CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP027716	Pseudomonas chlororaphis strain Pb-St2 chromosome, complete genome	1 crisprs	DinG,csa3,cas3,PD-DExK,DEDDh,WYL	0	0	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP027716_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027716_1

400919-401030

Orphan

Consensus_repeat	Method
GCGCTGATCGCGCCGGGCCCGGTGTAAAGAGGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP027716_1

>merge|CP027716|1|400919-401030|CRISPRCasFinder
GCGCTGATCGCGCCGGGCCCGGTGTAAAGAGGGGAAGCCCCGGCCTGCCTGTACCAAGGTTCCCAAAAGCGTGGGGGCCGCGCTGATTGCGCCGGGCCCGGTGTAAAGAGGG

>CP027716|1|1|400919-401030|CRISPRCasFinder
GCGCTGATCGCGCCGGGCCCGGTGTAAAGAGGG	GAAGCCCCGGCCTGCCTGTACCAAGGTTCCCAAAAGCGTGGGGGCC
GCGCTGATTGCGCCGGGCCCGGTGTAAAGAGGG

Protein	Signature genes	Signature genes Name	Protein_function
CP027716.1\|AZD27147.1\|395437_396724_-\|Murein-hydrolase-activator-EnvC	unknown	unknown	gnl\|CDD\|227278
CP027716.1\|AZD27146.1\|394095_395406_-\|Carboxyl-terminal-protease	unknown	unknown	gnl\|CDD\|223864
CP027716.1\|AZD27158.1\|407165_408887_+\|Acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173843
CP027716.1\|AZD27153.1\|400489_400864_+\|hypothetical-protein	unknown	unknown	unknown
CP027716.1\|AZD27148.1\|396861_398391_-\|2,3-bisphosphoglycerate-independent-phosphoglycerate-mutase	unknown	unknown	gnl\|CDD\|235463
CP027716.1\|AZD27145.1\|393970_394096_-\|hypothetical-protein	unknown	unknown	unknown
CP027716.1\|AZD27150.1\|398956_399211_+\|Glutaredoxin-3-(Grx3)	unknown	unknown	gnl\|CDD\|274017
CP027716.1\|AZD27154.1\|401668_403105_-\|Nitrogen-regulation-protein-NtrC	unknown	unknown	gnl\|CDD\|273818
CP027716.1\|AZD27155.1\|403101_404187_-\|Nitrogen-regulation-protein-NtrB	unknown	unknown	gnl\|CDD\|226370
CP027716.1\|AZD27161.1\|410967_412494_+\|3-hydroxyacyl-CoA-dehydrogenase-PaaC	unknown	unknown	gnl\|CDD\|236211
CP027716.1\|AZD27159.1\|408919_410107_+\|L-carnitine-dehydratase/bile-acid-inducible-protein-F	unknown	unknown	gnl\|CDD\|367110
CP027716.1\|AZD27160.1\|410176_410971_+\|Enoyl-CoA-hydratase/isomerase-family-protein	unknown	unknown	gnl\|CDD\|236162
CP027716.1\|AZD27151.1\|399267_399750_+\|Protein-export-protein-SecB-(maintains-pre-export-unfolded-state)	unknown	unknown	gnl\|CDD\|180234
CP027716.1\|AZD27157.1\|406153_407053_-\|Transcriptional-regulator,-LysR-family	unknown	unknown	gnl\|CDD\|176139
CP027716.1\|AZD27162.1\|412530_413733_+\|Acetyl-CoA-acetyltransferase	unknown	unknown	gnl\|CDD\|181242
CP027716.1\|AZD27144.1\|393170_393929_-\|Putative-periplasmic-protein-YibQ	unknown	unknown	gnl\|CDD\|377404
CP027716.1\|AZD27156.1\|404545_405958_-\|putative-MFS-type-transporter	unknown	unknown	gnl\|CDD\|340927
CP027716.1\|AZD27163.1\|413846_414962_+\|Methylphosphotriester-DNA--protein-cysteine-S-methyltransferase	unknown	unknown	gnl\|CDD\|225080
CP027716.1\|AZD27149.1\|398541_398955_+\|Rhodanese-related-sulfurtransferase-YibN	unknown	unknown	gnl\|CDD\|238089
CP027716.1\|AZD27152.1\|399969_400425_-\|tRNA-(cytidine(34)-2'-O)-methyltransferase	unknown	unknown	gnl\|CDD\|223297

Protein	Function_ID	Function_description	E-value
CP027716.1\|AZD27147.1\|395437_396724_-\|Murein-hydrolase-activator-EnvC	gnl\|CDD\|227278	COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning].	9.58722e-100
CP027716.1\|AZD27146.1\|394095_395406_-\|Carboxyl-terminal-protease	gnl\|CDD\|223864	COG0793, Prc, Periplasmic protease [Cell envelope biogenesis, outer membrane].	5.46649e-144
CP027716.1\|AZD27158.1\|407165_408887_+\|Acyl-CoA-dehydrogenase	gnl\|CDD\|173843	cd01154, AidB, Proteins involved in DNA damage response, similar to the AidB gene product. AidB is one of several genes involved in the SOS adaptive response to DNA alkylation damage, whose expression is activated by the Ada protein. Its function has not been entirely elucidated; however, it is similar in sequence and function to acyl-CoA dehydrogenases. It has been proposed that aidB directly destroys DNA alkylating agents such as nitrosoguanidines (nitrosated amides) or their reaction intermediates.	6.01586e-147
CP027716.1\|AZD27148.1\|396861_398391_-\|2,3-bisphosphoglycerate-independent-phosphoglycerate-mutase	gnl\|CDD\|235463	PRK05434, PRK05434, 2,3-bisphosphoglycerate-independent phosphoglycerate mutase.	0
CP027716.1\|AZD27152.1\|399969_400425_-\|tRNA-(cytidine(34)-2'-O)-methyltransferase	gnl\|CDD\|223297	COG0219, CspR, Predicted rRNA methylase (SpoU class) [Translation, ribosomal structure and biogenesis].	1.05147e-88
CP027716.1\|AZD27154.1\|401668_403105_-\|Nitrogen-regulation-protein-NtrC	gnl\|CDD\|273818	TIGR01818, Nitrogen_assimilation_regulatory_protein, nitrogen regulation protein NR(I). This model represents NtrC, a DNA-binding response regulator that is phosphorylated by NtrB and interacts with sigma-54. NtrC usually controls the expression of glutamine synthase, GlnA, and may be called GlnL, GlnG, etc. [Central intermediary metabolism, Nitrogen metabolism, Regulatory functions, DNA interactions, Signal transduction, Two-component systems].	0
CP027716.1\|AZD27155.1\|403101_404187_-\|Nitrogen-regulation-protein-NtrB	gnl\|CDD\|226370	COG3852, NtrB, Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms].	6.79614e-165
CP027716.1\|AZD27161.1\|410967_412494_+\|3-hydroxyacyl-CoA-dehydrogenase-PaaC	gnl\|CDD\|236211	PRK08268, PRK08268, 3-hydroxy-acyl-CoA dehydrogenase; Validated.	0
CP027716.1\|AZD27159.1\|408919_410107_+\|L-carnitine-dehydratase/bile-acid-inducible-protein-F	gnl\|CDD\|367110	pfam02515, CoA_transf_3, CoA-transferase family III. CoA-transferases are found in organisms from all lines of descent. Most of these enzymes belong to two well-known enzyme families, but recent work on unusual biochemical pathways of anaerobic bacteria has revealed the existence of a third family of CoA-transferases. The members of this enzyme family differ in sequence and reaction mechanism from CoA-transferases of the other families. Currently known enzymes of the new family are a formyl-CoA: oxalate CoA-transferase, a succinyl-CoA: (R)-benzylsuccinate CoA-transferase, an (E)-cinnamoyl-CoA: (R)-phenyllactate CoA-transferase, and a butyrobetainyl-CoA: (R)-carnitine CoA-transferase. In addition, a large number of proteins of unknown or differently annotated function from Bacteria, Archaea and Eukarya apparently belong to this enzyme family. Properties and reaction mechanisms of the CoA-transferases of family III are described and compared to those of the previously known CoA-transferases.	1.03664e-149
CP027716.1\|AZD27160.1\|410176_410971_+\|Enoyl-CoA-hydratase/isomerase-family-protein	gnl\|CDD\|236162	PRK08138, PRK08138, enoyl-CoA hydratase; Provisional.	2.51819e-159
CP027716.1\|AZD27151.1\|399267_399750_+\|Protein-export-protein-SecB-(maintains-pre-export-unfolded-state)	gnl\|CDD\|180234	PRK05751, PRK05751, preprotein translocase subunit SecB; Validated.	2.09825e-83
CP027716.1\|AZD27157.1\|406153_407053_-\|Transcriptional-regulator,-LysR-family	gnl\|CDD\|176139	cd08448, PBP2_LTTR_aromatics_like_2, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to regulators involved in the catabolism of aromatic compounds, contains type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type regulator similar to CbnR which is involved in the regulation of chlorocatechol breakdown. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	3.97655e-91
CP027716.1\|AZD27162.1\|412530_413733_+\|Acetyl-CoA-acetyltransferase	gnl\|CDD\|181242	PRK08131, PRK08131, 3-oxoadipyl-CoA thiolase.	0
CP027716.1\|AZD27144.1\|393170_393929_-\|Putative-periplasmic-protein-YibQ	gnl\|CDD\|377404	pfam04748, Polysacc_deac_2, Divergent polysaccharide deacetylase. This family is divergently related to pfam01522 (personal obs:Yeats C).	1.08612e-91
CP027716.1\|AZD27156.1\|404545_405958_-\|putative-MFS-type-transporter	gnl\|CDD\|340927	cd17369, MFS_ShiA_like, Shikimate transporter and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli shikimate transporter (ShiA), inner membrane metabolite transport protein YhjE, and other putative metabolite transporters. ShiA is involved in the uptake of shikimate, an aromatic compound involved in siderophore biosynthesis. It has been suggested that YhjE may mediate the uptake of osmoprotectants. The ShiA-like subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.40429e-152
CP027716.1\|AZD27163.1\|413846_414962_+\|Methylphosphotriester-DNA--protein-cysteine-S-methyltransferase	gnl\|CDD\|225080	COG2169, Ada, Adenosine deaminase [Nucleotide transport and metabolism].	1.96094e-79
CP027716.1\|AZD27149.1\|398541_398955_+\|Rhodanese-related-sulfurtransferase-YibN	gnl\|CDD\|238089	cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein. The cysteine containing enzymatically active version of the domain is also found in the Cdc25 class of protein phosphatases and a variety of proteins such as sulfide dehydrogenases and certain stress proteins such as senesence specific protein 1 in plants, PspE and GlpE in bacteria and cyanide and arsenate resistance proteins. Inactive versions (no active site cysteine) are also seen in dual specificity phosphatases, ubiquitin hydrolases from yeast and in sulfuryltransferases, where they are believed to play a regulatory role in multidomain proteins.	1.62355e-24
CP027716.1\|AZD27150.1\|398956_399211_+\|Glutaredoxin-3-(Grx3)	gnl\|CDD\|274017	TIGR02181, GRX_bact, Glutaredoxin, GrxC family. Glutaredoxins are thioltransferases (disulfide reductases) which utilize glutathione and NADPH as cofactors. Oxidized glutathione is regenerated by glutathione reductase. Together these components compose the glutathione system. Glutaredoxins utilize the CXXC motif common to thioredoxins and are involved in multiple cellular processes including protection from redox stress, reduction of critical enzymes such as ribonucleotide reductase and the generation of reduced sulfur for iron sulfur cluster formation. Glutaredoxins are capable of reduction of mixed disulfides of glutathione as well as the formation of glutathione mixed disulfides. This family of glutaredoxins includes the E. coli protein GrxC (Grx3) which appears to have a secondary role in reducing ribonucleotide reductase (in the absence of GrxA) possibly indicating a role in the reduction of other protein disulfides. [Energy metabolism, Electron transport].	1.27223e-49

>CP027716.1|AZD27153.1|400489_400864_+|hypothetical-protein
MLRVFGSLAIFGVMVGLMIGRLTTPDPTELQEVQVRPNALVVWFNNEPKVHGEHIDGAVALLFEAEGRAQKGQLRINDKDANWRVRAAEEGLLLNVVAARALHGEWSGSEVDGRWRLELQLREE
>CP027716.1|AZD27152.1|399969_400425_-|tRNA-(cytidine(34)-2'-O)-methyltransferase
MFHVILFQPEIPPNTGNVIRLCANSGCHLHLIEPLGFEMDDKRLRRAGLDYHEYATLQRHADLASCLESLGHPRLFAFTTKGSRPFHDASFAEGDAFLFGPESRGLPAEVLDALPAEQRLRLPMREGCRSLNLSNTVAVAVYEAWRQLGFK
>CP027716.1|AZD27151.1|399267_399750_+|Protein-export-protein-SecB-(maintains-pre-export-unfolded-state)
MTDQQNTAATEDESAPQFSLQRIYVRDLSFEAPKSPAIFRQQWEPSVGLDLNTRQKALEEGFHEVVLTLSVTVKNGDEVAFIAEVQQAGIFLIKNLDDASMSHTLGAFCPNILFPYAREALDSLVTRGSFPALMLAPVNFDALYAQELQRLQAAGENTVQ
>CP027716.1|AZD27150.1|398956_399211_+|Glutaredoxin-3-(Grx3)
MAAVVVYSSDYCPYCSRAKYLLENKGVAFEEIKVDGKPQVRAEMAQKAGRTSVPQIWIGSTHVGGCDDLFALERAGKLDALLAA
>CP027716.1|AZD27149.1|398541_398955_+|Rhodanese-related-sulfurtransferase-YibN
MVAHLIQFATEHYLLVGAFVILLALLIAHELSRGGRSLSTRELTALVNSEQGVVIDIRPSKEFAAGHIVGALNIPQDKLAARVGELEKHKAKTIILVDALGQHAGTHARELMKSGFTAAKLSGGVGSWKADNLPLVK
>CP027716.1|AZD27148.1|396861_398391_-|2,3-bisphosphoglycerate-independent-phosphoglycerate-mutase
MTTTPKPLVLMILDGFGHSESHESNAIYAAKKPVLDRLYASVPNGLISGSGMDVGLPDGQMGNSEVGHMNLGAGRVVYQDFTRVTKAIRDGEFFENPTICAAVDKAVAAGKAVHILGLLSDGGVHSHQDHLVAMAELAFKRGAEKIYLHAFLDGRDTPPKSATSSIELLDETFKTLGKGRIASLIGRYFAMDRDNRWDRVAQAYNLIVDGNGEFNAATAQEGLQAAYERGESDEFVKATTLGEPVKVEDGDAVVFMNFRADRARELSRVFVEDDFKEFARARQPKLAGFVMLTQYAASIPAPSAFAPGSLENVLGDYLAKNGKTQLRIAETEKYAHVTFFFSGGREEPFPGEERILIPSPKVATYDLQPEMSAPEVTDRIVDAIENQRYDVIVVNYANGDMVGHSGVFDAAVKAVECLDLCIGRIVDALEKVGGEALITADHGNVEQMSDAATGQAHTAHTSEPVPFIYVGKRNLKVREGGVLADVAPTMLKLLGLPQPAEMTGTSILV
>CP027716.1|AZD27147.1|395437_396724_-|Murein-hydrolase-activator-EnvC
MLRALITLALICLLQPAFADERAQTQQQLDATRQDIAELKKLLGKLQEEKSGVQKDLRGTETEMGKLEKQVDALQKELKKSESELQRLDEEKKKLQSARIEQQRLIAIQARAAYQNGRQEYLKLLLNQQNPEKFARTLTYYDYLSQARLEQLKNFNETLRQLANVEKEISLQQAQLLVQKSSLDTQREELDKVRKERQVALAKLNDDVKARGDKLKAREQDQADLGRVLKTIEETLARQAREAEQARQKALIAQQEAEKKRLREAQASADDSPRKPPRAAPGPLVSSAGASYGGPFASSRGKLPWPVDGRLLARFGESRGDDARTKWDGVMISASAGSQVHAVHGGRVVFADWLRGAGLLVILDHGNGYLSLYGHNQTLLKEAGDVVKAGESISTVGSSGGQGAPALYFAIRQQGRPSDPAQWCRAQG
>CP027716.1|AZD27146.1|394095_395406_-|Carboxyl-terminal-protease
MLHLSRLTSLALTIALVIGAPLAFAAETAQSTAATTTNAPLPLEELRTFAEVMDRIKAAYVEPVDDKTLLENAIKGMLSNLDPHSAYLGPEDFAELQESTSGEFGGLGIEVGAEDGIIKVVSPIDDTPASKAGIQAGDLIVKINGQPTRGQSMTEAVDKMRGKIGQKITLTLVRDGGAPFDVTLARATIQVKSVKSQLLESGYGYIRITQFQVKTGEEVSKALAKLRKDNGKKLNGIILDLRNNPGGVLQSAVEVVDHFITKGLIVYTKGRIANSELRFSATGKDESEAVPMVVLINGGSASASEIVAGALQDQKRAVLMGTTSFGKGSVQTVLPLNNDRALKITTALYFTPNGRSIQAQGIVPDIEVRRAKITSEAQDNEYFKEADLQGHLGNGNGGADKPTASGSKPKPMPQDDDYQLAQALSLLKGLSITRSK
>CP027716.1|AZD27145.1|393970_394096_-|hypothetical-protein
MEPVASKPAASPVGAQLARDSVLTTATPRQGLTRTLCCKSP
>CP027716.1|AZD27144.1|393170_393929_-|Putative-periplasmic-protein-YibQ
MIGLLCLLALTSIQAAEPAGRKAYLSLIIDDLGQNLPRDRRVLTLPGPVTTAIMPDTPHAAEFAREAHRAGKIVILHMPMDPATGPFAWHPELPIEELERRLDAAFKAVPYTSGINNHMGSRMTSQPQAMAWLMAELQRRHKFFVDSRTSAKTVAAAEAQKIGLASVSRDVFLDDERTEDAISHQLQTAINLARKQGSVVMIGHPYPQTLAVLERELPRLKAQGIDWIDIELMISVRSNRAMSGHGKDGVYR
>CP027716.1|AZD27154.1|401668_403105_-|Nitrogen-regulation-protein-NtrC
MSRSETVWIVDDDRSIRWVLEKALQQEGMTTQSFDSADGVMSRLARQQPDVIISDIRMPGASGLDLLARIREQHPRLPVIIMTAHSDLDSAVASYQGGAFEYLPKPFDVDEAVSLVKRANQHAQEQQGLEVIPALARTPEIIGEAPAMQEVFRAIGRLSHSNITVLINGESGTGKELVAHALHRHSPRAASPFIALNMAAIPKDLMESELFGHEKGAFTGAANLRRGRFEQADGGTLFLDEIGDMPADTQTRLLRVLADGEFYRVGGHTPVKVDVRIIAATHQNLETLVHAGKFREDLFHRLNVIRIHIPRLSDRREDIPTLAKHFLSRAAQELAVEPKLLKSETEEYLKNLPWPGNVRQLENTCRWITVMASGREVHISDLPPELLSLPQDSAPVTNWEQALRQWADQALARGQSSLLDSAVPSFERIMIETALKHTAGRRRDAAVLLGWGRNTLTRKIKELGMKVDGGDDDDSDEG
>CP027716.1|AZD27155.1|403101_404187_-|Nitrogen-regulation-protein-NtrB
MTISDPLHRLLLDNLTTATILLNADLRLEYMNPAAEMLLAISGQRSHGQFISELFTESAEALSSLRQAVQQAHPFTKREAMLTALTGQTLTVDYAVTPILSNGDTLLLLEVHPRDRLLRITKEEAQLSKQETSKMLVRGLAHEIKNPLGGIRGAAQLLARELPDENLKDYTNVIIEEADRLRNLVDRMLGSNKLPSLAMCNVHEVLERVSSLVEAESQGCITLVRDYDPSIPDVLIDREQMIQAVLNIVRNAMQAISSQNELRLGRICLRTRTMRQFTIGHVRHRLVTKIEIIDNGPGIPAELQETIFFPMVSGRPDGTGLGLAITQNIISQHQGLIECDSHPGHTTFSIFLPLEQGAPST
>CP027716.1|AZD27156.1|404545_405958_-|putative-MFS-type-transporter
MNAAQHAAAHKKARKAGIASFIGTTIEWYDFYAYGIAAALVFGKVFFPADLPAGTATLLSFLTLWAGFIARPVGGIIFGHLGDKIGRKTTLVITLIMMGVATTCIGLLPSYLQIGIWAPIALVVLRIIQGIAVGGEWGGAILIASESAPKGKGILYAAFAQQGSPAGNLLATLVFFGLSALPAPDFLLWGWRIPFLLSAALVLVGMVIRLKLEESDDMKRLIQQKKTVKLPILEVLRNHWQIVLLGAGVLPIIHVTYFKSTFALSWATKELGYSQGTFLSVIVIALVVQFITQPLGAVLVSRMDMRKAVMLMLLPEFLLMPAMFFAVETGIYWIAVLGMCLATVPHSMFYGAVGGILARAFPTKVRYSGLSISYQLCSLLVGGATPVLAQGILNNTGSIVGVAIASACYALVSLVCMLLLLKRIGHNAADLSTAEQADADELAREPRATPLIEPPATLQPSIDKDVQPAH
>CP027716.1|AZD27157.1|406153_407053_-|Transcriptional-regulator,-LysR-family
MDLKQLRYFVAVAEELHFGRAAARLFISQPALSFDIKKLESQLDVQLLTRNNKSVSLTNAGQVLLDEARYLLLRAEQARRLTLRSAQGFVGRLSIGFVNSILHRGLPQAVRSFEQDHPDTEIVLMEMNSAEQAQALQRGQIDIGFVHWSHFPESIRGEPVLAEPFLCCLPQGHRLAGEARIDLAQLANDDFILFPRNVSPHYHDLIIARCVAAGFSPRIRHETRLWQTVVAMVAYEMGVALVPQTLAGTWKEGVRYCEISGDGALSEVHAIRHADKPSAAAESFLTVLKALQKPVAPGL
>CP027716.1|AZD27158.1|407165_408887_+|Acyl-CoA-dehydrogenase
MTALPESAQDPLNIPDSRGLNLFDCDAGLVALLKVYLPPQLFAQWLPTLRQLGGRAGGELDVLALSADKNPPQLLPRTRRGEDLQSIHKHPDFIALERAAYAELGLASMSHGAEPVLPLVKYALTFLFVQAEFGLCCPVSMTDSLTRTLRKFGSPELVARYLPSLASRDFDRLFQGAMFMTEQAAGSDVSRTETRARLENGEWRLFGDKWFCSNPDADLAMVLARPEDAPEGMKGVSLFLLPKLRPDGSRNAYRILRLKDKLGSRSMASGEISLDGATAYLIGEVGRGFQQMADMINMSRLSNGVRAAGLMRRGVNEALYVARHRRAFGRHLVEMPLMQRQLLKMMLPAEQARSMFMQIATLLPKADAGDEAARKCVRILTPLIKFRACRDARRVTGDAMEVRGGVGYIEEWSDARLVRDAHLGSIWEGTSNIVALDIARAVTREQALEPLRHYLAGLLAEADLPTASQRLFETVLQRAVAAIEKVAQERRDDQVRLAGSALYHTATAIFMAWEASRQAPDYRRLALAHLLLQHKLLPRDPLRPEPALEPELLALLANEGPLSKADAMQLLPA
>CP027716.1|AZD27159.1|408919_410107_+|L-carnitine-dehydratase/bile-acid-inducible-protein-F
MNHSKGALAGLKVIDLSRVLGGPYCSQALADHGAEVIKLEPLSGDETRGWGPPFEGADASYFRGVNRNKQGIAVDLSRPAGITLLMRLLEDADVLIENFKPGTLERWGIGYAEVLSQRFPTLIHCAVSGFGGDGPLGGLPGYDAVIQAMAGLMSVNGEADSGPLRIGLPIVDMVTGLNALAGILLALNERHRSGLGQSLDITLYDCGVSLLHPHLANYFAAGKTPLRTGNAHPNIAPYDSYRTGTEPIFLAVGNDRQFAKLCEQLDAGALLDDPRFADNGRRSVNREALKQALETRLAEHDGTLLAQRLIRLGVPCGSIASIDKVVEHPHTRHRGLLVEIGDYRGVGSPVKLSRTPASYRSAPPALGANTREVLEGLGLDDQTIESLFEHGIVRE
>CP027716.1|AZD27160.1|410176_410971_+|Enoyl-CoA-hydratase/isomerase-family-protein
MSPESVSPQPLVLLEHPAPGVALLRLNRPQALNALNMALREELAEHFRRLDACPQTRVVVLTGGATVFAAGADLSELVNASALQLYAQHAERHWQAISACRKPVIAAVNGYALGGGCELAMHCDLIVAGHSARFAQPEIKVGVMPGAGGTQRLLRAVGKFQALRLLLTGCQVPADEALRLGLVSEVVADSETLPRALALATSIAGMPPLAVAQIKEVVLAGMDLPLEQALVLERKAFQLLFGSHDQREGMQAFLEKRKPEYQGK
>CP027716.1|AZD27161.1|410967_412494_+|3-hydroxyacyl-CoA-dehydrogenase-PaaC
MTAQPLQRIGLVGTGAMGRGIAQVMAMAGLKVFLFDARPGAAGTAREQLATIFAQQIEKARITPQDAAAAMLNLEVVDSLEALRDCQLVIEAIVENLEAKQQLFRQLEEVLASSAILASNTSSLSITAIASVCRHPERVAGLHFFNPVPRMRIVEVIDGLATRVGARLQALVRAIGYYPARAKDSPGFIVNHAGRAFGTEALRILSEGVAPAWRIDALLRDSAGFAMGPFELLDLIGLDVSVPVMESIYRQFYEEPRYRPHPVLRLMQAGGHLGRKSGQGFYLYDEPGDTRRPPQAVPHCAALPPVWIVADDEVGRLRLLDLLERLGAKVESGLRPSSSALCLVAPLGDDASEAALRHATDPSRTVAIDTLTTLDSQRCLMLNPATREDMQHAAHALFSADGGTVTMIRDSCGFIVQRTLASIVNLACDIAQQGIASVADIDAAVRLGLGYPLGPLEWGDQLGPERLLQILERLHALTGEPRYRPSGWLRRRALLGLSLRQPENPLPA
>CP027716.1|AZD27162.1|412530_413733_+|Acetyl-CoA-acetyltransferase
MLDAYIYSGLRTPFGRHGGSLASVRPDDLVGPLLVRLLETSRLPAEALEEVILGCTNQAGEDSRNLARNALLSAGLPWRVPGQTVNRLCASGLSAVIDAARAITCGEGRLYLAGGVESMSRAPFIMAKAESAYSRTLDVADSTIGARFANPKLVERYGNHSMPETGDNLARRFAISREDADRFAAASQARYQAALLAGVLADEIMAVEVPVGRKGQSLTVCDDEHPRPRSDLAALSRLPTLFAEGVVTAGNASGINDGAAVLLLGSREIGMEHGVAPMARILSSASVGVEPQFMGIGPHRAILLALQRARIGLEQLDLIEINEAFAPQVLACLKALNLDFGDPRVNPNGGAIAIGHPLGASGARLVLSACRTLQRNQQRYAVVSLCVGVGQGVAMVIERA
>CP027716.1|AZD27163.1|413846_414962_+|Methylphosphotriester-DNA--protein-cysteine-S-methyltransferase
MDNAPLLFQLPDDDTLYRALLERDPAYDGFAFVGVKSTGVFCRLTCAARKPKRENTVFFGSIKACVEAGFRACLRCRPLEQTGAQEPLVKQLLALLEHNADKRWYEGDLIELGFDPSTVRRAFKRHFGVTFLEMARLRRIGEGMQQLAGGASVIDAQISARFDSDSGFRSAFTRLLGQPPSNLRGRELLKADWLQTPIGVMLAVADAQALHLLEFFDRPALATELKRLQEHTGSTIGFGRFAPIDQIESELRRFFAGESASFATPLALNASAFTRTVWQALRAIPPGVTRSYAEVASSIGSASAVRAVARANGANQIAIVIACHRVIGSDGSLTGYGGGLWRKRWLLEHERRLYAQIQARQHLRADEPVAG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1268730 : 1358320

Pseudomonas_phage(42.31%)

tRNA,plate,tail,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZD27922.1\|1268730_1270083_+\|protease	Intramembrane protease RasP/YluC, implicated in cell division based on FtsL cleavage	NA	NA	NA	NA
AZD27923.1\|1270157_1272545_+	Outer membrane protein assembly factor YaeT	NA	NA	NA	NA
AZD27924.1\|1272590_1273094_+	Outer membrane chaperone Skp, precursor	NA	NA	NA	NA
AZD27925.1\|1273097_1274153_+	UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase	NA	NA	NA	NA
AZD27926.1\|1274262_1274703_+	3-hydroxyacyl-ACP dehydratase	NA	NA	NA	NA
AZD27927.1\|1274699_1275476_+	Acyl-ADP--UDP-N- acetylglucosamine O-acyltransferase	NA	NA	NA	NA
AZD27928.1\|1275478_1276609_+	Lipid-A-disaccharide synthase	NA	NA	NA	NA
AZD27929.1\|1276620_1277253_+	Ribonuclease HII	V5LS49	Emiliania_huxleyi_virus	7.5e-28	38.9
AZD27930.1\|1277322_1280847_+	DNA polymerase III alpha subunit	A0A2L1IZ23	Streptomyces_phage	3.6e-196	38.0
AZD27931.1\|1280987_1281935_+	Acetyl-coenzyme A carboxyl transferase alpha chain	NA	NA	NA	NA
AZD27932.1\|1282054_1283383_+\|tRNA	tRNA(Ile)-lysidine synthetase	NA	NA	NA	NA
AZD27933.1\|1283428_1283572_+	hypothetical protein	NA	NA	NA	NA
AZD27934.1\|1283657_1285289_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	6.9e-158	53.5
AZD27935.1\|1285294_1286140_+	2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase	E3T537	Cafeteria_roenbergensis_virus	1.2e-49	42.8
AZD27936.1\|1286298_1287588_+	Enolase	A0A1X9I5Z8	Streptococcus_phage	9.0e-137	59.2
AZD27937.1\|1287760_1288039_+	Cell division protein DivIC (FtsB), stabilizes FtsL against RasP cleavage	NA	NA	NA	NA
AZD27938.1\|1288035_1288743_+	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	NA	NA	NA	NA
AZD27939.1\|1288793_1289690_-	Transcriptional regulator, LysR family, in formaldehyde detoxification operon	NA	NA	NA	NA
AZD27940.1\|1289796_1290909_+	S-(hydroxymethyl)glutathione dehydrogenase	E3SJ82	Synechococcus_phage	8.3e-30	27.2
AZD27941.1\|1290992_1291844_+	S-formylglutathione hydrolase	NA	NA	NA	NA
AZD27942.1\|1291896_1292370_+	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
AZD27943.1\|1292366_1293425_+\|tRNA	tRNA pseudouridine(13) synthase	NA	NA	NA	NA
AZD27944.1\|1293412_1294162_+	5'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	2.3e-68	52.6
AZD27945.1\|1294161_1294839_+	Protein-L-isoaspartate O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.2e-42	52.0
AZD27946.1\|1295129_1295882_+	Murein hydrolase activator NlpD	A0A0S2SXL7	Bacillus_phage	5.7e-06	33.3
AZD27947.1\|1295988_1296993_+	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	5.0e-34	35.8
AZD27948.1\|1297493_1297817_-	4Fe-4S dicluster domain	NA	NA	NA	NA
AZD27949.1\|1297959_1300539_-	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	2.4e-27	23.5
AZD27950.1\|1300735_1301461_+	Transcriptional regulator	B5TK58	Pseudomonas_phage	1.3e-124	91.4
AZD27951.1\|1301980_1302328_+	Holin	B5TK61	Pseudomonas_phage	1.0e-50	87.7
AZD27952.1\|1302494_1303259_+	N-acetylmuramoyl-L-alanine amidase	A0A1W6DX33	Sphingobium_phage	1.2e-06	26.3
AZD27953.1\|1303479_1304004_+	hypothetical protein	NA	NA	NA	NA
AZD27954.1\|1304007_1304616_+\|plate	Baseplate assembly protein V	A0A2H4JBW8	uncultured_Caudovirales_phage	3.7e-48	60.4
AZD27955.1\|1304629_1304962_+\|plate	Baseplate assembly protein W	A0A2H4JI46	uncultured_Caudovirales_phage	2.1e-37	69.1
AZD27956.1\|1304958_1305954_+\|plate	Phage-related baseplate assembly protein	A0A2H4JC04	uncultured_Caudovirales_phage	2.3e-108	63.5
AZD27957.1\|1305950_1306586_+	Tail protein I	A0A2H4JDK0	uncultured_Caudovirales_phage	3.4e-44	55.2
AZD27958.1\|1306586_1308533_+\|tail	Prophage long tail fiber protein	A4PE45	Ralstonia_virus	1.5e-58	48.9
AZD27959.1\|1309078_1309300_+	hypothetical protein	NA	NA	NA	NA
AZD27960.1\|1309302_1310469_+\|tail	Major tail sheath protein	B0ZSG8	Halomonas_phage	2.9e-126	57.5
AZD27961.1\|1310468_1310975_+	hypothetical protein	Q6R4W3	Vibrio_virus	2.1e-25	36.9
AZD27962.1\|1311102_1311684_+	hypothetical protein	B0ZSH0	Halomonas_phage	9.1e-28	39.4
AZD27963.1\|1311680_1311806_+	hypothetical protein	NA	NA	NA	NA
AZD27964.1\|1311812_1314062_+	Phage protein	A0A2H4JAA5	uncultured_Caudovirales_phage	6.2e-08	41.7
AZD27965.1\|1314061_1314445_+\|tail	Unclassified tail protein	A0A2H4JAC8	uncultured_Caudovirales_phage	4.7e-33	53.5
AZD27966.1\|1314437_1314650_+\|tail	P2-like prophage tail protein X	A0A2H4JGD9	uncultured_Caudovirales_phage	3.9e-21	68.6
AZD27967.1\|1314659_1315679_+\|tail	Phage tail protein D	A0A2H4JH05	uncultured_Caudovirales_phage	4.7e-104	56.5
AZD27968.1\|1315859_1316444_+	hypothetical protein	B5TK65	Pseudomonas_phage	6.9e-76	71.5
AZD27969.1\|1316440_1316623_+	Mu-like prophage FluMu protein GP38	B5TK66	Pseudomonas_phage	6.5e-25	93.3
AZD27970.1\|1316622_1318119_+\|tail	Bacteriophage tail sheath protein	B5TK67	Pseudomonas_phage	3.5e-257	90.8
AZD27971.1\|1318185_1318533_+\|tail	Phage tail tube protein	B5TK68	Pseudomonas_phage	2.9e-58	93.9
AZD27972.1\|1318529_1318826_+\|tail	Phage small tail protein E	B5TK69	Pseudomonas_phage	2.3e-43	94.9
AZD27973.1\|1318956_1320909_+\|tail	Phage tail length tape-measure protein	B5TK70	Pseudomonas_phage	1.2e-42	51.2
AZD27974.1\|1320895_1322134_+\|tail	Phage tail/DNA circulation protein	B5TK71	Pseudomonas_phage	4.4e-181	75.7
AZD27975.1\|1322137_1323178_+\|tail	Prophage tail protein	B5TK72	Pseudomonas_phage	1.1e-161	82.7
AZD27976.1\|1323289_1323799_+\|plate	Prophage baseplate assembly protein V	B5TK73	Pseudomonas_phage	3.7e-78	87.6
AZD27977.1\|1323798_1324197_+	Bacteriophage protein GP46	B5TK74	Pseudomonas_phage	1.7e-65	89.4
AZD27978.1\|1324186_1325227_+	Phage FluMu protein gp47	B5TK75	Pseudomonas_phage	2.3e-167	87.0
AZD27979.1\|1325214_1325814_+\|tail	Prophage tail protein	B5TK76	Pseudomonas_phage	8.5e-106	91.5
AZD27980.1\|1325825_1326680_+\|tail	Prophage tail fiber protein	B5TK77	Pseudomonas_phage	4.4e-23	75.0
AZD27981.1\|1326684_1327326_+\|tail	putative tail fiber assembly-like protein	B5TK78	Pseudomonas_phage	1.6e-38	61.6
AZD27982.1\|1327422_1328343_+\|tail	Prophage tail fiber protein	B5TK77	Pseudomonas_phage	1.3e-23	42.3
AZD27983.1\|1328342_1328831_+	hypothetical protein	A0A291LAV4	Bordetella_phage	3.5e-09	45.5
AZD27984.1\|1328998_1329919_+\|tail	Prophage tail fiber protein	B5TK81	Pseudomonas_phage	1.5e-37	39.6
AZD27985.1\|1329921_1330407_+	Phage protein	Q9ZXK5	Pseudomonas_virus	4.2e-18	43.3
AZD27986.1\|1330478_1331219_+\|tail	Prophage tail fiber protein	B5TK77	Pseudomonas_phage	4.2e-22	67.1
AZD27987.1\|1331221_1331653_+	hypothetical protein	Q9ZXK5	Pseudomonas_virus	2.2e-23	38.4
AZD27988.1\|1331698_1332262_+	Lytic enzyme	B5TK83	Pseudomonas_phage	3.7e-87	83.3
AZD27989.1\|1332243_1332780_+	hypothetical protein	B5TK84	Pseudomonas_phage	2.2e-60	70.8
AZD27990.1\|1332862_1333363_+	Nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	1.0e-72	86.1
AZD27991.1\|1333446_1334499_+	RecA protein	A0A0S2MVG1	Bacillus_phage	4.4e-113	60.9
AZD27992.1\|1334507_1334975_+	Regulatory protein RecX	NA	NA	NA	NA
AZD27993.1\|1335020_1336136_-	Decarboxylase family protein	NA	NA	NA	NA
AZD27994.1\|1336620_1336815_+	hypothetical protein	NA	NA	NA	NA
AZD27995.1\|1336816_1337239_-	Putative NADPH-quinone reductase (modulator of drug activity B)	NA	NA	NA	NA
AZD27996.1\|1337428_1338139_+	putative conserved protein YfiP, contains DTW domain	NA	NA	NA	NA
AZD27997.1\|1338473_1339124_+	Transcriptional regulator, LuxR family	NA	NA	NA	NA
AZD27998.1\|1339199_1339562_+	Diacylglycerol kinase	NA	NA	NA	NA
AZD27999.1\|1339558_1340485_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZD28000.1\|1340618_1341398_+	Ferredoxin--NADP(+) reductase	NA	NA	NA	NA
AZD28001.1\|1341470_1342166_-	S-adenosylmethionine-dependent methyltransferase YaeB	NA	NA	NA	NA
AZD28002.1\|1342252_1343023_-	Rhamnolipid biosynthesis 3-oxoacyl-ACP reductase RhlG	NA	NA	NA	NA
AZD28003.1\|1343156_1343618_-	Uncharacterized protein YehS	Q9EYF4	Enterobacteria_phage	1.1e-36	51.3
AZD28004.1\|1343684_1344395_-	Ribosomal large subunit pseudouridine synthase F	NA	NA	NA	NA
AZD28005.1\|1344477_1344951_-	Acetyltransferase	NA	NA	NA	NA
AZD28006.1\|1345057_1346395_-	Ribosomal protein S12p Asp88 methylthiotransferase	NA	NA	NA	NA
AZD28007.1\|1346726_1348628_+	Kup system potassium uptake protein	M1HZV6	Acanthocystis_turfacea_Chlorella_virus	1.3e-78	34.9
AZD28008.1\|1348845_1349121_-	hypothetical protein	NA	NA	NA	NA
AZD28009.1\|1349621_1350917_-	Alanylphosphatidylglycerol hydrolase, periplasmic	NA	NA	NA	NA
AZD28010.1\|1350916_1353565_-	Alanylphosphatidylglycerol synthase	NA	NA	NA	NA
AZD28011.1\|1354503_1355568_+	DNA polymerase IV	NA	NA	NA	NA
AZD28012.1\|1355633_1356587_-	putative lipoprotein	NA	NA	NA	NA
AZD28013.1\|1356604_1358320_-\|tRNA	Prolyl-tRNA synthetase, bacterial type	NA	NA	NA	NA

DBSCAN-SWA_2

4167289 : 4173560

uncultured_Caudovirales_phage(83.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZD30538.1\|4167289_4167682_+\|tRNA	tRNA 5-methylaminomethyl-2-thiouridine synthase subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	9.6e-58	83.8
AZD30539.1\|4167685_4168048_+\|tRNA	tRNA 5-methylaminomethyl-2-thiouridine synthase subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	1.9e-44	75.0
AZD30540.1\|4168047_4168347_+\|tRNA	tRNA 5-methylaminomethyl-2-thiouridine synthase subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	6.3e-33	70.7
AZD30541.1\|4168343_4168679_+\|tRNA	tRNA 2-thiouridine synthesis protein TusE	A0A2H4J8B6	uncultured_Caudovirales_phage	8.5e-47	82.0
AZD30542.1\|4168675_4169677_+	Anthranilate phosphoribosyltransferase like	A0A2H4JBY5	uncultured_Caudovirales_phage	1.6e-165	84.5
AZD30543.1\|4169766_4170774_+	Glutathione S-transferase, omega	NA	NA	NA	NA
AZD30544.1\|4170884_4172279_-	Precorrin-2 oxidase	NA	NA	NA	NA
AZD30545.1\|4172279_4173560_-\|tRNA	Seryl-tRNA synthetase	A0A1B1IVT2	uncultured_Mediterranean_phage	3.6e-101	54.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage