73015_+	hypothetical protein	Q1MVG6	Enterobacteria_phage	4.2e-144	100.0
BBF51208.1\|73096_73315_+	hypothetical protein	Q71TI9	Escherichia_phage	3.4e-36	100.0
BBF51209.1\|73316_74579_+	hypothetical protein	A0A1B0V7L1	Salmonella_phage	5.4e-235	100.0
BBF51210.1\|74651_75158_+	hypothetical protein	A0A1B0VAK0	Salmonella_phage	6.3e-94	99.4
BBF51211.1\|75352_76081_+	morphogenetic protein	Q71T76	Escherichia_phage	4.9e-140	99.1
BBF51212.1\|76164_76368_+	hypothetical protein	A0A2R2Z313	Escherichia_phage	6.8e-31	94.0
BBF51213.1\|76360_76600_+	hypothetical protein	S5MQM0	Escherichia_phage	2.0e-34	92.4
BBF51214.1\|76596_77298_+	hypothetical protein	A0A0U2QW67	Escherichia_phage	7.0e-51	54.3
BBF51215.1\|77294_77585_+	hypothetical protein	A0A2I6TCB0	Escherichia_phage	1.2e-36	82.3
BBF51216.1\|77581_78316_+	hypothetical protein	A0A2I6TCG8	Escherichia_phage	6.5e-39	54.0
BBF51217.1\|78312_78612_+	hypothetical protein	A5VWB2	Enterobacteria_phage	1.3e-57	99.0
BBF51218.1\|78613_79099_+	hypothetical protein	A5VWB3	Enterobacteria_phage	3.1e-45	88.9
BBF51219.1\|79100_79310_+	hypothetical protein	A0A0F6TJE4	Escherichia_coli_O157_typing_phage	2.0e-33	92.8
BBF51220.1\|79306_79669_+	putative phage protein	A0A1B0V865	Salmonella_phage	4.0e-58	98.3
BBF51221.1\|79668_79845_+	hypothetical protein	A0A0F6TJP6	Escherichia_coli_O157_typing_phage	3.9e-19	84.5
BBF51222.1\|79841_80030_+	hypothetical protein	A0A1I9LJM4	Stx_converting_phage	1.4e-30	98.4
BBF51223.1\|80031_80547_+	hypothetical protein	G9L6B3	Escherichia_phage	2.4e-101	100.0
BBF51224.1\|80543_81113_+	putative phage protein	G9L6B4	Escherichia_phage	1.4e-102	95.7
BBF51225.1\|81103_81361_+	hypothetical protein	A0A077SLR0	Escherichia_phage	2.0e-40	97.6
BBF51226.1\|81360_81642_+	RNA-binding protein	A0A077SLL0	Escherichia_phage	3.4e-49	100.0
BBF51227.1\|81665_81959_+	hypothetical protein	A0A077SK23	Escherichia_phage	4.2e-50	99.0
BBF51228.1\|81965_82340_+	hypothetical protein	A0A077SL57	Escherichia_phage	1.2e-68	100.0
BBF51229.1\|82321_82996_+	hypothetical protein	A0A077SK55	Escherichia_phage	1.1e-114	97.6
BBF51230.1\|82992_83355_+	hypothetical protein	A0A1B0VBR1	Salmonella_phage	2.2e-56	99.2
BBF51231.1\|83430_83568_-	hypothetical protein	NA	NA	NA	NA
BBF51232.1\|84430_84787_-	hypothetical protein	A0A1B0VCG1	Salmonella_phage	3.1e-63	99.2
BBF51233.1\|84787_85372_-	hypothetical protein	Q1MVE8	Enterobacteria_phage	1.5e-110	99.0
BBF51234.1\|85546_85936_+	DNA repair protein	A0A077SK24	Escherichia_phage	6.4e-70	99.2
BBF51235.1\|86008_86230_+	hypothetical protein	A0A222YXU1	Escherichia_phage	6.7e-32	100.0
BBF51236.1\|86229_86610_+	death on curing protein	Q71T66	Escherichia_phage	1.9e-63	100.0
BBF51237.1\|86614_86794_+	hypothetical protein	Q71TH5	Escherichia_phage	1.2e-23	98.3
BBF51238.1\|86821_87865_+	hypothetical protein	A0A077SLM1	Escherichia_phage	1.1e-206	99.7
BBF51239.1\|87953_88406_+	hypothetical protein	Q71T63	Escherichia_phage	3.0e-79	100.0
BBF51240.1\|88491_89685_+	hypothetical protein	A0A077SL59	Escherichia_phage	1.7e-174	96.0
BBF51241.1\|89684_91169_+	phage DNA packaging protein	Q71T61	Escherichia_phage	2.1e-291	99.8
BBF51242.1\|91165_91729_+	hypothetical protein	Q38557	Escherichia_phage	4.1e-25	80.3
BBF51243.1\|91725_92844_+	phage antirepressor protein	A0A077SLR9	Escherichia_phage	8.3e-179	89.0
BBF51244.1\|92876_93728_-	hypothetical protein	A0A077SLM8	Escherichia_phage	1.0e-157	99.3
BBF51245.1\|93838_94048_-	hypothetical protein	A0A077SK26	Escherichia_phage	1.8e-31	100.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. AP018797

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2307 : 32308

Escherichia_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBF50995.1\|2307_3495_-\|transposase	IS91 transposase	NA	NA	NA	NA
BBF50996.1\|3494_3860_-\|transposase	IS91 transposase	NA	NA	NA	NA
BBF50997.1\|3878_4169_+	toxin of the RelE-RelB toxin-antitoxin system	A0A2H4JBF4	uncultured_Caudovirales_phage	4.8e-14	49.4
BBF50998.1\|4178_4724_+	hypothetical protein	NA	NA	NA	NA
BBF50999.1\|4966_5212_+	hypothetical protein	NA	NA	NA	NA
BBF51000.1\|5134_5320_-	hypothetical protein	NA	NA	NA	NA
BBF51001.1\|5375_5978_-	hypothetical protein	NA	NA	NA	NA
BBF51002.1\|6331_6637_+	hypothetical protein	NA	NA	NA	NA
BBF51003.1\|6605_9194_-\|transposase	transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	75.4
BBF51004.1\|9326_10031_-\|transposase	IS26 transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
BBF51005.1\|10100_10433_+	DNA-invertase	Q1MVP4	Enterobacteria_phage	3.0e-52	100.0
BBF51006.1\|10615_11476_+	TEM-1 beta-lactamase	Q1MVP3	Enterobacteria_phage	4.6e-161	100.0
BBF51007.1\|12060_12765_+\|transposase	IS26 transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
BBF51008.1\|12826_13534_+	plasmid replication protein A	NA	NA	NA	NA
BBF51009.1\|13520_14438_+	plasmid replication protein C	NA	NA	NA	NA
BBF51010.1\|14678_15494_+	sulfonamide-resistant dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	3.5e-09	27.6
BBF51011.1\|15554_16358_+	streptomycin phosphotransferase	NA	NA	NA	NA
BBF51012.1\|16357_17194_+	streptomycin phosphotransferase	NA	NA	NA	NA
BBF51013.1\|17254_17959_-\|transposase	IS26 transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
BBF51014.1\|18109_18925_+	aminoglycoside 3'-phosphotransferase	A0A193DTG4	Autographa_californica_nuclear_polyhedrosis_virus	6.1e-163	100.0
BBF51015.1\|19114_19819_-\|transposase	IS26 transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
BBF51016.1\|19865_21134_-\|transposase	transposase	NA	NA	NA	NA
BBF51017.1\|21208_21916_-	hypothetical protein	NA	NA	NA	NA
BBF51018.1\|21912_22149_-	mercury resistance protein MerE	NA	NA	NA	NA
BBF51019.1\|22145_22508_-	mercuric resistance operon coregulator MerD	NA	NA	NA	NA
BBF51020.1\|22525_24220_-	mercuric reductase MerA	A0A2K5B2C5	Erysipelothrix_phage	8.8e-39	27.6
BBF51021.1\|24271_24694_-	mercury transport protein MerC	NA	NA	NA	NA
BBF51022.1\|24729_25005_-	mercuric transport protein periplasmic component precursor MerP	NA	NA	NA	NA
BBF51023.1\|25018_25369_-	mercuric ion transport protein MerT	NA	NA	NA	NA
BBF51024.1\|25440_25875_+	mercuric resistance operon regulatory protein MerR	NA	NA	NA	NA
BBF51025.1\|26877_27120_+\|transposase	transposase	NA	NA	NA	NA
BBF51026.1\|27151_27829_-	tetracycline repressor protein TetR	NA	NA	NA	NA
BBF51027.1\|27907_29107_+	tetracycline resistance structural protein TetA	NA	NA	NA	NA
BBF51028.1\|29138_30023_-	transporter permease protein	NA	NA	NA	NA
BBF51029.1\|30511_32308_+\|transposase	transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	100.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. AP018801

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

5204 : 20487

Escherichia_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBF51447.1\|5204_6392_-\|transposase	IS91 transposase	NA	NA	NA	NA
BBF51448.1\|6391_6757_-\|transposase	IS91 transposase	NA	NA	NA	NA
BBF51449.1\|6791_7556_-	reverse gyrase	NA	NA	NA	NA
BBF51450.1\|7668_8562_-	hypothetical protein	NA	NA	NA	NA
BBF51451.1\|9301_9652_-\|transposase	IS100 transposase	A0A2L1IVB6	Escherichia_phage	2.3e-58	100.0
BBF51452.1\|9653_10214_+	resolvase ResA	I3WFA4	Macacine_betaherpesvirus	5.0e-07	80.6
BBF51453.1\|10526_11714_-\|transposase	IS91 transposase	NA	NA	NA	NA
BBF51454.1\|11713_12079_-\|transposase	IS91 transposase	NA	NA	NA	NA
BBF51455.1\|12416_12692_-	hypothetical protein	NA	NA	NA	NA
BBF51456.1\|12685_13330_-	partitioning protein ParA	A0A222YXS3	Escherichia_phage	1.9e-39	43.0
BBF51457.1\|13558_14530_+	plasmid partition protein	A0A222YXF2	Escherichia_phage	7.4e-67	42.9
BBF51458.1\|14534_14822_+	plasmid stable inheritance protein StbB	NA	NA	NA	NA
BBF51459.1\|14873_15200_+\|transposase	IS629 transposase OrfA	A0A0N7BVE9	Escherichia_phage	1.3e-55	100.0
BBF51460.1\|15199_16087_+\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	1.6e-169	100.0
BBF51461.1\|16244_17516_-	DNA polymerase V subunit UmuC	F1C5A5	Cronobacter_phage	5.4e-142	60.5
BBF51462.1\|17515_17953_-	ImpA protein	A0A1W6JNS2	Morganella_phage	9.2e-25	47.6
BBF51463.1\|17949_18198_-	DNA-damage-inducible protein	Q2A098	Sodalis_phage	1.9e-14	48.0
BBF51464.1\|18318_18417_+	hypothetical protein	NA	NA	NA	NA
BBF51465.1\|18591_19518_+	hypothetical protein	NA	NA	NA	NA
BBF51466.1\|19902_20487_+	DNA methylase	A0A2I7RE86	Vibrio_phage	4.1e-12	29.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. AP018799

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1797 : 33939

Escherichia_phage(40.0%)

integrase,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBF51247.1\|1797_2451_+\|protease	CAAX amino terminal protease family protein	NA	NA	NA	NA
BBF51248.1\|2543_2801_+	stable plasmid inheritance protein PemI	NA	NA	NA	NA
BBF51249.1\|2802_3135_+	toxin of the ChpB-ChpS toxin-antitoxin system	NA	NA	NA	NA
BBF51250.1\|3219_6186_-\|transposase	transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	73.2
BBF51251.1\|6188_6749_-	DNA-invertase	A0A1B0V7I5	Salmonella_phage	1.3e-50	87.9
BBF51252.1\|6971_7676_-\|transposase	IS26 transposase	A0A077SL39	Escherichia_phage	1.2e-138	99.6
BBF51253.1\|7794_8196_+	DNA-invertase	Q1MVP4	Enterobacteria_phage	4.9e-65	100.0
BBF51254.1\|8378_9239_+	TEM-1 beta-lactamase	Q1MVP3	Enterobacteria_phage	4.6e-161	100.0
BBF51255.1\|9515_10826_-	hypothetical protein	NA	NA	NA	NA
BBF51256.1\|11164_11842_-	hypothetical protein	NA	NA	NA	NA
BBF51257.1\|11838_12399_-	multidrug resistance protein MdtH	NA	NA	NA	NA
BBF51258.1\|12395_14039_-	phosphoethanolamine transferase MCR-5	NA	NA	NA	NA
BBF51259.1\|14057_14600_-	hypothetical protein	NA	NA	NA	NA
BBF51260.1\|14740_15445_+\|transposase	IS26 transposase	A0A077SL39	Escherichia_phage	1.2e-138	99.6
BBF51261.1\|16186_16951_-\|transposase	IS6100 transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7
BBF51262.1\|17177_17483_-	hypothetical protein	NA	NA	NA	NA
BBF51263.1\|17493_18699_-	putative chromate transport protein	NA	NA	NA	NA
BBF51264.1\|18854_19058_-	hypothetical protein	NA	NA	NA	NA
BBF51265.1\|19185_20025_-	sulfonamide-resistant dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
BBF51266.1\|20018_20366_-	multidrug efflux protein	NA	NA	NA	NA
BBF51267.1\|20571_21360_-	aminoglycoside adenylyltransferase	NA	NA	NA	NA
BBF51268.1\|21490_22039_-	dihydrofolate reductase	A0A1B2IAU3	Erwinia_phage	4.4e-16	34.1
BBF51269.1\|22121_23135_+\|integrase	integrase	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
BBF51270.1\|23382_24087_-\|transposase	IS26 transposase	A0A077SL39	Escherichia_phage	1.2e-138	99.6
BBF51271.1\|24123_24546_-	erythromycin resistance repressor protein	NA	NA	NA	NA
BBF51272.1\|24545_25784_-	erythromycin resistance regulator protein	NA	NA	NA	NA
BBF51273.1\|25780_26686_-	macrolide 2'-phosphotransferase I	NA	NA	NA	NA
BBF51274.1\|26807_27512_-\|transposase	IS26 transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
BBF51275.1\|27548_28676_-	hypothetical protein	NA	NA	NA	NA
BBF51276.1\|28726_28954_-	hypothetical protein	NA	NA	NA	NA
BBF51277.1\|29650_30193_-	Tunicamycin resistance protein	NA	NA	NA	NA
BBF51278.1\|30205_31066_-	aminoglycoside N3'-acetyltransferase	NA	NA	NA	NA
BBF51279.1\|31208_32177_+\|transposase	IS10 transposase	A4KWT9	Enterobacteria_phage	2.5e-187	100.0
BBF51280.1\|32280_33201_+\|transposase	IS10 transposase	A4KWT9	Enterobacteria_phage	2.7e-175	100.0
BBF51281.1\|33234_33939_-\|transposase	IS26 transposase	A0A077SL39	Escherichia_phage	1.2e-138	99.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. AP018800

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3563 : 59718

Escherichia_phage(28.57%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBF51357.1\|3563_5684_+	hemolysin B	W8CYL7	Bacillus_phage	1.6e-45	30.2
BBF51358.1\|5687_7127_+	hemolysin D	NA	NA	NA	NA
BBF51359.1\|7253_7871_-\|transposase	ISEc48 transposase	Q9ZXG3	Shigella_phage	8.0e-75	67.5
BBF51360.1\|7945_9484_-\|transposase	ISEc8 transposase	A0A0P0ZBS5	Stx2-converting_phage	3.8e-299	99.6
BBF51361.1\|9533_9767_-\|transposase	ISEc8 transposase	A0A0P0ZBY2	Stx2-converting_phage	3.8e-38	100.0
BBF51362.1\|9878_10259_-	hypothetical protein	A0A0P0ZBP6	Stx2-converting_phage	1.4e-66	100.0
BBF51363.1\|10408_10969_-	fertility inhibition protein FinO	NA	NA	NA	NA
BBF51364.1\|11071_11932_-	hypothetical protein	A2RQC8	Archaeal_BJ1_virus	9.7e-10	23.5
BBF51365.1\|11990_12737_-	conjugal transfer protein TraX	A0A077JBM8	Xanthomonas_phage	7.1e-09	30.9
BBF51366.1\|12756_18027_-	conjugal transfer protein TraI	NA	NA	NA	NA
BBF51367.1\|18026_20180_-	conjugal transfer protein TraD	NA	NA	NA	NA
BBF51368.1\|20432_21164_-	complement resistance protein precursor TraT	NA	NA	NA	NA
BBF51369.1\|21177_21687_-	surface exclusion protein TraS	NA	NA	NA	NA
BBF51370.1\|21683_23204_-	conjugal transfer protein TraG	NA	NA	NA	NA
BBF51371.1\|23403_23730_+\|transposase	IS629 transposase OrfA	A0A0N7BVE9	Escherichia_phage	1.3e-55	100.0
BBF51372.1\|23729_24617_+\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	1.6e-169	100.0
BBF51373.1\|24619_25822_-	conjugal transfer protein TraG	NA	NA	NA	NA
BBF51374.1\|25818_26502_-	conjugal transfer protein TraH	NA	NA	NA	NA
BBF51375.1\|26507_27098_-	conjugal transfer protein TraP	NA	NA	NA	NA
BBF51376.1\|27087_28515_-	conjugal transfer protein TraB	NA	NA	NA	NA
BBF51377.1\|28514_29243_-	conjugal transfer protein TraK	NA	NA	NA	NA
BBF51378.1\|29229_29796_-	conjugal transfer protein TraE	NA	NA	NA	NA
BBF51379.1\|29817_30129_-	conjugal transfer protein TraL	NA	NA	NA	NA
BBF51380.1\|30143_30503_-	conjugal transfer protein TraA	NA	NA	NA	NA
BBF51381.1\|30535_30931_-	conjugal transfer protein Y TraY	NA	NA	NA	NA
BBF51382.1\|31029_31719_-	conjugal transfer protein TraJ	NA	NA	NA	NA
BBF51383.1\|31905_32289_-	conjugal transfer protein TraM	NA	NA	NA	NA
BBF51384.1\|32702_32951_+	hypothetical protein	NA	NA	NA	NA
BBF51385.1\|32972_33212_+	hypothetical protein	NA	NA	NA	NA
BBF51386.1\|33508_34330_-	hypothetical protein	A0A2C9CYF8	Yersinia_phage	4.4e-44	38.2
BBF51387.1\|34450_34738_-	hypothetical protein	NA	NA	NA	NA
BBF51388.1\|35663_35876_-	modulator of Hok protein	NA	NA	NA	NA
BBF51389.1\|36097_36817_-	plasmid SOS inhibition protein PsiA	NA	NA	NA	NA
BBF51390.1\|36813_37248_-	plasmid SOS inhibition protein PsiB	NA	NA	NA	NA
BBF51391.1\|37302_39261_-	partitioning protein ParB	G8DH78	Emiliania_huxleyi_virus	6.6e-22	29.9
BBF51392.1\|39319_39553_-	hypothetical protein	A0A096XUX0	Cronobacter_phage	3.9e-06	51.1
BBF51393.1\|39608_40136_-	single-stranded DNA-binding protein	A0A1B0VAF5	Salmonella_phage	4.6e-47	54.1
BBF51394.1\|40778_41039_-	hypothetical protein	NA	NA	NA	NA
BBF51395.1\|41154_41601_-	hypothetical protein	A0A2I7RQ20	Vibrio_phage	5.5e-17	43.6
BBF51396.1\|41647_43009_-	hydrolase	NA	NA	NA	NA
BBF51397.1\|43060_43291_-	hypothetical protein	NA	NA	NA	NA
BBF51398.1\|44328_44520_-	hypothetical protein	NA	NA	NA	NA
BBF51399.1\|44516_44939_-	hypothetical protein	NA	NA	NA	NA
BBF51400.1\|44985_45411_-	antirestriction protein	NA	NA	NA	NA
BBF51401.1\|45660_46026_+\|transposase	IS91 transposase	NA	NA	NA	NA
BBF51402.1\|46025_46199_+\|transposase	IS91 transposase	NA	NA	NA	NA
BBF51403.1\|46280_46646_+\|transposase	IS91 transposase	NA	NA	NA	NA
BBF51404.1\|46645_46819_+\|transposase	IS91 transposase	NA	NA	NA	NA
BBF51405.1\|46900_47266_+\|transposase	IS91 transposase	NA	NA	NA	NA
BBF51406.1\|47265_48453_+\|transposase	IS91 transposase	NA	NA	NA	NA
BBF51407.1\|48559_48931_-	DNA methylase	A0A2I7RE86	Vibrio_phage	1.4e-10	33.9
BBF51408.1\|49315_50242_-	hypothetical protein	NA	NA	NA	NA
BBF51409.1\|50490_51450_+	plasmid partition protein	A0A222YXF2	Escherichia_phage	6.0e-61	40.6
BBF51410.1\|51449_51845_+	plasmid stable inheritance protein StbB	NA	NA	NA	NA
BBF51411.1\|51909_52134_-\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	2.7e-28	91.4
BBF51412.1\|52222_52366_-\|transposase	IS629 transposase OrfA	NA	NA	NA	NA
BBF51413.1\|52365_52605_-\|transposase	IS629 transposase OrfA	A0A0N7C1Z2	Escherichia_phage	7.2e-32	95.8
BBF51414.1\|52804_53194_-	hypothetical protein	NA	NA	NA	NA
BBF51415.1\|53237_54122_-	catalase-peroxidase HPI	NA	NA	NA	NA
BBF51416.1\|54219_54546_+\|transposase	IS629 transposase OrfA	Q6H9S4	Enterobacteria_phage	4.1e-54	97.2
BBF51417.1\|54545_55433_+\|transposase	IS629 transposase OrfB	A0A0N7C035	Escherichia_phage	1.6e-169	100.0
BBF51418.1\|55752_59718_+\|protease	serine protease EspP	Q9LA58	Enterobacterial_phage	1.1e-230	39.9

DBSCAN-SWA_2

66124 : 71412

Stx2-converting_phage(57.14%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBF51426.1\|66124_66586_-	endonuclease	A0A0R6PHV6	Moraxella_phage	4.2e-20	37.1
BBF51427.1\|67160_67679_-	hypothetical protein	A0A0P0ZBS5	Stx2-converting_phage	5.0e-94	99.4
BBF51428.1\|67781_68108_+\|transposase	IS629 transposase OrfA	A0A0N7BVE9	Escherichia_phage	1.3e-55	100.0
BBF51429.1\|68107_68995_+\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	1.6e-169	100.0
BBF51430.1\|69098_69479_+	hypothetical protein	A0A0P0ZBP6	Stx2-converting_phage	1.4e-66	100.0
BBF51431.1\|69590_69824_+\|transposase	ISEc8 transposase	A0A0P0ZBY2	Stx2-converting_phage	3.8e-38	100.0
BBF51432.1\|69873_71412_+\|transposase	ISEc8 transposase	A0A0P0ZBS5	Stx2-converting_phage	3.8e-299	99.6

Anti-CRISPR protein detection

Acr_ID: AP018800.1|BBF51399.1|44516_44939_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

AP018800.1|BBF51399.1|44516_44939_-|hypothetical-protein

44516_44939_-

140 aa aa

3563-59718

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
AP018798_1	Orphan	1.2\|54093\|13\|AP018798\|PILER-CR	54093-54105	13	13479-13491	1

1. spacer 1.2|54093|13|AP018798|PILER-CR matches to AP018800 position: 13479-13491, mismatch: 1

caataaatcgtgc	CRISPR spacer
caataaaccgtgc	Protospacer
*******.*****

6. AP018796

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: AP018796_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

AP018796_1

3512152-3512424

TypeI-E

I-E

Consensus_repeat	Method
CGGTTTATCCCCGCTGGCGCGGGGAACAC	PILER-CR
CGGTTTATCCCCGCTGGCGCGGGGAACAC	CRISPRCasFinder
CGGTTTATCCCCGCTGGCGCGGGGAACAC	CRT

4 spacers

cas2,cas1,cas6e,cas5,cas7,cse2gr11,cas8e,cas3

The CRISPR arrays of AP018796_1

>merge|AP018796|1|3512152-3512424|PILER-CR,CRISPRCasFinder,CRT
CGGTTTATCCCCGCTGACGCGGGGAACACAAAACCAAACTTCTCCATAAATTCCATAGCCGCGGTTTATCCCCGCTGGCGCGGGGAACACGAGAGTGCTGACAGGTGTCTCGATTACCTGATCGGTTTATCCCCGCTGGCGCGGGGAACACGAACGCAATATCACGGCGTTCTGCGGCCTCGGCGGTTTATCCCCGCTGGCGCGGGGAACACGTCGGGCCGGGTAAGTGAACCTGTCGGTTTTCCGGTTTATCCCCGCTGGCGCGGGGAACAC

>AP018796|1|1|3512152-3512424|PILER-CR
CGGTTTATCCCCGCTGACGCGGGGAACAC	AAAACCAAACTTCTCCATAAATTCCATAGCCG
CGGTTTATCCCCGCTGGCGCGGGGAACAC	GAGAGTGCTGACAGGTGTCTCGATTACCTGAT
CGGTTTATCCCCGCTGGCGCGGGGAACAC	GAACGCAATATCACGGCGTTCTGCGGCCTCGG
CGGTTTATCCCCGCTGGCGCGGGGAACAC	GTCGGGCCGGGTAAGTGAACCTGTCGGTTTTC
CGGTTTATCCCCGCTGGCGCGGGGAACAC

>AP018796|1|1|3512152-3512424|CRISPRCasFinder
CGGTTTATCCCCGCTGACGCGGGGAACAC	AAAACCAAACTTCTCCATAAATTCCATAGCCG
CGGTTTATCCCCGCTGGCGCGGGGAACAC	GAGAGTGCTGACAGGTGTCTCGATTACCTGAT
CGGTTTATCCCCGCTGGCGCGGGGAACAC	GAACGCAATATCACGGCGTTCTGCGGCCTCGG
CGGTTTATCCCCGCTGGCGCGGGGAACAC	GTCGGGCCGGGTAAGTGAACCTGTCGGTTTTC
CGGTTTATCCCCGCTGGCGCGGGGAACAC

>AP018796|1|1|3512152-3512424|CRT
CGGTTTATCCCCGCTGACGCGGGGAACAC	AAAACCAAACTTCTCCATAAATTCCATAGCCG
CGGTTTATCCCCGCTGGCGCGGGGAACAC	GAGAGTGCTGACAGGTGTCTCGATTACCTGAT
CGGTTTATCCCCGCTGGCGCGGGGAACAC	GAACGCAATATCACGGCGTTCTGCGGCCTCGG
CGGTTTATCCCCGCTGGCGCGGGGAACAC	GTCGGGCCGGGTAAGTGAACCTGTCGGTTTTC
CGGTTTATCCCCGCTGGCGCGGGGAACAC

Protein	Signature genes	Signature genes Name	Protein_function
AP018796.1\|BBF49144.1\|3504706_3505756_-\|tRNA(Glu)-pseudouridine(13)-synthase	unknown	unknown	gnl\|CDD\|234884
AP018796.1\|BBF49147.1\|3506960_3507272_-\|cell-division-protein-FtsB	unknown	unknown	gnl\|CDD\|179156
AP018796.1\|BBF49159.1\|3516722_3518285_-\|CRISPR-associated-protein-CasA/Cse1	cas8e	cd09669_cas8e_CAS-I-E	gnl\|CDD\|274192
AP018796.1\|BBF49160.1\|3518382_3521082_-\|CRISPR-associated-helicase/endonuclease-Cas3	cas3	COG1203_cas3_CAS-I	gnl\|CDD\|224124
AP018796.1\|BBF49152.1\|3511032_3512070_+\|alkaline-phosphatase	unknown	unknown	gnl\|CDD\|182299
AP018796.1\|BBF49148.1\|3507465_3507789_-\|inner-membrane-protein	unknown	unknown	gnl\|CDD\|371891
AP018796.1\|BBF49158.1\|3516186_3516726_-\|CRISPR-associated-protein-Cse2/CasB	cse2gr11	cd09731_cse2gr11_CAS-I-E	gnl\|CDD\|187862
AP018796.1\|BBF49151.1\|3509872_3510781_-\|sulfate-adenylyltransferase-subunit-2	unknown	unknown	gnl\|CDD\|235375
AP018796.1\|BBF49153.1\|3512520_3512814_-\|CRISPR-adaptation-ssRNA-endonuclease	cas2	cd09648_cas2_CAS-I-E	gnl\|CDD\|236930
AP018796.1\|BBF49145.1\|3505752_3506232_-\|2C-methyl-D-erythritol-2,4-cyclodiphosphate-synthase	unknown	unknown	gnl\|CDD\|178851
AP018796.1\|BBF49156.1\|3514362_3515109_-\|CRISPR-associated-protein-Cas5/CasD	cas5	cd09645_cas5_CAS-I-E	gnl\|CDD\|187776
AP018796.1\|BBF49157.1\|3515119_3516175_-\|CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	cd09646_cas7_CAS-I-E	gnl\|CDD\|273843
AP018796.1\|BBF49149.1\|3507838_3508444_-\|adenosine-5'-phosphosulfate-kinase	unknown	unknown	gnl\|CDD\|179661
AP018796.1\|BBF49146.1\|3506231_3506942_-\|4-diphosphocytidyl-2C-methyl-D-erythritol-synthase	unknown	unknown	gnl\|CDD\|234670
AP018796.1\|BBF49162.1\|3521692_3522427_-\|3'-phosphoadenosine-5'-phosphosulfate-reductase	unknown	unknown	gnl\|CDD\|234997
AP018796.1\|BBF49143.1\|3503964_3504726_-\|broad-specificity-5'(3')-nucleotidase-and-polyphosphatase	unknown	unknown	gnl\|CDD\|234732
AP018796.1\|BBF49150.1\|3508443_3509871_-\|sulfate-adenylyltransferase-subunit-1	unknown	unknown	gnl\|CDD\|235349
AP018796.1\|BBF49155.1\|3513730_3514381_-\|CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	cd09664_cas6e_CAS-I-E	gnl\|CDD\|273869
AP018796.1\|BBF49161.1\|3521275_3521428_-\|Hok/gef-family-protein	unknown	unknown	gnl\|CDD\|366840
AP018796.1\|BBF49154.1\|3512813_3513734_-\|CRISPR-associated-protein-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693

Protein	Function_ID	Function_description	E-value
AP018796.1\|BBF49144.1\|3504706_3505756_-\|tRNA(Glu)-pseudouridine(13)-synthase	gnl\|CDD\|234884	PRK00984, truD, tRNA pseudouridine synthase D; Reviewed.	0
AP018796.1\|BBF49147.1\|3506960_3507272_-\|cell-division-protein-FtsB	gnl\|CDD\|179156	PRK00888, ftsB, cell division protein FtsB; Reviewed.	5.55235e-62
AP018796.1\|BBF49159.1\|3516722_3518285_-\|CRISPR-associated-protein-CasA/Cse1	gnl\|CDD\|274192	TIGR02547, CRISPR_system_Cascade_subunit_CasA, CRISPR type I-E/ECOLI-associated protein CasA/Cse1. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This model family, represented by CT1972 from Chlorobium tepidum, is found in Ecoli subtype CRISPR/Cas regions of many bacteria, most of which are mesophiles, and not in Archaea. It is designated Cse1.	0
AP018796.1\|BBF49160.1\|3518382_3521082_-\|CRISPR-associated-helicase/endonuclease-Cas3	gnl\|CDD\|224124	COG1203, COG1203, CRISPR-associated helicase Cas3 [Defense mechanisms].	6.73288e-179
AP018796.1\|BBF49152.1\|3511032_3512070_+\|alkaline-phosphatase	gnl\|CDD\|182299	PRK10199, PRK10199, alkaline phosphatase isozyme conversion aminopeptidase; Provisional.	0
AP018796.1\|BBF49148.1\|3507465_3507789_-\|inner-membrane-protein	gnl\|CDD\|371891	pfam12084, DUF3561, Protein of unknown function (DUF3561). This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are about 110 amino acids in length.	1.22003e-52
AP018796.1\|BBF49158.1\|3516186_3516726_-\|CRISPR-associated-protein-Cse2/CasB	gnl\|CDD\|187862	cd09731, Cse2_I-E, CRISPR/Cas system-associated protein Cse2. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Small alpha-helical protein; also known as Cse2/CasB/YgcK family; specific gene for I-E subtype;.	7.30002e-26
AP018796.1\|BBF49151.1\|3509872_3510781_-\|sulfate-adenylyltransferase-subunit-2	gnl\|CDD\|235375	PRK05253, PRK05253, sulfate adenylyltransferase subunit CysD.	0
AP018796.1\|BBF49153.1\|3512520_3512814_-\|CRISPR-adaptation-ssRNA-endonuclease	gnl\|CDD\|236930	PRK11558, PRK11558, putative ssRNA endonuclease; Provisional.	2.35543e-65
AP018796.1\|BBF49145.1\|3505752_3506232_-\|2C-methyl-D-erythritol-2,4-cyclodiphosphate-synthase	gnl\|CDD\|178851	PRK00084, ispF, 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase; Reviewed.	1.56248e-104
AP018796.1\|BBF49156.1\|3514362_3515109_-\|CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|187776	cd09645, Cas5_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas5. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas5 is a RAMP superfamily protein; Subunit of the Cascade complex.	3.02728e-49
AP018796.1\|BBF49157.1\|3515119_3516175_-\|CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|273843	TIGR01869, CRISPR_system_Cascade_subunit_CasC, CRISPR-associated protein Cas7/Cse4/CasC, subtype I-E/ECOLI. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum and is part of the Ecoli subtype of CRISPR/Cas locis. It is designated Cse4, for CRISPR/Cas Subtype Ecoli protein 4.	6.10696e-155
AP018796.1\|BBF49149.1\|3507838_3508444_-\|adenosine-5'-phosphosulfate-kinase	gnl\|CDD\|179661	PRK03846, PRK03846, adenylylsulfate kinase; Provisional.	7.34447e-148
AP018796.1\|BBF49146.1\|3506231_3506942_-\|4-diphosphocytidyl-2C-methyl-D-erythritol-synthase	gnl\|CDD\|234670	PRK00155, ispD, D-ribitol-5-phosphate cytidylyltransferase.	3.26939e-121
AP018796.1\|BBF49162.1\|3521692_3522427_-\|3'-phosphoadenosine-5'-phosphosulfate-reductase	gnl\|CDD\|234997	PRK02090, PRK02090, phosphoadenylyl-sulfate reductase.	7.99311e-138
AP018796.1\|BBF49143.1\|3503964_3504726_-\|broad-specificity-5'(3')-nucleotidase-and-polyphosphatase	gnl\|CDD\|234732	PRK00346, surE, 5'(3')-nucleotidase/polyphosphatase; Provisional.	1.92279e-150
AP018796.1\|BBF49150.1\|3508443_3509871_-\|sulfate-adenylyltransferase-subunit-1	gnl\|CDD\|235349	PRK05124, cysN, sulfate adenylyltransferase subunit 1; Provisional.	0
AP018796.1\|BBF49155.1\|3513730_3514381_-\|CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|273869	TIGR01907, CRISPR_system_Cascade_subunit_CasE, CRISPR-associated protein Cas6/Cse3/CasE, subtype I-E/ECOLI. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This model family, represented by CT1974 from Chlorobium tepidum, is found in the Ecoli subtype of CRISPR/Cas regions and is designated Cse3 (CRISPR/Cas Subtype Ecoli protein 3). The representative of this family from Thermus thermophilus HB8 (TTHB192) has been crystallized and found to have a structure consisting of two domains with opposing parallel beta-sheets known as a beta-sheet platform. This structure is similar to those found in the Sex-lethal protein and poly(A)-binding protein. This structure is consistent with an RNA-binding function.	7.04911e-92
AP018796.1\|BBF49161.1\|3521275_3521428_-\|Hok/gef-family-protein	gnl\|CDD\|366840	pfam01848, HOK_GEF, Hok/gef family.	8.32243e-12
AP018796.1\|BBF49154.1\|3512813_3513734_-\|CRISPR-associated-protein-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	4.23259e-157

>AP018796.1|BBF49152.1|3511032_3512070_+|alkaline-phosphatase
MFSALRHRTAALALGVCFILPVHASSPKPGDFANTQARHIATFFPGRMTGTPAEMLSADYIRQQFQQMGYRSDIRTFNSRYIYTARDNRKSWHNVTGSTVIAAHEGKAPQQIIIMAHLDTYAPLSDADADANLGGLTLQGMDDNAAGLGVMLELAERLKNTPTEYGIRFVATSGEEEGKLGAENLLKRMSDTEKKNTLLVINLDNLIVGDKLYFNSGVKTPEAVRKLTRDRALAIARSHGIAATTNPGLNKNYPKGTGCCNDAEIFDKAGIAVLSVEATNWNLGNKDGYQQRAKTPAFPAGNSWHDVRLDNQQHIDKALPGRIERRCRDVMRIMLPLVKELAKAS
>AP018796.1|BBF49151.1|3509872_3510781_-|sulfate-adenylyltransferase-subunit-2
MDQIRLTHLRQLEAESIHIIREVAAEFSNPVMLYSIGKDSSVMLHLARKAFYPGTLPFPLLHVDTGWKFREMYEFRDRTAKAYGCELLVHKNPEGVAMGINPFVHGSAKHTDIMKTEGLKQALNKYGFDAAFGGARRDEEKSRAKERIYSFRDRFHRWDPKNQRPELWHNYNGQINKGESIRVFPLSNWTEQDIWQYIWLENIDIVPLYLAAERPVLERDGMLMMIDDNRIDLQPGEVIKKRMVRFRTLGCWPLTGAVESNAQTLPEIIEEMLVSTTSERQGRVIDRDQAGSMELKKRQGYF
>AP018796.1|BBF49150.1|3508443_3509871_-|sulfate-adenylyltransferase-subunit-1
MNTALAQQIANEGGVEAWMIAQQHKSLLRFLTSGSVDDGKSTLIGRLLHDTRQIYEDQLSSLHNDSKRHGTQGEKLDLALLVDGLQAEREQGITIDVAYRYFSTEKRKFIIADTPGHEQYTRNMATGASTCELAILLIDARKGVLDQTRRHSFISTLLGIKHLVVAINKMDLVDYSEETFTRIREDYLTFAGQLPGNLDIRFVPLSALEGDNVASQSESMPWYSGPTLLEVLETVEIQRVVDAQPMRFPVQYVNRPNLDFRGYAGTLASGRVEVGQRVKVLPSGVESNVARIVTFDGDREEAFAGEAITLVLTDEIDISRGDLLLAADEALPAVQSASVDVVWMAEQPLSPGQSYDIKIAGKKTRARVDGIRYQVDINNLTQREVENLPLNGIGLVDLTFDEPLVLDRYQQNPVTGGLIFIDRLSNVTVGAGMVHEPVSQATAAPSEFSAFELELNALVRRHFPHWGARDLLGDK
>AP018796.1|BBF49149.1|3507838_3508444_-|adenosine-5'-phosphosulfate-kinase
MALHDENVVWHSHPVTVQQRELHHGHRGVVLWFTGLSGSGKSTVAGALEEALHKLGVSTYLLDGDNVRHGLCSDLGFSDADRKENIRRVGEVANLMVEAGLVVLTAFISPHRAERQMVRERVGEGRFIEVFVDTPLAICEARDPKGLYKKARAGELRNFTGIDSVYEAPESAEIHLNGEQLVTNLVQQLLDLLRQNDIIRS
>AP018796.1|BBF49148.1|3507465_3507789_-|inner-membrane-protein
MRNSHNITLTNNDSLTEDEETTWSLPGAVVGFISWLFALAMPMLIYGSNTLFFFIYTWPFFLALMPVAVVVGIALHSLMDGKLRYSIVFTLVTVGIMFGALFMWLLG
>AP018796.1|BBF49147.1|3506960_3507272_-|cell-division-protein-FtsB
MGKLTLLLLAILVWLQYSLWFGKNGIHDYTRVNDDVAAQQATNAKLKARNDQLFAEIDDLNGGQEALEERARNELSMTRPGETFYRLVPDASKRAQSAGQNNR
>AP018796.1|BBF49146.1|3506231_3506942_-|4-diphosphocytidyl-2C-methyl-D-erythritol-synthase
MATTHLDVCAVVPAAGFGRRMQTECPKQYLSIGNQTILEHSVHALLAHPRVKRVVIAISPGDSRFAQLPLANHPQITVVDGGDERADSVLAGLKAAGDAQWVLVHDAARPCLHQDDLARLLALSETSRTGGILAAPVRDTMKRAEPGKNAIAHTVDRNGLWHALTPQFFPRELLHDCLTRALNEGATITDEASALEYCGFHPQLVEGRADNIKVTRPEDLALAEFYLTRTIHQENT
>AP018796.1|BBF49145.1|3505752_3506232_-|2C-methyl-D-erythritol-2,4-cyclodiphosphate-synthase
MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIKATK
>AP018796.1|BBF49144.1|3504706_3505756_-|tRNA(Glu)-pseudouridine(13)-synthase
MIEFDNLTYLHGKPQGTGLLKANPEDFVVVEDLGFEPDGEGEYILVRILKNGCNTRFVADALAKFLKIHAREVSFAGQKDKHAVTEQWLCARVPGKEMPDLSAFQLEGCQVLEYARHKRKLRLGALKGNAFTLVLREVSNRDDVEQRLNDICVKGVPNYFGAQRFGIGGSNLQGAQRWAQTNTPVRDRNKRSFWLSAARSALFNQIVAERLKKADVNQVVDGDALQLAGRGSWFVATTEELAELQRRVNDKELMITAALPGSGEWGTQREALAFEQAAVAAETELQALLVREKVEAARRAMLLYPQQLSWNWWDDVTVEIRFWLPAGSFATSVVRELINTTGDYAHIAE
>AP018796.1|BBF49143.1|3503964_3504726_-|broad-specificity-5'(3')-nucleotidase-and-polyphosphatase
MRILLSNDDGVHAPGIQTLAKALREFADVQVVAPDRNRSGASNSLTLESSLRTFTFENGDIAVQMGTPTDCVYLGVNALMRPRPDIVVSGINAGPNLGDDVIYSGTVAAAMEGRHLGFPALAVSLDGHKHYDTAAAVTCSILRALCKEPLRTGRILNINVPDLPLDQIKGIRVTRCGTRHPADQVIPQQDPRGNTLYWIGPPGGKCDAGPGTDFAAVDEGYVSITPLHVDLTAHSAQDVVSDWLNSVGVGTQW
>AP018796.1|BBF49153.1|3512520_3512814_-|CRISPR-adaptation-ssRNA-endonuclease
MSMVVVVTENVPPRLRGRLAIWLLEVRAGVYVGDTSKRIREMIWQQITQLAGCGNVVMAWATNTESGFEFQTWGENRRIPVDLDGLRLVSFLPVDNQ
>AP018796.1|BBF49154.1|3512813_3513734_-|CRISPR-associated-protein-Cas1
MTFVPLSPIPLKDRTSMIFLQYGQIDVLDGAFVLIDKTGIRTHIPVGSVACIMLEPGTRVSHAAVHLAATVGTLLVWVGEAGVRVYSSGQPGGARADKLLYQAKLALTEDLRLKVVRKMYELRFREPQPARRSVEQLRGIEGSRVRQTYALLAKQYGVKWNGRKYDPKDWEKGDVVNRCISAATSCLYGISEAAVLAAGYAPAIGFIHSGKPLSFVYDIADIIKFDSVVPKAFEIAARQPAEPDKEVRLACRDIFRSTKLTGKLIPLIEEVLAAGEIEPPQPAPDMLPPAIPEPETLGDSGHRGRG
>AP018796.1|BBF49155.1|3513730_3514381_-|CRISPR-associated-protein-Cas6/Cse3/CasE
MYLSRITLHTGQLSPAQLLHLVDRGEYVMHQWLWDLFPGGKERQFLYRREELQGAFRFFVLSQERPAESDTFTIECRSFAPELCTGQQLCFNLRANPTICKAGKRHDLLMEAKRQVRGQAEGSDVWLHQQQAALDWLAAQGERSGFTLLDTSVDAYRQQQLRRENSRQLIQFSSVDYTGMLTVTDPGLFVQRLSQGYGKSRAFGCGLMLIKPGAEA
>AP018796.1|BBF49156.1|3514362_3515109_-|CRISPR-associated-protein-Cas5/CasD
MSQYLIFQLHGPMASWGGDAPGEVRHTHELPSRSALLGLLAAGVGIRRDDTERLNAFNRHYSLVVCASRNPRWARDYHTVQMPKEVRKARYFSRREELSDPELLSAIISRRDYYTDAWWMVAVATTADAPYSLEQLQDGLRHPVFPLYLGRKSHPLALPLAPLLLEGNACDALCNAYQQYQDHFHKLKVSLPKLQDECWWEGKHDGLVASKILRRRDVPLNRQQWLFGERTVNQGAWLSKEEPCTSQE
>AP018796.1|BBF49157.1|3515119_3516175_-|CRISPR-associated-protein-Cas7/Cse4/CasC
MTTFIQLHLLTAYPAANLNRDDTGAPKTVVLGGATRLRVSSQSLKRAWRTSALFEQALAGHIGIRSGRIAREAATILIEKGIEDKKAIEWSAKIADYLGKAKNDKKPKDPLTNAETEQLVHISPAEFDAVKALAHQLAEEKRAPKEEDLALLRKDRMAVDIAMFGRMLANKPEFNVEAACQVAHAFGVSETIVEDDFFTAVDDLRQASEDAGAGHLGETGFGSALFYTYICIDKDLLVENLGGDEALANQTIRAFTEAALKVSPTGKQNSFASRAYASWALAEKGTDQPRSLAAAFYEPINGTRQLDVAVQRITTLRENMNTVYEQKTECASFDVMNKQGSMKDVLDFICA
>AP018796.1|BBF49158.1|3516186_3516726_-|CRISPR-associated-protein-Cse2/CasB
MSIVKEEHKATLRKWREELQAKRGNRASLRRSTTVNDVCLSEGFRSLLMQTHTLWKIEAQEWRFTALALVAAVSANVKAIDERQPFAAQLAAVMSKGRFTRLSAVKTPDELLRQLRRAVRLLNGSVNLDSLAEGVFRWCQESDDLLNHHRRQQRPTEFIRIRWALEYYQAGDADNEQNQ
>AP018796.1|BBF49159.1|3516722_3518285_-|CRISPR-associated-protein-CasA/Cse1
MNSFSLLTTPWLPVRFKDGTTGKLAPVDLADENVVDIAAPRADLQGTAWQFLLGLLQTSFAPKNHGRWDDIWQDGLEAEKLREALLSLEHAFQFGADSPSFMQDFEALKGDKVQVASLLPEIPGAQTTKFNKDHFIKRGVTEHVCPHCSALALFSLQLNAPSGGKGYRTGLRGGGPMTTLIELQEYQGNQQTPLWRKLWPNVMPQDEADLPLPKKFDDLVFPWLGPTRTSELAGAVVTHDQVNKLQAYWGMPRRIRIDFNTTTVGNCDICGEQSDALLSLMTTKNYGANYAMWQHPLTPYRIPLKEGGEFYSVKPQPGGLIWRDWLGLIETGKSENNTELPALVVKLFNASSLKQAKVGLWGFGYDFDNMKARCWYEHHFPLLLKKKEGQIPKLRLAAQTASRILSLLRSALKEAWFSDPKGARGDFSFVDIDFWNKTQHRFLRLVRQIEEGQDADELLGKWQKEIWLFARQDFDERVFTNPYEPVDLKRVMTARKKYFTTSAEKQSAKAAREKKQEAAE
>AP018796.1|BBF49160.1|3518382_3521082_-|CRISPR-associated-helicase/endonuclease-Cas3
MRKYPLSLLKDKNIVTFFDFWGKNRRGEKDGGDDYHLLCWHSLDVAAMGYLMVKRNCFGLADYFRQLGISDKEQAAQFFAWLLCWHDIGKFARSFQQLYLPPELKIQEGARKNYEKISHSTLGYWLWNHYLSECQELLPSSSLSPRKLRRVIEMWMPVTTGHHGQPPDRMDELDNFLPEDKAAARDFLLEIKPLFPLIESPAFWDDDEGIELIKHLSWYISATVVLADWTGSSTRFFPRVAHPMDIKGYWQKTLIQAQNALTVFPLKAKVAPFNGINTLFPFIENPTPLQQKVLDLDISQQGPQLFILEDVTGAGKTEAALILAHRLIAAGKAQGLFFGLPTMATANAMYDRLVKTWLAFYSPESRPSLVLAHSARTLMDRFNESLWSGDLVGSEEPDEQTFSQGCAAWFADSNKKALLAEIGVGTLDQAMMAVMPFKHNNLRLLGLSNKILLADEIHACDAYMSCILEGLIERQARGGNSVILLSATLSQQQRDKLVAAFARGTEGQQEAPFLEKDDYPWLTHVTKSDVNSHRVATRKDVERSVSVGWLHSEQECIARIESAVSQGKCIAWIRNSVDDAIKVHRQLLARGVIPASSLSLFHSRFAFSDRQRIETETLARFGKYCSLQRASQVIVCTQVIEQSVDIDLDEMISDLAPVDLLIQRAGRLQRHIRDINGQLKRDGKDERSPPELLILAPVWDDSPGDEWFGSAMRNSAFVYPDHGRIWLTQRVLREQGAIQMPHAARLLIESVYGEDVVMPEGFARSEQEQVGKYYCDRAMAKKFVLNFRPGYAANINDYLPEKLSTRLAEESVSLWLATCIDGVVKPYATGAHAWEMSVVRVRRSWWKKHRDEFSLLEGEAFRLWCIEQRQDPEMANVILVNDDESCGYSATEGLIGKVG
>AP018796.1|BBF49161.1|3521275_3521428_-|Hok/gef-family-protein
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
>AP018796.1|BBF49162.1|3521692_3522427_-|3'-phosphoadenosine-5'-phosphosulfate-reductase
MSKLDLNALNELPKVDRILALAETNAELEKLDAEGRVAWALDNLPGEYVLSSSFGIQAAVSLHLVNQIHPDIPVILTDTGYLFPETYRFIDELTDKLKLNLKVYRATESAAWQEARYGKLWEQGVEGIEKYNDINKVEPMNRALKELNAQTWFAGLRREQSGSRANLPVLAIQRGVFKVLPIIDWDNRTIYQYLQKHGLKYHPLWDEGYLSVGDTHTTRKWEPGMSEEETRFFGLKRECGLHEG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: AP018796_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

AP018796_2

3538126-3538520

Unclear

I-E

Consensus_repeat	Method
CGGTTTATCCCCGCTGGCGCGGGGAACAC	CRISPRCasFinder
CGGTTTATCCCCGCTGGCGCGGGGAAC	CRT
CGGTTTATCCCCGCTGGCGCGGGGAACA	PILER-CR

6 spacers

The CRISPR arrays of AP018796_2

>merge|AP018796|2|3538126-3538520|CRISPRCasFinder,CRT,PILER-CR
TGGTTTATCCCCGCTGGCGCGGGGAACTCGACAGAACGGCCTCAGTAGTCTCGTCAGGCTCCGGTTTATCCCCGCTGGCGCGGGGAGCTCTACGTGAAGAATATTTGCAACACCCGCAAGAACGGTTTATCCCCGCTGGCGCGGGGAACACTCCAACCTTCCATGAGATACGCGCATTAGCGGCGGTTTATCCCCGCTGGCGCGGGGAACACCGTGACCGCCTGTACACGCTGTAATGGCTCACCGGTTTATCCCCGCTGGCGCGGGGAACACACACTATCCGGGCGGTATTACGCCCAAATATCCGGTTTATCCCCGCTGGCGCGGGGAACACCTGCCGGGTGAAACCACTCGCGGCAGATCTTGCGGTTTATCCCCGCTGGCGCGGGGAACAC

>AP018796|2|2|3538126-3538520|CRISPRCasFinder
TGGTTTATCCCCGCTGGCGCGGGGAACTC	GACAGAACGGCCTCAGTAGTCTCGTCAGGCTC
CGGTTTATCCCCGCTGGCGCGGGGAGCTC	TACGTGAAGAATATTTGCAACACCCGCAAGAA
CGGTTTATCCCCGCTGGCGCGGGGAACAC	TCCAACCTTCCATGAGATACGCGCATTAGCGG
CGGTTTATCCCCGCTGGCGCGGGGAACAC	CGTGACCGCCTGTACACGCTGTAATGGCTCAC
CGGTTTATCCCCGCTGGCGCGGGGAACAC	ACACTATCCGGGCGGTATTACGCCCAAATATC
CGGTTTATCCCCGCTGGCGCGGGGAACAC	CTGCCGGGTGAAACCACTCGCGGCAGATCTTG
CGGTTTATCCCCGCTGGCGCGGGGAACAC

>AP018796|2|2|3538126-3538518|CRT
TGGTTTATCCCCGCTGGCGCGGGGAAC	TCGACAGAACGGCCTCAGTAGTCTCGTCAGGCTC
CGGTTTATCCCCGCTGGCGCGGGGAGC	TCTACGTGAAGAATATTTGCAACACCCGCAAGAA
CGGTTTATCCCCGCTGGCGCGGGGAAC	ACTCCAACCTTCCATGAGATACGCGCATTAGCGG
CGGTTTATCCCCGCTGGCGCGGGGAAC	ACCGTGACCGCCTGTACACGCTGTAATGGCTCAC
CGGTTTATCCCCGCTGGCGCGGGGAAC	ACACACTATCCGGGCGGTATTACGCCCAAATATC
CGGTTTATCCCCGCTGGCGCGGGGAAC	ACCTGCCGGGTGAAACCACTCGCGGCAGATCTTG
CGGTTTATCCCCGCTGGCGCGGGGAAC

>AP018796|2|2|3538187-3538519|PILER-CR
CGGTTTATCCCCGCTGGCGCGGGGAGCT	CTACGTGAAGAATATTTGCAACACCCGCAAGAACGG
TTTATCCCCGCTGGCGCGGGGAACACTC	CAACCTTCCATGAGATACGCGCATTAGCGGCGG
TTTATCCCCGCTGGCGCGGGGAACACCG	TGACCGCCTGTACACGCTGTAATGGCTCACCGG
TTTATCCCCGCTGGCGCGGGGAACACAC	ACTATCCGGGCGGTATTACGCCCAAATATCCGG
TTTATCCCCGCTGGCGCGGGGAACACCT	GCCGGGTGAAACCACTCGCGGCAGATCTTGCGG
TTTATCCCCGCTGGCGCGGGGAACA

Protein	Signature genes	Signature genes Name	Protein_function
AP018796.1\|BBF49170.1\|3529889_3530669_-\|flavoprotein	unknown	unknown	gnl\|CDD\|224997
AP018796.1\|BBF49175.1\|3536008_3537487_+\|kinase	unknown	unknown	gnl\|CDD\|212662
AP018796.1\|BBF49185.1\|3547811_3548294_-\|23S-rRNA-m(5)U1939-methyltransferase	unknown	unknown	gnl\|CDD\|237291
AP018796.1\|BBF49169.1\|3529032_3529893_-\|flavoprotein	unknown	unknown	gnl\|CDD\|224936
AP018796.1\|BBF49166.1\|3526770_3528042_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|182194
AP018796.1\|BBF49171.1\|3530646_3532056_-\|MFS-sugar-transporter	unknown	unknown	gnl\|CDD\|340929
AP018796.1\|BBF49172.1\|3532077_3533532_-\|FAD-linked-oxidoreductase	unknown	unknown	gnl\|CDD\|223354
AP018796.1\|BBF49174.1\|3534705_3535983_+\|transporter	unknown	unknown	gnl\|CDD\|349949
AP018796.1\|BBF49176.1\|3538859_3539531_-\|7-carboxy-7-deazaguanine-synthase	unknown	unknown	gnl\|CDD\|275126
AP018796.1\|BBF49179.1\|3540755_3542054_-\|enolase	unknown	unknown	gnl\|CDD\|234617
AP018796.1\|BBF49177.1\|3539669_3539810_+\|membrane-stress-resistance-protein	unknown	unknown	unknown
AP018796.1\|BBF49181.1\|3544006_3544798_-\|nucleoside-triphosphate-pyrophosphohydrolase	unknown	unknown	gnl\|CDD\|236569
AP018796.1\|BBF49180.1\|3542141_3543779_-\|CTP-synthetase	unknown	unknown	gnl\|CDD\|235437
AP018796.1\|BBF49182.1\|3544868_3545204_-\|mRNA-interferase-toxin	unknown	unknown	gnl\|CDD\|182138
AP018796.1\|BBF49183.1\|3545203_3545452_-\|antitoxin-of-toxin-antitoxin-system	unknown	unknown	gnl\|CDD\|182082
AP018796.1\|BBF49184.1\|3545529_3547764_-\|(p)ppGpp-synthetase-RelA	unknown	unknown	gnl\|CDD\|182797
AP018796.1\|BBF49178.1\|3539823_3540696_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224429
AP018796.1\|BBF49168.1\|3528309_3528885_+\|antiterminator-regulatory-protein	unknown	unknown	gnl\|CDD\|224865
AP018796.1\|BBF49167.1\|3528032_3528293_+\|ferredoxin	unknown	unknown	gnl\|CDD\|225289
AP018796.1\|BBF49173.1\|3533601_3534387_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187605

Protein	Function_ID	Function_description	E-value
AP018796.1\|BBF49170.1\|3529889_3530669_-\|flavoprotein	gnl\|CDD\|224997	COG2086, FixA, Electron transfer flavoprotein, beta subunit [Energy production and conversion].	3.2021e-62
AP018796.1\|BBF49175.1\|3536008_3537487_+\|kinase	gnl\|CDD\|212662	cd07779, FGGY_ygcE_like, uncharacterized ygcE-like proteins. This subfamily consists of uncharacterized hypothetical bacterial proteins with similarity to Escherichia coli sugar kinase ygcE , whose functional roles are not yet clear. Escherichia coli ygcE is recognized by this model, but is not present in the alignment as it contains a deletion relative to other members of the group. These proteins belong to the FGGY family of carbohydrate kinases, the monomers of which contain two large domains, which are separated by a deep cleft that forms the active site. This model includes both the N-terminal domain, which adopts a ribonuclease H-like fold, and the structurally related C-terminal domain.	1.84635e-108
AP018796.1\|BBF49185.1\|3547811_3548294_-\|23S-rRNA-m(5)U1939-methyltransferase	gnl\|CDD\|237291	PRK13168, rumA, 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD.	4.65666e-118
AP018796.1\|BBF49169.1\|3529032_3529893_-\|flavoprotein	gnl\|CDD\|224936	COG2025, FixB, Electron transfer flavoprotein, alpha subunit [Energy production and conversion].	5.55254e-89
AP018796.1\|BBF49166.1\|3526770_3528042_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|182194	PRK10015, PRK10015, oxidoreductase; Provisional.	2.77152e-127
AP018796.1\|BBF49171.1\|3530646_3532056_-\|MFS-sugar-transporter	gnl\|CDD\|340929	cd17371, MFS_MucK, Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Acinetobacter sp. Cis,cis-muconate transport protein (MucK), Escherichia coli putative sialic acid transporter 1, and similar proteins. MucK functions in the uptake of muconate and allows Acinetobacter calcoaceticus ADP1 (BD413) to grow on exogenous cis,cis-muconate as the sole carbon source. The MucK subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	8.50431e-51
AP018796.1\|BBF49172.1\|3532077_3533532_-\|FAD-linked-oxidoreductase	gnl\|CDD\|223354	COG0277, GlcD, FAD/FMN-containing dehydrogenases [Energy production and conversion].	1.25325e-82
AP018796.1\|BBF49174.1\|3534705_3535983_+\|transporter	gnl\|CDD\|349949	cd06174, MFS, Major Facilitator Superfamily. The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.	3.54023e-29
AP018796.1\|BBF49176.1\|3538859_3539531_-\|7-carboxy-7-deazaguanine-synthase	gnl\|CDD\|275126	TIGR04322, organic_radical_activating_enzyme, putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE. Members of this radical SAM domain protein family appear to be the E. coli form of the queuosine biosynthesis protein QueE. QueE is involved in making preQ0 (7-cyano-7-deazaquanine), a precursor of both the bacterial/eukaryotic modified tRNA base queuosine and the archaeal modified base archaeosine. Members occur in species that lack known forms of QueE but usually are not found in queuosine biosynthesis operons. Members of this family tend to form bi-directional best hit matches to members of known (TIGR03365) and putative (TIGR03963) QueE families from other lineages.	3.73859e-155
AP018796.1\|BBF49179.1\|3540755_3542054_-\|enolase	gnl\|CDD\|234617	PRK00077, eno, enolase; Provisional.	0
AP018796.1\|BBF49184.1\|3545529_3547764_-\|(p)ppGpp-synthetase-RelA	gnl\|CDD\|182797	PRK10872, relA, (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional.	0
AP018796.1\|BBF49181.1\|3544006_3544798_-\|nucleoside-triphosphate-pyrophosphohydrolase	gnl\|CDD\|236569	PRK09562, mazG, nucleoside triphosphate pyrophosphohydrolase; Reviewed.	8.97718e-160
AP018796.1\|BBF49180.1\|3542141_3543779_-\|CTP-synthetase	gnl\|CDD\|235437	PRK05380, pyrG, CTP synthetase; Validated.	0
AP018796.1\|BBF49182.1\|3544868_3545204_-\|mRNA-interferase-toxin	gnl\|CDD\|182138	PRK09907, PRK09907, endoribonuclease MazF.	2.42227e-74
AP018796.1\|BBF49183.1\|3545203_3545452_-\|antitoxin-of-toxin-antitoxin-system	gnl\|CDD\|182082	PRK09798, PRK09798, MazF-MazE toxin-antitoxin system antitoxin MazE.	6.19513e-48
AP018796.1\|BBF49178.1\|3539823_3540696_+\|hypothetical-protein	gnl\|CDD\|224429	COG1512, COG1512, Beta-propeller domains of methanol dehydrogenase type [General function prediction only].	1.01855e-100
AP018796.1\|BBF49168.1\|3528309_3528885_+\|antiterminator-regulatory-protein	gnl\|CDD\|224865	COG1954, GlpP, Glycerol-3-phosphate responsive antiterminator (mRNA-binding) [Transcription].	5.83077e-88
AP018796.1\|BBF49167.1\|3528032_3528293_+\|ferredoxin	gnl\|CDD\|225289	COG2440, FixX, Ferredoxin-like protein [Energy production and conversion].	8.55479e-42
AP018796.1\|BBF49173.1\|3533601_3534387_-\|SDR-family-oxidoreductase	gnl\|CDD\|187605	cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogenase (Ga5DH)-like, classical (c) SDRs. Ga5DH catalyzes the NADP-dependent conversion of carbon source D-gluconate and 5-keto-D-gluconate. This SDR subgroup has a classical Gly-rich NAD(P)-binding motif and a conserved active site tetrad pattern. However, it has been proposed that Arg104 (Streptococcus suis Ga5DH numbering), as well as an active site Ca2+, play a critical role in catalysis. In addition to Ga5DHs this subgroup contains Erwinia chrysanthemi KduD which is involved in pectin degradation, and is a putative 2,5-diketo-3-deoxygluconate dehydrogenase. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107,15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	2.61186e-139

>AP018796.1|BBF49175.1|3536008_3537487_+|kinase
MSKKYIIGIDGGSQSTKVVMYDLEGNVVCEGKGLLQPMHTPYADTAEHPDDDLWASLCFAGHDLMSQFAGNKEDIVGIGLGSIRCCRALLKADGTPAAPLISWQDARVTRPYEHTNPDVAYVTSFSGYLTHRLTGEFKDNIANYFGQWPVDYKSWAWSEDAAVMDKFNIPRHMLFDVQMPGTVLGHITPQAALATHFPAGLPVVCTTSDKPVEALGAGLLDDETAVISLGTYIALMMNGKALPKDPVAYWPIMSSIPQTLLYEGYGIRKGMWTVSWLRDMLGESLIQDARAQDLSPEDLLNKKASSVPPGCNGLMTVLDWLTNPWEPYKRGIMIGFDSSMDYAWIYRSILESVALTLKNNYDNMCNEMNHFAKHVIITGGGSNSDLFMQIFADVFNLPARRNAINGCASLGAAINTAVGLGLYPDYATAVDKMVRVKDIFIPIESNAKRYDAMNKGIFKDLTKHTDVILKKSYEVMHGELGNVDSIQSWSNA
>AP018796.1|BBF49174.1|3534705_3535983_+|transporter
MQHNSYRRWITLAIISFSGGVSFDLAYLRYIYQIPMAKFMGFSNTEIGLIMSTFGIAAIILYAPSGVIADKFSHRKMITSAMIITGLLGLLMATYPPLWVMLCIQVAFAITTILMLWSVSIKAASLLGDHSEQGKIMGWMEGLRGVGVMSLAVFTMWVFSRFAPDDSASLKTVIIIYSVVYILLGILCWFFVSDNNNLRSANNEEKQSFQLSDILAVLRISTTWYCSMVIFGVFTIYAILSYSTNYLTEMYGMSLVAASYMGIVINKIFRALCGPLGGIITTYSKVKSPTRVIQILSVLGLLALTALLVTNSNPQSVAMGIGLILLLGFTCYASRGLYWACPGEVRTPSYIMGTTVGICSVIGFLPDVFVYPIIGHWQDTLPAAEAYRNMWLMGMAALAMVIVFTFLLFQKIRTADSAPAMASSK
>AP018796.1|BBF49173.1|3533601_3534387_-|SDR-family-oxidoreductase
MSIESLNAFSMDFFSLKGKTAIVTGGNSGLGQAFAMALAKAGANIFIPSFVKDNGETKEMIEKQGVEVDFMQVDITAEGAPQKIIAACCERFGTVDILVNNAGICKLNKVLDFGRADWDSMIDVNLTAAFELSYEAAKIMIPQKSGKIINICSLFSYLGGQWSPAYSATKHALAGFTKAYCDELGQYNIQVNGIAPGYYATDITLATRSNPETNQRVLDHIPANRWGDTQDLMGAAVFLASPASNYVNGHLLVVDGGYLVR
>AP018796.1|BBF49172.1|3532077_3533532_-|FAD-linked-oxidoreductase
MSLSRAAIVDQLKEIVGADRVITDETVLKKNSIDRFRKFPDIHGIYTLPIPAAVVKLGSTEQVSRVLNFMNAHKINGVPRTGASATEGGLETVVENSVVLDGSAMNQIINIDIENMQATAQCGVPLEVLENALREKGYTTGHSPQSKPLAQMGGLVATRSIGQFSTLYGAIEDMVVGLEAVLADGTVTRIKNVPRRAAGPDIRHIIIGNEGALCYITEVTVKIFKFTPENNLFYGYILEDMKTGFNILREVMVEGYRPSIARLYDAEDGTQHFTHFADGKCVLIFMAEGNPRIAKATGEGIAEIVARYPQCQRVDSKLIETWFNNLNWGPDKVAAERVQILKTGNMGFTTEVSGCWSCIHEIYESVINRIRTEFPHADDITMLGGHSSHSYQNGTNMYFVYDYNVVDCKPEEEIDKYHNPLNKIICEETIRLGGSMVHHHGIGKHRVHWSKLEHGSAWALLEGLKKQFDPNGIMNTGTIYPIEK
>AP018796.1|BBF49171.1|3530646_3532056_-|MFS-sugar-transporter
MTGRCLFGFSGEKPFLLPDNEGVKMNTSPVRMDDLPLNRFHCRIAALTFGAHLTDGYVLGVIGYAIIQLTPAMQLTPFMAGMIGGSALLGLFLGSLVLGWISDHIGRQKIFTFSFLLITLASFLQFFATTPEHLIGLRILIGIGLGGDYSVGHTLLAEFSPRRHRGILLGAFSVVWTVGYVLASIAGHHFISENPEAWRWLLASAALPALLITLLRWGTPESPRWLLRQGRFAEAHAIVHRYFGPHVLLGDEVVTATHKHIKTLFSSRYWRRTAFNSVFFVCLVIPWFVIYTWLPTIAQTIGLEDALTASLMLNALLIVGALLGLVLTHLLAHRKFLLGSFLLLAATLVVMACLPSGSSLTLLLFVLFSTTISAVSNLVGILPAESFPTDIRSLGVGFATAMSRLGAAVSTGLLPWVLAQWGMQVTLLLLATVLLVGFVVTWLWAPETKALPLVAAGNVGGANEHSVSV
>AP018796.1|BBF49170.1|3529889_3530669_-|flavoprotein
MNILLAFKAEPDAGMLAEKEWQAAAQGKSGPDISLLRSLLGADEQAAAALLLAQRKNGTPMSLTALSMGDERALHWLRYLMALGFEEAVLLETAADLRFAPEFVARHIAEWQHQNPLDLIITGCQSSEGQNGQTPFLLAEMLGWPCFTQVERFTLDALFITLEQRIEHGLRCCRVRLPAVIAVRQCGEVALPVPGMRQRMAAGKAEIIRKTVAAEMPAMQCLQLARAEQRRGATLIDGQTVAEKAQKLWQDYLRQRMQP
>AP018796.1|BBF49169.1|3529032_3529893_-|flavoprotein
MNIAIVTINQENAAIASWLAAQDFSGCTLAHWQIEPQPVVAEQVLDALVEQWQRTPADVVLFPPGTFGDELSTRLAWRLHGASICQVTSLDIPTVSVRKSHWGNALTATLQTEKRPLCLSLARQAGAVKNATLPSGMQQLNIVPGALPDWLVSTEDLKNVTRDPLAEARRVLVVGQGGEADNQEIAMLAEKLGAEVGYSRARVMNGGVDAEKVIGISGHLLAPEVCIVVGASGAAALMAGVRNSKFVVAINHDASAAVFSQADVGVVDDWKVVLEALVTNIHADCQ
>AP018796.1|BBF49168.1|3528309_3528885_+|antiterminator-regulatory-protein
MPLLHLLRQNPVIAAVKDNASLQLAIDSECQFISVLYGNICTISNIVKKIKNAGKYAFIHVDLLEGASNKEVVIQFLKLVTEADGIISTKASMLKAARAEGFFCIHRLFIVDSISFHNIDKQVAQSNPDCIEILPGCMPKVLGWVTEKIRQPLIAGGLVCDEEDARNAINAGVVALSTTNTGVWTLAKKLL
>AP018796.1|BBF49167.1|3528032_3528293_+|ferredoxin
MSVAHNLWRVADAPHIVPADSVERQMVQRLINACPAGLFSLTPEGDLRVDYHGCLECGTCRLLCDESTLQQWRYPPSGFGITYRFG
>AP018796.1|BBF49166.1|3526770_3528042_+|FAD-dependent-oxidoreductase
MEDDCDIIIIGAGIAGTACALRCARAGLSVLLLERAEIPGSKNLSGGRLYTHALAELLPQFHLTAPLERRITHESLSLLTPDGATTFSSLQPGGESWSVLRARFDPWLVAEAEEEGVECIPGATVDALYEENGRVCGVICGDDILRARYVVLAEGANSVLAERHGLVTRPAGEAMALGIKEVLSLEPSAIEERFHLENNEGAALLFSGRICDDLPGGAFLYTNQQTLSLGIVCPLSSLTQSRVPASELLTRFKAHPAVRPLIKNTESLEYGAHLVPEGGLHSMPVQYAGNGWLLVGDALRSCVNTGISVRGMDMALTGAQAAAQTLISACQHREPQNLFALYHHNVERSLLWDVLQRYQHVPALLQRPGWYRAWPALMQDISRDLWDQGDKPVPPLRQLFWRHLRRHGLWHLAGDVIRSLRCL
>AP018796.1|BBF49176.1|3538859_3539531_-|7-carboxy-7-deazaguanine-synthase
MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPVGCAWCDTKHTWEKLEDREVSLFSILAKTKESDKWGAASSEDLLAVIGRQGYTARHVVITGGEPCIHDLLPLTDLLEKNGFSCQIETSGTHEVRCTPNTWVTVSPKLNMRGGYDVLSQALERANEIKHPVGRVRDIEALDELLATLTDDKPRVIALQPISQKDDATRLCIETCIARNWRLSMQTHKYLNIA
>AP018796.1|BBF49177.1|3539669_3539810_+|membrane-stress-resistance-protein
MSEENKENGFNHVKTFTKIIFIFSVLVFNDDESKITDAAVNLFIQI
>AP018796.1|BBF49178.1|3539823_3540696_+|hypothetical-protein
MRYFILMFTFVCSFVAAQPTIVPQLQQQVTDLTSSLNSQEKKELTHKLESIFNNTQVQIAVLIVPTTKDETIEQYATRVFDNWRLGDAKRNDGILIIVAWSDRTVRIQVGYGLEEKVTDALAGDIIRSNMIPAFKQQKFAQGLELAINALNNQLTSQHQYPTNPSESESASSSDHYYFAIFWVFAVMFFPFWFFHQGSNFCRACKSGVYISAIYLLDLFLFSDKIFSIAVFSFFFTFTIFMVFTCLCVLQKRASGKSYHSDNSGSGGGSSGGGFSGGGGSSGGGGASGRW
>AP018796.1|BBF49179.1|3540755_3542054_-|enolase
MSKIVKIIGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTGSREALELRDGDKSRFLGKGVTKAVAAVNGPIAQALIGKDAKDQAGIDKIMIDLDGTENKSKFGANAILAVSLANAKAAAAAKGMPLYEHIAELNGTPGKYSMPVPMMNIINGGEHADNNVDIQEFMIQPVGAKTVKEAIRMGSEVFHHLAKVLKAKGMNTAVGDEGGYAPNLGSNAEALAVIAEAVKAAGYELGKDITLAMDCAASEFYKDGKYVLAGEGNKAFTSEEFTHFLEELTKQYPIVSIEDGLDESDWDGFAYQTKVLGDKIQLVGDDLFVTNTKILKEGIEKGIANSILIKFNQIGSLTETLAAIKMAKDAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRVAKYNQLIRIEEALGEKAPYNGRKEIKGQA
>AP018796.1|BBF49180.1|3542141_3543779_-|CTP-synthetase
MTTNYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAETDLDLGHYERFIRTKMSRRNNFTTGRIYSDVLRKERRGDYLGATVQVIPHITNAIKERVLEGGEGHDVVLVEIGGTVGDIESLPFLEAIRQMAVEIGREHTLFMHLTLVPYMAASGEVKTKPTQHSVKELLSIGIQPDILICRSDRAVPANERAKIALFCNVPEKAVISLKDVDSIYKIPGLLKSQGLDDYICKRFSLNCPEANLSEWEQVIFEEANPVSEVTIGMVGKYIELPDAYKSVIEALKHGGLKNRVSVNIKLIDSQDVETRGVEILKGLDAILVPGGFGYRGVEGMITTARFARENNIPYLGICLGMQVALIDYARHVANMENANSTEFVPDCKYPVVALITEWRDENGNVEVRSEKSDLGGTMRLGAQQCQLVDDSLVRQLYNAPTIVERHRHRYEVNNMLLKQIEDAGLRVAGRSGDDQLVEIIEVPNHPWFVACQFHPEFTSTPRDGHPLFAGFVKAASEFQKRQAK
>AP018796.1|BBF49181.1|3544006_3544798_-|nucleoside-triphosphate-pyrophosphohydrolase
MNQIDRLLTIMQRLRDPENGCPWDKEQTFATIAPYTLEETYEVLDAIAREDFDDLRGELGDLLFQVVFYAQMAQEEGRFDFNDICAAISDKLERRHPHVFADSSAENSSEVLARWEQIKTEERAQKAQHSALDDIPRSLPALMRAQKIQKRCANVGFDWTTLGPVVDKVYEEIDEVMYEARQAVVDQAKLEEEMGDLLFATVNLARHLGTKAEIALQKANEKFERRFREVERIVAARGLEMTGVDLETMEEVWQQVKRQEIDL
>AP018796.1|BBF49182.1|3544868_3545204_-|mRNA-interferase-toxin
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIG
>AP018796.1|BBF49183.1|3545203_3545452_-|antitoxin-of-toxin-antitoxin-system
MIHSSVKRWGNSPAVRIPATLMQALNLNIDDEVKIDLVDGKLIIEPVRKEPVFTLAELVNDITPENLHENIDWGEPKDKEVW
>AP018796.1|BBF49184.1|3545529_3547764_-|(p)ppGpp-synthetase-RelA
MVAVRSAHINKAGEFDPEKWIASLGITSQKSCECLAETWAYCLQQTQGHPDASLLLWRGVEMVEILSTLSMDIDTLRAALLFPLADANVVSEDVLRESVGKSVVNLIHGVRDMAAIRQLKATHTDSVSSEQVDNVRRMLLAMVDDFRCVVIKLAERIAHLREVKDAPEDERVLAAKECTNIYAPLANRLGIGQLKWELEDYCFRYLHPTEYKRIAKLLHERRLDREHYIEEFVGHLRAEMKAEGVKAEVYGRPKHIYSIWRKMQKKNLAFDELFDVRAVRIVAERLQDCYAALGIVHTHYRHLPDEFDDYVANPKPNGYQSIHTVVLGPGGKTVEIQIRTKQMHEDAELGVAAHWKYKEGAAAGGARSGHEDRIAWLRKLIAWQEEMADSGEMLDEVRSQVFDDRVYVFTPKGDVVDLPAGSTPLDFAYHIHSDVGHRCIGAKIGGRIVPFTYQLQMGDQIEIITQKQPNPSRDWLNPNLGYVTTSRGRSKIHAWFRKQDRDKNILAGRQILDDELEHLGISLKEAEKHLLPRYNFNDVDELLAAIGGGDIRLNQMVNFLQSQFNKPSAEEQDAAALKQLQQKSYTPQNRSKDNGRVVVEGVGNLMHHIARCCQPIPGDEIVGFITQGRGISVHRADCEQLAELRSHAPERIVDAVWGESYSAGYSLVVRVVANDRSGLLRDITTILANEKVNVLGVASRSDTKQQLATIDMTIEIYNLQVLGRVLGKLNQVPDVIDARRLHGS
>AP018796.1|BBF49185.1|3547811_3548294_-|23S-rRNA-m(5)U1939-methyltransferase
MVARALEWLDVQPEDRVLDLFCGMGNFTLPLAKQAASVVGVEGVPALVEKGQQNARLNGLQNVTFYHENLEEDVTKQPWAKNGFDKVLLDPARAGAAGVMQQIIKLEPIRIVYVSCNPATLARDSEALLKAGYTIARLAMLDMFPHTGHLESMVLFSRVK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
AP018796_1	1.1\|3512181\|32\|AP018796\|PILER-CR,CRISPRCasFinder,CRT	3512181-3512212	32	NZ_CP050442	Tolypothrix sp. PCC 7910 plasmid unnamed2, complete sequence	41503-41534	6	0.812
AP018796_2	2.1\|3538155\|32\|AP018796\|CRISPRCasFinder	3538155-3538186	32	MK814759	Gordonia phage Reyja, complete genome	4467-4498	8	0.75
AP018796_1	1.2\|3512242\|32\|AP018796\|PILER-CR,CRISPRCasFinder,CRT	3512242-3512273	32	LT599585	Pseudomonas veronii 1YdBTEX2 genome assembly, plasmid: PVE_plasmid	32377-32408	9	0.719
AP018796_1	1.3\|3512303\|32\|AP018796\|PILER-CR,CRISPRCasFinder,CRT	3512303-3512334	32	NC_010553	Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence	292180-292211	9	0.719
AP018796_1	1.3\|3512303\|32\|AP018796\|PILER-CR,CRISPRCasFinder,CRT	3512303-3512334	32	NZ_CP020740	[Pseudomonas] mesoacidophila strain ATCC 31433 plasmid pATCC31433, complete sequence	20747-20778	9	0.719

1. spacer 1.1|3512181|32|AP018796|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP050442 (Tolypothrix sp. PCC 7910 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.812

aaaaccaaacttctccataaattccatagccg	CRISPR spacer
attactaaacttctgcataaattccataggag	Protospacer
*  **.******** **************  *

2. spacer 2.1|3538155|32|AP018796|CRISPRCasFinder matches to MK814759 (Gordonia phage Reyja, complete genome) position: , mismatch: 8, identity: 0.75

-gacagaacggcctcagtagtctcgtcaggctc	CRISPR spacer
ccaccg-ctggccccagtagcctcgtcaggctt	Protospacer
  ** *  .****.******.***********.

3. spacer 1.2|3512242|32|AP018796|PILER-CR,CRISPRCasFinder,CRT matches to LT599585 (Pseudomonas veronii 1YdBTEX2 genome assembly, plasmid: PVE_plasmid) position: , mismatch: 9, identity: 0.719

gagagtgctgacaggtgtctcgattacctgat	CRISPR spacer
ggctttgctggcaggtctctcgattaccttgg	Protospacer
*.   *****.***** ************ .

4. spacer 1.3|3512303|32|AP018796|PILER-CR,CRISPRCasFinder,CRT matches to NC_010553 (Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence) position: , mismatch: 9, identity: 0.719

gaacgcaatatcacggcgttctgcggcctcgg	CRISPR spacer
atcggcaatatcacggcgtttttcggcgccgc	Protospacer
.   ****************.* **** .**

5. spacer 1.3|3512303|32|AP018796|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020740 ([Pseudomonas] mesoacidophila strain ATCC 31433 plasmid pATCC31433, complete sequence) position: , mismatch: 9, identity: 0.719

gaacgcaatatcacggcgttctgcggcctcgg	CRISPR spacer
accggcaacatcacggcgttcttcggcgccgc	Protospacer
.   ****.************* **** .**

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

326349 : 337371

Escherichia_phage(30.0%)

integrase,transposase

attL 329944:329958|attR 344479:344493

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBF45937.1\|326349_327405_-	outer membrane phosphoporin protein E	Q1MVN1	Enterobacteria_phage	9.1e-119	61.1
BBF45938.1\|327692_328796_+	gamma-glutamate kinase	A0A1X9I5D0	Streptococcus_phage	1.1e-61	40.4
BBF45939.1\|328807_330061_+	gamma-glutamyl-phosphate reductase	A0A1X9I5D4	Streptococcus_phage	1.7e-95	47.0
329944:329958	attL	NA	NA	NA	NA
BBF45940.1\|330416_331631_+\|integrase	integrase	Q7M297	Enterobacteria_phage	7.5e-133	56.5
BBF45941.1\|331773_332655_+	hypothetical protein	NA	NA	NA	NA
BBF45942.1\|332852_333050_+	putative phage protein	A0A1V0E8E5	Vibrio_phage	1.7e-07	48.1
BBF45943.1\|333049_333481_+	putative phage protein	A0A1W6JPH9	Morganella_phage	5.1e-28	49.0
BBF45944.1\|333493_334327_+	phage antirepressor	G9L6G1	Escherichia_phage	5.3e-21	47.5
BBF45945.1\|334460_334787_+\|transposase	IS629 transposase OrfA	A0A0N7BVE9	Escherichia_phage	1.3e-55	100.0
BBF45946.1\|334786_335674_+\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	1.6e-169	100.0
BBF45947.1\|336045_337371_-	pyridine nucleotide-dependent disulfide oxidoreductase of reactive chlorine stress species resistance	A0A2K5B2C5	Erysipelothrix_phage	8.5e-114	47.8
344479:344493	attR	NA	NA	NA	NA

DBSCAN-SWA_2

346832 : 472968

113

Escherichia_phage(25.71%)

holin,transposase,capsid,protease,head,tail,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBF45956.1\|346832_348866_+\|holin	choline transporter of high affinity	A0A2I7QNT1	Vibrio_phage	3.4e-21	27.4
BBF45957.1\|349438_353422_+	AidA-I family adhesin	A0A2L1IV18	Escherichia_phage	2.5e-124	38.1
BBF45958.1\|353563_354652_+	c-di-GMP-specific phosphodiesterase	NA	NA	NA	NA
BBF45959.1\|354693_355626_-	DNA-binding transcriptional regulator	NA	NA	NA	NA
BBF45960.1\|355717_356215_-	hypothetical protein	NA	NA	NA	NA
BBF45961.1\|356472_357078_+	ankyrin domain-containing protein	NA	NA	NA	NA
BBF45962.1\|357117_357981_+	hypothetical protein	NA	NA	NA	NA
BBF45963.1\|357970_359518_+	NAD(P)-binding succinyl-CoA synthase	NA	NA	NA	NA
BBF45964.1\|359517_360936_+	hypothetical protein	NA	NA	NA	NA
BBF45965.1\|361079_362030_+	carbamate kinase	NA	NA	NA	NA
BBF45966.1\|362039_363422_+	metallo-dependent hydrolase domain deaminase	NA	NA	NA	NA
BBF45967.1\|363720_364131_+	hypothetical protein	NA	NA	NA	NA
BBF45968.1\|364381_365368_+	sugar-binding protein	NA	NA	NA	NA
BBF45969.1\|365416_366901_+	ATP-binding component of sugar ABC transporter	G3M9Y6	Bacillus_virus	8.0e-12	28.7
BBF45970.1\|366893_367865_+	permease	NA	NA	NA	NA
BBF45971.1\|367861_368818_+	permease	NA	NA	NA	NA
BBF45972.1\|368904_369954_+	broad specificity NADPH-dependent aldehyde reductase	A0A2K9L339	Tupanvirus	8.3e-72	45.0
BBF45973.1\|370196_371012_+	hypothetical protein	NA	NA	NA	NA
BBF45974.1\|371685_372318_-	neutral amino-acid efflux system	NA	NA	NA	NA
BBF45975.1\|372503_372779_+	hypothetical protein	NA	NA	NA	NA
BBF45976.1\|372876_374463_-	propionate catabolism operon regulatory protein	NA	NA	NA	NA
BBF45977.1\|374701_375592_+	2-methylisocitrate lyase	NA	NA	NA	NA
BBF45978.1\|375636_376806_+	2-methylcitrate synthase	NA	NA	NA	NA
BBF45979.1\|376839_378291_+	2-methylcitrate dehydratase	NA	NA	NA	NA
BBF45980.1\|378330_380217_+	propionate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	2.4e-53	29.4
BBF45981.1\|380555_381815_+	cytosine transporter	NA	NA	NA	NA
BBF45982.1\|381804_383088_+	cytosine/isoguanine deaminase	NA	NA	NA	NA
BBF45983.1\|383127_384027_-	transcriptional activator of cyn operon	A0A2P0ZL89	Lactobacillus_phage	4.2e-16	27.3
BBF45984.1\|384136_384796_+	carbonic anhydrase	NA	NA	NA	NA
BBF45985.1\|384826_385297_+	cyanate aminohydrolase	NA	NA	NA	NA
BBF45986.1\|385302_386484_+	cyanate transporter	NA	NA	NA	NA
BBF45987.1\|386562_387816_-	lactose permease	NA	NA	NA	NA
BBF45988.1\|387867_390942_-	beta-D-galactosidase	L0N6M2	Herpes_simplex_virus	0.0e+00	98.8
BBF45989.1\|391064_392156_-	lactose operon repressor	C6ZCU4	Enterobacteria_phage	7.1e-191	98.9
BBF45990.1\|392223_393171_-	mhp operon transcriptional activator	NA	NA	NA	NA
BBF45991.1\|393247_394912_+	3-(3-hydroxyphenyl)propionate hydroxylase	NA	NA	NA	NA
BBF45992.1\|394913_395858_+	2,3-dihydroxyphenylpropionate 1,2-dioxygenase	NA	NA	NA	NA
BBF45993.1\|395875_396742_+	2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase	NA	NA	NA	NA
BBF45994.1\|396751_397561_+	2-keto-4-pentenoate hydratase	NA	NA	NA	NA
BBF45995.1\|397557_398508_+	acetaldehyde-CoA dehydrogenase II	G9E526	Ostreococcus_lucimarinus_virus	8.7e-36	35.2
BBF45996.1\|398504_399518_+	4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase	E5EQ69	Micromonas_sp._RCC1109_virus	1.2e-43	31.1
BBF45997.1\|399792_401004_+	3-hydroxyphenylpropionic transporter	NA	NA	NA	NA
BBF45998.1\|401105_401645_+	hypothetical protein	NA	NA	NA	NA
BBF45999.1\|401769_402603_-	S-formylglutathione hydrolase	NA	NA	NA	NA
BBF46000.1\|402695_403805_-	S-(hydroxymethyl)glutathione dehydrogenase	A0A0K0KVL7	Prochlorococcus_phage	1.2e-31	28.6
BBF46001.1\|403839_404115_-	regulator protein that represses frmRAB operon	NA	NA	NA	NA
BBF46002.1\|404299_405073_-	hypothetical protein	NA	NA	NA	NA
BBF46003.1\|405633_406830_-	glycosyl transferase	NA	NA	NA	NA
BBF46004.1\|406839_407511_-	PIG-L family deacetylase	NA	NA	NA	NA
BBF46005.1\|408126_409089_+	taurine ABC transporter periplasmic binding protein	NA	NA	NA	NA
BBF46006.1\|409101_409869_+	taurine ABC transporter ATPase	G9BWD6	Planktothrix_phage	8.6e-26	40.3
BBF46007.1\|409934_410693_+	taurine ABC transporter permease	NA	NA	NA	NA
BBF46008.1\|410689_411541_+	taurine dioxygenase	NA	NA	NA	NA
BBF46009.1\|411645_412620_-	5-aminolevulinate dehydratase	NA	NA	NA	NA
BBF46010.1\|413144_413858_+	flagellin structural protein	NA	NA	NA	NA
BBF46011.1\|413984_414872_-\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	1.6e-169	100.0
BBF46012.1\|414871_415198_-\|transposase	IS629 transposase OrfA	A0A0N7BVE9	Escherichia_phage	1.3e-55	100.0
BBF46013.1\|415203_417384_-\|tail	phage tail length tape measure protein	A0A2R9YJM8	Escherichia_phage	0.0e+00	90.7
BBF46014.1\|417376_417811_-\|tail	phage minor tail protein	A0A0K2FJB3	Enterobacteria_phage	6.9e-65	100.0
BBF46015.1\|417792_418215_-\|tail	phage minor tail protein	A0A0K2FIQ8	Enterobacteria_phage	3.1e-70	96.4
BBF46016.1\|418230_418971_-\|tail	phage major tail protein	A0A0K2FJ05	Enterobacteria_phage	1.0e-129	98.0
BBF46017.1\|418978_419374_-\|tail	phage minor tail protein	A0A0K2FIF4	Enterobacteria_phage	1.4e-69	98.5
BBF46018.1\|419370_419949_-\|tail	phage minor tail protein	A0A2R9YJK4	Escherichia_phage	1.3e-79	99.0
BBF46019.1\|420041_420788_-\|transposase	IS602 transposase	Q716C2	Shigella_phage	4.3e-83	59.0
BBF46020.1\|420907_421219_-\|transposase	IS602 transposase	Q716C1	Shigella_phage	2.4e-11	40.8
BBF46021.1\|421275_421575_-\|head,tail	phage head-tail adaptor protein	A0A2R9YJJ5	Escherichia_phage	8.4e-46	98.9
BBF46022.1\|421586_421982_-	phage DNA packaging protein	A0A2R9YJP4	Escherichia_phage	5.7e-58	95.5
BBF46023.1\|422023_423049_-\|capsid	phage major capsid protein	C6ZCY2	Enterobacteria_phage	3.1e-188	97.4
BBF46024.1\|423104_423437_-\|head	phage head-DNA stabilization protein	A0A2R9YJN3	Escherichia_phage	5.0e-55	99.1
BBF46025.1\|423446_423965_-\|head,protease	phage prohead protease	A0A0K2FI53	Enterobacteria_phage	1.7e-81	97.7
BBF46026.1\|424647_425280_+	response regulator	NA	NA	NA	NA
BBF46027.1\|425282_425798_-	fimbrial protein	NA	NA	NA	NA
BBF46028.1\|425842_426808_-	fimbrial-like adhesin protein	NA	NA	NA	NA
BBF46029.1\|426849_429459_-	outer membrane usher protein FimD	NA	NA	NA	NA
BBF46030.1\|429489_430182_-	periplasmic pilus chaperone	NA	NA	NA	NA
BBF46031.1\|430401_430944_-	type-1 fimbrial protein subunit A	NA	NA	NA	NA
BBF46032.1\|431424_432291_+	5,10-methylene-tetrahydrofolate dehydrogenase	A0A249XZQ2	Enterococcus_phage	1.7e-30	37.5
BBF46033.1\|432292_432505_+	ribosome-associated protein	NA	NA	NA	NA
BBF46034.1\|432612_433134_+	inner membrane protein	NA	NA	NA	NA
BBF46035.1\|433169_434555_-\|tRNA	cysteinyl-tRNA synthetase	M1PG92	Moumouvirus	3.0e-45	34.8
BBF46036.1\|434728_435223_+	peptidyl-prolyl cis-trans isomerase B	NA	NA	NA	NA
BBF46037.1\|435225_435948_+	UDP-2,3-diacylglucosamine pyrophosphohydrolase	NA	NA	NA	NA
BBF46038.1\|436065_436575_+	N5-carboxyaminoimidazole ribonucleotide mutase	NA	NA	NA	NA
BBF46039.1\|436571_437639_+	N5-carboxyaminoimidazole ribonucleotide synthase	NA	NA	NA	NA
BBF46040.1\|437775_438669_-	carbonate kinase	NA	NA	NA	NA
BBF46041.1\|438665_439481_-	anaerobic allantoin catabolic oxamate carbamoyltransferase	NA	NA	NA	NA
BBF46042.1\|439491_440751_-	hypothetical protein	NA	NA	NA	NA
BBF46043.1\|440760_442428_-	NAD(P)-binding acyl-CoA synthetase	NA	NA	NA	NA
BBF46044.1\|442744_443794_+	ureidoglycolate dehydrogenase	NA	NA	NA	NA
BBF46045.1\|443815_445051_+	allantoate amidohydrolase	NA	NA	NA	NA
BBF46046.1\|445061_445847_+	hypothetical protein	NA	NA	NA	NA
BBF46047.1\|445975_447121_-	glycerate kinase II	W6LM47	Streptococcus_phage	1.1e-48	41.9
BBF46048.1\|447142_448444_-	uracil/xanthine transporter	NA	NA	NA	NA
BBF46049.1\|448500_449862_-	allantoinase	NA	NA	NA	NA
BBF46050.1\|449921_451376_-	allantoin transporter	NA	NA	NA	NA
BBF46051.1\|451544_452423_-	tartronate semialdehyde reductase	NA	NA	NA	NA
BBF46052.1\|452522_453299_-	hydroxypyruvate isomerase	NA	NA	NA	NA
BBF46053.1\|453311_455093_-	glyoxylate carboligase	E4WLQ6	Ostreococcus_tauri_virus	7.8e-38	27.0
BBF46054.1\|455182_455998_-	glyoxylate-inducible transcriptional repressor of all and gcl operons	NA	NA	NA	NA
BBF46055.1\|456075_456558_-	ureidoglycolate hydrolase	NA	NA	NA	NA
BBF46056.1\|456787_457714_+	allD operon transcriptional activator	NA	NA	NA	NA
BBF46057.1\|457782_458877_+\|tRNA	tRNA 2-selenouridine synthase	NA	NA	NA	NA
BBF46058.1\|458992_459364_+	transcriptional regulator	A0A077SLK2	Escherichia_phage	3.1e-50	75.4
BBF46059.1\|460108_460369_-	hypothetical protein	NA	NA	NA	NA
BBF46060.1\|460791_464562_-	type IV secretion protein Rhs	A0A2H4JFP5	uncultured_Caudovirales_phage	1.9e-17	31.0
BBF46061.1\|464990_467405_-	ABC transporter permease	NA	NA	NA	NA
BBF46062.1\|467401_468088_-	ABC transporter ATPase	G9BWD6	Planktothrix_phage	2.9e-33	35.6
BBF46063.1\|468088_468682_+	acyl-CoA thioesterase I	NA	NA	NA	NA
BBF46064.1\|468671_469481_+	oxidoreductase	NA	NA	NA	NA
BBF46065.1\|469541_470396_+	thioredoxin	NA	NA	NA	NA
BBF46066.1\|470458_471241_-	iron export ABC transporter permease	NA	NA	NA	NA
BBF46067.1\|471227_471905_-	iron export ABC transporter ATPase	G3M9Y6	Bacillus_virus	3.1e-27	33.8
BBF46068.1\|472050_472968_+\|protease	protease	NA	NA	NA	NA

DBSCAN-SWA_3

480538 : 533483

Bacillus_phage(21.43%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBF46077.1\|480538_481018_+\|tRNA	Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase	NA	NA	NA	NA
BBF46078.1\|481054_482707_-	UDP-sugar hydrolase	NA	NA	NA	NA
BBF46079.1\|482924_484145_+	fosmidomycin resistance protein	NA	NA	NA	NA
BBF46080.1\|484382_486059_+	inner membrane NAD(P)-binding transporter	NA	NA	NA	NA
BBF46081.1\|486191_487496_-	inosine/guanosine kinase	NA	NA	NA	NA
BBF46082.1\|487647_488607_+	acetyl esterase	L7RDF8	Acanthamoeba_polyphaga_moumouvirus	1.1e-14	24.3
BBF46083.1\|488603_489566_-	ferrochelatase	NA	NA	NA	NA
BBF46084.1\|489801_490446_-	adenylate kinase	NA	NA	NA	NA
BBF46085.1\|490626_492501_-	heat shock protein Hsp90	A0A1B1ISV4	uncultured_Mediterranean_phage	1.0e-117	38.0
BBF46086.1\|492610_493216_-	recombination protein RecR	NA	NA	NA	NA
BBF46087.1\|493215_493545_-	hypothetical protein	NA	NA	NA	NA
BBF46088.1\|493597_495529_-	DNA polymerase III/DNA elongation factor III tau and gamma subunits DnaX	A0A1L2BWV7	Bacteriophage	5.1e-43	41.5
BBF46089.1\|495657_496209_-	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	3.7e-31	47.3
BBF46090.1\|496361_496739_-	inner membrane protein	NA	NA	NA	NA
BBF46091.1\|496808_497336_+	primosomal replication protein PriC	NA	NA	NA	NA
BBF46092.1\|497349_497511_+	hypothetical protein	NA	NA	NA	NA
BBF46093.1\|497782_498679_+\|transposase	IS621 transposase	NA	NA	NA	NA
BBF46094.1\|498648_499395_-\|transposase	IS602 transposase	Q716C2	Shigella_phage	4.3e-83	59.0
BBF46095.1\|499514_499826_-\|transposase	IS602 transposase	Q716C1	Shigella_phage	2.4e-11	40.8
BBF46096.1\|500262_503625_-	mechanosensitive channel protein	NA	NA	NA	NA
BBF46097.1\|503752_504400_-	transcriptional repressor	NA	NA	NA	NA
BBF46098.1\|504541_505735_+	multidrug efflux system	NA	NA	NA	NA
BBF46099.1\|505757_508907_+	multidrug efflux system protein	S5VTK5	Leptospira_phage	6.2e-54	23.9
BBF46100.1\|509452_509827_+	Hha toxicity attenuator TomB	NA	NA	NA	NA
BBF46101.1\|509852_510071_+	modulator of gene expression with H-NS	NA	NA	NA	NA
BBF46102.1\|510242_510794_+	maltose O-acetyltransferase	NA	NA	NA	NA
BBF46103.1\|510909_511380_+	hypothetical protein	NA	NA	NA	NA
BBF46104.1\|511543_513094_+	membrane-anchored cyclic-di-GMP phosphodiesterase	NA	NA	NA	NA
BBF46105.1\|513135_513489_-	hypothetical protein	NA	NA	NA	NA
BBF46106.1\|513867_514179_+	6-O-methylguanine DNA methyltransferase	NA	NA	NA	NA
BBF46107.1\|514209_514782_-	outer membrane lipoprotein	NA	NA	NA	NA
BBF46108.1\|514999_515860_+	acyl-CoA thioesterase 2	NA	NA	NA	NA
BBF46109.1\|515907_517194_-	ammonium transporter	NA	NA	NA	NA
BBF46110.1\|517223_517562_-	nitrogen regulatory protein P-II 2	NA	NA	NA	NA
BBF46111.1\|517742_519524_-	multidrug ABC transporter ATPase	W8CYL7	Bacillus_phage	1.4e-42	27.1
BBF46112.1\|519516_521289_-	multidrug ABC transporter ATPase	W8CYL7	Bacillus_phage	3.4e-49	30.1
BBF46113.1\|521318_521777_-	transcriptional regulator	NA	NA	NA	NA
BBF46114.1\|521929_522748_-	thiamine pyrimidine pyrophosphate hydrolase	NA	NA	NA	NA
BBF46115.1\|522847_524548_+	ABC transporter periplasmic binding protein	NA	NA	NA	NA
BBF46116.1\|524612_525308_+	7-cyano-7-deazaguanine synthase	A0A2H4J8Q7	uncultured_Caudovirales_phage	5.5e-88	67.6
BBF46117.1\|525359_525758_-	long-chain acyl-CoA thioesterase III	NA	NA	NA	NA
BBF46118.1\|525851_526223_-	competence-suppressing periplasmic helix-hairpin-helix DNA-binding protein	NA	NA	NA	NA
BBF46119.1\|526373_528245_-	peptidyl-prolyl cis-trans isomerase D	NA	NA	NA	NA
BBF46120.1\|528436_528709_-	transcriptional regulator HU subunit beta	A7KV42	Bacillus_phage	1.1e-20	58.4
BBF46121.1\|528917_531272_-\|protease	lon protease	A0A0R6PGP8	Moraxella_phage	1.6e-224	52.4
BBF46122.1\|531459_532734_-\|protease	ATP-dependent protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	8.7e-132	56.4
BBF46123.1\|532859_533483_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	2.9e-64	63.9

DBSCAN-SWA_4

832980 : 865708

Enterobacteria_phage(53.66%)

integrase,transposase,holin,protease,head,tail

attL 827573:827589|attR 857480:857496

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
827573:827589	attL	NA	NA	NA	NA
BBF46393.1\|832980_833931_-\|integrase	integrase	K7P6P6	Enterobacteria_phage	2.1e-159	99.3
BBF46394.1\|833896_834784_-\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	1.6e-169	100.0
BBF46395.1\|834783_835110_-\|transposase	IS629 transposase OrfA	A0A0N7BVE9	Escherichia_phage	1.3e-55	100.0
BBF46396.1\|835135_835309_-	phage lysozyme	A0A0N7KZA0	Stx2-converting_phage	1.2e-17	100.0
BBF46397.1\|835308_835515_-\|holin	phage holine protein	A0A0P0ZC45	Stx2-converting_phage	5.3e-31	98.5
BBF46398.1\|835962_837813_-	hypothetical protein	B6DZ89	Enterobacteria_phage	0.0e+00	95.9
BBF46399.1\|838355_839099_-	membrane protein	NA	NA	NA	NA
BBF46400.1\|839283_839973_-	phage antiterminator Q	I6PDF8	Cronobacter_phage	1.5e-58	48.1
BBF46401.1\|840449_841409_+	outer membrane protein	NA	NA	NA	NA
BBF46402.1\|841620_841809_-	phage protein NinH	A5VW84	Enterobacteria_phage	5.5e-27	100.0
BBF46403.1\|841805_842168_-	phage endonuclease RUS	A5VW85	Enterobacteria_phage	3.5e-62	98.3
BBF46404.1\|842164_842455_-	hypothetical protein	K7PK25	Enterobacteria_phage	7.1e-50	97.9
BBF46405.1\|842447_842660_-	hypothetical protein	K7PK10	Enterobacteria_phage	1.6e-35	100.0
BBF46406.1\|842652_842829_-	phage protein NinF	A0A220NRM2	Escherichia_phage	1.9e-26	100.0
BBF46407.1\|842828_843188_-	hypothetical protein	G8EYI2	Enterobacteria_phage	2.7e-62	95.0
BBF46408.1\|843190_843367_-	hypothetical protein	A5VW90	Enterobacteria_phage	4.6e-28	100.0
BBF46409.1\|843363_843774_-	recombination protein	A0A0P0ZCW6	Stx2-converting_phage	2.1e-71	98.5
BBF46410.1\|843745_844108_-	hypothetical protein	A0A2I6PIG0	Escherichia_phage	4.4e-33	67.9
BBF46411.1\|844125_844332_-	hypothetical protein	G8C7M4	Escherichia_phage	7.9e-27	98.5
BBF46412.1\|844404_844695_-	phage exclusion protein	K7PH23	Enterobacteria_phage	2.5e-50	100.0
BBF46413.1\|845071_845320_+\|tail	phage tail protein	E4WL21	Enterobacteria_phage	6.2e-18	63.2
BBF46414.1\|845309_846815_+\|head,protease	phage prohead protease	A0A2I6TC87	Escherichia_phage	1.6e-100	54.0
BBF46415.1\|846851_847199_+\|head	phage head-DNA stabilization protein	A0A2R9YJN3	Escherichia_phage	2.0e-22	58.1
BBF46416.1\|847256_848285_+\|head	phage head protein	C6ZCY2	Enterobacteria_phage	1.3e-114	61.3
BBF46417.1\|848336_848711_+	phage DNA packaging protein	NA	NA	NA	NA
BBF46418.1\|848703_849057_+\|head,tail	phage head-tail adaptor protein	A0A0K2FJB7	Enterobacteria_phage	2.5e-41	69.2
BBF46419.1\|849071_849647_+\|tail	phage minor tail protein	A0A2R9YJK4	Escherichia_phage	7.5e-51	58.7
BBF46420.1\|849643_850039_+\|tail	phage minor tail protein	A0A2R9YJI2	Escherichia_phage	4.2e-61	87.0
BBF46421.1\|850046_850799_+\|tail	phage major tail protein	Q687F6	Enterobacteria_phage	3.9e-132	97.2
BBF46422.1\|850812_851244_+\|tail	phage minor tail protein	A0A0K2FIQ8	Enterobacteria_phage	2.4e-41	67.4
BBF46423.1\|851270_851684_+\|tail	phage minor tail protein	S5MDP5	Escherichia_phage	1.6e-42	82.2
BBF46424.1\|851664_854244_+\|tail	phage tail length tape measure protein	A0A2R9YJM8	Escherichia_phage	0.0e+00	80.4
BBF46425.1\|854240_854570_+\|tail	phage minor tail protein	Q687F2	Enterobacteria_phage	4.3e-59	100.0
BBF46426.1\|854569_854917_+\|tail	phage minor tail protein	A0A0P0ZBE3	Stx2-converting_phage	2.0e-51	100.0
BBF46427.1\|854874_855267_+\|tail	phage minor tail protein	Q9EYE3	Enterobacteria_phage	4.0e-72	99.2
BBF46428.1\|855277_856021_+\|tail	phage tail assembly protein	Q9EYE4	Enterobacteria_phage	3.7e-151	100.0
BBF46429.1\|856017_856596_+\|tail	phage tail assembly protein	Q9EYE5	Enterobacteria_phage	3.4e-99	99.5
BBF46430.1\|856836_860313_+	phage host specificity protein	A0A0P0ZBW1	Stx2-converting_phage	0.0e+00	89.5
857480:857496	attR	NA	NA	NA	NA
BBF46431.1\|860380_860980_+	outer membrane precursor Lom	Q687E7	Enterobacteria_phage	1.8e-108	98.0
BBF46432.1\|861044_862358_+\|tail	phage tail fiber protein	A0A0P0ZD68	Stx2-converting_phage	9.7e-78	98.9
BBF46433.1\|862359_862629_+	hypothetical protein	Q687E5	Enterobacteria_phage	4.6e-43	96.6
BBF46434.1\|863007_863616_+	T3SS secreted effector NleH	A5LH48	Enterobacteria_phage	1.4e-95	89.6
BBF46435.1\|863930_864671_+	hypothetical protein	A5LH49	Enterobacteria_phage	2.8e-138	98.4
BBF46436.1\|865609_865708_+	T3SS secreted effector NleG	H6WZN1	Escherichia_phage	1.7e-08	93.5

DBSCAN-SWA_5

989818 : 998667

Planktothrix_phage(33.33%)

tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBF46556.1\|989818_990268_+	macrolide ABC transporter permease/ATPase	G9BWD6	Planktothrix_phage	1.6e-16	35.6
BBF46557.1\|990295_991765_+	macrolide ABC transporter permease/ATPase	G9BWD6	Planktothrix_phage	1.4e-08	47.5
BBF46558.1\|991837_992062_-	inhibitor of DNA replication cold shock protein homolog	A0A2H4N7Y6	Lake_Baikal_phage	2.3e-16	61.2
BBF46559.1\|992384_992705_+\|protease	ATP-dependent Clp protease adaptor protein ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	1.6e-13	44.4
BBF46560.1\|992735_995012_+\|protease	ATP-binding component of serine protease	A0A223W0B1	Agrobacterium_phage	1.9e-166	42.5
BBF46561.1\|995696_995915_-	translation initiation factor IF-1	NA	NA	NA	NA
BBF46562.1\|996199_996904_-\|tRNA	leucyl/phenylalanyl-tRNA-protein transferase	NA	NA	NA	NA
BBF46563.1\|996945_998667_-	glutathione ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.9e-20	25.2

DBSCAN-SWA_6

1100086 : 1231109

162

Escherichia_phage(64.41%)

integrase,terminase,transposase,holin,protease,capsid,tail,lysis,portal,tRNA

attL 1112182:1112205|attR 1173400:1173423

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBF46647.1\|1100086_1100416_-\|tRNA	mnm(5)-s(2)U34-tRNA 2-thiolation sulfurtransferase	NA	NA	NA	NA
BBF46648.1\|1100506_1101166_-	membrane protein	A0A2H4JFM9	uncultured_Caudovirales_phage	5.2e-48	54.9
BBF46649.1\|1101573_1101843_-\|integrase	integrase	A0A192Y7M7	Salmonella_phage	1.4e-20	56.1
BBF46650.1\|1101875_1102589_-\|integrase	integrase	A0A192Y7M7	Salmonella_phage	9.7e-48	47.9
BBF46651.1\|1102566_1102809_-	phage excisionase	NA	NA	NA	NA
BBF46652.1\|1102876_1103917_-	exodeoxyribonuclease VIII	K7PLW7	Enterobacteria_phage	2.1e-59	61.2
BBF46653.1\|1103971_1104859_-\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	1.6e-169	100.0
BBF46654.1\|1104858_1105185_-\|transposase	IS629 transposase OrfA	A0A0N7BVE9	Escherichia_phage	1.3e-55	100.0
BBF46655.1\|1105236_1106661_-	exonuclease family protein	NA	NA	NA	NA
BBF46656.1\|1106753_1106945_-	hypothetical protein	NA	NA	NA	NA
BBF46657.1\|1106941_1107130_-	cell division inhibition protein	NA	NA	NA	NA
BBF46658.1\|1107661_1108036_-	hypothetical protein	NA	NA	NA	NA
BBF46659.1\|1108047_1108281_-	hypothetical protein	M4QQ57	Salicola_phage	7.8e-07	53.2
BBF46660.1\|1108472_1109189_-	phage repressor protein CI	H9C160	Pectobacterium_phage	3.8e-52	42.0
BBF46661.1\|1109238_1109454_+	phage antirepressor protein Cro	NA	NA	NA	NA
BBF46662.1\|1109450_1109876_+	hypothetical protein	NA	NA	NA	NA
BBF46663.1\|1109947_1111018_+	phage replication protein	A0A088CD36	Shigella_phage	3.2e-63	65.2
BBF46664.1\|1111058_1111481_+	phage exclusion protein	A0A0U2QQN3	Escherichia_phage	1.1e-64	92.1
BBF46665.1\|1111477_1111774_+	hypothetical protein	A0A0U2SAZ1	Escherichia_phage	7.5e-47	93.7
BBF46666.1\|1111770_1112232_+	hypothetical protein	Q8VNQ2	Enterobacteria_phage	3.4e-38	92.9
1112182:1112205	attL	NA	NA	NA	NA
BBF46667.1\|1112209_1112566_+	hypothetical protein	A0A2R2Z307	Escherichia_phage	3.0e-58	98.3
BBF46668.1\|1112616_1112829_+	hypothetical protein	A0A2R2Z310	Escherichia_phage	5.8e-33	94.3
BBF46669.1\|1113080_1113344_+	hypothetical protein	A0A2P0P958	Salmonella_phage	8.8e-31	72.4
BBF46670.1\|1113354_1114224_+	putative phage protein	A0A1U9AJ59	Stx1_converting_phage	5.2e-120	76.8
BBF46671.1\|1114339_1114444_+	hypothetical protein	NA	NA	NA	NA
BBF46672.1\|1114432_1114588_-	hypothetical protein	Q7Y2Q9	Escherichia_phage	1.9e-09	83.8
BBF46673.1\|1114632_1114845_+	phage maintenance protein	A0A0U2QV81	Escherichia_phage	1.2e-25	91.4
BBF46674.1\|1115292_1116342_+	hypothetical protein	U5P0K4	Shigella_phage	3.4e-110	54.9
BBF46675.1\|1116354_1116726_+	endodeoxyribonuclease	V5URS4	Shigella_phage	1.3e-35	63.7
BBF46676.1\|1116715_1117087_+	antiterminator	Q777W5	Enterobacteria_phage	1.0e-53	84.0
BBF46677.1\|1117238_1118057_+\|protease	CAAX amino terminal protease family protein	NA	NA	NA	NA
BBF46678.1\|1118343_1118541_+	hypothetical protein	S5MQK8	Escherichia_phage	2.6e-27	96.9
BBF46679.1\|1118804_1119392_+	AraC-family transcriptional regulator	NA	NA	NA	NA
BBF46680.1\|1120159_1122010_+	hypothetical protein	B6DZ89	Enterobacteria_phage	0.0e+00	95.9
BBF46681.1\|1122457_1122664_+\|holin	phage holine protein	Q6H9V8	Enterobacteria_phage	5.3e-31	98.5
BBF46682.1\|1122746_1123634_-\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	1.6e-169	100.0
BBF46683.1\|1123633_1123960_-\|transposase	IS629 transposase OrfA	A0A0N7BVE9	Escherichia_phage	1.3e-55	100.0
BBF46684.1\|1124232_1124505_-	hypothetical protein	NA	NA	NA	NA
BBF46685.1\|1124664_1125198_+	phage endolysin	A0A1U9AJ98	Stx1_converting_phage	3.1e-99	94.4
BBF46686.1\|1125418_1125532_+	putative phage protein	A0A2L1IV24	Escherichia_phage	5.6e-11	97.3
BBF46687.1\|1125533_1126001_+	phage endopeptidase	Q7AYI6	Enterobacteria_phage	2.2e-72	93.5
BBF46688.1\|1126465_1126780_+	PchABC family transcriptional regulator	NA	NA	NA	NA
BBF46689.1\|1127135_1128023_-\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	1.6e-169	100.0
BBF46690.1\|1128022_1128349_-\|transposase	IS629 transposase OrfA	A0A0N7BVE9	Escherichia_phage	1.3e-55	100.0
BBF46691.1\|1128435_1129329_-	T3SS secreted effector TccP2	NA	NA	NA	NA
BBF46692.1\|1129774_1130158_-	hypothetical protein	Q6H9S1	Enterobacteria_phage	4.4e-55	84.3
BBF46693.1\|1130775_1131894_+	hydrogenase 1 small subunit	NA	NA	NA	NA
BBF46694.1\|1131890_1133684_+	hydrogenase 1 large subunit	NA	NA	NA	NA
BBF46695.1\|1133702_1134410_+	hydrogenase 1 b-type cytochrome subunit	NA	NA	NA	NA
BBF46696.1\|1134406_1134994_+\|protease	hydrogenase 1 maturation protease	NA	NA	NA	NA
BBF46697.1\|1134990_1135389_+	hydrogenase-1 operon protein HyaE	NA	NA	NA	NA
BBF46698.1\|1135385_1136243_+	hydrogenase-1 protein nickel incorporation factor	NA	NA	NA	NA
BBF46699.1\|1136376_1137921_+	cytochrome d terminal oxidase subunit I	NA	NA	NA	NA
BBF46700.1\|1137932_1139069_+	cytochrome bd-II oxidase subunit II	NA	NA	NA	NA
BBF46701.1\|1139081_1139174_+	cytochrome bd-II oxidase subunit	NA	NA	NA	NA
BBF46702.1\|1139253_1140552_+	phosphoanhydride phosphorylase	NA	NA	NA	NA
BBF46703.1\|1140666_1142847_-	colanic acid production tyrosine-protein kinase	NA	NA	NA	NA
BBF46704.1\|1142866_1143313_-	O-antigen capsule forming protein-tyrosine-phosphatase	NA	NA	NA	NA
BBF46705.1\|1143300_1144440_-	O-antigen capsule outer membrane auxiliary protein export channel	NA	NA	NA	NA
BBF46706.1\|1144485_1146582_-	O-antigen capsule production periplasmic protein	NA	NA	NA	NA
BBF46707.1\|1146581_1147328_-	O-antigen capsule production periplasmic protein	NA	NA	NA	NA
BBF46708.1\|1147324_1147969_-	O-antigen capsule production lipoprotein	NA	NA	NA	NA
BBF46709.1\|1148075_1148381_-	O-antigen capsule production threonine-rich inner membrane protein	NA	NA	NA	NA
BBF46710.1\|1149320_1149533_+	cold-shock protein	A0A1W6JNX5	Morganella_phage	7.8e-22	71.4
BBF46711.1\|1149926_1150100_+	hypothetical protein	NA	NA	NA	NA
BBF46712.1\|1150147_1151221_-	electron transporter	NA	NA	NA	NA
BBF46713.1\|1151292_1153992_-	hybrid sensory histidine kinase in two-component regulatory system with TorR	A0A1V0SGX0	Hokovirus	1.0e-36	31.9
BBF46714.1\|1154119_1155148_+	periplasmic sensory protein associated with the TorRS two-component regulatory system	NA	NA	NA	NA
BBF46715.1\|1155120_1155813_-	two-component regulatory system response regulator TorR	W8CYM9	Bacillus_phage	4.5e-18	28.0
BBF46716.1\|1155942_1157115_+	trimethylamine N-oxidoreductase I cytochrome c-type subunit	NA	NA	NA	NA
BBF46717.1\|1157114_1159661_+	biotin sulfoxide reductase	A0A077SK27	Escherichia_phage	1.0e-70	29.2
BBF46718.1\|1159657_1160257_+	TorA-maturation chaperone	NA	NA	NA	NA
BBF46719.1\|1160349_1160655_-	modulator of CbpA co-chaperone	NA	NA	NA	NA
BBF46720.1\|1160654_1161575_-	DNA-binding protein	A0A1V0SIM1	Klosneuvirus	3.2e-11	43.0
BBF46721.1\|1161834_1163094_+	hypothetical protein	NA	NA	NA	NA
BBF46722.1\|1163385_1164627_+	glucose-1-phosphatase	NA	NA	NA	NA
BBF46723.1\|1164664_1164892_-	hypothetical protein	NA	NA	NA	NA
BBF46724.1\|1164912_1165491_-	NAD(P)H:quinone oxidoreductase	NA	NA	NA	NA
BBF46725.1\|1165487_1166798_-\|integrase	integrase	A0A0P0ZGT7	Escherichia_phage	2.4e-254	100.0
BBF46726.1\|1166850_1167135_-	phage excisionase	G9L654	Escherichia_phage	9.1e-50	100.0
BBF46727.1\|1167180_1167432_-	hypothetical protein	G3CFG8	Escherichia_phage	2.9e-39	100.0
BBF46728.1\|1167419_1167653_-	hypothetical protein	G3CFG9	Escherichia_phage	3.1e-35	98.7
BBF46729.1\|1167796_1168186_-	hypothetical protein	A0A0H4J3B1	Shigella_phage	2.1e-52	100.0
BBF46730.1\|1168221_1168434_-	hypothetical protein	A0A0P0ZGA1	Escherichia_phage	7.1e-31	100.0
BBF46731.1\|1168393_1169020_-	adenine methylase	G9L6F9	Escherichia_phage	1.8e-122	100.0
BBF46732.1\|1169016_1169448_-	regulatory protein	A0A2R2Z303	Escherichia_phage	7.3e-75	100.0
BBF46733.1\|1169503_1170133_-	antirepressor	G9L6G1	Escherichia_phage	2.3e-117	100.0
BBF46734.1\|1170382_1170667_-	phage antirepressor	G9L6G2	Escherichia_phage	4.1e-50	100.0
BBF46735.1\|1171022_1171952_-	hypothetical protein	A0A0H4IU61	Shigella_phage	5.1e-182	100.0
BBF46736.1\|1171948_1172464_-	hypothetical protein	G9L6B3	Escherichia_phage	2.4e-101	100.0
BBF46737.1\|1172465_1172654_-	hypothetical protein	A0A1I9LJM4	Stx_converting_phage	1.4e-30	98.4
BBF46738.1\|1172650_1172827_-	hypothetical protein	A0A0F6TJP6	Escherichia_coli_O157_typing_phage	3.9e-19	84.5
BBF46739.1\|1172826_1173189_-	putative phage protein	A0A1B0V865	Salmonella_phage	8.9e-58	97.4
BBF46740.1\|1173185_1173395_-	hypothetical protein	A0A0F6TJE4	Escherichia_coli_O157_typing_phage	2.0e-33	92.8
BBF46741.1\|1173396_1174290_-	hypothetical protein	A0A0N7BYR8	Escherichia_phage	1.4e-165	93.0
1173400:1173423	attR	NA	NA	NA	NA
BBF46742.1\|1174286_1174526_-	hypothetical protein	A0A2R2Z309	Escherichia_phage	6.7e-38	97.5
BBF46743.1\|1174518_1174722_-	hypothetical protein	A0A2R2Z313	Escherichia_phage	4.7e-32	100.0
BBF46744.1\|1174718_1175597_-	hypothetical protein	A0A2R2Z314	Escherichia_phage	1.0e-179	100.0
BBF46745.1\|1175704_1176148_-	hypothetical protein	A0A2R2Z306	Escherichia_phage	1.7e-79	100.0
BBF46746.1\|1176224_1177046_-	hypothetical protein	A0A2R2Z323	Escherichia_phage	2.3e-149	100.0
BBF46747.1\|1177109_1177457_-	hypothetical protein	A0A2R2X2A9	Escherichia_phage	5.9e-59	100.0
BBF46748.1\|1177532_1178120_-	hypothetical protein	A0A2R2Z318	Escherichia_phage	4.0e-108	100.0
BBF46749.1\|1178119_1178809_-	exonuclease	A0A2R2Z325	Escherichia_phage	2.7e-135	100.0
BBF46750.1\|1178805_1179756_-	phage DNA recombination protein Bet	A0A0P0ZFY9	Escherichia_phage	3.2e-179	99.7
BBF46751.1\|1179773_1180055_-	hypothetical protein	A0A0P0ZFG3	Escherichia_phage	1.1e-47	100.0
BBF46752.1\|1180075_1180357_-	AbrB family transcriptional regulator	A0A0P0ZGC3	Escherichia_phage	3.0e-45	100.0
BBF46753.1\|1180368_1180581_-	phage cell division inhibitor protein	A0A2R2Z321	Escherichia_phage	2.2e-32	98.6
BBF46754.1\|1180651_1181326_-	hypothetical protein	A0A0P0ZGP9	Escherichia_phage	1.3e-123	100.0
BBF46755.1\|1181582_1182230_-	hypothetical protein	A0A0H4IQ68	Shigella_phage	1.9e-119	99.5
BBF46756.1\|1182985_1183366_-	hypothetical protein	NA	NA	NA	NA
BBF46757.1\|1183365_1183836_-	hypothetical protein	D0UIM3	Aggregatibacter_phage	5.4e-23	41.6
BBF46758.1\|1184016_1184970_-	type II site-specific deoxyribonuclease	A0A0P0ZG22	Escherichia_phage	3.6e-183	97.8
BBF46759.1\|1184966_1186436_-	modification methyltransferase	A0A2R2Z316	Escherichia_phage	2.7e-278	97.1
BBF46760.1\|1186531_1187251_-	phage repressor protein CI	A0A2R2X2B0	Escherichia_phage	3.1e-86	68.6
BBF46761.1\|1187356_1187596_+	hypothetical protein	NA	NA	NA	NA
BBF46762.1\|1187636_1187900_+	hypothetical protein	A0A0N7BYT1	Escherichia_phage	2.9e-42	98.8
BBF46763.1\|1188121_1188508_+	hypothetical protein	A0A286S263	Klebsiella_phage	2.6e-23	44.8
BBF46764.1\|1188501_1190022_+	helicase	A0A0N7KZV6	Escherichia_phage	8.6e-304	98.8
BBF46765.1\|1190011_1190983_+	DNA primase	A0A0H4IPK0	Shigella_phage	9.4e-195	99.7
BBF46766.1\|1190982_1191432_+	hypothetical protein	A0A0P0ZFW0	Escherichia_phage	7.6e-83	100.0
BBF46767.1\|1191439_1192003_+	recombination endonuclease	A0A0P0ZG59	Escherichia_phage	1.3e-103	98.4
BBF46768.1\|1191999_1192194_+	hypothetical protein	G9L694	Escherichia_phage	1.9e-30	100.0
BBF46769.1\|1192186_1192621_+	antiterminator	G9L695	Escherichia_phage	2.8e-82	100.0
BBF46770.1\|1193842_1195780_+	hypothetical protein	A0A1I9LJQ8	Stx_converting_phage	0.0e+00	99.7
BBF46771.1\|1195917_1196097_+	hypothetical protein	A0A2R2Z345	Escherichia_phage	2.2e-25	100.0
BBF46772.1\|1196137_1196383_+	hypothetical protein	A0A088CE63	Shigella_phage	3.2e-19	98.8
BBF46773.1\|1196460_1196676_+\|lysis	phage lysis protein	A0A2R2Z340	Escherichia_phage	1.2e-33	100.0
BBF46774.1\|1196680_1197214_+	phage endolysin	A0A2R2Z343	Escherichia_phage	5.1e-102	99.4
BBF46775.1\|1197488_1198058_+	phage antirepressor	A0A2R2Z339	Escherichia_phage	1.8e-105	100.0
BBF46776.1\|1198057_1198207_+	hypothetical protein	A0A0P0ZFU6	Escherichia_phage	2.4e-17	100.0
BBF46777.1\|1198214_1198679_+	endopeptidase	A0A2R2Z341	Escherichia_phage	5.8e-78	100.0
BBF46778.1\|1198710_1199004_-	Bor protein precursor	A0A2R2X2B2	Escherichia_phage	6.8e-48	100.0
BBF46779.1\|1199153_1199357_+	hypothetical protein	A0A2R2Z338	Escherichia_phage	7.7e-35	100.0
BBF46780.1\|1199412_1200219_+\|terminase	phage terminase	A0A0P0ZG40	Escherichia_phage	1.3e-133	100.0
BBF46781.1\|1200199_1201906_+\|terminase	phage terminase large subunit	G9L6K0	Escherichia_phage	0.0e+00	100.0
BBF46782.1\|1201905_1204050_+\|portal	phage portal protein	A0A2R2Z346	Escherichia_phage	0.0e+00	100.0
BBF46783.1\|1204206_1205214_+	hypothetical protein	A0A2R2Z355	Escherichia_phage	2.3e-180	100.0
BBF46784.1\|1205237_1206452_+\|capsid	phage major capsid protein	A0A2R2Z358	Escherichia_phage	1.3e-233	100.0
BBF46785.1\|1206507_1206897_+	hypothetical protein	A0A2R2Z353	Escherichia_phage	9.9e-63	100.0
BBF46786.1\|1206946_1207408_+	hypothetical protein	A0A2R2Z354	Escherichia_phage	7.8e-75	100.0
BBF46787.1\|1207391_1207955_+	hypothetical protein	A0A0P0ZGG2	Escherichia_phage	4.1e-102	100.0
BBF46788.1\|1207954_1208605_+	hypothetical protein	A0A0P0ZG46	Escherichia_phage	4.6e-121	100.0
BBF46789.1\|1208601_1210539_+\|tail	phage tail fiber protein	A0A1I9LJS9	Stx_converting_phage	3.1e-64	99.3
BBF46790.1\|1210540_1210810_+	hypothetical protein	Q9EYE9	Enterobacteria_phage	6.4e-45	98.9
BBF46791.1\|1210949_1211129_+	hypothetical protein	A0A2R2Z344	Escherichia_phage	2.8e-28	100.0
BBF46792.1\|1211125_1211215_+	hypothetical protein	NA	NA	NA	NA
BBF46793.1\|1211432_1213058_+	hypothetical protein	A0A088CBK0	Shigella_phage	0.0e+00	99.8
BBF46794.1\|1213054_1214323_+\|tail	phage tail fiber protein	A0A2L1IV54	Escherichia_phage	2.6e-213	89.5
BBF46795.1\|1214337_1214616_+	outer membrane protein	A0A2R2Z367	Escherichia_phage	1.1e-50	100.0
BBF46796.1\|1214621_1215239_+	hypothetical protein	A0A2R2Z362	Escherichia_phage	1.1e-121	100.0
BBF46797.1\|1215329_1216064_+	outer membrane precursor protein Lom	A0A2R2Z365	Escherichia_phage	1.3e-135	100.0
BBF46798.1\|1216296_1216437_+	hypothetical protein	A0A2R2X2B4	Escherichia_phage	3.1e-19	100.0
BBF46799.1\|1216493_1216895_+	hypothetical protein	A0A2R2Z359	Escherichia_phage	3.7e-73	100.0
BBF46800.1\|1216988_1217645_+	hypothetical protein	A0A2R2Z361	Escherichia_phage	2.4e-109	100.0
BBF46801.1\|1217647_1218094_+	hypothetical protein	A0A2R2Z357	Escherichia_phage	6.2e-77	100.0
BBF46802.1\|1218103_1218355_+	hypothetical protein	A0A2R2Z351	Escherichia_phage	7.9e-13	100.0
BBF46803.1\|1218365_1219631_+	hypothetical protein	A0A1I9LJU3	Stx_converting_phage	9.9e-205	98.8
BBF46804.1\|1219699_1228069_+	hypothetical protein	Q08J70	Stx2-converting_phage	0.0e+00	93.4
BBF46805.1\|1228134_1228251_-	hypothetical protein	A0A0P0ZG52	Escherichia_phage	1.3e-15	100.0
BBF46806.1\|1229009_1229183_+	hypothetical protein	Q9KX95	Enterobacteria_phage	4.9e-06	96.3
BBF46807.1\|1229265_1230594_-	pyrimidine permease	Q9KX94	Enterobacteria_phage	1.0e-231	98.4
BBF46808.1\|1230614_1231109_-	pyrimidine utilization flavin reductase protein F	Q9KX93	Enterobacteria_phage	5.0e-51	97.9

DBSCAN-SWA_7

1248822 : 1282223

Escherichia_phage(38.46%)

integrase,transposase

attL 1241060:1241074|attR 1272284:1272298

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1241060:1241074	attL	NA	NA	NA	NA
BBF46824.1\|1248822_1250025_+\|integrase	integrase	A0A1B0VMI6	Pseudomonas_phage	3.8e-44	34.4
BBF46825.1\|1250211_1252029_-	membrane protein	NA	NA	NA	NA
BBF46826.1\|1253262_1253448_-	hypothetical protein	NA	NA	NA	NA
BBF46827.1\|1254079_1255513_+	hypothetical protein	NA	NA	NA	NA
BBF46828.1\|1256333_1256897_+	hypothetical protein	NA	NA	NA	NA
BBF46829.1\|1257051_1259412_+	IS-excision enhancer IEE	Q84473	Paramecium_bursaria_Chlorella_virus	1.8e-34	32.5
BBF46830.1\|1259573_1259843_-	hypothetical protein	NA	NA	NA	NA
BBF46831.1\|1260168_1261707_-\|transposase	ISEc8 transposase	A0A0P0ZBS5	Stx2-converting_phage	1.7e-299	99.8
BBF46832.1\|1261918_1262245_+\|transposase	IS629 transposase OrfA	A0A0N7BVE9	Escherichia_phage	1.3e-55	100.0
BBF46833.1\|1262244_1263132_+\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	1.6e-169	100.0
BBF46834.1\|1263988_1264348_+	diacylglycerol kinase	NA	NA	NA	NA
BBF46835.1\|1264440_1266060_-	membrane-associated metal-dependent hydrolase	NA	NA	NA	NA
BBF46836.1\|1266322_1266559_-	hypothetical protein	NA	NA	NA	NA
BBF46837.1\|1266939_1267638_+	urease accessory protein	NA	NA	NA	NA
BBF46838.1\|1267728_1268031_+	urease subunit gamma	NA	NA	NA	NA
BBF46839.1\|1268039_1268360_+	urease subunit beta	NA	NA	NA	NA
BBF46840.1\|1268352_1270056_+	urease subunit alpha	NA	NA	NA	NA
BBF46841.1\|1270065_1270530_+	urease accessory protein	NA	NA	NA	NA
BBF46842.1\|1270530_1271205_+	urease accessory protein	NA	NA	NA	NA
BBF46843.1\|1271216_1271834_+	urease accessory protein	NA	NA	NA	NA
BBF46844.1\|1271872_1272136_+	hypothetical protein	NA	NA	NA	NA
BBF46845.1\|1272089_1272431_-\|transposase	IS600 transposase OrfA	NA	NA	NA	NA
1272284:1272298	attR	NA	NA	NA	NA
BBF46846.1\|1272492_1272621_-	complement resistance protein precursor TraT	NA	NA	NA	NA
BBF46847.1\|1273045_1273309_+	50S ribosomal protein L31 type B	NA	NA	NA	NA
BBF46848.1\|1273610_1273751_+	hypothetical protein	G9L6L7	Escherichia_phage	2.4e-11	66.7
BBF46849.1\|1274596_1275295_-	membrane protein	NA	NA	NA	NA
BBF46850.1\|1276827_1277208_-	hypothetical protein	A0A218MNE7	uncultured_virus	1.1e-26	47.8
BBF46851.1\|1277363_1277690_+\|transposase	IS629 transposase OrfA	A0A0N7BVE9	Escherichia_phage	1.3e-55	100.0
BBF46852.1\|1277689_1278577_+\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	1.6e-169	100.0
BBF46853.1\|1278945_1279371_+\|transposase	IS682 transposase	Q6H9S5	Enterobacteria_phage	1.4e-33	73.2
BBF46854.1\|1279367_1279718_+\|transposase	IS682 transposase	A0A0P0ZBY2	Stx2-converting_phage	1.1e-39	64.7
BBF46855.1\|1279748_1281362_+\|transposase	IS682 transposase	A0A0P0ZEB3	Stx2-converting_phage	3.1e-166	65.7
BBF46856.1\|1281365_1282223_-\|transposase	transposase	S5VLC8	Leptospira_phage	3.3e-26	30.0

DBSCAN-SWA_8

1301175 : 1326342

Escherichia_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBF46875.1\|1301175_1301304_-\|transposase	transposase	NA	NA	NA	NA
BBF46876.1\|1301646_1301841_-	hypothetical protein	NA	NA	NA	NA
BBF46877.1\|1301892_1302066_-	hypothetical protein	NA	NA	NA	NA
BBF46878.1\|1302154_1302427_+	hypothetical protein	NA	NA	NA	NA
BBF46879.1\|1302991_1303189_+	regulatory protein	NA	NA	NA	NA
BBF46880.1\|1303918_1305043_+	glucosyl-transferase	NA	NA	NA	NA
BBF46881.1\|1305461_1305755_-\|transposase	IS1 transposase InsB	U5P0U6	Shigella_phage	8.3e-46	92.8
BBF46882.1\|1306396_1306855_-	membrane protein	NA	NA	NA	NA
BBF46883.1\|1307312_1307822_+	hypothetical protein	NA	NA	NA	NA
BBF46884.1\|1307910_1308534_+	DNA-binding protein	NA	NA	NA	NA
BBF46885.1\|1308629_1308863_+	hypothetical protein	NA	NA	NA	NA
BBF46886.1\|1308915_1309107_-	hypothetical protein	NA	NA	NA	NA
BBF46887.1\|1309781_1310828_+	HecB-like protein	NA	NA	NA	NA
BBF46888.1\|1311068_1313750_+	UvrD/REP helicase-like protein	NA	NA	NA	NA
BBF46889.1\|1314250_1314466_+	phosphoadenosine phosphosulfate reductase	A0A218M763	Flavobacterium_phage	1.7e-08	53.4
BBF46890.1\|1314505_1315483_+	phosphoadenosine phosphosulfate reductase	A0A068F1U8	Mycobacterium_phage	3.0e-47	32.7
BBF46891.1\|1315467_1316106_+	hypothetical protein	A0A0F7L444	uncultured_marine_virus	1.9e-55	52.5
BBF46892.1\|1316169_1317057_-\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	1.6e-169	100.0
BBF46893.1\|1317056_1317383_-\|transposase	IS629 transposase OrfA	A0A0N7BVE9	Escherichia_phage	1.3e-55	100.0
BBF46894.1\|1317464_1318646_+	siderophore biosynthesis protein	NA	NA	NA	NA
BBF46895.1\|1318646_1319594_+	siderophore biosynthesis protein	NA	NA	NA	NA
BBF46896.1\|1319593_1321336_+	siderophore biosynthesis protein	NA	NA	NA	NA
BBF46897.1\|1321332_1322670_+	siderophore biosynthesis protein	NA	NA	NA	NA
BBF46898.1\|1322675_1324871_+	ferric siderophore receptor	NA	NA	NA	NA
BBF46899.1\|1325128_1326016_-\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	1.4e-168	99.7
BBF46900.1\|1326015_1326342_-\|transposase	IS629 transposase OrfA	A0A0N7BVE9	Escherichia_phage	1.3e-55	100.0

DBSCAN-SWA_9

1418173 : 1482890

Stx2-converting_phage(40.38%)

integrase,terminase,transposase,holin,protease,head,tail,portal,tRNA

attL 1413267:1413281|attR 1419748:1419762

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1413267:1413281	attL	NA	NA	NA	NA
BBF47003.1\|1418173_1419292_-\|integrase	integrase	Q77Z04	Phage_21	2.9e-83	43.9
BBF47004.1\|1419260_1419530_-	phage excisionase	NA	NA	NA	NA
BBF47005.1\|1419591_1422057_-	exonuclease	A0A192Y6E0	Salmonella_phage	8.8e-56	57.1
1419748:1419762	attR	NA	NA	NA	NA
BBF47006.1\|1422149_1422341_-	hypothetical protein	NA	NA	NA	NA
BBF47007.1\|1422337_1422526_-	cell division inhibition protein	NA	NA	NA	NA
BBF47008.1\|1423009_1423228_-	hypothetical protein	NA	NA	NA	NA
BBF47009.1\|1423268_1423658_-	hypothetical protein	NA	NA	NA	NA
BBF47010.1\|1423953_1424232_-	hypothetical protein	NA	NA	NA	NA
BBF47011.1\|1424233_1424425_-	hypothetical protein	NA	NA	NA	NA
BBF47012.1\|1424445_1424817_-	phage repressor protein CI	NA	NA	NA	NA
BBF47013.1\|1424915_1425218_+	phage antirepressor protein Cro	K7PHA1	Enterobacteria_phage	1.5e-05	34.8
BBF47014.1\|1425214_1425640_+	hypothetical protein	NA	NA	NA	NA
BBF47015.1\|1425662_1426625_+	phage replication protein	U5P0A0	Shigella_phage	2.1e-69	51.2
BBF47016.1\|1426665_1427082_+	phage exclusion protein	A0A0U2QQN3	Escherichia_phage	1.6e-63	90.6
BBF47017.1\|1427121_1428009_-\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	1.6e-169	100.0
BBF47018.1\|1428008_1428335_-\|transposase	IS629 transposase OrfA	A0A0N7BVE9	Escherichia_phage	1.3e-55	100.0
BBF47019.1\|1428882_1430010_+	hypothetical protein	U5P0K4	Shigella_phage	6.8e-88	47.8
BBF47020.1\|1430010_1430376_+	phage endonuclease RUS	V5URS4	Shigella_phage	1.6e-38	64.3
BBF47021.1\|1430384_1430915_+	phage antiterminator	A0A0U2S606	Escherichia_phage	9.3e-72	72.6
BBF47022.1\|1431156_1431354_+	hypothetical protein	S5MQK8	Escherichia_phage	1.0e-28	98.5
BBF47023.1\|1431504_1432563_+	DNA methylase	S5MDR0	Escherichia_phage	2.0e-198	94.0
BBF47024.1\|1433150_1433240_+	hypothetical protein	Q5MBW5	Stx1-converting_phage	1.6e-08	96.3
BBF47025.1\|1433359_1435210_+	hypothetical protein	H6WZJ9	Escherichia_phage	0.0e+00	98.1
BBF47026.1\|1435657_1435864_+\|holin	phage holine protein	A0A0P0ZC45	Stx2-converting_phage	2.4e-31	100.0
BBF47027.1\|1435868_1436213_+	hypothetical protein	A0A0P0ZD64	Stx2-converting_phage	1.0e-58	100.0
BBF47028.1\|1436263_1436797_+	phage endolysin	A0A0N7KZF9	Stx2-converting_phage	7.4e-101	98.9
BBF47029.1\|1437067_1437637_+	phage antirepressor	A0A1I9LJR6	Stx_converting_phage	3.1e-105	100.0
BBF47030.1\|1437636_1437783_+	hypothetical protein	A0A0P0ZE99	Stx2-converting_phage	2.6e-16	100.0
BBF47031.1\|1437790_1438258_+	phage endopeptidase	Q6H9V3	Enterobacteria_phage	6.9e-79	100.0
BBF47032.1\|1438620_1438848_-	hypothetical protein	A0A0P0ZE23	Stx2-converting_phage	1.7e-35	100.0
BBF47033.1\|1438889_1439255_+	DNase	B6ETE5	Enterobacteria_phage	2.0e-65	99.2
BBF47034.1\|1439544_1440108_+\|terminase	phage terminase small subunit	A0A0P0ZDD1	Stx2-converting_phage	3.8e-79	100.0
BBF47035.1\|1440104_1441766_+\|terminase	phage terminase large subunit	H6WZK9	Escherichia_phage	0.0e+00	98.9
BBF47036.1\|1441829_1443767_+\|head,protease	phage prohead protease	B6ETE8	Enterobacteria_phage	0.0e+00	99.7
BBF47037.1\|1443811_1444033_+	hypothetical protein	B6DZA0	Enterobacteria_phage	5.8e-36	100.0
BBF47038.1\|1443978_1445343_+\|portal	phage portal protein	B6DZX6	Stx2-converting_phage	1.9e-254	98.0
BBF47039.1\|1445339_1446725_+\|portal	phage portal protein	H6WZL3	Escherichia_phage	2.1e-83	84.2
BBF47040.1\|1446721_1447048_+	phage DNA packaging protein	B6ETF0	Enterobacteria_phage	7.0e-54	100.0
BBF47041.1\|1447057_1447408_+\|head,tail	phage head-tail adaptor	A0A0P0ZB28	Stx2-converting_phage	1.6e-59	100.0
BBF47042.1\|1447404_1447851_+\|tail	phage minor tail protein	A0A0N7KZI9	Stx2-converting_phage	5.2e-76	100.0
BBF47043.1\|1447847_1448192_+\|tail	phage minor tail protein	A0A0P0ZC17	Stx2-converting_phage	1.4e-57	100.0
BBF47044.1\|1448258_1448975_+\|tail	phage major tail protein	A0A0P0ZD29	Stx2-converting_phage	5.6e-128	98.7
BBF47045.1\|1448980_1449355_+\|tail	phage tail assembly protein	A0A0P0ZE84	Stx2-converting_phage	5.6e-63	97.6
BBF47046.1\|1449450_1449660_+\|tail	phage minor tail protein	A0A0P0ZDE6	Stx2-converting_phage	2.0e-33	100.0
BBF47047.1\|1449711_1452954_+\|tail	phage tail length tape measure protein	A0A0P0ZE78	Stx2-converting_phage	0.0e+00	98.3
BBF47048.1\|1452946_1453288_+\|tail	phage minor tail protein	H6WZM2	Escherichia_phage	5.3e-60	95.6
BBF47049.1\|1453287_1453986_+\|tail	phage minor tail protein	A0A0P0ZBE3	Stx2-converting_phage	1.7e-129	97.0
BBF47050.1\|1454002_1454323_-	regulatory protein	A0A0P0ZBD1	Stx2-converting_phage	3.0e-49	100.0
BBF47051.1\|1454430_1454634_+	transcriptional regulator	A0A0P0ZC65	Stx2-converting_phage	2.8e-16	74.6
BBF47052.1\|1454623_1455310_+	antirepressor	A0A0P0ZBT0	Stx2-converting_phage	3.1e-120	100.0
BBF47053.1\|1455681_1456419_+\|tail	phage tail assembly protein	A0A0P0ZDT1	Stx2-converting_phage	1.9e-147	98.8
BBF47054.1\|1456415_1456997_+\|tail	phage tail assembly protein	Q6H9T3	Enterobacteria_phage	7.3e-94	97.4
BBF47055.1\|1457233_1460713_+	phage host specificity protein	A0A0P0ZDT4	Stx2-converting_phage	0.0e+00	97.6
BBF47056.1\|1460779_1461379_+	outer membrane precursor Lom	Q687E7	Enterobacteria_phage	8.0e-112	100.0
BBF47057.1\|1461539_1462766_+\|tail	phage tail fiber protein	Q687E6	Enterobacteria_phage	2.1e-58	99.0
BBF47058.1\|1462767_1463037_+	hypothetical protein	A0A2R2Z347	Escherichia_phage	2.4e-44	98.9
BBF47059.1\|1463143_1463233_+	hypothetical protein	NA	NA	NA	NA
BBF47060.1\|1463252_1465601_+	T3SS secreted effector EspX	NA	NA	NA	NA
BBF47061.1\|1466191_1469593_+	T3SS secreted effector EspN	A0A0N7KZG3	Stx2-converting_phage	1.0e-219	39.2
BBF47062.1\|1469761_1470340_+\|transposase	transposase	NA	NA	NA	NA
BBF47063.1\|1470481_1470715_+	hypothetical protein	NA	NA	NA	NA
BBF47064.1\|1470903_1472265_-	T3SS secreted effector EspK	Q9MBM1	Phage_Gifsy-1	4.0e-50	28.9
BBF47065.1\|1472628_1473492_-	spermidine/putrescine ABC transporter permease	Q6GZ02	Mycoplasma_phage	6.7e-11	28.7
BBF47066.1\|1473475_1474612_-	spermidine/putrescine ABC transporter ATPase	Q6GZ03	Mycoplasma_phage	9.4e-29	39.8
BBF47067.1\|1474861_1476091_+	peptidase T	NA	NA	NA	NA
BBF47068.1\|1476236_1477358_-	50S ribosomal protein L16 arginine hydroxylase	NA	NA	NA	NA
BBF47069.1\|1477433_1478894_-	two-component system sensor histidine kinase PhoQ	NA	NA	NA	NA
BBF47070.1\|1478893_1479565_-	two-component regulatory system response regulator PhoP	NA	NA	NA	NA
BBF47071.1\|1479732_1481103_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.2e-108	44.9
BBF47072.1\|1481106_1481748_-	lysogenization regulator	NA	NA	NA	NA
BBF47073.1\|1481783_1482890_-\|tRNA	tRNA(Gln,Lys,Glu) U34 2-thiouridylase	NA	NA	NA	NA

DBSCAN-SWA_10

1568782 : 1655813

100

Enterobacteria_phage(40.68%)

terminase,protease,transposase,tail,lysis,portal,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBF47159.1\|1568782_1568968_-\|transposase	IS4 transposase	NA	NA	NA	NA
BBF47160.1\|1569091_1571767_-	acetaldehyde dehydrogenase	NA	NA	NA	NA
BBF47161.1\|1572243_1572891_+	inner membrane protein	NA	NA	NA	NA
BBF47162.1\|1572917_1573073_+	hypothetical protein	NA	NA	NA	NA
BBF47163.1\|1573048_1573210_-	hypothetical protein	NA	NA	NA	NA
BBF47164.1\|1573583_1575260_+	oligopeptide ABC transporter periplasmic binding protein	NA	NA	NA	NA
BBF47165.1\|1575345_1576266_+	oligopeptide ABC transporter permease	NA	NA	NA	NA
BBF47166.1\|1576280_1577189_+	oligopeptide ABC transporter permease	NA	NA	NA	NA
BBF47167.1\|1577200_1578214_+	oligopeptide ABC transporter ATPase	G9BWD6	Planktothrix_phage	2.0e-14	31.7
BBF47168.1\|1578210_1579215_+	oligopeptide ABC transporter ATPase	G9BWD6	Planktothrix_phage	8.0e-24	35.6
BBF47169.1\|1579267_1579597_-	hypothetical protein	NA	NA	NA	NA
BBF47170.1\|1579631_1581092_-	cardiolipin synthase 1	NA	NA	NA	NA
BBF47171.1\|1581462_1582716_-	voltage-gated potassium channel	NA	NA	NA	NA
BBF47172.1\|1583014_1583311_-	hypothetical protein	NA	NA	NA	NA
BBF47173.1\|1584106_1584655_+	site-specific recombinases	G8I4U3	Mycobacterium_phage	2.7e-21	36.1
BBF47174.1\|1586165_1586354_-	hypothetical protein	NA	NA	NA	NA
BBF47175.1\|1586460_1586997_+	hypothetical protein	A0A0U2SAW4	Escherichia_phage	4.1e-59	71.9
BBF47176.1\|1587056_1587311_+	hypothetical protein	A0A222YXX1	Escherichia_phage	2.4e-25	73.2
BBF47177.1\|1587307_1587604_+	hypothetical protein	A0A0U2SAZ1	Escherichia_phage	4.4e-47	93.7
BBF47178.1\|1587600_1588062_+	hypothetical protein	Q8VNQ2	Enterobacteria_phage	6.9e-39	95.2
BBF47179.1\|1588039_1588396_+	hypothetical protein	A0A2R2Z307	Escherichia_phage	6.7e-58	97.5
BBF47180.1\|1588491_1588863_+	hypothetical protein	A0A0N7KZJ2	Stx2-converting_phage	2.7e-49	78.9
BBF47181.1\|1588859_1589213_+	putative phage protein	Q9EY98	Enterobacteria_phage	5.5e-36	65.0
BBF47182.1\|1589418_1589718_-	plasmid stabilization protein	A0A2R2Z2Y1	Escherichia_phage	1.6e-49	96.0
BBF47183.1\|1589723_1589981_-	transcriptional regulator	A0A0N7C055	Escherichia_phage	6.6e-31	88.0
BBF47184.1\|1590396_1591446_+	hypothetical protein	U5P0K4	Shigella_phage	1.0e-109	54.3
BBF47185.1\|1591458_1591833_+	phage endonuclease RUS	V5URS4	Shigella_phage	2.4e-34	62.7
BBF47186.1\|1591829_1592651_+	phage antitermination protein Q	K7P7B9	Enterobacteria_phage	2.8e-83	61.9
BBF47187.1\|1592877_1593075_+	hypothetical protein	S5MQK8	Escherichia_phage	1.8e-28	98.5
BBF47188.1\|1593225_1594284_+	DNA methylase	S5MDR0	Escherichia_phage	1.7e-205	98.0
BBF47189.1\|1594878_1596825_+	hypothetical protein	Q9EYC8	Enterobacteria_phage	0.0e+00	99.1
BBF47190.1\|1596962_1597142_+	hypothetical protein	A0A2R2Z345	Escherichia_phage	2.2e-25	100.0
BBF47191.1\|1597182_1597428_+	hypothetical protein	A0A088CE63	Shigella_phage	3.2e-19	98.8
BBF47192.1\|1597505_1597721_+\|lysis	phage lysis protein	A0A2R2Z340	Escherichia_phage	1.2e-33	100.0
BBF47193.1\|1597724_1597970_+	hypothetical protein	NA	NA	NA	NA
BBF47194.1\|1597995_1598322_+\|transposase	IS629 transposase OrfA	A0A0N7BVE9	Escherichia_phage	1.3e-55	100.0
BBF47195.1\|1598321_1599209_+\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	1.6e-169	100.0
BBF47196.1\|1599406_1599595_+	hypothetical protein	Q08JA0	Stx2-converting_phage	4.2e-19	72.6
BBF47197.1\|1599631_1600165_+	phage endolysin	B6DZ92	Enterobacteria_phage	2.1e-100	97.2
BBF47198.1\|1600288_1600462_+	hypothetical protein	Q687G2	Enterobacteria_phage	3.6e-17	95.6
BBF47199.1\|1600463_1600931_+	endopeptidase	Q7AYI6	Enterobacteria_phage	3.9e-74	96.1
BBF47200.1\|1601344_1601821_+\|terminase	phage terminase small subunit	Q8VNN8	Enterobacteria_phage	3.3e-84	100.0
BBF47201.1\|1601817_1603941_+\|terminase	phage terminase large subunit	Q9EYD1	Enterobacteria_phage	0.0e+00	100.0
BBF47202.1\|1603937_1604150_+	hypothetical protein	Q687G1	Enterobacteria_phage	2.3e-29	98.6
BBF47203.1\|1604149_1605652_+\|portal	phage portal protein	Q9EYD2	Enterobacteria_phage	4.8e-291	100.0
BBF47204.1\|1605596_1607621_+\|protease	phage protease/scaffold protein	S5M7Q8	Escherichia_phage	0.0e+00	99.8
BBF47205.1\|1607708_1608035_+	membrane protein	Q9EYD5	Enterobacteria_phage	6.1e-50	100.0
BBF47206.1\|1608027_1608309_+	DNA breaking-rejoining protein	Q8VNN4	Enterobacteria_phage	3.9e-45	97.8
BBF47207.1\|1608311_1608935_+\|tail	phage minor tail protein	Q9EYD6	Enterobacteria_phage	6.6e-101	100.0
BBF47208.1\|1608947_1609346_+\|tail	phage minor tail protein	Q9EYD7	Enterobacteria_phage	5.9e-71	100.0
BBF47209.1\|1609353_1610106_+\|tail	phage major tail protein	Q687F6	Enterobacteria_phage	5.8e-136	100.0
BBF47210.1\|1610119_1610542_+\|tail	phage minor tail protein	Q687F5	Enterobacteria_phage	5.1e-73	100.0
BBF47211.1\|1610568_1610877_+\|tail	phage minor tail protein	Q687F4	Enterobacteria_phage	1.3e-54	100.0
BBF47212.1\|1610920_1613566_+\|tail	phage tail length tape measure protein	Q9EYE1	Enterobacteria_phage	0.0e+00	99.5
BBF47213.1\|1613562_1613892_+\|tail	phage minor tail protein	Q687F2	Enterobacteria_phage	4.3e-59	100.0
BBF47214.1\|1613891_1614239_+\|tail	phage minor tail protein	A0A0P0ZBE3	Stx2-converting_phage	2.0e-51	100.0
BBF47215.1\|1614196_1614589_+\|tail	phage minor tail protein	Q687F1	Enterobacteria_phage	9.9e-71	97.7
BBF47216.1\|1614599_1615343_+\|tail	phage tail assembly protein	Q6H9T4	Enterobacteria_phage	1.5e-147	98.4
BBF47217.1\|1615339_1615921_+\|tail	phage tail assembly protein	Q6H9T3	Enterobacteria_phage	7.3e-94	97.4
BBF47218.1\|1616157_1619637_+	phage host specificity protein	A0A0P0ZDT4	Stx2-converting_phage	0.0e+00	97.3
BBF47219.1\|1619704_1620304_+	outer membrane precursor Lom	Q687E7	Enterobacteria_phage	8.8e-111	99.0
BBF47220.1\|1620368_1621682_+\|tail	phage tail fiber protein	A0A0P0ZCC1	Stx2-converting_phage	3.7e-77	97.0
BBF47221.1\|1621683_1621953_+	hypothetical protein	A0A1U9AJC2	Stx1_converting_phage	2.7e-43	97.8
BBF47222.1\|1622407_1622800_+\|transposase	IS1 transposase InsB	U5P0U6	Shigella_phage	8.4e-54	85.3
BBF47223.1\|1623088_1623679_+	T3SS secreted effector OspG	NA	NA	NA	NA
BBF47224.1\|1624056_1624227_+\|tail	phage tail component	A0A0U2RK60	Escherichia_phage	9.4e-10	62.5
BBF47225.1\|1624715_1625222_-	hypothetical protein	NA	NA	NA	NA
BBF47226.1\|1625267_1625768_-	hypothetical protein	NA	NA	NA	NA
BBF47227.1\|1625853_1626033_-	hypothetical protein	NA	NA	NA	NA
BBF47228.1\|1626413_1627220_-	tryptophan synthase alpha chain	NA	NA	NA	NA
BBF47229.1\|1627219_1628413_-	tryptophan synthase beta chain	NA	NA	NA	NA
BBF47230.1\|1628424_1629783_-	indole-3-glycerolphosphate synthetase and N-(5-phosphoribosyl)anthranilate isomerase	A0A0P0IR83	Acinetobacter_phage	8.6e-37	40.7
BBF47231.1\|1629786_1631382_-	anthranilate synthase component II	A0A0N7IRD9	Acinetobacter_phage	3.8e-52	38.5
BBF47232.1\|1631381_1632944_-	component I of anthranilate synthase	NA	NA	NA	NA
BBF47233.1\|1633217_1634099_+\|tRNA	S-adenosylmethionine tRNA ribosyltransferase	NA	NA	NA	NA
BBF47234.1\|1634095_1634716_+	RNA binding protein	NA	NA	NA	NA
BBF47235.1\|1634816_1635689_+	ribosomal large subunit pseudouridine synthase B	NA	NA	NA	NA
BBF47236.1\|1635728_1636319_-	cob(I)alamin adenosyltransferase/cobinamide ATP-dependent adenosyltransferase	NA	NA	NA	NA
BBF47237.1\|1636315_1637074_-	EmrKY-TolC system oxoacyl-(acyl carrier protein) reductase	A0A0N9R355	Chrysochromulina_ericina_virus	4.4e-06	24.5
BBF47238.1\|1637293_1638343_+	peptidase	A0A2H4UUF9	Bodo_saltans_virus	1.3e-21	31.5
BBF47239.1\|1638378_1638630_-	hypothetical protein	NA	NA	NA	NA
BBF47240.1\|1639009_1641607_+	DNA topoisomerase I	A0A2K9L1Q2	Tupanvirus	1.7e-86	34.7
BBF47241.1\|1641816_1642791_+	N-acetylserine-responsive cysteine regulon transcriptional activator	NA	NA	NA	NA
BBF47242.1\|1643121_1643250_+	hypothetical protein	NA	NA	NA	NA
BBF47243.1\|1643252_1643420_+	hypothetical protein	NA	NA	NA	NA
BBF47244.1\|1643533_1643629_+	hypothetical protein	NA	NA	NA	NA
BBF47245.1\|1643792_1646468_+	aconitate hydratase 1	NA	NA	NA	NA
BBF47246.1\|1646531_1647122_-	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	7.7e-43	48.9
BBF47247.1\|1647291_1648056_+	phosphatidylglycerophosphatase B	NA	NA	NA	NA
BBF47248.1\|1648204_1648513_+	inner membrane-anchored protein	NA	NA	NA	NA
BBF47249.1\|1648519_1649689_+	hypothetical protein	NA	NA	NA	NA
BBF47250.1\|1649820_1650618_+	orotidine-5'-phosphate decarboxylase	NA	NA	NA	NA
BBF47251.1\|1650617_1650944_+	stress response translation initiation inhibitor	NA	NA	NA	NA
BBF47252.1\|1651069_1651288_-	osmotically and stress inducible lipoprotein	NA	NA	NA	NA
BBF47253.1\|1651556_1652306_-	global regulator of transcription	NA	NA	NA	NA
BBF47254.1\|1652395_1652569_-	hypothetical protein	NA	NA	NA	NA
BBF47255.1\|1652716_1653397_-	modulator of Rnase II stability	NA	NA	NA	NA
BBF47256.1\|1653406_1654534_-	modulator of Rnase II stability	NA	NA	NA	NA
BBF47257.1\|1654599_1655487_-\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	1.6e-169	100.0
BBF47258.1\|1655486_1655813_-\|transposase	IS629 transposase OrfA	A0A0N7BVE9	Escherichia_phage	1.3e-55	100.0

DBSCAN-SWA_11

1716197 : 1776496

Escherichia_phage(41.18%)

integrase,terminase,holin,transposase,protease,head,tail,portal,tRNA

attL 1715831:1715846|attR 1746985:1747000

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1715831:1715846	attL	NA	NA	NA	NA
BBF47318.1\|1716197_1717430_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	3.1e-17	39.5
BBF47319.1\|1717684_1718668_+	Zn(II) transporter	NA	NA	NA	NA
BBF47320.1\|1718942_1719116_+	hypothetical protein	NA	NA	NA	NA
BBF47321.1\|1719145_1720519_+	ATP-dependent RNA helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	6.6e-53	33.1
BBF47322.1\|1720647_1721583_-\|tRNA	tRNA s(2)C32 thioltransferase	A0A0U2S5Z2	Escherichia_phage	5.9e-146	98.8
BBF47323.1\|1721634_1722870_-\|integrase	integrase	A0A0U2JGI6	Escherichia_phage	3.8e-241	99.5
BBF47324.1\|1722871_1723087_-	hypothetical protein	A0A0U2RY08	Escherichia_phage	1.8e-37	100.0
BBF47325.1\|1723186_1723375_-	hypothetical protein	A0A0U2QL97	Escherichia_phage	5.5e-27	98.4
BBF47326.1\|1723617_1724427_-	recombination and repair protein	A0A1P8DTF2	Proteus_phage	4.0e-106	71.5
BBF47327.1\|1724419_1727020_-	exonuclease VIII	A0A0U2I1R6	Escherichia_phage	6.1e-249	63.5
BBF47328.1\|1727121_1727397_-	hypothetical protein	A0A0U2QW85	Escherichia_phage	4.0e-42	95.6
BBF47329.1\|1727471_1727642_-	hypothetical protein	A0A0U2SHB5	Escherichia_phage	3.6e-17	71.4
BBF47330.1\|1727641_1727863_-	phage cell division inhibitor protein	A0A0U2RTC4	Escherichia_phage	2.0e-36	98.6
BBF47331.1\|1728181_1728793_+	phage superinfection exclusion protein	NA	NA	NA	NA
BBF47332.1\|1728789_1728945_-	hypothetical protein	M4QQ57	Salicola_phage	6.1e-08	55.3
BBF47333.1\|1729377_1729797_-	regulator for DicB	A0A2I6PIE7	Escherichia_phage	5.5e-19	46.5
BBF47334.1\|1729876_1730131_+	phage antirepressor Cro	A0A2I6PIE5	Escherichia_phage	1.3e-18	61.6
BBF47335.1\|1730127_1730550_+	hypothetical protein	A0A0U2RXZ9	Escherichia_phage	1.3e-68	92.9
BBF47336.1\|1730627_1731416_+	hypothetical protein	G9L6A8	Escherichia_phage	2.0e-41	64.3
BBF47337.1\|1731422_1732169_+	phage DNA replication protein	V5UQI5	Shigella_phage	5.6e-115	81.3
BBF47338.1\|1732191_1732953_+	hypothetical protein	A0A0U2SAW4	Escherichia_phage	7.0e-121	90.5
BBF47339.1\|1732968_1733391_+	phage exclusion protein	A0A0U2QQN3	Escherichia_phage	3.1e-62	88.5
BBF47340.1\|1733496_1733709_+	hypothetical protein	A0A2R2Z310	Escherichia_phage	5.8e-33	94.3
BBF47341.1\|1733960_1734224_+	hypothetical protein	A0A2P0P958	Salmonella_phage	8.8e-31	72.4
BBF47342.1\|1734234_1734396_+	hypothetical protein	A0A192Y6F5	Salmonella_phage	3.2e-15	89.4
BBF47343.1\|1735151_1736303_+	DNA methylase	Q8JKX6	Natrialba_phage	1.0e-22	36.9
BBF47344.1\|1736270_1737260_-	hypothetical protein	NA	NA	NA	NA
BBF47345.1\|1737259_1738651_-	hypothetical protein	NA	NA	NA	NA
BBF47346.1\|1739150_1739750_+	hypothetical protein	A0A0U2RT94	Escherichia_phage	1.1e-105	92.0
BBF47347.1\|1739749_1740040_+	hypothetical protein	A0A0U2KD41	Escherichia_phage	3.3e-47	87.5
BBF47348.1\|1740036_1740591_+	phage antiterminator	A0A0U2S606	Escherichia_phage	5.0e-68	69.1
BBF47349.1\|1741152_1741584_+	TciA/TerB-like protein	H6WZJ6	Escherichia_phage	3.3e-67	97.2
BBF47350.1\|1741396_1741915_-	hypothetical protein	NA	NA	NA	NA
BBF47351.1\|1742154_1743720_+	hypothetical protein	B6DZ89	Enterobacteria_phage	3.7e-294	95.7
BBF47352.1\|1743736_1744006_+	hypothetical protein	H6WZJ9	Escherichia_phage	1.6e-43	100.0
BBF47353.1\|1744155_1744371_+\|holin	phage holin protein	Q6H9V8	Enterobacteria_phage	1.3e-32	97.2
BBF47354.1\|1744375_1744720_+	hypothetical protein	A0A0P0ZD64	Stx2-converting_phage	1.8e-55	95.6
BBF47355.1\|1744770_1745304_+	phage endolysin	B6DZ92	Enterobacteria_phage	1.3e-100	97.7
BBF47356.1\|1745577_1746117_+	hypothetical protein	Q5MBW0	Stx1-converting_phage	3.0e-86	99.4
BBF47357.1\|1746119_1747007_-\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	1.6e-169	100.0
1746985:1747000	attR	NA	NA	NA	NA
BBF47358.1\|1747006_1747333_-\|transposase	IS629 transposase OrfA	A0A0N7BVE9	Escherichia_phage	1.3e-55	100.0
BBF47359.1\|1747409_1747586_+	hypothetical protein	Q5MBW0	Stx1-converting_phage	3.3e-26	98.3
BBF47360.1\|1747582_1747678_+	hypothetical protein	NA	NA	NA	NA
BBF47361.1\|1747823_1748282_+	endopeptidase	Q7AYI6	Enterobacteria_phage	2.6e-70	93.4
BBF47362.1\|1748620_1748947_+	membrane protein	H6WZK5	Escherichia_phage	6.3e-55	98.1
BBF47363.1\|1749078_1749279_-	hypothetical protein	H6WZK6	Escherichia_phage	1.3e-29	97.0
BBF47364.1\|1749320_1749686_+	DNase	B6ETE5	Enterobacteria_phage	1.6e-62	96.7
BBF47365.1\|1749974_1750538_+\|terminase	phage terminase small subunit	A0A0P0ZD56	Stx2-converting_phage	1.1e-89	100.0
BBF47366.1\|1750534_1752196_+\|terminase	phage terminase large subunit	A0A0N7KZG0	Stx2-converting_phage	0.0e+00	99.3
BBF47367.1\|1752259_1754197_+\|head,protease	phage prohead protease	H6WZL0	Escherichia_phage	0.0e+00	99.7
BBF47368.1\|1754241_1754463_+	hypothetical protein	A0A0P0ZD92	Stx2-converting_phage	5.8e-36	100.0
BBF47369.1\|1754408_1755773_+\|portal	phage portal protein	A0A0P0ZCX8	Stx2-converting_phage	2.5e-254	97.4
BBF47370.1\|1755769_1756831_+\|portal	phage portal protein	A0A0P0ZCZ4	Stx2-converting_phage	1.6e-99	84.8
BBF47371.1\|1756827_1757154_+	phage DNA packaging protein	A0A0P0ZDE0	Stx2-converting_phage	5.4e-54	100.0
BBF47372.1\|1757163_1757514_+\|head,tail	phage head-tail adaptor	H6WZL5	Escherichia_phage	2.0e-59	100.0
BBF47373.1\|1757510_1757957_+\|tail	phage minor tail protein	A0A0N7KZI9	Stx2-converting_phage	5.2e-76	100.0
BBF47374.1\|1757953_1758298_+\|tail	phage minor tail protein	A0A0P0ZC17	Stx2-converting_phage	9.4e-57	99.1
BBF47375.1\|1758366_1759083_+\|tail	phage major tail protein	A0A0P0ZD29	Stx2-converting_phage	1.4e-126	97.9
BBF47376.1\|1759088_1759463_+\|tail	phage tail assembly protein	A0A0N7KZA2	Stx2-converting_phage	3.0e-64	99.2
BBF47377.1\|1759558_1759768_+\|tail	phage minor tail protein	A0A0P0ZDE6	Stx2-converting_phage	2.0e-33	100.0
BBF47378.1\|1759819_1763062_+\|tail	phage tail length tape measure protein	A0A0P0ZCJ4	Stx2-converting_phage	0.0e+00	98.9
BBF47379.1\|1763054_1763396_+\|tail	phage minor tail protein	A0A0P0ZCS8	Stx2-converting_phage	8.7e-63	100.0
BBF47380.1\|1763395_1764094_+\|tail	phage minor tail protein	H6WZM3	Escherichia_phage	1.3e-129	97.4
BBF47381.1\|1764104_1764848_+\|tail	phage tail assembly protein	A0A0P0ZE89	Stx2-converting_phage	5.4e-150	99.2
BBF47382.1\|1764844_1765426_+\|tail	phage tail assembly protein	Q6H9T3	Enterobacteria_phage	3.3e-86	89.6
BBF47383.1\|1765616_1766144_-	copper/zinc-superoxide dismutase	Q9MC02	Salmonella_phage	1.8e-59	60.5
BBF47384.1\|1766277_1769775_+	phage host specificity protein	A0A0P0ZEQ8	Stx2-converting_phage	0.0e+00	94.3
BBF47385.1\|1769845_1770445_+	outer membrane precursor Lom	B6ETG5	Enterobacteria_phage	3.0e-111	100.0
BBF47386.1\|1770509_1771823_+\|tail	phage tail fiber protein	A0A0P0ZCC1	Stx2-converting_phage	7.9e-80	97.9
BBF47387.1\|1771824_1772094_+	hypothetical protein	A0A0P0ZCV7	Stx2-converting_phage	4.2e-44	95.5
BBF47388.1\|1772206_1772782_+	T3SS secreted effector NleG	H6WZN1	Escherichia_phage	5.3e-89	88.4
BBF47389.1\|1772854_1773484_+	T3SS secreted effector NleG	B6DZB9	Enterobacteria_phage	1.3e-77	92.2
BBF47390.1\|1773565_1774207_+	T3SS secreted effector NleG	B6DZC0	Enterobacteria_phage	6.8e-109	100.0
BBF47391.1\|1774787_1775222_-	universal stress protein UspF	A0A1W6JNV4	Morganella_phage	1.4e-28	52.8
BBF47392.1\|1775362_1776496_-	outer membrane pore protein	Q1MVN1	Enterobacteria_phage	1.2e-116	58.3

DBSCAN-SWA_12

1974606 : 1992665

Escherichia_phage(44.44%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBF47568.1\|1974606_1974810_+	selenoprotein	J9Q802	Salmonella_phage	1.6e-11	55.2
BBF47569.1\|1974845_1976306_-	NAD-dependent D-mannonate oxidoreductase	G8DCZ3	Micromonas_pusilla_virus	5.6e-42	30.3
BBF47570.1\|1976394_1977678_-	transport protein	NA	NA	NA	NA
BBF47571.1\|1977737_1978052_+	DNA damage-inducible protein	Q687E4	Enterobacteria_phage	1.3e-25	81.9
BBF47572.1\|1978584_1979298_+	T3SS secreted effector NleG	B6ETE1	Enterobacteria_phage	1.3e-121	99.1
BBF47573.1\|1979522_1980398_-	T3SS secreted effector OspB	A0A0P0ZCT1	Stx2-converting_phage	1.5e-162	100.0
BBF47574.1\|1980538_1980808_-	hypothetical protein	Q687E5	Enterobacteria_phage	6.4e-45	100.0
BBF47575.1\|1980809_1982615_-	hypothetical protein	H6WZJ9	Escherichia_phage	0.0e+00	96.8
BBF47576.1\|1982929_1983097_-	hypothetical protein	H6WZJ7	Escherichia_phage	5.4e-10	70.6
BBF47577.1\|1983093_1983240_-	TciA/TerB-like protein	H6WZJ6	Escherichia_phage	6.8e-17	95.8
BBF47578.1\|1984141_1984831_-	phage late gene regulator Q	I6PDF8	Cronobacter_phage	4.0e-59	51.1
BBF47579.1\|1984827_1985193_-	phage endonuclease RUS	V5URS4	Shigella_phage	1.6e-38	67.5
BBF47580.1\|1985193_1986249_-	hypothetical protein	A0A291AWV9	Escherichia_phage	2.9e-88	47.6
BBF47581.1\|1986250_1986529_-	hypothetical protein	I6PCV7	Cronobacter_phage	2.8e-11	48.4
BBF47582.1\|1986598_1986856_-	putative phage protein	NA	NA	NA	NA
BBF47583.1\|1987076_1987289_-	phage maintenance protein	A0A0U2QV81	Escherichia_phage	1.3e-16	72.9
BBF47584.1\|1987567_1988326_-	porcine attaching-effacing associated protein Paa/adherence factor AdfO	NA	NA	NA	NA
BBF47585.1\|1989024_1989189_-	hypothetical protein	NA	NA	NA	NA
BBF47586.1\|1989185_1989920_-	hypothetical protein	A0A0U2SAW4	Escherichia_phage	2.9e-108	84.3
BBF47587.1\|1989953_1990376_-	phage replication protein	A0A0U2JGJ0	Escherichia_phage	1.2e-77	98.6
BBF47588.1\|1990407_1991448_-	phage replication protein	A0A0U2RT81	Escherichia_phage	7.9e-91	87.2
BBF47589.1\|1991419_1991971_-	hypothetical protein	NA	NA	NA	NA
BBF47590.1\|1992257_1992665_+	regulator for DicB	I6PD69	Cronobacter_phage	9.8e-29	49.6

DBSCAN-SWA_13

1997952 : 2063101

Stx2-converting_phage(35.19%)

integrase,terminase,transposase,protease,holin,head,tail,portal

attL 2031368:2031384|attR 2070617:2070633

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBF47598.1\|1997952_1999083_+\|integrase	integrase	O21940	Phage_21	3.4e-103	51.4
BBF47599.1\|1999128_1999767_-	outer membrane protein OmpW	NA	NA	NA	NA
BBF47600.1\|2000123_2000867_+	inner membrane protein	NA	NA	NA	NA
BBF47601.1\|2000896_2001436_+	intracellular septation protein A	NA	NA	NA	NA
BBF47602.1\|2001540_2001939_+	acyl-CoA esterase	NA	NA	NA	NA
BBF47603.1\|2001978_2002734_-	periplasmic protein TonB	NA	NA	NA	NA
BBF47604.1\|2002788_2003142_+	phage recombinase	NA	NA	NA	NA
BBF47605.1\|2003490_2004141_-	T3SS secreted effector NleG	B6ETE1	Enterobacteria_phage	6.6e-27	32.4
BBF47606.1\|2005647_2006238_-	T3SS secreted effector EspM	NA	NA	NA	NA
BBF47607.1\|2006421_2007069_+	T3SS secreted effector NleG	B6ETE1	Enterobacteria_phage	1.6e-41	41.1
BBF47608.1\|2007823_2008093_-	hypothetical protein	NA	NA	NA	NA
BBF47609.1\|2008544_2008892_+	hypothetical protein	A0A218MNI5	uncultured_virus	2.1e-11	51.5
BBF47610.1\|2009084_2009411_+\|transposase	IS629 transposase OrfA	A0A0N7BVE9	Escherichia_phage	1.3e-55	100.0
BBF47611.1\|2009410_2010298_+\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	1.6e-169	100.0
BBF47612.1\|2010419_2010779_-	T3SS secreted effector NleF	NA	NA	NA	NA
BBF47613.1\|2010844_2011756_-	T3SS secreted effector NleH	A5LH48	Enterobacteria_phage	3.0e-134	82.2
BBF47614.1\|2012229_2012622_+\|integrase	integrase	K7PHK0	Enterobacteria_phage	8.2e-57	88.9
BBF47615.1\|2013099_2013369_-	hypothetical protein	A0A1U9AJC2	Stx1_converting_phage	2.7e-43	97.8
BBF47616.1\|2013370_2014675_-\|tail	phage tail fiber protein	A0A0P0ZCC1	Stx2-converting_phage	1.2e-72	95.4
BBF47617.1\|2014826_2015426_-	outer membrane precursor Lom	Q9EV15	Enterobacteria_phage	4.1e-108	97.0
BBF47618.1\|2015493_2018967_-	phage host specificity protein	A0A0P0ZBW1	Stx2-converting_phage	0.0e+00	90.1
BBF47619.1\|2019309_2019891_-\|tail	phage tail assembly protein	H6WZM5	Escherichia_phage	7.5e-91	97.4
BBF47620.1\|2019887_2020631_-\|tail	phage tail assembly protein	A0A0P0ZE89	Stx2-converting_phage	1.1e-147	97.2
BBF47621.1\|2020636_2021335_-\|tail	phage minor tail protein	A0A0P0ZBE3	Stx2-converting_phage	7.6e-130	97.0
BBF47622.1\|2021334_2021676_-\|tail	phage minor tail protein	A0A0P0ZBQ8	Stx2-converting_phage	4.7e-61	97.3
BBF47623.1\|2021668_2023111_-\|tail	phage tail length tape measure protein	A0A0P0ZCJ4	Stx2-converting_phage	5.1e-229	93.3
BBF47624.1\|2023129_2023495_+\|transposase	IS91 transposase	NA	NA	NA	NA
BBF47625.1\|2023494_2024682_+\|transposase	IS91 transposase	NA	NA	NA	NA
BBF47626.1\|2024861_2026739_-\|tail	phage tail length tape measure protein	A0A0P0ZCJ4	Stx2-converting_phage	5.9e-278	91.5
BBF47627.1\|2026790_2027000_-\|tail	phage minor tail protein	A0A0P0ZDE6	Stx2-converting_phage	2.0e-33	100.0
BBF47628.1\|2027095_2027470_-\|tail	phage tail assembly protein	A0A0P0ZE84	Stx2-converting_phage	5.0e-64	98.4
BBF47629.1\|2027475_2028192_-\|tail	phage major tail protein	A0A0P0ZD29	Stx2-converting_phage	1.3e-124	95.8
BBF47630.1\|2028258_2028603_-\|tail	phage minor tail protein	A0A0P0ZC17	Stx2-converting_phage	9.4e-57	99.1
BBF47631.1\|2028599_2029046_-\|tail	phage minor tail protein	A0A0N7KZI9	Stx2-converting_phage	5.2e-76	100.0
BBF47632.1\|2029042_2029393_-\|head,tail	phage head-tail adaptor	A0A0P0ZB28	Stx2-converting_phage	1.6e-59	100.0
BBF47633.1\|2029402_2029729_-	phage DNA packaging protein	A0A0P0ZBH1	Stx2-converting_phage	9.2e-54	100.0
BBF47634.1\|2029731_2032311_-\|portal	phage portal protein	A0A0P0ZDD0	Stx2-converting_phage	0.0e+00	99.8
2031368:2031384	attL	NA	NA	NA	NA
BBF47635.1\|2032256_2032478_-	hypothetical protein	B6DZA0	Enterobacteria_phage	5.8e-36	100.0
BBF47636.1\|2032522_2034460_-\|head,protease	phage prohead protease	H6WZL0	Escherichia_phage	0.0e+00	99.7
BBF47637.1\|2034523_2036185_-\|terminase	phage terminase large subunit	H6WZK9	Escherichia_phage	0.0e+00	98.9
BBF47638.1\|2036181_2036745_-\|terminase	phage terminase small subunit	A0A0P0ZDD1	Stx2-converting_phage	3.8e-79	100.0
BBF47639.1\|2037034_2037400_-	DNase	B6DZ96	Enterobacteria_phage	2.9e-64	96.7
BBF47640.1\|2037441_2037669_+	hypothetical protein	A0A0P0ZE23	Stx2-converting_phage	1.7e-35	100.0
BBF47641.1\|2038037_2038262_-	hypothetical protein	NA	NA	NA	NA
BBF47642.1\|2038258_2038753_-	endopeptidase	Q9ZXB6	Enterobacteria_phage	4.0e-77	93.8
BBF47643.1\|2039050_2039584_-	phage endolysin	A0A0N7KZF9	Stx2-converting_phage	2.8e-100	98.3
BBF47644.1\|2039634_2039979_-	hypothetical protein	A0A0P0ZD64	Stx2-converting_phage	1.0e-58	100.0
BBF47645.1\|2039983_2040190_-\|holin	phage holine protein	O48430	Enterobacteria_phage	1.8e-31	100.0
BBF47646.1\|2040635_2042486_-	hypothetical protein	B6DZ89	Enterobacteria_phage	0.0e+00	98.4
BBF47647.1\|2042933_2043065_-	hypothetical protein	H6WZJ7	Escherichia_phage	5.2e-08	85.7
BBF47648.1\|2043324_2043651_+\|transposase	IS629 transposase OrfA	A0A0N7BVE9	Escherichia_phage	1.3e-55	100.0
BBF47649.1\|2043650_2044538_+\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	1.6e-169	100.0
BBF47650.1\|2044804_2045494_-	phage antiterminator Q	I6PDF8	Cronobacter_phage	5.5e-56	48.1
BBF47651.1\|2045624_2046512_-\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	4.0e-168	99.3
BBF47652.1\|2046511_2046838_-\|transposase	IS629 transposase OrfA	Q6H9S4	Enterobacteria_phage	4.1e-54	97.2
BBF47653.1\|2046889_2047138_-	phage exclusion protein	A0A0U2QQN3	Escherichia_phage	2.3e-28	84.8
BBF47654.1\|2047176_2048142_-	replication protein	U5P0A0	Shigella_phage	2.6e-56	60.8
BBF47655.1\|2048122_2048644_-	phage regulatory protein CII	NA	NA	NA	NA
BBF47656.1\|2048627_2048855_-	phage antirepressor protein Cro	NA	NA	NA	NA
BBF47657.1\|2048932_2049340_+	phage repressor CI	I6PD69	Cronobacter_phage	2.5e-24	46.2
BBF47658.1\|2049532_2049685_+	hypothetical protein	M4QQ57	Salicola_phage	6.6e-07	53.2
BBF47659.1\|2049696_2050062_+	hypothetical protein	NA	NA	NA	NA
BBF47660.1\|2050030_2050231_-	hypothetical protein	NA	NA	NA	NA
BBF47661.1\|2050733_2050922_+	cell division inhibition protein	NA	NA	NA	NA
BBF47662.1\|2050918_2051110_+	hypothetical protein	NA	NA	NA	NA
BBF47663.1\|2051203_2053675_+	exonuclease	A0A192Y6E0	Salmonella_phage	3.2e-58	56.1
BBF47664.1\|2053762_2053999_+	phage excisionase	S4TND0	Salmonella_phage	6.1e-15	50.7
BBF47665.1\|2054033_2055314_+\|integrase	integrase	B6DZ48	Enterobacteria_phage	1.9e-155	62.1
BBF47666.1\|2055333_2055444_-	hypothetical protein	NA	NA	NA	NA
BBF47667.1\|2055501_2056521_-	Zn-dependent NAD(P)-binding oxidoreductase	E3SJ82	Synechococcus_phage	9.7e-17	25.9
BBF47668.1\|2056532_2057747_-	bifunctional D-altronate/D-mannonate dehydratase	Q6A202	Oenococcus_phage	1.4e-46	29.0
BBF47669.1\|2057952_2058279_-	inner membrane protein	A0A218MNG8	uncultured_virus	9.9e-24	55.6
BBF47670.1\|2058413_2058755_+	periplasmic protein	NA	NA	NA	NA
BBF47671.1\|2058789_2059350_+	spermidine N(1)-acetyltransferase	NA	NA	NA	NA
BBF47672.1\|2059352_2060099_-	lipoprotein	NA	NA	NA	NA
BBF47673.1\|2060170_2060476_+	hypothetical protein	NA	NA	NA	NA
BBF47674.1\|2060674_2063101_+	anaerobic dimethyl sulfoxide reductase subunit A	A0A077SK27	Escherichia_phage	2.0e-214	49.0
2070617:2070633	attR	NA	NA	NA	NA

DBSCAN-SWA_14

2195230 : 2236952

Enterobacteria_phage(81.58%)

integrase,terminase,transposase,holin,capsid,plate,tail,portal,tRNA

attL 2197633:2197657|attR 2229593:2229617

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBF47798.1\|2195230_2195980_-	vitamin B12 ABC transporter ATPase	A0A2R8FG22	Brazilian_cedratvirus	1.6e-08	28.3
BBF47799.1\|2195979_2196531_-	glutathione peroxidase	NA	NA	NA	NA
BBF47800.1\|2196593_2197574_-	vitamin B12 ABC transporter permease	NA	NA	NA	NA
2197633:2197657	attL	NA	NA	NA	NA
BBF47801.1\|2197763_2198159_-	hypothetical protein	NA	NA	NA	NA
BBF47802.1\|2198169_2198871_-\|integrase	integrase	Q83VS6	Escherichia_phage	4.1e-59	47.0
BBF47803.1\|2199158_2199437_+	hypothetical protein	A0A0A7NRX5	Enterobacteria_phage	1.5e-33	78.3
BBF47804.1\|2199448_2199691_+	hypothetical protein	A0A0A7NQ71	Enterobacteria_phage	2.3e-38	100.0
BBF47805.1\|2199755_2200637_-\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	1.9e-114	92.6
BBF47806.1\|2200822_2202133_+	replication protein	A0A0A7NQ77	Enterobacteria_phage	6.4e-247	97.7
BBF47807.1\|2202209_2203169_+	plasmid partition protein	A0A0A7NPX4	Enterobacteria_phage	7.1e-179	98.4
BBF47808.1\|2203173_2203485_+	plasmid partition protein	A0A0A7NPT5	Enterobacteria_phage	2.2e-41	83.5
BBF47809.1\|2203849_2204119_+	hypothetical protein	NA	NA	NA	NA
BBF47810.1\|2204681_2205206_+	hypothetical protein	NA	NA	NA	NA
BBF47811.1\|2205220_2206267_-\|portal	phage portal protein	A0A0A7NPT9	Enterobacteria_phage	1.9e-201	99.1
BBF47812.1\|2206266_2208018_-\|terminase	phage terminase large subunit	A0A0A7NV54	Enterobacteria_phage	0.0e+00	95.0
BBF47813.1\|2208172_2209009_+	phage scaffolding protein	A0A0A7NRY7	Enterobacteria_phage	2.7e-150	100.0
BBF47814.1\|2209032_2210085_+\|capsid	phage major capsid protein	A0A0A7NQ82	Enterobacteria_phage	1.3e-194	97.7
BBF47815.1\|2210130_2210931_+\|terminase	phage terminase small subunit	A0A0A7NPX9	Enterobacteria_phage	6.6e-130	91.4
BBF47816.1\|2211033_2211528_+\|capsid	phage capsid completion protein	A0A0A7NPU2	Enterobacteria_phage	2.7e-89	99.4
BBF47817.1\|2211527_2211728_+\|tail	phage tail protein	A0A0A7NV57	Enterobacteria_phage	3.5e-32	100.0
BBF47818.1\|2211730_2212054_+\|holin	phage holin protein	A0A0A7NRY9	Enterobacteria_phage	1.6e-50	99.1
BBF47819.1\|2212050_2212443_+	phage endolysin	A0A0A7NQ86	Enterobacteria_phage	5.8e-71	100.0
BBF47820.1\|2212439_2212847_+	hypothetical protein	A0A0A7NPY2	Enterobacteria_phage	4.5e-66	98.5
BBF47821.1\|2212984_2213452_+\|tail	phage tail protein	A0A0A7NPU6	Enterobacteria_phage	1.0e-85	99.4
BBF47822.1\|2213435_2214080_+\|tail	phage tail completion protein	A0A0A7NV60	Enterobacteria_phage	3.1e-114	99.5
BBF47823.1\|2214076_2214658_+\|plate	phage baseplate assembly protein	A0A0A7NRZ3	Enterobacteria_phage	1.0e-100	96.9
BBF47824.1\|2214654_2215005_+\|plate	phage baseplate assembly protein	A0A0A7NQ90	Enterobacteria_phage	9.2e-60	100.0
BBF47825.1\|2215008_2215905_+\|plate	phage baseplate assembly protein	A0A0A7NPY5	Enterobacteria_phage	1.1e-154	98.0
BBF47826.1\|2215897_2216428_+\|tail	phage tail protein	A0A0A7NPV1	Enterobacteria_phage	1.1e-93	99.4
BBF47827.1\|2216430_2218563_+\|tail	phage side tail fiber protein	U5N099	Enterobacteria_phage	4.2e-131	66.7
BBF47828.1\|2218562_2219141_+\|tail	phage tail fiber assembly protein	K7PMH7	Enterobacteria_phage	1.7e-95	89.0
BBF47829.1\|2219184_2219757_-	hypothetical protein	NA	NA	NA	NA
BBF47830.1\|2219913_2220402_-\|tail	phage tail assembly protein	A0A0A7NV65	Enterobacteria_phage	3.0e-85	99.4
BBF47831.1\|2220414_2223222_-\|tail	phage tail protein	A0A0A7NRZ9	Enterobacteria_phage	0.0e+00	94.9
BBF47832.1\|2223372_2223747_-\|tail	phage tail protein	A0A0A7NPZ0	Enterobacteria_phage	6.9e-37	73.2
BBF47833.1\|2223802_2224189_-\|tail	phage tail tube protein	A0A0A7NPV8	Enterobacteria_phage	5.6e-66	97.7
BBF47834.1\|2224185_2224314_-\|tail	phage tail tube protein	A0A0A7NPV8	Enterobacteria_phage	8.6e-16	100.0
BBF47835.1\|2224313_2225498_-\|tail	phage tail sheath protein	A0A0A7NV69	Enterobacteria_phage	8.1e-225	99.0
BBF47836.1\|2225655_2226765_+	phage late gene regulator	A0A0A7NQ97	Enterobacteria_phage	9.6e-204	98.6
BBF47837.1\|2226990_2228493_+	hypothetical protein	NA	NA	NA	NA
BBF47838.1\|2228736_2228997_+	phage regulatory protein	NA	NA	NA	NA
BBF47839.1\|2229187_2229328_+	hypothetical protein	A0A0A7NPZ4	Enterobacteria_phage	4.5e-18	95.7
BBF47840.1\|2229634_2229934_-	integration host factor DNA-binding protein alpha subunit	A0A0H3UZA0	Geobacillus_virus	7.2e-13	40.0
2229593:2229617	attR	NA	NA	NA	NA
BBF47841.1\|2229938_2232326_-\|tRNA	phenylalanine tRNA synthetase beta subunit	NA	NA	NA	NA
BBF47842.1\|2232340_2233324_-\|tRNA	phenylalanine tRNA synthetase alpha subunit	A0A2K9L3A8	Tupanvirus	1.4e-33	38.5
BBF47843.1\|2233774_2234131_-	50S ribosomal subunit protein L20	NA	NA	NA	NA
BBF47844.1\|2234183_2234381_-	50S ribosomal subunit protein L35	NA	NA	NA	NA
BBF47845.1\|2234477_2234912_-	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	6.1e-13	33.8
BBF47846.1\|2235023_2236952_-\|tRNA	threonyl-tRNA synthetase	A0A2K9L297	Tupanvirus	3.2e-130	37.4

DBSCAN-SWA_15

2456407 : 2544474

107

Enterobacteria_phage(33.33%)

integrase,terminase,transposase,protease,holin,head,tail,portal

attL 2518712:2518736|attR 2548824:2548848

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBF48064.1\|2456407_2457556_-\|transposase	IS609 transposase	A0A1W6JP07	Morganella_phage	1.3e-206	97.4
BBF48065.1\|2457623_2457911_+\|transposase	IS609 transposase	A0A1S5RHE3	Helicobacter_phage	3.1e-29	66.7
BBF48066.1\|2459007_2459805_-	transcriptional regulator	NA	NA	NA	NA
BBF48067.1\|2459814_2460366_-	hypothetical protein	NA	NA	NA	NA
BBF48068.1\|2460534_2460867_-	multidrug resistance protein	NA	NA	NA	NA
BBF48069.1\|2461200_2461515_-	flagellar basal-body component	NA	NA	NA	NA
BBF48070.1\|2461728_2463387_+	flagellar basal-body MS-ring and collar protein	NA	NA	NA	NA
BBF48071.1\|2463379_2464375_+	flagellar motor switching and energizing component	NA	NA	NA	NA
BBF48072.1\|2464367_2465054_+	negative regulator of FliI ATPase activity	NA	NA	NA	NA
BBF48073.1\|2465053_2466427_+	flagellum-specific ATP synthase	NA	NA	NA	NA
BBF48074.1\|2466445_2466889_+	flagellar protein	NA	NA	NA	NA
BBF48075.1\|2466885_2468013_+	flagellar hook-length control protein	NA	NA	NA	NA
BBF48076.1\|2468117_2468582_+	flagellar biosynthesis protein	NA	NA	NA	NA
BBF48077.1\|2468586_2469591_+	flagellar motor switching and energizing component	NA	NA	NA	NA
BBF48078.1\|2469587_2470001_+	flagellar motor switching and energizing component	NA	NA	NA	NA
BBF48079.1\|2470003_2470369_+	flagellar biosynthesis protein	NA	NA	NA	NA
BBF48080.1\|2470368_2471106_+	flagellar biosynthesis protein	NA	NA	NA	NA
BBF48081.1\|2471115_2471385_+	flagellar biosynthesis protein	NA	NA	NA	NA
BBF48082.1\|2471392_2472178_+	flagellar export pore protein	NA	NA	NA	NA
BBF48083.1\|2472467_2473091_+	transcriptional regulator	NA	NA	NA	NA
BBF48084.1\|2473134_2473323_-	hypothetical protein	NA	NA	NA	NA
BBF48085.1\|2473485_2473713_+	hypothetical protein	NA	NA	NA	NA
BBF48086.1\|2474010_2474826_+	mannosyl-3-phosphoglycerate phosphatase	NA	NA	NA	NA
BBF48087.1\|2474822_2476517_-	membrane-anchored diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.3e-18	35.6
BBF48088.1\|2476687_2476870_-	hypothetical protein	NA	NA	NA	NA
BBF48089.1\|2476948_2477866_-	inner membrane protein	NA	NA	NA	NA
BBF48090.1\|2478038_2478959_+	amino acid exporter for phenylalanine	NA	NA	NA	NA
BBF48091.1\|2478947_2479418_-	DNA mismatch endonuclease of very short patch repair	E5E3X5	Burkholderia_phage	1.5e-33	47.6
BBF48092.1\|2479398_2480817_-	DNA cytosine methyltransferase	E5E3X6	Burkholderia_phage	1.8e-101	55.3
BBF48093.1\|2480883_2481579_-	HD superfamily phosphohydrolase	A0A1D6Y7U0	Golden_Marseillevirus	2.1e-07	28.0
BBF48094.1\|2481618_2481921_-	inner membrane protein	NA	NA	NA	NA
BBF48095.1\|2482550_2483714_+	outer membrane pore protein	Q1MVN1	Enterobacteria_phage	7.2e-109	56.2
BBF48096.1\|2484304_2485156_+	heat shock protein Hsp31	NA	NA	NA	NA
BBF48097.1\|2485263_2486622_-	two-component system sensor histidine kinase YedV	NA	NA	NA	NA
BBF48098.1\|2486621_2487404_-	response regulator	W8CYM9	Bacillus_phage	4.8e-32	35.2
BBF48099.1\|2487425_2487839_+	hydroxyisourate hydrolase	NA	NA	NA	NA
BBF48100.1\|2487947_2488952_+	reductase	NA	NA	NA	NA
BBF48101.1\|2488952_2489588_+	inner membrane heme subunit for periplasmic YedYZ reductase	NA	NA	NA	NA
BBF48102.1\|2489823_2490495_+	zinc and cadmium binding protein	NA	NA	NA	NA
BBF48103.1\|2490837_2491368_+	cytochrome	A0A0U2QLA7	Escherichia_phage	1.9e-56	100.0
BBF48104.1\|2492602_2493589_-	T3SS secreted effector NleC	NA	NA	NA	NA
BBF48105.1\|2494021_2494291_-	hypothetical protein	A0A1U9AJC2	Stx1_converting_phage	2.7e-43	97.8
BBF48106.1\|2494292_2495606_-\|tail	phage tail fiber protein	A0A0P0ZCC1	Stx2-converting_phage	3.7e-77	97.0
BBF48107.1\|2495670_2496270_-	outer membrane precursor Lom	Q687E7	Enterobacteria_phage	8.8e-111	99.0
BBF48108.1\|2496337_2499814_-	phage host specificity protein	Q687E8	Enterobacteria_phage	0.0e+00	96.7
BBF48109.1\|2500060_2500642_-\|tail	phage tail assembly protein	Q6H9T3	Enterobacteria_phage	7.3e-94	97.4
BBF48110.1\|2500638_2501382_-\|tail	phage tail assembly protein	Q6H9T4	Enterobacteria_phage	3.3e-147	98.0
BBF48111.1\|2501387_2502086_-\|tail	phage minor tail protein	Q687F1	Enterobacteria_phage	4.7e-132	99.1
BBF48112.1\|2502085_2502415_-\|tail	phage minor tail protein	Q687F2	Enterobacteria_phage	4.3e-59	100.0
BBF48113.1\|2502411_2505024_-\|tail	phage tail length tape measure protein	Q687F3	Enterobacteria_phage	0.0e+00	96.0
BBF48114.1\|2505004_2505418_-\|tail	phage minor tail protein	Q687F4	Enterobacteria_phage	3.2e-43	83.2
BBF48115.1\|2505444_2505867_-\|tail	phage minor tail protein	Q687F5	Enterobacteria_phage	1.7e-71	98.6
BBF48116.1\|2505880_2506633_-\|tail	phage major tail protein	Q687F6	Enterobacteria_phage	4.9e-135	99.2
BBF48117.1\|2506640_2507036_-\|tail	phage minor tail protein	A0A2R9YJI2	Escherichia_phage	1.5e-58	82.4
BBF48118.1\|2507032_2507566_-\|tail	phage minor tail protein	A0A2R9YJK4	Escherichia_phage	1.6e-58	66.7
BBF48119.1\|2507581_2507935_-\|head,tail	phage head-tail adaptor protein	A0A0K2FJB7	Enterobacteria_phage	1.5e-41	70.1
BBF48120.1\|2507927_2508311_-	phage DNA packaging protein	NA	NA	NA	NA
BBF48121.1\|2508362_2509391_-\|head	phage head protein	C6ZCY2	Enterobacteria_phage	3.6e-112	61.0
BBF48122.1\|2509448_2509796_-\|head	phage head-DNA stabilization protein	A0A2R9YJN3	Escherichia_phage	8.9e-23	58.1
BBF48123.1\|2509832_2511338_-\|head,protease	phage prohead protease	A0A2I6TC87	Escherichia_phage	3.0e-99	53.5
BBF48124.1\|2511327_2512920_-\|portal	phage portal protein	K7P6U7	Enterobacteria_phage	7.1e-184	60.9
BBF48125.1\|2512916_2513123_-\|head,tail	phage head-tail joining protein	K7PM10	Enterobacteria_phage	7.9e-11	56.9
BBF48126.1\|2513106_2515035_-\|terminase	phage terminase large subunit	A0A0K2FJ14	Enterobacteria_phage	3.6e-262	66.4
BBF48127.1\|2515006_2515618_-\|terminase	terminase small subunit	O64316	Escherichia_phage	8.9e-34	47.3
BBF48128.1\|2516245_2516560_-	PchABC family transcriptional regulator	NA	NA	NA	NA
BBF48129.1\|2517024_2517492_-	phage endopeptidase	Q7AYI6	Enterobacteria_phage	5.5e-68	89.0
BBF48130.1\|2517789_2518323_-	phage endolysin	Q6H9V6	Enterobacteria_phage	1.9e-101	96.0
BBF48131.1\|2518365_2518788_-	hypothetical protein	Q08JA0	Stx2-converting_phage	8.5e-52	83.5
2518712:2518736	attL	NA	NA	NA	NA
BBF48132.1\|2518753_2519641_-\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	3.6e-169	99.7
BBF48133.1\|2519640_2519967_-\|transposase	IS629 transposase OrfA	A0A0N7BVE9	Escherichia_phage	1.3e-55	100.0
BBF48134.1\|2520045_2520195_-	hypothetical protein	NA	NA	NA	NA
BBF48135.1\|2520198_2520414_-\|holin	phage holine protein	A0A0P0ZC45	Stx2-converting_phage	7.7e-33	97.2
BBF48136.1\|2520490_2520763_-	hypothetical protein	A0A0P0ZBB8	Stx2-converting_phage	2.2e-21	100.0
BBF48137.1\|2520803_2520983_-	hypothetical protein	A0A2R2Z345	Escherichia_phage	2.2e-25	100.0
BBF48138.1\|2521120_2523058_-	hypothetical protein	Q6H9W1	Enterobacteria_phage	0.0e+00	96.4
BBF48139.1\|2523372_2523540_-	hypothetical protein	H6WZJ7	Escherichia_phage	5.4e-10	70.6
BBF48140.1\|2523536_2523968_-	TciA/TerB-like protein	H6WZJ6	Escherichia_phage	3.3e-67	97.2
BBF48141.1\|2524055_2524481_+\|transposase	ISEc23 transposase	Q6H9S5	Enterobacteria_phage	1.5e-48	99.0
BBF48142.1\|2524477_2524828_+\|transposase	ISEc23 transposase	A0A0P0ZBY2	Stx2-converting_phage	4.7e-40	66.4
BBF48143.1\|2524858_2526472_+\|transposase	ISEc23 transposase	A0A0P0ZEB3	Stx2-converting_phage	4.4e-181	64.0
BBF48144.1\|2526957_2527545_-	phage regulatory protein	NA	NA	NA	NA
BBF48145.1\|2527805_2528003_-	hypothetical protein	S5MQK8	Escherichia_phage	6.8e-28	98.5
BBF48146.1\|2528226_2528781_-	phage antiterminator	A0A0U2S606	Escherichia_phage	8.0e-66	67.4
BBF48147.1\|2528789_2529149_-	phage endonuclease RUS	V5URS4	Shigella_phage	5.0e-37	63.5
BBF48148.1\|2529161_2530211_-	hypothetical protein	U5P0K4	Shigella_phage	1.2e-110	54.6
BBF48149.1\|2530212_2530485_-	hypothetical protein	S4TNP0	Salmonella_phage	1.1e-12	53.0
BBF48150.1\|2530606_2530951_-	hypothetical protein	A0A1I9LJU6	Stx_converting_phage	6.1e-56	99.1
BBF48151.1\|2531070_2531283_-	regulatory protein MokC for HokC	A0A0P0ZAX5	Stx2-converting_phage	6.0e-30	100.0
BBF48152.1\|2531516_2532074_-	putative phage protein	A0A0N7KZV3	Escherichia_phage	2.8e-34	41.7
BBF48153.1\|2532075_2532294_-	hypothetical protein	A0A2R2Z311	Escherichia_phage	2.3e-21	72.2
BBF48154.1\|2532421_2532733_-	hypothetical protein	A0A0U2QV73	Escherichia_phage	1.6e-55	91.3
BBF48155.1\|2532725_2532953_-	hypothetical protein	A0A1B5FPG2	Escherichia_phage	5.1e-11	49.3
BBF48156.1\|2532949_2533231_-	hypothetical protein	A0A222YXX1	Escherichia_phage	1.0e-29	73.6
BBF48157.1\|2533263_2533980_-	hypothetical protein	A0A0U2SAW4	Escherichia_phage	2.1e-71	62.6
BBF48158.1\|2534001_2534748_-	phage DNA replication protein	A0A088CBP4	Shigella_phage	3.6e-114	83.2
BBF48159.1\|2534754_2535825_-	phage replication protein	A0A088CD36	Shigella_phage	1.7e-64	65.7
BBF48160.1\|2535896_2536322_-	hypothetical protein	NA	NA	NA	NA
BBF48161.1\|2536305_2536587_-	phage antirepressor protein Cro	K7PHA1	Enterobacteria_phage	8.5e-24	72.6
BBF48162.1\|2536686_2537106_+	phage repressor protein CI	K7PK07	Enterobacteria_phage	4.0e-25	65.1
BBF48163.1\|2537290_2537524_+	hypothetical protein	M4QQ57	Salicola_phage	2.7e-07	53.2
BBF48164.1\|2537535_2538174_+	hypothetical protein	A0A2R2Z306	Escherichia_phage	2.5e-07	41.9
BBF48165.1\|2538174_2538384_-	hypothetical protein	NA	NA	NA	NA
BBF48166.1\|2538954_2539143_+	cell division inhibition protein	NA	NA	NA	NA
BBF48167.1\|2539139_2539331_+	hypothetical protein	NA	NA	NA	NA
BBF48168.1\|2539423_2541811_+	exonuclease	A0A192Y7M7	Salmonella_phage	5.9e-81	63.8
BBF48169.1\|2542046_2542844_+	anti-repressor for DgsA	NA	NA	NA	NA
BBF48170.1\|2543199_2544474_+\|integrase	integrase	B7SYF8	Stenotrophomonas_phage	1.4e-76	40.9
2548824:2548848	attR	NA	NA	NA	NA

DBSCAN-SWA_16

2605517 : 2612537

Shigella_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBF48237.1\|2605517_2606636_-	GDP-D-mannose dehydratase	M1IBC3	Acanthocystis_turfacea_Chlorella_virus	5.6e-135	65.7
BBF48238.1\|2606686_2607760_-	glycosyl transferase	NA	NA	NA	NA
BBF48239.1\|2608345_2609239_-	UTP--glucose-1-phosphate uridylyltransferase	A0A127AW70	Bacillus_phage	4.3e-45	40.3
BBF48240.1\|2609344_2610250_-\|transposase	IS2 transposase	Q9ZXG3	Shigella_phage	4.1e-176	99.0
BBF48241.1\|2610207_2610573_-\|transposase	IS2 transposase	Q76S41	Shigella_phage	1.1e-58	99.2
BBF48242.1\|2610661_2611582_-\|transposase	IS30 transposase	NA	NA	NA	NA
BBF48243.1\|2611538_2611907_-\|transposase	IS911 transposase	Q716C1	Shigella_phage	6.1e-38	97.7
BBF48244.1\|2611976_2612537_-	GDP-D-mannose dehydratase	M1IBC3	Acanthocystis_turfacea_Chlorella_virus	5.6e-75	75.0

DBSCAN-SWA_17

2691556 : 2700995

Enterobacteria_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBF48311.1\|2691556_2692693_+	VMA domain YehL ATPase stimulator	Q9EYF7	Enterobacteria_phage	1.1e-162	97.7
BBF48312.1\|2692689_2694489_+	hypothetical protein	Q9EYF6	Enterobacteria_phage	0.0e+00	96.1
BBF48313.1\|2694451_2694688_+	hypothetical protein	Q9EYF6	Enterobacteria_phage	2.1e-36	96.2
BBF48314.1\|2694812_2695274_+	lipoprotein	Q9EYF5	Enterobacteria_phage	7.1e-76	99.3
BBF48315.1\|2695313_2695784_-	hypothetical protein	Q9EYF4	Enterobacteria_phage	2.0e-81	99.4
BBF48316.1\|2695830_2696550_-	two-component regulatory system response regulator YehT	NA	NA	NA	NA
BBF48317.1\|2696546_2698232_-	histidine kinase	Q9EYF3	Enterobacteria_phage	2.5e-304	99.6
BBF48318.1\|2698453_2699185_+	transcriptional activator of csgD and csgBA	Q9EYF2	Enterobacteria_phage	9.7e-112	99.5
BBF48319.1\|2699244_2699352_+	membrane protein	NA	NA	NA	NA
BBF48320.1\|2699332_2700064_-	ABC transporter permease	NA	NA	NA	NA
BBF48321.1\|2700068_2700995_-	transporter subunit: ATP-binding component of ABC superfamily protein	G9BWD6	Planktothrix_phage	1.3e-23	34.6

DBSCAN-SWA_18

2769998 : 2833786

Enterobacteria_phage(18.52%)

integrase,terminase,transposase,protease,holin,head

attL 2807940:2807975|attR 2839808:2839843

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBF48383.1\|2769998_2771240_+\|integrase	integrase	A0A1V0E8G8	Vibrio_phage	1.6e-98	43.1
BBF48384.1\|2771736_2771943_+	AlpA family phage regulatory protein	NA	NA	NA	NA
BBF48385.1\|2773003_2773309_-	hypothetical protein	NA	NA	NA	NA
BBF48386.1\|2773505_2773706_+	hypothetical protein	NA	NA	NA	NA
BBF48387.1\|2773702_2774161_+	hypothetical protein	A0A1W6JPD9	Morganella_phage	2.6e-06	49.1
BBF48388.1\|2774133_2774367_+	hypothetical protein	NA	NA	NA	NA
BBF48389.1\|2774359_2774593_+	hypothetical protein	NA	NA	NA	NA
BBF48390.1\|2774598_2774898_+	hypothetical protein	NA	NA	NA	NA
BBF48391.1\|2774894_2776295_+	DNA primase	A0A2H4JFA4	uncultured_Caudovirales_phage	1.6e-115	60.1
BBF48392.1\|2776311_2776500_+	hypothetical protein	NA	NA	NA	NA
BBF48393.1\|2776496_2776742_+	hypothetical protein	NA	NA	NA	NA
BBF48394.1\|2776872_2777067_+	hypothetical protein	NA	NA	NA	NA
BBF48395.1\|2777070_2777232_+	hypothetical protein	NA	NA	NA	NA
BBF48396.1\|2777359_2777848_+\|terminase	phage terminase small subunit	A0A0P0ZCQ9	Stx2-converting_phage	3.9e-24	41.7
BBF48397.1\|2777859_2778021_+	hypothetical protein	NA	NA	NA	NA
BBF48398.1\|2778007_2778934_+\|head,protease	phage head protease	A0A0R6PHC6	Moraxella_phage	1.2e-13	24.9
BBF48399.1\|2779669_2781991_-	autotransporter outer membrane protein	NA	NA	NA	NA
BBF48400.1\|2782310_2782958_+	two-component regulatory system response regulator NarP	NA	NA	NA	NA
BBF48401.1\|2782992_2784045_-	heme lyase subunit CcmH	NA	NA	NA	NA
BBF48402.1\|2784041_2784599_-	thiol:disulfide interchange protein DsbE	NA	NA	NA	NA
BBF48403.1\|2784595_2786539_-	heme lyase subunit CcmF	NA	NA	NA	NA
BBF48404.1\|2786535_2787015_-	cytochrome c-type biogenesis protein CcmE	NA	NA	NA	NA
BBF48405.1\|2787011_2787221_-	cytochrome c biogenesis protein	NA	NA	NA	NA
BBF48406.1\|2787217_2787955_-	heme export ABC transporter permease	NA	NA	NA	NA
BBF48407.1\|2787996_2788659_-	heme export ABC transporter permease	NA	NA	NA	NA
BBF48408.1\|2788655_2789273_-	heme export ABC transporter ATPase	G3M9Y6	Bacillus_virus	1.9e-12	25.5
BBF48409.1\|2789291_2789894_-	quinol dehydrogenase	NA	NA	NA	NA
BBF48410.1\|2789903_2790353_-	cytochrome c-type protein NapB	NA	NA	NA	NA
BBF48411.1\|2790349_2791213_-	ferredoxin-type protein	NA	NA	NA	NA
BBF48412.1\|2791199_2791895_-	ferredoxin-type protein	NA	NA	NA	NA
BBF48413.1\|2791901_2794388_-	periplasmic nitrate reductase NapA	NA	NA	NA	NA
BBF48414.1\|2794384_2794648_-	nitrate reductase	NA	NA	NA	NA
BBF48415.1\|2794637_2795132_-	ferredoxin-type protein	NA	NA	NA	NA
BBF48416.1\|2795240_2795405_+	hypothetical protein	NA	NA	NA	NA
BBF48417.1\|2795540_2796029_+	ecotin	NA	NA	NA	NA
BBF48418.1\|2796177_2797824_-	malate dehydrogenase	NA	NA	NA	NA
BBF48419.1\|2798041_2799685_-	microcin J25 efflux ABC transporter permease/ATPase	W8CYL7	Bacillus_phage	9.5e-14	24.0
BBF48420.1\|2799760_2800411_-	oxidative demethylase of N1-methyladenine or N3-methylcytosine DNA lesions	A0A2K9L3R7	Tupanvirus	1.4e-05	31.7
BBF48421.1\|2800410_2801475_-	bifunctional transcriptional activator/DNA repair enzyme Ada	A0A0G2Y1B6	Acanthamoeba_polyphaga_mimivirus	1.8e-18	50.5
BBF48422.1\|2801548_2802604_-	thiamine-synthetic flavin transferase lipoprotein	NA	NA	NA	NA
BBF48423.1\|2802715_2803807_-	outer membrane porin OmpC	Q1MVN1	Enterobacteria_phage	9.4e-119	60.1
BBF48424.1\|2804545_2807218_+	phosphotransfer intermediate protein in two-component regulatory system with RcsBC	NA	NA	NA	NA
BBF48425.1\|2807234_2807885_+	two-component regulatory system response regulator RcsB	NA	NA	NA	NA
2807940:2807975	attL	NA	NA	NA	NA
BBF48426.1\|2808084_2810934_-	hybrid sensory kinase in two-component regulatory system with RcsB and YojN	A0A1V0SGX0	Hokovirus	1.4e-41	27.2
BBF48427.1\|2811208_2811985_-	hypothetical protein	NA	NA	NA	NA
BBF48428.1\|2811989_2813639_-	hypothetical protein	NA	NA	NA	NA
BBF48429.1\|2813639_2818244_-	alpha-2-macroglobulin family protein	NA	NA	NA	NA
BBF48430.1\|2818835_2820158_+	T3SS secreted effector NleA	H6WZN2	Escherichia_phage	9.7e-227	85.5
BBF48431.1\|2820851_2821385_-	T3SS secreted effector NleG	B6DZC0	Enterobacteria_phage	6.4e-28	42.0
BBF48432.1\|2821527_2821854_+\|transposase	IS629 transposase OrfA	A0A0N7BVE9	Escherichia_phage	1.3e-55	100.0
BBF48433.1\|2821853_2822741_+\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	1.6e-169	100.0
BBF48434.1\|2822780_2823305_-	hypothetical protein	A0A0N7CEE8	Salmonella_phage	1.2e-84	89.7
BBF48435.1\|2823454_2823892_-	phage murein endopeptidase	A0A0P0ZBQ9	Stx2-converting_phage	5.0e-71	97.9
BBF48436.1\|2823888_2824386_-	phage lysozyme	A0A1B5FP97	Escherichia_phage	1.9e-90	98.2
BBF48437.1\|2824385_2824601_-\|holin	phage holine protein	A0A0P0ZC45	Stx2-converting_phage	4.5e-33	98.6
BBF48438.1\|2825663_2826221_-	membrane protein	NA	NA	NA	NA
BBF48439.1\|2826473_2827097_-	phage antitermination protein Q	K7PM87	Enterobacteria_phage	9.8e-113	98.6
BBF48440.1\|2827093_2827759_-	serine/threonine-specific protein phosphatase 1	Q5TJL8	Enterobacteria_phage	5.0e-131	99.5
BBF48441.1\|2827755_2828358_-	recombination endonuclease	A0A1U9AJF8	Stx1_converting_phage	1.6e-91	94.6
BBF48442.1\|2828332_2828899_-	hypothetical protein	A0A1U9AJK5	Stx1_converting_phage	6.6e-108	99.5
BBF48443.1\|2828891_2829008_-	hypothetical protein	NA	NA	NA	NA
BBF48444.1\|2829392_2830361_+	hypothetical protein	A0A1U9AJG3	Stx1_converting_phage	6.3e-151	99.7
BBF48445.1\|2830399_2831227_+	hypothetical protein	A0A1U9AJG3	Stx1_converting_phage	1.6e-150	99.6
BBF48446.1\|2832069_2832414_+	hypothetical protein	K7PJY7	Enterobacterial_phage	5.3e-60	100.0
BBF48447.1\|2832715_2833786_+\|integrase	integrase	K7PHK0	Enterobacteria_phage	1.1e-196	98.0
2839808:2839843	attR	NA	NA	NA	NA

DBSCAN-SWA_19

2927543 : 3061775

159

Escherichia_phage(60.34%)

integrase,terminase,transposase,protease,capsid,head,tail,lysis,portal,tRNA

attL 2959096:2959119|attR 3061971:3061994

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBF48534.1\|2927543_2928356_-\|tRNA	tRNA pseudouridine(38-40) synthase	NA	NA	NA	NA
BBF48535.1\|2928355_2929369_-	semialdehyde dehydrogenase	NA	NA	NA	NA
BBF48536.1\|2929434_2930571_-	erythronate-4-phosphate dehydrogenase	A0A2R8FDS8	Brazilian_cedratvirus	5.9e-23	29.1
BBF48537.1\|2930669_2931665_+	flagella assembly protein	NA	NA	NA	NA
BBF48538.1\|2931661_2932840_-	arabinose efflux transporter	NA	NA	NA	NA
BBF48539.1\|2933123_2934344_-	3-oxoacyl-[acyl-carrier-protein] synthase I	NA	NA	NA	NA
BBF48540.1\|2934502_2936509_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
BBF48541.1\|2936629_2936908_-	hypothetical protein	NA	NA	NA	NA
BBF48542.1\|2936941_2937490_-	elongation factor	NA	NA	NA	NA
BBF48543.1\|2937489_2938299_-	TauE/TSUP family inner membrane protein	NA	NA	NA	NA
BBF48544.1\|2938298_2939123_-	penicillin-insensitive murein endopeptidase	NA	NA	NA	NA
BBF48545.1\|2939126_2940212_-	chorismate synthase	A0A291AU41	Pandoravirus	9.1e-90	48.4
BBF48546.1\|2940246_2941179_-	adenine-specific methylase	NA	NA	NA	NA
BBF48547.1\|2941344_2941896_+	DNA endonuclease	NA	NA	NA	NA
BBF48548.1\|2941968_2942820_-	outer membrane protein	NA	NA	NA	NA
BBF48549.1\|2942821_2943361_-	fimbrial-like adhesin protein	NA	NA	NA	NA
BBF48550.1\|2943357_2943846_-	fimbrial-like adhesin protein	NA	NA	NA	NA
BBF48551.1\|2943842_2944352_-	fimbrial-like adhesin protein	NA	NA	NA	NA
BBF48552.1\|2944367_2945120_-	periplasmic pilin chaperone	NA	NA	NA	NA
BBF48553.1\|2945139_2947785_-	outer membrane usher protein	NA	NA	NA	NA
BBF48554.1\|2947866_2948430_-	fimbrial-like adhesin protein	NA	NA	NA	NA
BBF48555.1\|2949113_2949599_-	phosphohistidine phosphatase	NA	NA	NA	NA
BBF48556.1\|2949801_2951946_-	fatty acid oxidation complex subunit alpha	NA	NA	NA	NA
BBF48557.1\|2951945_2953256_-	beta-ketoacyl-CoA thiolase	NA	NA	NA	NA
BBF48558.1\|2953435_2953720_-	hypothetical protein	NA	NA	NA	NA
BBF48559.1\|2954091_2955432_+	long-chain fatty acid outer membrane transporter	NA	NA	NA	NA
BBF48560.1\|2955798_2956857_+	hypothetical protein	NA	NA	NA	NA
BBF48561.1\|2957038_2957794_-	phospholipid-binding lipoprotein	NA	NA	NA	NA
BBF48562.1\|2958087_2959020_+	inner membrane protein	E7DYY8	Enterobacteria_phage	1.2e-167	100.0
2959096:2959119	attL	NA	NA	NA	NA
BBF48563.1\|2959241_2967596_-	hypothetical protein	Q08J70	Stx2-converting_phage	0.0e+00	96.8
BBF48564.1\|2967665_2968931_-	hypothetical protein	Q08J71	Stx2-converting_phage	1.7e-204	100.0
BBF48565.1\|2968941_2969193_-	hypothetical protein	A0A2R2Z351	Escherichia_phage	7.9e-13	100.0
BBF48566.1\|2969203_2969650_-	hypothetical protein	Q08J73	Stx2-converting_phage	1.1e-76	100.0
BBF48567.1\|2969652_2970306_-	hypothetical protein	Q08J74	Stx2-converting_phage	9.3e-114	100.0
BBF48568.1\|2970399_2970801_-	hypothetical protein	Q08J75	Stx2-converting_phage	7.0e-72	100.0
BBF48569.1\|2970857_2970998_-	hypothetical protein	A0A2R2X2B4	Escherichia_phage	3.1e-19	100.0
BBF48570.1\|2971230_2971968_-	outer membrane precursor protein Lom	A0A2L1IV31	Escherichia_phage	1.1e-110	81.2
BBF48571.1\|2972047_2972665_-	hypothetical protein	A0A2L1IV83	Escherichia_phage	3.7e-120	98.0
BBF48572.1\|2972670_2972949_-	outer membrane protein	A0A2L1IV69	Escherichia_phage	2.6e-49	100.0
BBF48573.1\|2972963_2974232_-\|tail	phage tail fiber protein	A0A2R2Z364	Escherichia_phage	7.1e-219	99.5
BBF48574.1\|2974228_2975854_-	hypothetical protein	A0A1I9LJT3	Stx_converting_phage	0.0e+00	99.3
BBF48575.1\|2976148_2976337_-	hypothetical protein	A0A2R2Z344	Escherichia_phage	6.9e-30	100.0
BBF48576.1\|2976476_2976725_-	hypothetical protein	A0A1I9LJT0	Stx_converting_phage	2.3e-41	100.0
BBF48577.1\|2976779_2977667_-\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	1.6e-169	100.0
BBF48578.1\|2977666_2977993_-\|transposase	IS629 transposase OrfA	A0A0N7BVE9	Escherichia_phage	1.3e-55	100.0
BBF48579.1\|2978060_2979998_-\|tail	phage tail fiber protein	A0A1I9LJS9	Stx_converting_phage	1.1e-64	100.0
BBF48580.1\|2979994_2980645_-	hypothetical protein	A0A2R2X2B3	Escherichia_phage	7.8e-121	100.0
BBF48581.1\|2980644_2981208_-	hypothetical protein	A0A2R2Z349	Escherichia_phage	3.2e-102	100.0
BBF48582.1\|2981191_2981653_-	hypothetical protein	A0A2R2Z354	Escherichia_phage	3.0e-74	99.3
BBF48583.1\|2981702_2982092_-	hypothetical protein	A0A2R2Z353	Escherichia_phage	9.9e-63	100.0
BBF48584.1\|2982147_2983362_-\|capsid	phage major capsid protein	A0A2R2Z358	Escherichia_phage	1.3e-233	100.0
BBF48585.1\|2983385_2984393_-	hypothetical protein	A0A2R2Z355	Escherichia_phage	2.3e-180	100.0
BBF48586.1\|2984550_2986695_-\|portal	phage portal protein	A0A2R2Z346	Escherichia_phage	0.0e+00	100.0
BBF48587.1\|2986694_2988401_-\|terminase	phage terminase large subunit	G9L6K0	Escherichia_phage	0.0e+00	100.0
BBF48588.1\|2988381_2989188_-\|terminase	phage terminase	A0A2R2Z334	Escherichia_phage	7.6e-134	100.0
BBF48589.1\|2989596_2989890_+	Bor protein precursor	A0A2R2X2B2	Escherichia_phage	6.8e-48	100.0
BBF48590.1\|2989921_2990386_-	endopeptidase	A0A2R2Z341	Escherichia_phage	5.8e-78	100.0
BBF48591.1\|2990393_2990543_-	hypothetical protein	A0A0P0ZFU6	Escherichia_phage	2.4e-17	100.0
BBF48592.1\|2990542_2991112_-	phage antirepressor	A0A2R2Z339	Escherichia_phage	3.4e-104	98.9
BBF48593.1\|2991382_2991916_-	phage endolysin	A0A1I9LJR4	Stx_converting_phage	3.9e-102	98.9
BBF48594.1\|2991920_2992136_-\|lysis	phage lysis protein	Q9ZWW2	Enterobacteria_phage	6.9e-34	100.0
BBF48595.1\|2992212_2992458_-	hypothetical protein	S5MW40	Escherichia_phage	2.2e-15	90.1
BBF48596.1\|2992814_2994752_-	hypothetical protein	A0A0P0ZGE0	Escherichia_phage	0.0e+00	99.2
BBF48597.1\|2995987_2997082_-	restriction enzyme BgcI subunit beta	NA	NA	NA	NA
BBF48598.1\|2997141_2999103_-	type I restriction-modification enzyme M subunit	A0A2H4JBT5	uncultured_Caudovirales_phage	6.3e-81	36.7
BBF48599.1\|2999593_2999749_-	regulatory protein MokC for HokC	A0A1I9LJU7	Stx_converting_phage	1.6e-16	92.2
BBF48600.1\|2999948_3000374_-	antiterminator	Q777W5	Enterobacteria_phage	1.2e-53	73.2
BBF48601.1\|3000366_3000567_-	hypothetical protein	G9L694	Escherichia_phage	1.2e-27	92.4
BBF48602.1\|3000563_3001127_-	recombination endonuclease	A0A0P0ZG59	Escherichia_phage	1.3e-103	98.4
BBF48603.1\|3001134_3001389_-	hypothetical protein	A0A0P0ZFW0	Escherichia_phage	3.1e-33	100.0
BBF48604.1\|3001477_3002215_-	DNA modification protein	A0A0C4UQZ7	Shigella_phage	1.7e-103	79.0
BBF48605.1\|3002483_3002948_+	hypothetical protein	NA	NA	NA	NA
BBF48606.1\|3002986_3003232_-	hypothetical protein	NA	NA	NA	NA
BBF48607.1\|3003267_3003450_-	hypothetical protein	S5MBZ5	Escherichia_phage	1.3e-09	54.4
BBF48608.1\|3003596_3005636_-	hypothetical protein	S5MDQ7	Escherichia_phage	4.3e-274	79.4
BBF48609.1\|3005735_3006296_-	DNA-invertase	A0A0C4UR34	Shigella_phage	4.3e-75	75.7
BBF48610.1\|3006800_3007364_+\|tail	phage tail fiber assembly protein	A0A0U2QV64	Escherichia_phage	1.3e-42	52.5
BBF48611.1\|3007355_3007511_-\|tail	phage tail fiber	A0A0U2SAV1	Escherichia_phage	8.8e-15	73.5
BBF48612.1\|3007590_3008265_-\|tail	phage tail fiber	C9DGQ8	Escherichia_phage	4.3e-37	43.8
BBF48613.1\|3008264_3008825_-\|tail	phage tail protein	C9DGQ7	Escherichia_phage	2.3e-44	48.1
BBF48614.1\|3008815_3009898_-	hypothetical protein	A0A0C4UQU9	Shigella_phage	1.1e-98	53.2
BBF48615.1\|3009897_3010335_-	hypothetical protein	A0A0C4UR04	Shigella_phage	1.9e-38	53.5
BBF48616.1\|3010327_3010942_-	hypothetical protein	A0A0C4UQZ3	Shigella_phage	4.7e-51	51.0
BBF48617.1\|3010931_3012056_-\|tail	phage tail protein	C9DGQ3	Escherichia_phage	6.5e-91	48.5
BBF48618.1\|3012039_3013389_-	DMT family permease	C9DGQ2	Escherichia_phage	7.7e-54	33.1
BBF48619.1\|3013375_3015451_-	phage tape measure protein	A0A0C4UQU8	Shigella_phage	6.2e-71	37.7
BBF48620.1\|3015577_3016054_-	hypothetical protein	A0A0C4UR03	Shigella_phage	1.0e-21	50.8
BBF48621.1\|3016068_3016434_-\|tail	phage tail protein	C9DGP8	Escherichia_phage	2.0e-25	51.7
BBF48622.1\|3016442_3017945_-\|tail	phage tail sheath protein	C9DGP7	Escherichia_phage	1.5e-138	51.5
BBF48623.1\|3017941_3018187_-	hypothetical protein	C9DGP6	Escherichia_phage	2.8e-07	54.5
BBF48624.1\|3018187_3018748_-	hypothetical protein	A0A0C4UQU7	Shigella_phage	1.6e-42	48.3
BBF48625.1\|3018744_3019164_-	hypothetical protein	A0A0C4UR02	Shigella_phage	1.8e-33	53.6
BBF48626.1\|3019160_3019544_-	hypothetical protein	NA	NA	NA	NA
BBF48627.1\|3019587_3020535_-\|head	phage major head subunit	A0A0C4UQR9	Shigella_phage	1.2e-122	67.2
BBF48628.1\|3020534_3021659_-\|protease	protease	A0A0C4UQU6	Shigella_phage	7.5e-79	47.6
BBF48629.1\|3021835_3022309_-	phage morphogenesis protein	A0A0C4UR01	Shigella_phage	6.0e-38	53.9
BBF48630.1\|3022430_3023762_-\|head	phage head morphogenesis protein	A0A0C4UQY9	Shigella_phage	1.6e-152	59.0
BBF48631.1\|3023745_3025335_-	hypothetical protein	A0A0C4UQR8	Shigella_phage	8.5e-169	57.7
BBF48632.1\|3025334_3026999_-\|portal	phage portal protein	A0A0C4UR29	Shigella_phage	2.0e-229	73.0
BBF48633.1\|3026998_3027580_-	hypothetical protein	A0A0C4UQU5	Shigella_phage	1.9e-49	57.0
BBF48634.1\|3027582_3027873_-	hypothetical protein	A0A0C4UR00	Shigella_phage	1.4e-24	62.1
BBF48635.1\|3027865_3028177_-	hypothetical protein	NA	NA	NA	NA
BBF48636.1\|3028157_3028451_-	hypothetical protein	NA	NA	NA	NA
BBF48637.1\|3028597_3029098_-	hypothetical protein	NA	NA	NA	NA
BBF48638.1\|3029060_3029561_-	phage lysozyme	B6SD29	Bacteriophage	3.0e-27	42.6
BBF48639.1\|3029632_3030058_-	transcription regulator	NA	NA	NA	NA
BBF48640.1\|3030127_3030637_-	hypothetical protein	A0A0C4UQU3	Shigella_phage	5.1e-27	42.4
BBF48641.1\|3030633_3030930_-	hypothetical protein	NA	NA	NA	NA
BBF48642.1\|3030919_3031117_-	hypothetical protein	A0A291AXE7	Shigella_phage	1.2e-05	34.5
BBF48643.1\|3031109_3031442_-	hypothetical protein	NA	NA	NA	NA
BBF48644.1\|3031457_3031826_-	hypothetical protein	NA	NA	NA	NA
BBF48645.1\|3031822_3032134_-	hypothetical protein	NA	NA	NA	NA
BBF48646.1\|3032130_3032679_-	hypothetical protein	NA	NA	NA	NA
BBF48647.1\|3032685_3033201_-	hypothetical protein	C9DGM0	Escherichia_phage	6.5e-46	54.2
BBF48648.1\|3033200_3033734_-	hypothetical protein	A0A0C4UQU2	Shigella_phage	2.8e-68	67.8
BBF48649.1\|3033737_3034280_-	hypothetical protein	A0A0C4UQZ6	Shigella_phage	4.9e-28	40.0
BBF48650.1\|3034377_3034908_-	host-nuclease inhibitor protein	C9DGL8	Escherichia_phage	1.9e-48	57.1
BBF48651.1\|3034919_3035213_-	hypothetical protein	NA	NA	NA	NA
BBF48652.1\|3035217_3035490_-	hypothetical protein	NA	NA	NA	NA
BBF48653.1\|3035486_3035768_-	hypothetical protein	I6WB15	Burkholderia_virus	2.8e-11	47.4
BBF48654.1\|3035769_3036024_-	hypothetical protein	NA	NA	NA	NA
BBF48655.1\|3036036_3036258_-	hypothetical protein	NA	NA	NA	NA
BBF48656.1\|3036260_3037193_-	DNA transposition protein	A0A0C4UQR3	Shigella_phage	3.1e-70	48.7
BBF48657.1\|3037264_3039355_-	DNA transposition protein	A0A2D1GNK9	Pseudomonas_phage	6.8e-166	47.4
BBF48658.1\|3039795_3040326_+	regulatory protein	A0A2D1GNR8	Pseudomonas_phage	3.7e-36	62.4
BBF48659.1\|3040563_3040815_-	hypothetical protein	A0A2R2Z328	Escherichia_phage	2.4e-41	100.0
BBF48660.1\|3040814_3041786_-	DNA primase	A0A0H4IPK0	Shigella_phage	9.4e-195	99.7
BBF48661.1\|3041775_3043296_-	helicase	A0A0N7KZV6	Escherichia_phage	8.6e-304	98.8
BBF48662.1\|3043289_3043676_-	hypothetical protein	A0A286S263	Klebsiella_phage	2.6e-23	44.8
BBF48663.1\|3043897_3044161_-	hypothetical protein	A0A0N7BYT1	Escherichia_phage	2.9e-42	98.8
BBF48664.1\|3044209_3044413_-	phage repressor Cro	A0A2R2Z333	Escherichia_phage	9.8e-30	98.5
BBF48665.1\|3044508_3045222_+	phage repressor protein CI	A0A2R2X2B0	Escherichia_phage	6.3e-132	100.0
BBF48666.1\|3045316_3046786_+	modification methyltransferase	A0A2L1IV91	Escherichia_phage	4.3e-284	99.4
BBF48667.1\|3046782_3047736_+	type II site-specific deoxyribonuclease	A0A0P0ZG22	Escherichia_phage	3.5e-186	99.7
BBF48668.1\|3048490_3049135_+	hypothetical protein	A0A0H4IQ68	Shigella_phage	7.5e-92	79.5
BBF48669.1\|3049404_3050043_+	antirepressor	A0A0P0ZG08	Escherichia_phage	7.0e-106	87.3
BBF48670.1\|3050113_3050326_+	phage cell division inhibitor protein	A0A0P0ZGD1	Escherichia_phage	5.8e-33	100.0
BBF48671.1\|3050337_3050619_+	AbrB family transcriptional regulator	A0A0P0ZGC3	Escherichia_phage	8.7e-45	98.9
BBF48672.1\|3050639_3050921_+	hypothetical protein	A0A0P0ZFG3	Escherichia_phage	1.4e-47	98.9
BBF48673.1\|3050938_3051889_+	phage DNA recombination protein Bet	A0A0P0ZFY9	Escherichia_phage	5.4e-179	99.7
BBF48674.1\|3051885_3052575_+	exonuclease	A0A0P0ZFI7	Escherichia_phage	5.0e-134	99.1
BBF48675.1\|3052574_3053162_+	hypothetical protein	A0A2R2Z318	Escherichia_phage	5.8e-107	99.0
BBF48676.1\|3053236_3053584_+	hypothetical protein	A0A0P0ZGH3	Escherichia_phage	5.9e-59	100.0
BBF48677.1\|3053647_3054469_+	hypothetical protein	A0A2R2Z323	Escherichia_phage	7.2e-148	99.3
BBF48678.1\|3054545_3055022_+	hypothetical protein	A0A2L1IV82	Escherichia_phage	3.4e-81	96.8
BBF48679.1\|3055129_3056008_+	hypothetical protein	A0A2R2Z314	Escherichia_phage	5.5e-178	99.3
BBF48680.1\|3056004_3056208_+	hypothetical protein	A0A2R2Z313	Escherichia_phage	3.0e-31	98.5
BBF48681.1\|3056200_3056440_+	hypothetical protein	A0A2R2Z309	Escherichia_phage	6.7e-38	97.5
BBF48682.1\|3056436_3057201_+	hypothetical protein	G9L6G6	Escherichia_phage	4.6e-56	57.4
BBF48683.1\|3057197_3057746_+	hypothetical protein	A0A076GCN9	Escherichia_phage	7.0e-14	73.6
BBF48684.1\|3057897_3058086_+	hypothetical protein	A0A1I9LJM4	Stx_converting_phage	2.8e-31	100.0
BBF48685.1\|3058087_3058297_+	hypothetical protein	A0A077SL56	Escherichia_phage	4.2e-36	100.0
BBF48686.1\|3058293_3059172_+	hypothetical protein	A0A077SK54	Escherichia_phage	3.7e-97	63.6
BBF48687.1\|3059164_3059320_+	hypothetical protein	G3CFH1	Escherichia_phage	9.1e-20	98.0
BBF48688.1\|3059355_3059763_+	hypothetical protein	A0A0P0ZH73	Escherichia_phage	2.0e-50	81.5
BBF48689.1\|3059906_3060140_+	hypothetical protein	G3CFG9	Escherichia_phage	2.3e-35	100.0
BBF48690.1\|3060127_3060379_+	hypothetical protein	G3CFG8	Escherichia_phage	2.9e-39	100.0
BBF48691.1\|3060439_3060622_+	phage excisionase	G3CFG7	Escherichia_phage	4.1e-27	100.0
BBF48692.1\|3060605_3061775_-\|integrase	integrase	G3CFG6	Escherichia_phage	7.5e-231	100.0
3061971:3061994	attR	NA	NA	NA	NA

DBSCAN-SWA_20

3276795 : 3362537

Enterobacteria_phage(70.97%)

integrase,terminase,holin,protease,capsid,plate,tail,portal,tRNA

attL 3260797:3260812|attR 3365466:3365481

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3260797:3260812	attL	NA	NA	NA	NA
BBF48884.1\|3276795_3277299_-\|tRNA	tRNA-specific adenosine deaminase	NA	NA	NA	NA
BBF48885.1\|3277356_3277992_-	phosphatidylglycerophosphatase C	NA	NA	NA	NA
BBF48886.1\|3278200_3279049_+	transcriptional regulator	NA	NA	NA	NA
BBF48887.1\|3279104_3279365_+	ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	1.1e-17	52.3
BBF48888.1\|3280058_3280439_-	holo-[acyl-carrier-protein] synthase 1	NA	NA	NA	NA
BBF48889.1\|3280438_3281170_-	pyridoxine 5'-phosphate synthase	NA	NA	NA	NA
BBF48890.1\|3281181_3281910_-	DNA repair protein RecO	NA	NA	NA	NA
BBF48891.1\|3281921_3282827_-	GTP-binding protein Era	NA	NA	NA	NA
BBF48892.1\|3282823_3283504_-	RNase III	A0A2P0VNZ5	Tetraselmis_virus	5.6e-21	39.6
BBF48893.1\|3283776_3284751_-	leader peptidase	NA	NA	NA	NA
BBF48894.1\|3284766_3286566_-	back-translocating elongation factor EF4	A0A2K9L6L3	Tupanvirus	4.2e-23	41.9
BBF48895.1\|3286763_3287243_-	SoxR iron-sulfur cluster reduction factor component	NA	NA	NA	NA
BBF48896.1\|3287239_3288196_-	anti-sigma E factor	NA	NA	NA	NA
BBF48897.1\|3288195_3288846_-	anti-sigma factor	NA	NA	NA	NA
BBF48898.1\|3288878_3289454_-	RNA polymerase sigma E factor	NA	NA	NA	NA
BBF48899.1\|3289861_3291484_+	L-aspartate oxidase	NA	NA	NA	NA
BBF48900.1\|3291468_3292206_-\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
BBF48901.1\|3292337_3293672_+	ATP-dependent RNA helicase	E3T5E1	Cafeteria_roenbergensis_virus	2.9e-45	30.8
BBF48902.1\|3293881_3294763_-	transcriptional regulator	NA	NA	NA	NA
BBF48903.1\|3294866_3295454_+	cysteine and O-acetylserine exporter	NA	NA	NA	NA
BBF48904.1\|3295509_3295893_-	autonomous glycyl radical cofactor	Q7Y524	Enterobacteria_phage	1.4e-32	72.0
BBF48905.1\|3296196_3296886_+	uracil-DNA-glycosylase	A0A172DS90	Canid_alphaherpesvirus	7.1e-56	48.8
BBF48906.1\|3296933_3297971_-	methyltransferase	NA	NA	NA	NA
BBF48907.1\|3298177_3298597_+	thioredoxin 2	A0A0K2FIM3	Achromobacter_phage	2.8e-15	38.5
BBF48908.1\|3298665_3299364_+	hypothetical protein	NA	NA	NA	NA
BBF48909.1\|3299395_3302056_+	protein lysine acetyltransferase	NA	NA	NA	NA
BBF48910.1\|3302169_3303525_+	phosphatidylserine synthase	NA	NA	NA	NA
BBF48911.1\|3303621_3303894_+	lipoprotein	NA	NA	NA	NA
BBF48912.1\|3303890_3305189_-	alpha-ketoglutarate transporter	Q6JIH2	Burkholderia_virus	1.3e-45	32.2
BBF48913.1\|3311041_3313615_-	chaperone protein ClpB	H6X3M6	Enterobacteria_phage	2.6e-127	35.3
BBF48914.1\|3313744_3314476_-	hypothetical protein	NA	NA	NA	NA
BBF48915.1\|3314472_3315453_-	ribosomal large subunit pseudouridine synthase D	NA	NA	NA	NA
BBF48916.1\|3315587_3316325_+	BamABCDE complex OM biogenesis lipoprotein	NA	NA	NA	NA
BBF48917.1\|3316595_3316937_+	translation inhibitor protein RaiA	NA	NA	NA	NA
BBF48918.1\|3317087_3317888_-	methyltransferase	Q775B4	Bordetella_phage	5.2e-66	53.7
BBF48919.1\|3318228_3318525_-	hypothetical protein	M4ZS56	Bacillus_phage	9.0e-16	67.2
BBF48920.1\|3318660_3318801_-	hypothetical protein	A0A0A7NPZ4	Enterobacteria_phage	7.0e-19	100.0
BBF48921.1\|3318992_3319253_-	phage regulatory protein	NA	NA	NA	NA
BBF48922.1\|3319295_3320405_-	phage late gene regulator	A0A0A7NQ97	Enterobacteria_phage	1.3e-195	94.9
BBF48923.1\|3320562_3321747_+\|tail	phage tail sheath protein	A0A0A7NV69	Enterobacteria_phage	1.6e-225	99.5
BBF48924.1\|3321746_3322259_+\|tail	phage tail tube protein	A0A0A7NPV8	Enterobacteria_phage	3.2e-93	100.0
BBF48925.1\|3322314_3322689_+\|tail	phage tail protein	A0A0A7NPZ0	Enterobacteria_phage	9.0e-37	73.2
BBF48926.1\|3322839_3325647_+\|tail	phage tail protein	A0A0A7NRZ9	Enterobacteria_phage	0.0e+00	96.5
BBF48927.1\|3325659_3326148_+\|tail	phage tail assembly protein	A0A0A7NV65	Enterobacteria_phage	1.4e-85	99.4
BBF48928.1\|3326176_3326776_-	DNA-invertase	A0A0A7NPV4	Enterobacteria_phage	3.8e-98	98.9
BBF48929.1\|3326880_3327717_+\|tail	phage tail protein	Q7Y4D4	Escherichia_virus	3.7e-147	91.4
BBF48930.1\|3327720_3327885_+\|tail	phage tail fiber assembly protein	A0A0A7NRZ7	Enterobacteria_phage	3.4e-17	95.2
BBF48931.1\|3328003_3328249_+\|tail	phage tail fiber assembly protein	A0A077SK10	Escherichia_phage	7.6e-37	100.0
BBF48932.1\|3328277_3328811_-\|tail	phage tail fiber assembly protein	A0A077SL44	Escherichia_phage	1.4e-96	100.0
BBF48933.1\|3328813_3330667_-\|tail	phage tail protein	A0A0A7NV63	Enterobacteria_phage	8.1e-171	77.1
BBF48934.1\|3330669_3331200_-\|tail	phage tail protein	A0A0A7NPV1	Enterobacteria_phage	6.2e-92	98.2
BBF48935.1\|3331192_3332089_-\|plate	phage baseplate assembly protein	A0A0A7NPY5	Enterobacteria_phage	1.3e-153	97.3
BBF48936.1\|3332092_3332443_-\|plate	phage baseplate assembly protein	A0A0A7NQ90	Enterobacteria_phage	9.2e-60	100.0
BBF48937.1\|3332439_3333021_-\|plate	phage baseplate assembly protein	A0A0A7NRZ3	Enterobacteria_phage	1.7e-103	99.5
BBF48938.1\|3333017_3333662_-\|tail	phage tail completion protein	A0A0A7NV60	Enterobacteria_phage	2.7e-113	98.6
BBF48939.1\|3333645_3334113_-\|tail	phage tail protein	A0A0A7NPU6	Enterobacteria_phage	7.6e-86	99.4
BBF48940.1\|3334250_3334658_-	hypothetical protein	A0A0A7NPY2	Enterobacteria_phage	1.6e-63	94.8
BBF48941.1\|3334654_3335047_-	phage endolysin	A0A0A7NQ86	Enterobacteria_phage	5.8e-71	100.0
BBF48942.1\|3335043_3335367_-\|holin	phage holin protein	A0A0A7NRY9	Enterobacteria_phage	6.1e-50	98.1
BBF48943.1\|3335369_3335570_-\|tail	phage tail protein	A0A0A7NV57	Enterobacteria_phage	3.5e-32	100.0
BBF48944.1\|3335569_3336064_-\|capsid	phage capsid completion protein	A0A0A7NPU2	Enterobacteria_phage	2.7e-89	99.4
BBF48945.1\|3336166_3336967_-\|terminase	phage terminase small subunit	A0A0A7NPX9	Enterobacteria_phage	3.2e-124	88.0
BBF48946.1\|3337012_3338065_-\|capsid	phage major capsid protein	A0A0A7NQ82	Enterobacteria_phage	2.3e-194	97.4
BBF48947.1\|3338088_3338925_-	phage scaffolding protein	A0A0A7NRY7	Enterobacteria_phage	2.7e-150	100.0
BBF48948.1\|3339079_3340831_+\|terminase	phage terminase large subunit	A0A0A7NV54	Enterobacteria_phage	0.0e+00	99.0
BBF48949.1\|3340830_3341877_+\|portal	phage portal protein	A0A0A7NPT9	Enterobacteria_phage	1.5e-206	100.0
BBF48950.1\|3342366_3342558_-	hypothetical protein	A0A1J0MGJ9	Serratia_phage	4.1e-14	63.5
BBF48951.1\|3342599_3343322_-	hypothetical protein	Q1MVF7	Enterobacteria_phage	2.8e-34	38.9
BBF48952.1\|3343318_3343528_-	hypothetical protein	A0A077SL56	Escherichia_phage	4.2e-36	100.0
BBF48953.1\|3343529_3344021_-	hypothetical protein	G9L661	Escherichia_phage	7.5e-84	92.6
BBF48954.1\|3344023_3344338_-	hypothetical protein	A0A0A7NRY2	Enterobacteria_phage	8.6e-49	93.3
BBF48955.1\|3344334_3344667_-	carboxylate-amine ligase	A0A0A7NV51	Enterobacteria_phage	1.4e-54	97.2
BBF48956.1\|3344730_3345042_-	plasmid partition protein	A0A0A7NPT5	Enterobacteria_phage	2.5e-48	95.1
BBF48957.1\|3345046_3346006_-	plasmid partition protein	A0A0A7NPX4	Enterobacteria_phage	6.4e-180	99.4
BBF48958.1\|3346082_3348908_-	replication protein	A0A0A7NQ77	Enterobacteria_phage	0.0e+00	87.9
BBF48959.1\|3348904_3349294_-	inositol monophosphatase 1	NA	NA	NA	NA
BBF48960.1\|3349290_3349911_-	hypothetical protein	S5MQL6	Escherichia_phage	1.2e-09	40.4
BBF48961.1\|3349964_3350795_-\|protease	serine protease	A0A0A7NPW9	Enterobacteria_phage	5.6e-132	99.3
BBF48962.1\|3350791_3350995_-	hypothetical protein	A0A0A7NQ74	Enterobacteria_phage	8.3e-29	98.5
BBF48963.1\|3351006_3351306_-	hypothetical protein	A0A0A7NRX6	Enterobacteria_phage	2.1e-41	89.9
BBF48964.1\|3351302_3351548_-	MarR family transcriptional regulator	A0A0A7NV47	Enterobacteria_phage	3.3e-40	98.8
BBF48965.1\|3351544_3351748_-	hypothetical protein	A0A0A7NPS8	Enterobacteria_phage	8.6e-26	85.1
BBF48966.1\|3351834_3351948_-	membrane protein	A0A0A7NPW7	Enterobacteria_phage	2.5e-11	100.0
BBF48967.1\|3351944_3352187_-	hypothetical protein	A0A0A7NQ71	Enterobacteria_phage	2.3e-38	100.0
BBF48968.1\|3352198_3352477_-	hypothetical protein	A0A0A7NRX5	Enterobacteria_phage	2.4e-34	80.4
BBF48969.1\|3352487_3352829_-	hypothetical protein	A0A0A7NV42	Enterobacteria_phage	2.5e-54	91.4
BBF48970.1\|3352847_3353174_-	hypothetical protein	NA	NA	NA	NA
BBF48971.1\|3353269_3353572_+	repressor protein	Q1JS63	Enterobacteria_phage	2.3e-19	52.0
BBF48972.1\|3353638_3354628_+\|integrase	integrase	Q83VS6	Escherichia_phage	3.4e-99	53.5
BBF48973.1\|3354941_3356102_+	chorismate mutase and prephenate dehydratase	NA	NA	NA	NA
BBF48974.1\|3356144_3357266_-	chorismate mutase-T and prephenate dehydrogenase	NA	NA	NA	NA
BBF48975.1\|3357276_3358347_-	3-deoxy-D-arabino-heptulosonate-7-phosphate synthase	A0A0F6R6T6	Escherichia_coli_O157_typing_phage	5.3e-90	51.2
BBF48976.1\|3358559_3358922_+	lipoprotein	NA	NA	NA	NA
BBF48977.1\|3359071_3359590_+	periplasmic inhibitor of YfiN activity	NA	NA	NA	NA
BBF48978.1\|3359579_3360806_+	membrane-anchored diguanylate cyclase	NA	NA	NA	NA
BBF48979.1\|3360821_3361304_+	OM lipoprotein positive effector of YfiN activity	NA	NA	NA	NA
BBF48980.1\|3361380_3361728_-	50S ribosomal subunit protein L19	NA	NA	NA	NA
BBF48981.1\|3361769_3362537_-\|tRNA	tRNA m(1)G37 methyltransferase	NA	NA	NA	NA
3365466:3365481	attR	NA	NA	NA	NA

DBSCAN-SWA_21

3372093 : 3417261

Enterobacteria_phage(75.41%)

integrase,terminase,transposase,protease,tail,portal

attL 3399212:3399227|attR 3423938:3423953

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBF48993.1\|3372093_3372576_+	tmRNA-binding trans-translation protein	W5RAM5	Staphylococcus_phage	4.0e-29	46.8
BBF48994.1\|3372751_3372877_+	hypothetical protein	NA	NA	NA	NA
BBF48995.1\|3373424_3373673_+	DNA-damage-inducible protein DinI	Q687E4	Enterobacteria_phage	2.4e-38	100.0
BBF48996.1\|3374040_3374310_-	hypothetical protein	Q687E5	Enterobacteria_phage	6.4e-45	100.0
BBF48997.1\|3374311_3375634_-\|tail	phage tail fiber protein	Q687E6	Enterobacteria_phage	3.7e-77	99.1
BBF48998.1\|3375698_3376298_-	outer membrane precursor Lom	Q687E7	Enterobacteria_phage	8.8e-111	99.0
BBF48999.1\|3376365_3379842_-	phage host specificity protein	Q687E8	Enterobacteria_phage	0.0e+00	96.6
BBF49000.1\|3380078_3380660_-\|tail	phage tail assembly protein	Q6H9T3	Enterobacteria_phage	7.3e-94	97.4
BBF49001.1\|3380656_3381400_-\|tail	phage tail assembly protein	Q6H9T4	Enterobacteria_phage	1.5e-147	98.4
BBF49002.1\|3381410_3381803_-\|tail	phage minor tail protein	Q687F1	Enterobacteria_phage	9.9e-71	97.7
BBF49003.1\|3381760_3382108_-\|tail	phage minor tail protein	A0A0P0ZBE3	Stx2-converting_phage	2.0e-51	100.0
BBF49004.1\|3382107_3382437_-\|tail	phage minor tail protein	Q687F2	Enterobacteria_phage	4.3e-59	100.0
BBF49005.1\|3382433_3385079_-\|tail	phage tail length tape measure protein	Q9EYE1	Enterobacteria_phage	0.0e+00	99.5
BBF49006.1\|3385122_3385431_-\|tail	phage minor tail protein	Q687F4	Enterobacteria_phage	1.3e-54	100.0
BBF49007.1\|3385457_3385880_-\|tail	phage minor tail protein	Q687F5	Enterobacteria_phage	5.1e-73	100.0
BBF49008.1\|3385893_3386646_-\|tail	phage major tail protein	Q687F6	Enterobacteria_phage	5.8e-136	100.0
BBF49009.1\|3386653_3386809_-\|tail	phage minor tail protein	Q687F7	Enterobacteria_phage	1.1e-22	100.0
BBF49010.1\|3386998_3387325_+\|transposase	IS629 transposase OrfA	A0A0N7BVE9	Escherichia_phage	1.3e-55	100.0
BBF49011.1\|3387324_3388212_+\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	1.6e-169	100.0
BBF49012.1\|3388214_3388361_-\|tail	phage minor tail protein	Q687G0	Enterobacteria_phage	3.5e-21	100.0
BBF49013.1\|3388373_3388997_-\|tail	phage minor tail protein	Q8VNN3	Enterobacteria_phage	8.9e-106	100.0
BBF49014.1\|3388999_3389281_-	DNA breaking-rejoining protein	Q8VNN4	Enterobacteria_phage	2.1e-46	100.0
BBF49015.1\|3389273_3389600_-	membrane protein	Q9EYD5	Enterobacteria_phage	6.1e-50	100.0
BBF49016.1\|3389687_3391712_-\|protease	phage protease/scaffold protein	S5M7Q8	Escherichia_phage	0.0e+00	99.8
BBF49017.1\|3391656_3393159_-\|portal	phage portal protein	Q9EYD2	Enterobacteria_phage	4.8e-291	100.0
BBF49018.1\|3393158_3393371_-	hypothetical protein	Q687G1	Enterobacteria_phage	2.3e-29	98.6
BBF49019.1\|3393367_3395491_-\|terminase	phage terminase large subunit	Q9EYD1	Enterobacteria_phage	0.0e+00	100.0
BBF49020.1\|3395487_3395964_-\|terminase	phage terminase small subunit	Q8VNN8	Enterobacteria_phage	3.3e-84	100.0
BBF49021.1\|3396376_3396844_-	phage endopeptidase	Q7AYI6	Enterobacteria_phage	7.7e-78	100.0
BBF49022.1\|3397627_3397897_-	Shiga toxin 1 subunit B	Q7AYI7	Enterobacteria_phage	1.6e-43	100.0
BBF49023.1\|3397906_3398854_-	Shiga toxin 1 subunit A	Q777W4	Enterobacteria_phage	3.2e-171	100.0
3399212:3399227	attL	NA	NA	NA	NA
BBF49024.1\|3399360_3399552_-	antiterminator	Q777W5	Enterobacteria_phage	2.7e-29	100.0
BBF49025.1\|3399509_3399842_-	antiterminator	Q8VNP1	Enterobacteria_phage	4.3e-51	98.9
BBF49026.1\|3399786_3399981_-	hypothetical protein	G9L694	Escherichia_phage	1.9e-30	100.0
BBF49027.1\|3399977_3400583_-	recombination endonuclease	Q8VNP2	Enterobacteria_phage	1.9e-97	100.0
BBF49028.1\|3400582_3401062_-	hypothetical protein	A0A0P0ZCB2	Stx2-converting_phage	1.9e-84	99.4
BBF49029.1\|3401144_3401306_-	hypothetical protein	Q8VNP4	Enterobacteria_phage	5.6e-20	100.0
BBF49030.1\|3401380_3402085_-	phage antirepressor protein	Q8VNP5	Enterobacteria_phage	9.6e-133	100.0
BBF49031.1\|3402538_3403066_-	DNA methylase	Q9EYC2	Enterobacteria_phage	1.6e-100	100.0
BBF49032.1\|3403062_3403509_-	recombination protein	Q8VNP6	Enterobacteria_phage	2.4e-81	100.0
BBF49033.1\|3403465_3403702_-	hypothetical protein	Q687G3	Enterobacteria_phage	9.3e-40	100.0
BBF49034.1\|3403712_3403928_-	hypothetical protein	A0A0N7KZ98	Stx2-converting_phage	7.7e-33	100.0
BBF49035.1\|3404060_3404339_-	hypothetical protein	Q9EYB9	Enterobacteria_phage	4.4e-49	100.0
BBF49036.1\|3404408_3404678_-	hypothetical protein	Q687G4	Enterobacteria_phage	8.4e-45	100.0
BBF49037.1\|3404677_3406114_-	replication protein	Q8VNP7	Enterobacteria_phage	6.1e-275	100.0
BBF49038.1\|3406103_3407003_-	replication protein	Q8VNP8	Enterobacteria_phage	1.6e-164	100.0
BBF49039.1\|3406995_3407142_-	hypothetical protein	Q687G5	Enterobacteria_phage	1.1e-19	100.0
BBF49040.1\|3407176_3407455_-	phage regulatory protein CII	Q8VNP9	Enterobacteria_phage	3.6e-43	100.0
BBF49041.1\|3407547_3407874_+\|transposase	IS629 transposase OrfA	A0A0N7BVE9	Escherichia_phage	1.3e-55	100.0
BBF49042.1\|3407873_3408422_+\|transposase	IS629 transposase OrfB	Q687G6	Enterobacteria_phage	7.6e-101	100.0
BBF49043.1\|3408555_3408954_+	recombination protein	Q8VNQ0	Enterobacteria_phage	1.8e-72	99.2
BBF49044.1\|3408954_3409467_+	single-stranded DNA-binding protein	Q8VNQ1	Enterobacteria_phage	1.8e-75	100.0
BBF49045.1\|3409480_3409774_+	ABC transporter ATP-binding protein	Q687G7	Enterobacteria_phage	8.5e-51	100.0
BBF49046.1\|3409784_3409952_+	hypothetical protein	Q687G8	Enterobacteria_phage	3.0e-24	100.0
BBF49047.1\|3409948_3410548_+	hypothetical protein	Q8VNQ2	Enterobacteria_phage	1.8e-111	100.0
BBF49048.1\|3410549_3410897_+	hypothetical protein	Q687G9	Enterobacteria_phage	9.4e-65	100.0
BBF49049.1\|3410899_3411787_-\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	1.6e-169	100.0
BBF49050.1\|3411786_3412113_-\|transposase	IS629 transposase OrfA	A0A0N7BVE9	Escherichia_phage	1.3e-55	100.0
BBF49051.1\|3412632_3413139_+\|integrase	integrase	A0A1B5FPC6	Escherichia_phage	2.3e-91	100.0
BBF49052.1\|3413177_3413594_+	hypothetical protein	A0A1B5FPM5	Escherichia_phage	1.1e-72	100.0
BBF49053.1\|3413666_3415415_-	hypothetical protein	A0A1B5FPH1	Escherichia_phage	0.0e+00	99.8
BBF49054.1\|3415416_3417261_-	histidine kinase-like protein	A0A1B5FPD5	Escherichia_phage	5.9e-307	99.7
3423938:3423953	attR	NA	NA	NA	NA

DBSCAN-SWA_22

3488662 : 3495802

Escherichia_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBF49128.1\|3488662_3491224_+	methyl-directed mismatch repair protein MutS	E3T5Q7	Cafeteria_roenbergensis_virus	1.7e-30	20.6
BBF49129.1\|3491329_3491986_+	serine/threonine-specific protein phosphatase 2	A0A222YWF0	Escherichia_phage	5.6e-50	47.4
BBF49130.1\|3492036_3492804_-	DeoR family transcriptional regulator	A0A077SK06	Escherichia_phage	3.3e-70	56.7
BBF49131.1\|3492999_3493908_+	dehydrogenase	A0A077SLF7	Escherichia_phage	3.0e-118	76.9
BBF49132.1\|3493904_3495167_+	hypothetical protein	A0A077SLJ7	Escherichia_phage	3.7e-135	61.4
BBF49133.1\|3495163_3495802_+	class II aldolase	A0A077SK32	Escherichia_phage	1.4e-82	75.0

DBSCAN-SWA_23

3731600 : 3775915

Escherichia_phage(40.0%)

tRNA,protease,integrase,transposase

attL 3765118:3765133|attR 3783159:3783174

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBF49355.1\|3731600_3732359_+\|protease	metalloprotease	NA	NA	NA	NA
BBF49356.1\|3732414_3733158_-	4-hydroxy-2-ketovalerate aldolase	NA	NA	NA	NA
BBF49357.1\|3733144_3734254_-	transferase	NA	NA	NA	NA
BBF49358.1\|3734257_3735115_-	PTS fructose transporter subunit IID	NA	NA	NA	NA
BBF49359.1\|3735114_3735864_-	enzyme IIC component of PTS	NA	NA	NA	NA
BBF49360.1\|3735889_3736375_-	enzyme IIB component of PTS	NA	NA	NA	NA
BBF49361.1\|3736385_3736814_-	enzyme IIB component of PTS	NA	NA	NA	NA
BBF49362.1\|3736932_3739773_-	transcriptional regulator	NA	NA	NA	NA
BBF49363.1\|3739989_3740910_-	agmatinase	NA	NA	NA	NA
BBF49364.1\|3741045_3741777_-	lipoprotein	NA	NA	NA	NA
BBF49365.1\|3741922_3743899_-	biosynthetic arginine decarboxylase	NA	NA	NA	NA
BBF49366.1\|3744386_3744638_-	inner membrane protein	NA	NA	NA	NA
BBF49367.1\|3744693_3745848_+	S-adenosylmethionine synthetase	A0A2H4PQS6	Staphylococcus_phage	4.0e-128	63.2
BBF49368.1\|3746283_3747678_+	D-galactose transporter	NA	NA	NA	NA
BBF49369.1\|3747796_3748252_+	hypothetical protein	NA	NA	NA	NA
BBF49370.1\|3748346_3749054_+	DNA-specific endonuclease I	NA	NA	NA	NA
BBF49371.1\|3749133_3749865_+	16S rRNA m(3)U1498 methyltransferase	NA	NA	NA	NA
BBF49372.1\|3749877_3750828_+	glutathione synthetase	NA	NA	NA	NA
BBF49373.1\|3750864_3751500_+	hypothetical protein	NA	NA	NA	NA
BBF49374.1\|3751499_3751916_+	holliday junction resolvase	NA	NA	NA	NA
BBF49375.1\|3752091_3753072_-	twitching motility protein PilT	NA	NA	NA	NA
BBF49376.1\|3753089_3753794_+	hypothetical protein	NA	NA	NA	NA
BBF49377.1\|3753811_3754378_+	hypothetical protein	NA	NA	NA	NA
BBF49378.1\|3754374_3754665_+	hypothetical protein	NA	NA	NA	NA
BBF49379.1\|3754672_3755266_+	dITP/XTP pyrophosphatase	NA	NA	NA	NA
BBF49380.1\|3755258_3756395_+	oxidoreductase	NA	NA	NA	NA
BBF49381.1\|3756707_3757694_+	C4-dicarboxylate-binding periplasmic protein	NA	NA	NA	NA
BBF49382.1\|3757738_3758242_+	C4-dicarboxylate ABC transporter permease	NA	NA	NA	NA
BBF49383.1\|3758241_3759543_+	C4-dicarboxylate transport system large permease component	NA	NA	NA	NA
BBF49384.1\|3759598_3760606_-	hypothetical protein	NA	NA	NA	NA
BBF49385.1\|3760722_3761769_-	periplasmic L-asparaginase 2	NA	NA	NA	NA
BBF49386.1\|3761944_3762664_-	hypothetical protein	NA	NA	NA	NA
BBF49387.1\|3762847_3763174_-	hypothetical protein	NA	NA	NA	NA
BBF49388.1\|3763173_3763893_-\|tRNA	tRNA m(7)G46 methyltransferase	NA	NA	NA	NA
BBF49389.1\|3764053_3765106_+	adenine DNA glycosylase	NA	NA	NA	NA
3765118:3765133	attL	NA	NA	NA	NA
BBF49390.1\|3765133_3765409_+	oxidative damage protective factor for iron-sulfur proteins	NA	NA	NA	NA
BBF49391.1\|3765473_3766553_+	membrane-bound lytic murein transglycosylase C	NA	NA	NA	NA
BBF49392.1\|3766754_3768011_+	nucleoside transporter	NA	NA	NA	NA
BBF49393.1\|3768060_3770196_-	ornithine decarboxylase isozyme	NA	NA	NA	NA
BBF49394.1\|3770593_3771301_+	inner membrane protein	NA	NA	NA	NA
BBF49395.1\|3771679_3772939_+\|integrase	integrase	A0A1B0VMI6	Pseudomonas_phage	8.4e-79	42.8
BBF49396.1\|3773055_3773307_-\|transposase	ISEc8 transposase	A0A0P0ZBS5	Stx2-converting_phage	2.8e-42	98.8
BBF49397.1\|3773382_3773709_+\|transposase	IS629 transposase OrfA	A0A0N7BVE9	Escherichia_phage	1.3e-55	100.0
BBF49398.1\|3773708_3774596_+\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	1.6e-169	100.0
BBF49399.1\|3774955_3775915_+\|transposase	ISEc13 transposase	NA	NA	NA	NA
3783159:3783174	attR	NA	NA	NA	NA

DBSCAN-SWA_24

3781039 : 3824234

Shigella_phage(42.86%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBF49403.1\|3781039_3781270_+\|transposase	IS630 transposase	NA	NA	NA	NA
BBF49404.1\|3781333_3781894_+\|transposase	IS630 transposase	NA	NA	NA	NA
BBF49405.1\|3782521_3783295_-	hypothetical protein	NA	NA	NA	NA
BBF49406.1\|3783467_3784613_-	T3SS secreted effector EspG	NA	NA	NA	NA
BBF49407.1\|3785099_3785966_-\|transposase	IS3 transposase OrfB	A0A0P0I4A4	Acinetobacter_phage	3.9e-51	40.6
BBF49408.1\|3785962_3786262_-\|transposase	IS3 transposase OrfA	NA	NA	NA	NA
BBF49409.1\|3786776_3787565_-	T3SS secreted effector EspF	NA	NA	NA	NA
BBF49410.1\|3787760_3788039_-	T3SS component EscG	NA	NA	NA	NA
BBF49411.1\|3788044_3788266_-	T3SS structure protein EscF	NA	NA	NA	NA
BBF49412.1\|3788300_3788708_-	T3SS chaperone CesD2	NA	NA	NA	NA
BBF49413.1\|3788714_3789677_-	T3SS translocator EspB	NA	NA	NA	NA
BBF49414.1\|3789697_3790840_-	T3SS translocator EspD	NA	NA	NA	NA
BBF49415.1\|3790852_3791431_-	T3SS translocator EspA	NA	NA	NA	NA
BBF49416.1\|3791489_3792545_-	T3SS secretion switching protein SepL	NA	NA	NA	NA
BBF49417.1\|3792726_3793908_+	T3SS structure protein EscD	NA	NA	NA	NA
BBF49418.1\|3794196_3797004_-	intimin	NA	NA	NA	NA
BBF49419.1\|3797061_3797532_-	T3SS chaperone CesT	NA	NA	NA	NA
BBF49420.1\|3797666_3799322_-	T3SS translocated intimin receptor Tir	NA	NA	NA	NA
BBF49421.1\|3799644_3800130_-	T3SS secreted effector Map	NA	NA	NA	NA
BBF49422.1\|3800520_3800883_+	T3SS chaperone CesF	NA	NA	NA	NA
BBF49423.1\|3801061_3801571_-	T3SS secreted effector EspH	NA	NA	NA	NA
BBF49424.1\|3801601_3802519_-	T3SS structure protein SepQ	NA	NA	NA	NA
BBF49425.1\|3802890_3803211_-	T3SS component	NA	NA	NA	NA
BBF49426.1\|3803270_3804611_-	T3SS structure protein EscN	NA	NA	NA	NA
BBF49427.1\|3804594_3806622_-	T3SS structure protein EscV	NA	NA	NA	NA
BBF49428.1\|3806618_3806972_-	regulator Mpc	NA	NA	NA	NA
BBF49429.1\|3807156_3807453_+	T3SS secreted effector EspZ	NA	NA	NA	NA
BBF49430.1\|3807484_3807913_+	T3SS component	NA	NA	NA	NA
BBF49431.1\|3807915_3808488_+	T3SS structure protein EscJ	NA	NA	NA	NA
BBF49432.1\|3808493_3808949_+	T3SS secretion switching protein SepD	NA	NA	NA	NA
BBF49433.1\|3808948_3810487_+	T3SS structure protein EscC	D0U184	Enterobacteria_phage	1.0e-09	29.3
BBF49434.1\|3810500_3810956_+	T3SS chaperone CesD	NA	NA	NA	NA
BBF49435.1\|3811339_3811753_-	positive regulator GrlA	NA	NA	NA	NA
BBF49436.1\|3811808_3812180_-	negative regulator GrlR	NA	NA	NA	NA
BBF49437.1\|3812375_3812834_+	hypothetical protein	NA	NA	NA	NA
BBF49438.1\|3812830_3813868_-	T3SS structure protein EscU	NA	NA	NA	NA
BBF49439.1\|3813860_3814637_-	T3SS structure protein EscT	NA	NA	NA	NA
BBF49440.1\|3814636_3814906_-	T3SS structure protein EscS	NA	NA	NA	NA
BBF49441.1\|3814905_3815559_-	T3SS structure protein EscR	NA	NA	NA	NA
BBF49442.1\|3815563_3816217_-	T3SS component	NA	NA	NA	NA
BBF49443.1\|3816203_3816803_-	T3SS component	NA	NA	NA	NA
BBF49444.1\|3816799_3817114_-	T3SS component	NA	NA	NA	NA
BBF49445.1\|3817126_3817345_-	T3SS component	NA	NA	NA	NA
BBF49446.1\|3817359_3817731_-	transcription regulator Ler	NA	NA	NA	NA
BBF49447.1\|3818586_3819426_-\|transposase	IS2 transposase	Q9ZXG3	Shigella_phage	1.7e-152	92.5
BBF49448.1\|3819772_3820099_+\|transposase	IS629 transposase OrfA	A0A0N7BVE9	Escherichia_phage	1.3e-55	100.0
BBF49449.1\|3820098_3820986_+\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	1.6e-169	100.0
BBF49450.1\|3822037_3822139_-	regulatory protein	NA	NA	NA	NA
BBF49451.1\|3822329_3822533_-	hypothetical protein	NA	NA	NA	NA
BBF49452.1\|3823056_3823368_+\|transposase	IS602 transposase	Q716C1	Shigella_phage	2.4e-11	40.8
BBF49453.1\|3823487_3824234_+\|transposase	IS602 transposase	Q716C2	Shigella_phage	4.3e-83	59.0

DBSCAN-SWA_25

4064242 : 4120928

Escherichia_phage(15.79%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBF49681.1\|4064242_4065130_-\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	1.6e-169	100.0
BBF49682.1\|4065129_4065456_-\|transposase	IS629 transposase OrfA	A0A0N7BVE9	Escherichia_phage	1.3e-55	100.0
BBF49683.1\|4065461_4066526_-	EptAB family phosphoethanolamine transferase	NA	NA	NA	NA
BBF49684.1\|4067085_4067418_-	preprotein translocase membrane subunit SecG	NA	NA	NA	NA
BBF49685.1\|4067645_4068983_-	phosphoglucosamine mutase	NA	NA	NA	NA
BBF49686.1\|4068975_4069824_-	7,8-dihydropteroate synthase	S4W084	Pandoravirus	3.4e-23	29.9
BBF49687.1\|4069913_4071857_-\|protease	ATP-dependent zinc-metallo protease	G8DDJ2	Micromonas_pusilla_virus	6.4e-118	43.6
BBF49688.1\|4071947_4072577_-	23S rRNA U2552 2'-O-ribose methyltransferase	NA	NA	NA	NA
BBF49689.1\|4072702_4072996_+	RNA binding protein associated with pre-50S ribosomal subunits	NA	NA	NA	NA
BBF49690.1\|4073151_4073628_-	transcript cleavage factor	NA	NA	NA	NA
BBF49691.1\|4073875_4075309_+	D-alanyl-D-alanine carboxypeptidase, penicillin-binding protein 4	NA	NA	NA	NA
BBF49692.1\|4075348_4076521_-	GTPase involved in cell partitioning and DNA repair	NA	NA	NA	NA
BBF49693.1\|4076536_4077502_-	inner membrane transporter	NA	NA	NA	NA
BBF49694.1\|4077628_4077886_-	50S ribosomal subunit protein L27	NA	NA	NA	NA
BBF49695.1\|4077906_4078218_-	50S ribosomal subunit protein L21	NA	NA	NA	NA
BBF49696.1\|4078476_4079448_+	octaprenyl diphosphate synthase	A0A1V0SE37	Indivirus	6.0e-08	25.8
BBF49697.1\|4079674_4079953_+	transcriptional regulator	A0A2I7S995	Vibrio_phage	2.6e-17	71.4
BBF49698.1\|4080000_4081260_-	UDP-N-acetylglucosamine 1-carboxyvinyltransferase	NA	NA	NA	NA
BBF49699.1\|4081314_4081584_-	acid stress protein	NA	NA	NA	NA
BBF49700.1\|4081728_4082022_-	phospholipid ABC transporter substrate-binding protein	NA	NA	NA	NA
BBF49701.1\|4082021_4082657_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
BBF49702.1\|4082675_4083236_-	ABC-type organic solvent transporter	NA	NA	NA	NA
BBF49703.1\|4083232_4084015_-	ABC transporter permease	NA	NA	NA	NA
BBF49704.1\|4084022_4084832_-	organic solvent ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.2e-19	29.3
BBF49705.1\|4085041_4086019_+	calcium/sodium:proton antiporter	NA	NA	NA	NA
BBF49706.1\|4086032_4087019_+	D-arabinose 5-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	1.9e-38	31.5
BBF49707.1\|4087039_4087606_+	3-deoxy-D-manno-octulosonate 8-phosphate phosphatase	A0A140XBD6	Dickeya_phage	1.4e-54	75.7
BBF49708.1\|4087602_4088178_+	periplasmic membrane-anchored LPS-binding protein	NA	NA	NA	NA
BBF49709.1\|4088146_4088704_+	lipopolysaccharide export system protein LptA	NA	NA	NA	NA
BBF49710.1\|4088710_4089436_+	lipopolysaccharide export ABC transporter ATPase	A0A2H4PQG7	Staphylococcus_phage	3.2e-22	28.4
BBF49711.1\|4089483_4090917_+	RNA polymerase sigma 54 factor RpoN	NA	NA	NA	NA
BBF49712.1\|4090939_4091227_+	ribosome hibernation promoting factor HPF	A0A0M7QCF2	Escherichia_phage	2.5e-10	44.3
BBF49713.1\|4091344_4091836_+	sugar-specific enzyme IIA component of PTS	NA	NA	NA	NA
BBF49714.1\|4091881_4092736_+	nucleotide-binding protein	A0A0R8VB27	Thermobifida_phage	1.1e-05	28.4
BBF49715.1\|4092732_4093005_+	phosphohistidinoprotein-hexose phosphotransferase component of N-regulated PTS system	NA	NA	NA	NA
BBF49716.1\|4093218_4093851_+	Mg(2+)-starvation-stimulated protein	NA	NA	NA	NA
BBF49717.1\|4093847_4094576_-	biosynthetic peptidoglycan transglycosylase	NA	NA	NA	NA
BBF49718.1\|4094572_4095226_-	isoprenoid biosynthesis protein with amidotransferase-like domain	NA	NA	NA	NA
BBF49719.1\|4095455_4097792_-	aerobic respiration control sensor histidine protein kinase	A0A1V0SGX0	Hokovirus	1.7e-40	31.2
BBF49720.1\|4097887_4098817_-	Fe-S oxidoreductase	A0A2H4PQV5	Staphylococcus_phage	8.8e-17	35.0
BBF49721.1\|4099398_4103952_+	glutamate synthase large subunit	NA	NA	NA	NA
BBF49722.1\|4103964_4105383_+	glutamate synthase small subunit	NA	NA	NA	NA
BBF49723.1\|4105566_4105938_+	hypothetical protein	NA	NA	NA	NA
BBF49724.1\|4106065_4106614_+	hypothetical protein	A0A0U2BZN7	Salmonella_phage	2.3e-73	88.5
BBF49725.1\|4106673_4107138_-	hypothetical protein	NA	NA	NA	NA
BBF49726.1\|4107134_4108010_-	N-acetylmannosamine kinase	NA	NA	NA	NA
BBF49727.1\|4108006_4108696_-	N-acetylmannosamine-6-P epimerase	NA	NA	NA	NA
BBF49728.1\|4108743_4110234_-	sialic acid transporter	Q6JIH2	Burkholderia_virus	4.9e-09	23.6
BBF49729.1\|4110343_4111237_-	N-acetylneuraminate lyase	NA	NA	NA	NA
BBF49730.1\|4111358_4112150_-	sialic acid-inducible nan operon repressor	NA	NA	NA	NA
BBF49731.1\|4112529_4113897_+	transporter	NA	NA	NA	NA
BBF49732.1\|4113939_4114437_-\|protease	ClpXP protease specificity enhancing factor	A0A1S5R3H3	Pseudomonas_phage	3.3e-26	42.9
BBF49733.1\|4114442_4115081_-	stringent starvation protein A	NA	NA	NA	NA
BBF49734.1\|4115475_4115868_-	30S ribosomal subunit protein S9	NA	NA	NA	NA
BBF49735.1\|4115883_4116312_-	50S ribosomal subunit protein L13	NA	NA	NA	NA
BBF49736.1\|4116530_4117658_-	cell division protein ZapE	NA	NA	NA	NA
BBF49737.1\|4117851_4118250_+	inner membrane-anchored protein	NA	NA	NA	NA
BBF49738.1\|4118403_4119771_+\|protease	serine endoprotease	A0A1B1IT49	uncultured_Mediterranean_phage	2.3e-21	25.6
BBF49739.1\|4119860_4120928_+\|protease	serine endoprotease	A0A1S5Y2X3	uncultured_archaeal_virus	6.8e-05	24.2

DBSCAN-SWA_26

4582301 : 4589872

Shigella_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBF50181.1\|4582301_4582694_+	antiterminator	A0A088CD47	Shigella_phage	9.6e-66	93.6
BBF50182.1\|4582852_4583218_+\|transposase	IS2 transposase	Q76S41	Shigella_phage	9.6e-60	100.0
BBF50183.1\|4583175_4583820_+\|transposase	IS2 transposase	Q9ZXG3	Shigella_phage	5.7e-124	99.5
BBF50184.1\|4584377_4584584_+	hypothetical protein	NA	NA	NA	NA
BBF50185.1\|4585175_4585322_+	hypothetical protein	NA	NA	NA	NA
BBF50186.1\|4585578_4586403_+	DNA-damage-inducible protein DinD	A0A1W6JPJ7	Morganella_phage	6.3e-91	77.0
BBF50187.1\|4586694_4587312_+	inner membrane protein	NA	NA	NA	NA
BBF50188.1\|4587308_4588991_-	DNA ligase	F8SJM3	Pseudomonas_phage	4.3e-22	22.3
BBF50189.1\|4589248_4589872_+	guanylate kinase	K4JYM5	Abalone_herpesvirus	4.1e-18	34.5

DBSCAN-SWA_27

5056748 : 5101661

Enterobacteria_phage(35.29%)

integrase,terminase,transposase,holin,protease,head,tail,portal,tRNA

attL 5079007:5079020|attR 5104410:5104423

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBF50594.1\|5056748_5057282_+	hypothetical protein	K7PKJ4	Enterobacteria_phage	1.1e-99	100.0
BBF50595.1\|5057478_5057652_+	hypothetical protein	K7PJQ2	Enterobacteria_phage	4.4e-23	100.0
BBF50596.1\|5057699_5057981_-	hypothetical protein	K7PGU0	Enterobacteria_phage	8.7e-45	98.9
BBF50597.1\|5058017_5058590_-	exonuclease	K7PLW7	Enterobacteria_phage	6.7e-108	97.9
BBF50598.1\|5058589_5059324_-	putative phage protein	S5MC19	Escherichia_phage	1.4e-139	98.8
BBF50599.1\|5059326_5059518_-	hypothetical protein	G9L660	Escherichia_phage	9.5e-27	100.0
BBF50600.1\|5059570_5059987_-	hypothetical protein	A0A076GCN9	Escherichia_phage	1.4e-30	69.9
BBF50601.1\|5060133_5060607_-	methyltransferase	H9C170	Pectobacterium_phage	4.0e-66	75.5
BBF50602.1\|5060603_5060954_-	hypothetical protein	A0A0P0ZBF8	Stx2-converting_phage	1.6e-56	94.8
BBF50603.1\|5060944_5061481_-	hypothetical protein	U5P0T3	Shigella_phage	3.1e-99	98.3
BBF50604.1\|5061608_5062433_-	hypothetical protein	Q8SBF9	Shigella_phage	1.0e-149	99.6
BBF50605.1\|5062498_5062861_-	hypothetical protein	Q8SBF8	Shigella_phage	8.6e-61	100.0
BBF50606.1\|5063564_5064212_-	phage repressor protein CI	K7PKK1	Enterobacteria_phage	3.1e-117	99.5
BBF50607.1\|5064354_5064615_+	phage antirepressor Cro	K7PJQ8	Enterobacteria_phage	7.8e-40	97.7
BBF50608.1\|5064607_5065159_+	transcriptional regulator	Q8SBF4	Shigella_phage	9.9e-101	99.5
BBF50609.1\|5065261_5065993_-\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	2.8e-135	100.0
BBF50610.1\|5066070_5066658_+	hypothetical protein	A5LH76	Enterobacteria_phage	3.9e-111	98.5
BBF50611.1\|5066671_5067424_+	phage antitermination protein Q	K7PGU5	Enterobacteria_phage	5.3e-137	99.2
BBF50612.1\|5068703_5070554_+	hypothetical protein	B6DZ89	Enterobacteria_phage	0.0e+00	96.9
BBF50613.1\|5071002_5071209_+\|holin	phage holine protein	A0A0P0ZC45	Stx2-converting_phage	2.4e-31	100.0
BBF50614.1\|5071208_5071706_+	phage lysozyme	A0A0N7KZA0	Stx2-converting_phage	2.6e-92	100.0
BBF50615.1\|5071702_5072170_+	phage murein endopeptidase	Q7AYI6	Enterobacteria_phage	4.0e-58	80.1
BBF50616.1\|5072635_5072950_+	PchABC family transcriptional regulator	NA	NA	NA	NA
BBF50617.1\|5072997_5073162_-	hypothetical protein	A0A0P0ZCA1	Stx2-converting_phage	6.5e-08	96.8
BBF50618.1\|5073203_5073659_+	DNase	H6WZK7	Escherichia_phage	1.0e-63	82.7
BBF50619.1\|5073850_5074414_+\|terminase	phage terminase small subunit	B6DZ97	Enterobacteria_phage	7.3e-83	94.1
BBF50620.1\|5074410_5076072_+\|terminase	phage terminase large subunit	A0A0N7KZG0	Stx2-converting_phage	0.0e+00	98.7
BBF50621.1\|5076135_5078073_+\|head,protease	phage prohead protease	H6WZL0	Escherichia_phage	0.0e+00	98.4
BBF50622.1\|5078117_5078339_+	hypothetical protein	H6WZL1	Escherichia_phage	3.4e-36	100.0
BBF50623.1\|5078284_5079649_+\|portal	phage portal protein	B6DZX6	Stx2-converting_phage	2.5e-254	96.9
5079007:5079020	attL	NA	NA	NA	NA
BBF50624.1\|5079645_5080623_+\|portal	phage portal protein	B6DZX7	Stx2-converting_phage	9.2e-57	79.2
BBF50625.1\|5080702_5081029_+	phage DNA packaging protein	B6ETF0	Enterobacteria_phage	7.0e-54	100.0
BBF50626.1\|5081038_5081389_+\|head,tail	phage head-tail adaptor	A0A0P0ZB28	Stx2-converting_phage	1.6e-59	100.0
BBF50627.1\|5081385_5081832_+\|tail	phage minor tail protein	A0A0P0ZCD2	Stx2-converting_phage	8.1e-77	100.0
BBF50628.1\|5081828_5082173_+\|tail	phage minor tail protein	A0A0P0ZC17	Stx2-converting_phage	1.4e-57	100.0
BBF50629.1\|5082239_5082956_+\|tail	phage major tail protein	A0A0P0ZD29	Stx2-converting_phage	2.1e-127	98.3
BBF50630.1\|5082961_5083336_+\|tail	phage tail assembly protein	A0A0P0ZE84	Stx2-converting_phage	1.7e-64	99.2
BBF50631.1\|5083431_5083641_+\|tail	phage minor tail protein	A0A0P0ZDE6	Stx2-converting_phage	2.0e-33	100.0
BBF50632.1\|5083692_5086935_+\|tail	phage tail length tape measure protein	A0A0P0ZCJ4	Stx2-converting_phage	0.0e+00	93.2
BBF50633.1\|5086927_5087269_+\|tail	phage minor tail protein	A0A0P0ZCS8	Stx2-converting_phage	8.7e-63	100.0
BBF50634.1\|5087268_5087967_+\|tail	phage minor tail protein	H6WZM3	Escherichia_phage	3.1e-131	98.3
BBF50635.1\|5087977_5088721_+\|tail	phage tail assembly protein	A0A0P0ZE89	Stx2-converting_phage	5.4e-150	99.2
BBF50636.1\|5088717_5089299_+\|tail	phage tail assembly protein	Q6H9T3	Enterobacteria_phage	8.6e-87	89.6
BBF50637.1\|5089534_5093011_+	phage host specificity protein	Q6H9T2	Enterobacteria_phage	0.0e+00	96.1
BBF50638.1\|5093079_5093703_+	outer membrane protein Lom	A0A1U8QHD6	Enterobacteria_phage	1.1e-68	60.4
BBF50639.1\|5093767_5095081_+\|tail	phage tail fiber protein	A0A0P0ZD68	Stx2-converting_phage	3.3e-78	99.1
BBF50640.1\|5095082_5095352_+	hypothetical protein	B6DZB8	Enterobacteria_phage	2.4e-44	98.9
BBF50641.1\|5095527_5095935_+	T3SS secreted effector NleG	B6DZB9	Enterobacteria_phage	5.7e-69	96.2
BBF50642.1\|5096064_5097123_-	T3SS secreted effector EspW	NA	NA	NA	NA
BBF50643.1\|5097201_5097852_-	T3SS secreted effector NleG	B6DZZ5	Stx2-converting_phage	2.8e-25	37.2
BBF50644.1\|5098034_5098625_+	T3SS secreted effector EspM	NA	NA	NA	NA
BBF50645.1\|5099126_5099375_-	DNA-damage-inducible protein DinI	A5LH55	Enterobacteria_phage	3.1e-38	98.8
BBF50646.1\|5099436_5099766_-\|integrase	integrase	S5MDN5	Escherichia_phage	1.7e-55	99.1
BBF50647.1\|5099770_5100535_-\|integrase	integrase	S5MDN5	Escherichia_phage	3.1e-145	99.6
BBF50648.1\|5100623_5101661_+\|tRNA	tRNA-dihydrouridine synthase A	NA	NA	NA	NA
5104410:5104423	attR	NA	NA	NA	NA

DBSCAN-SWA_28

5184476 : 5280156

Escherichia_phage(15.38%)

tRNA,transposase,integrase,protease

attL 5258032:5258061|attR 5283523:5283552

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBF50728.1\|5184476_5185166_-\|tRNA	lysine tRNA synthetase	A0A1V0SAC0	Catovirus	1.2e-39	39.5
BBF50729.1\|5185250_5185577_+\|transposase	IS629 transposase OrfA	A0A0N7BVE9	Escherichia_phage	1.3e-55	100.0
BBF50730.1\|5185576_5186464_+\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	1.6e-169	100.0
BBF50731.1\|5186466_5186661_-\|transposase	transposase	F6MIM4	Haemophilus_phage	3.9e-12	69.8
BBF50732.1\|5186832_5196504_-	adherence factor Efa1	NA	NA	NA	NA
BBF50733.1\|5197154_5197943_-	endonuclease	NA	NA	NA	NA
BBF50734.1\|5198377_5199052_-	T3SS secreted effector NleE	NA	NA	NA	NA
BBF50735.1\|5199100_5200090_-	T3SS secreted effector NleB	Q8HAB2	Salmonella_phage	1.1e-97	58.5
BBF50736.1\|5200698_5201157_-	T3SS secreted effector EspL	NA	NA	NA	NA
BBF50737.1\|5201262_5202348_-	T3SS secreted effector EspL	NA	NA	NA	NA
BBF50738.1\|5203175_5204048_-\|transposase	IS609 transposase	A0A1W6JP07	Morganella_phage	1.1e-146	97.4
BBF50739.1\|5204178_5204730_+\|transposase	IS609 transposase	A0A1S5RHE3	Helicobacter_phage	6.6e-36	58.7
BBF50740.1\|5205169_5205964_+	hypothetical protein	NA	NA	NA	NA
BBF50741.1\|5206034_5206484_-	50S ribosomal subunit protein L9	NA	NA	NA	NA
BBF50742.1\|5206525_5206753_-	30S ribosomal subunit protein S18	NA	NA	NA	NA
BBF50743.1\|5206757_5207072_-	primosomal protein N	NA	NA	NA	NA
BBF50744.1\|5207078_5207474_-	30S ribosomal subunit protein S6	NA	NA	NA	NA
BBF50745.1\|5207800_5208076_+	hypothetical protein	NA	NA	NA	NA
BBF50746.1\|5208204_5208891_-	L-ribulose 5-phosphate 4-epimerase	NA	NA	NA	NA
BBF50747.1\|5208890_5209745_-	L-xylulose 5-phosphate 3-epimerase	NA	NA	NA	NA
BBF50748.1\|5209754_5210405_-	3-keto-L-gulonate 6-phosphate decarboxylase	NA	NA	NA	NA
BBF50749.1\|5210418_5210883_-	L-ascorbate-specific enzyme IIA component of PTS	NA	NA	NA	NA
BBF50750.1\|5210892_5211198_-	L-ascorbate-specific enzyme IIB component of PTS	NA	NA	NA	NA
BBF50751.1\|5211213_5212611_-	L-ascorbate-specific enzyme IIC permease component of PTS	NA	NA	NA	NA
BBF50752.1\|5212965_5214030_+	L-ascorbate 6-phosphate lactonase	NA	NA	NA	NA
BBF50753.1\|5214137_5214893_+	transcriptional repressor	NA	NA	NA	NA
BBF50754.1\|5214889_5215639_-	acyl CoA esterase	NA	NA	NA	NA
BBF50755.1\|5215820_5216150_+	biofilm peroxide resistance protein	NA	NA	NA	NA
BBF50756.1\|5216298_5216574_+	hypothetical protein	NA	NA	NA	NA
BBF50757.1\|5216690_5218316_-	isovaleryl-CoA dehydrogenase	NA	NA	NA	NA
BBF50758.1\|5218399_5219563_-	ATP-Grasp family ATPase	B2ZXR7	Ralstonia_phage	4.9e-81	43.8
BBF50759.1\|5219565_5220204_-	hypothetical protein	NA	NA	NA	NA
BBF50760.1\|5220213_5220612_-	inner membrane protein	NA	NA	NA	NA
BBF50761.1\|5220629_5221289_-	hypothetical protein	NA	NA	NA	NA
BBF50762.1\|5221339_5222038_-	hypothetical protein	NA	NA	NA	NA
BBF50763.1\|5222056_5222458_-	hypothetical protein	NA	NA	NA	NA
BBF50764.1\|5222584_5223316_-	23S rRNA mG2251 2'-O-ribose methyltransferase	NA	NA	NA	NA
BBF50765.1\|5223495_5225856_-	exoribonuclease R	Q0GXV6	Lactococcus_phage	6.2e-67	33.1
BBF50766.1\|5225894_5226320_-	nitric oxide-sensitive repressor for NO regulon	NA	NA	NA	NA
BBF50767.1\|5226524_5227823_-	adenylosuccinate synthetase	W5S5V7	Pithovirus	2.2e-66	35.9
BBF50768.1\|5227926_5228124_-	transcriptional regulator	NA	NA	NA	NA
BBF50769.1\|5228205_5229210_-\|protease	protease modulator HflC	NA	NA	NA	NA
BBF50770.1\|5229212_5230472_-\|protease	modulator for HflB protease specific for phage lambda cII repressor	A0A1L2CVV0	Pectobacterium_phage	3.6e-05	25.5
BBF50771.1\|5230557_5231838_-	GTP-binding protein HflX	NA	NA	NA	NA
BBF50772.1\|5231914_5232223_-	RNA-binding protein Hfq	NA	NA	NA	NA
BBF50773.1\|5232308_5233259_-\|tRNA	delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase	NA	NA	NA	NA
BBF50774.1\|5233251_5235099_-	methyl-directed mismatch repair protein MutL	A0A1B2LRQ5	Wolbachia_phage	5.8e-60	41.3
BBF50775.1\|5235108_5236446_-	N-acetylmuramoyl-l-alanine amidase II	A0A067ZJB6	Vibrio_phage	8.8e-18	31.0
BBF50776.1\|5236464_5236926_-\|tRNA	tRNA(ANN) t(6)A37 threonylcarbamoyladenosine modification protein	NA	NA	NA	NA
BBF50777.1\|5236897_5238430_-	carbohydrate kinase	NA	NA	NA	NA
BBF50778.1\|5238443_5239583_+	epoxyqueuosine reductase	NA	NA	NA	NA
BBF50779.1\|5240477_5241023_-	oligoribonuclease	Q8B5Y0	Diachasmimorpha_longicaudata_entomopoxvirus	2.2e-28	40.4
BBF50780.1\|5241117_5242170_+	ribosome small subunit-dependent GTPase A	NA	NA	NA	NA
BBF50781.1\|5242266_5243235_+	phosphatidylserine decarboxylase	NA	NA	NA	NA
BBF50782.1\|5243256_5246580_+	mechanosensitive channel protein	NA	NA	NA	NA
BBF50783.1\|5246608_5246911_-	inner membrane protein	NA	NA	NA	NA
BBF50784.1\|5246919_5247234_-	hypothetical protein	NA	NA	NA	NA
BBF50785.1\|5247285_5248743_-	transporter	NA	NA	NA	NA
BBF50786.1\|5249006_5249984_-	elongation factor	A0A2K9KZX5	Tupanvirus	6.8e-28	28.2
BBF50787.1\|5250308_5252117_+	anaerobic fumarate reductase catalytic and NAD/flavoprotein subunit	NA	NA	NA	NA
BBF50788.1\|5252109_5252844_+	fumarate reductase Fe-S subunit	NA	NA	NA	NA
BBF50789.1\|5252854_5253250_+	fumarate reductase membrane anchor subunit	NA	NA	NA	NA
BBF50790.1\|5253260_5253620_+	fumarate reductase membrane anchor subunit	NA	NA	NA	NA
BBF50791.1\|5253682_5254816_+	beta-lactamase	NA	NA	NA	NA
BBF50792.1\|5254904_5255438_+	outer membrane lipoprotein Blc	A0A1W6JNX6	Morganella_phage	2.7e-47	55.0
BBF50793.1\|5255434_5255752_-	multidrug efflux system protein	NA	NA	NA	NA
BBF50794.1\|5255933_5256080_-	entericidin B membrane lipoprotein	NA	NA	NA	NA
BBF50795.1\|5256190_5256316_-	entericidin A	NA	NA	NA	NA
BBF50796.1\|5256367_5256934_-	polyproline-specific translation elongation factor EF-P	NA	NA	NA	NA
BBF50797.1\|5256975_5258004_+	EF-P-Lys34 lysylation protein	NA	NA	NA	NA
5258032:5258061	attL	NA	NA	NA	NA
BBF50798.1\|5258393_5259263_+	hypothetical protein	NA	NA	NA	NA
BBF50799.1\|5259466_5259820_-	hypothetical protein	NA	NA	NA	NA
BBF50800.1\|5259957_5261604_-	molecular chaperone GroEL	A0A2I7SAK5	Vibrio_phage	5.3e-190	68.9
BBF50801.1\|5261647_5261941_-	co-chaperonin GroES	K4F9I2	Cronobacter_phage	9.2e-13	45.4
BBF50802.1\|5262216_5263473_+	transporter	NA	NA	NA	NA
BBF50803.1\|5263488_5263965_-	exclusion suppressor FxsA	NA	NA	NA	NA
BBF50804.1\|5264301_5265738_+	aspartate ammonia-lyase	NA	NA	NA	NA
BBF50805.1\|5265855_5267157_+	C4-dicarboxylate antiporter	NA	NA	NA	NA
BBF50806.1\|5267272_5267611_+	divalent-cation tolerance protein	NA	NA	NA	NA
BBF50807.1\|5267586_5269284_+	thiol:disulfide interchange protein and activator of DsbC	NA	NA	NA	NA
BBF50808.1\|5269320_5269896_+	transcriptional regulator	NA	NA	NA	NA
BBF50809.1\|5270275_5271541_+\|integrase	integrase	Q7M297	Enterobacteria_phage	2.7e-77	38.3
BBF50810.1\|5271657_5272443_-	hypothetical protein	A0A0P0ZBS5	Stx2-converting_phage	2.3e-114	99.0
BBF50811.1\|5272531_5272861_+\|transposase	ISSfl3 transposase	NA	NA	NA	NA
BBF50812.1\|5272987_5273206_+\|transposase	ISSfl3 transposase	NA	NA	NA	NA
BBF50813.1\|5273202_5273550_+\|transposase	ISSfl3 transposase	A0A0P0ZDM8	Stx2-converting_phage	1.0e-42	72.0
BBF50814.1\|5273569_5275018_+\|transposase	transposase	A0A0P0ZEB3	Stx2-converting_phage	3.9e-136	55.3
BBF50815.1\|5275871_5276405_-	PagC-like membrane protein	Q9LA63	Enterobacterial_phage	1.2e-15	32.4
BBF50816.1\|5277721_5278519_+\|transposase	transposase	NA	NA	NA	NA
BBF50817.1\|5278558_5279446_-\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	1.6e-169	100.0
BBF50818.1\|5279445_5279772_-\|transposase	IS629 transposase OrfA	A0A0N7BVE9	Escherichia_phage	1.3e-55	100.0
BBF50819.1\|5279865_5280156_+\|transposase	IS609 transposase	A0A1W6JP07	Morganella_phage	7.2e-42	99.0
5283523:5283552	attR	NA	NA	NA	NA

DBSCAN-SWA_29

5344377 : 5404804

Escherichia_phage(58.33%)

integrase,protease,transposase

attL 5337135:5337155|attR 5380485:5380505

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
5337135:5337155	attL	NA	NA	NA	NA
BBF50876.1\|5344377_5345088_+\|integrase	integrase	Q7M297	Enterobacteria_phage	1.8e-41	42.7
BBF50877.1\|5345091_5345754_+	hypothetical protein	NA	NA	NA	NA
BBF50878.1\|5346267_5347185_-	hypothetical protein	NA	NA	NA	NA
BBF50879.1\|5347177_5347951_-	hypothetical protein	NA	NA	NA	NA
BBF50880.1\|5348530_5349880_-	hypothetical protein	NA	NA	NA	NA
BBF50881.1\|5349998_5352083_-\|protease	ATP-dependent Lon protease	NA	NA	NA	NA
BBF50882.1\|5352093_5354691_-	alkaline phosphatase	NA	NA	NA	NA
BBF50883.1\|5354867_5358542_-	hypothetical protein	NA	NA	NA	NA
BBF50884.1\|5358587_5362229_-	ATPase-like protein	NA	NA	NA	NA
BBF50885.1\|5362240_5362843_-	hypothetical protein	NA	NA	NA	NA
BBF50886.1\|5362839_5363445_-	membrane protein	NA	NA	NA	NA
BBF50887.1\|5363738_5364425_+	hypothetical protein	NA	NA	NA	NA
BBF50888.1\|5364552_5364735_+	hypothetical protein	NA	NA	NA	NA
BBF50889.1\|5364845_5365718_-	restriction endonuclease	NA	NA	NA	NA
BBF50890.1\|5365929_5366910_-	9-O-acetyl-N-acetylneuraminic acid deacetylase	Q08JA2	Stx2-converting_phage	9.4e-102	55.9
BBF50891.1\|5366974_5368081_-	N-acetylneuraminic acid mutarotase	NA	NA	NA	NA
BBF50892.1\|5368100_5368817_-	N-acetylneuraminic acid outer membrane channel protein	NA	NA	NA	NA
BBF50893.1\|5370272_5370875_+	type 1 fimbriae regulatory protein FimB	A0A2L1IV36	Escherichia_phage	1.5e-54	51.8
BBF50894.1\|5371352_5371949_+	type 1 fimbriae regulatory protein FimE	A0A2L1IV36	Escherichia_phage	3.9e-50	53.4
BBF50895.1\|5372429_5372978_+	major type 1 subunit fimbrin	NA	NA	NA	NA
BBF50896.1\|5373135_5373582_+	fimbrial protein involved in type 1 pilus biosynthesis	NA	NA	NA	NA
BBF50897.1\|5373618_5374344_+	periplasmic chaperone	NA	NA	NA	NA
BBF50898.1\|5374410_5377164_+	outer membrane usher protein FimD	A0A0N7C1Y0	Escherichia_phage	2.5e-43	100.0
BBF50899.1\|5376970_5377858_-\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	1.6e-169	100.0
BBF50900.1\|5377857_5378184_-\|transposase	IS629 transposase OrfA	A0A0N7BVE9	Escherichia_phage	1.3e-55	100.0
BBF50901.1\|5378370_5378901_+	minor component of type 1 fimbriae	NA	NA	NA	NA
BBF50902.1\|5378913_5379417_+	minor component of type 1 fimbriae	NA	NA	NA	NA
BBF50903.1\|5379436_5380339_+	minor component of type 1 fimbriae	NA	NA	NA	NA
BBF50904.1\|5380360_5380684_+	hypothetical protein	NA	NA	NA	NA
5380485:5380505	attR	NA	NA	NA	NA
BBF50905.1\|5380588_5381932_-	fructuronate transporter	NA	NA	NA	NA
BBF50906.1\|5382271_5383456_+	mannonate hydrolase	NA	NA	NA	NA
BBF50907.1\|5383536_5384997_+	NAD-dependent D-mannonate oxidoreductase	H8ZJP8	Ostreococcus_tauri_virus	7.3e-50	32.2
BBF50908.1\|5385018_5385213_-	hypothetical protein	NA	NA	NA	NA
BBF50909.1\|5385259_5385985_+	fructuronate-inducible hexuronate regulon transcriptional repressor	NA	NA	NA	NA
BBF50910.1\|5386125_5386956_-	hypothetical protein	NA	NA	NA	NA
BBF50911.1\|5387628_5388021_+	DNA replication protein IraD	NA	NA	NA	NA
BBF50912.1\|5388013_5388925_-	hypochlorite-responsive transcription factor	NA	NA	NA	NA
BBF50913.1\|5388989_5390162_-	isoaspartyl dipeptidase	NA	NA	NA	NA
BBF50914.1\|5390174_5390636_-	SpmB family inner membrane protein	NA	NA	NA	NA
BBF50915.1\|5390632_5391316_-	nucleoside recognition pore and gate family inner membrane transporter	NA	NA	NA	NA
BBF50916.1\|5391565_5392120_+	RNA 2'-phosphotransferase	A0A2R2ZGT8	Clostridioides_phage	2.7e-37	45.6
BBF50917.1\|5392132_5392516_-	transport protein	NA	NA	NA	NA
BBF50918.1\|5392479_5393310_-	transport protein	NA	NA	NA	NA
BBF50919.1\|5393377_5394349_-	hypothetical protein	NA	NA	NA	NA
BBF50920.1\|5394302_5394560_-	hypothetical protein	NA	NA	NA	NA
BBF50921.1\|5394556_5395324_-	activator of (R)-hydroxyglutaryl-CoA dehydratase	NA	NA	NA	NA
BBF50922.1\|5395333_5396485_-	2-hydroxyglutaryl-CoA dehydratase	NA	NA	NA	NA
BBF50923.1\|5396600_5397881_-	zinc-type alcohol dehydrogenase-like protein	NA	NA	NA	NA
BBF50924.1\|5397921_5399154_-	multidrug efflux system protein	NA	NA	NA	NA
BBF50925.1\|5399620_5400577_+	hypothetical protein	Q2A0A7	Sodalis_phage	1.7e-60	51.2
BBF50926.1\|5400821_5402234_-	transcriptional regulator/aminotransferase	NA	NA	NA	NA
BBF50927.1\|5402410_5402575_+	hypothetical protein	NA	NA	NA	NA
BBF50928.1\|5402926_5403565_+	penicillin G acylase precursor	NA	NA	NA	NA
BBF50929.1\|5403590_5403917_+\|transposase	IS629 transposase OrfA	A0A0N7BVE9	Escherichia_phage	3.7e-55	99.1
BBF50930.1\|5403916_5404804_+\|transposase	IS629 transposase OrfB	A0A0N7C1X7	Escherichia_phage	1.6e-169	100.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage