CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP027718	Pseudomonas chlororaphis subsp. aurantiaca strain Q16 chromosome, complete genome	4 crisprs	DinG,csa3,cas3,PD-DExK,DEDDh,WYL	0	7	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP027718_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027718_1

423757-423859

Orphan

Consensus_repeat	Method
GCGCCGGGCCCGGTGTAAAGAGGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP027718_1

>merge|CP027718|1|423757-423859|CRISPRCasFinder
GCGCCGGGCCCGGTGTAAAGAGGGGAAGCCCCGGCCTGCCTGTACCAAGGTTCCCAAAAGCGTGAGGGCCGCGCTGATTGCGCTGGGCCCGGTGTAAAGAGGG

>CP027718|1|1|423757-423859|CRISPRCasFinder
GCGCCGGGCCCGGTGTAAAGAGGG	GAAGCCCCGGCCTGCCTGTACCAAGGTTCCCAAAAGCGTGAGGGCCGCGCTGATT
GCGCTGGGCCCGGTGTAAAGAGGG

Protein	Signature genes	Signature genes Name	Protein_function
CP027718.1\|AZD76982.1\|422798_423254_-\|tRNA-(cytidine(34)-2'-O)-methyltransferase	unknown	unknown	gnl\|CDD\|223297
CP027718.1\|AZD76981.1\|422096_422579_+\|Protein-export-protein-SecB-(maintains-pre-export-unfolded-state)	unknown	unknown	gnl\|CDD\|180234
CP027718.1\|AZD76976.1\|416924_418235_-\|Carboxyl-terminal-protease	unknown	unknown	gnl\|CDD\|223864
CP027718.1\|AZD76983.1\|423318_423693_+\|hypothetical-protein	unknown	unknown	unknown
CP027718.1\|AZD76974.1\|415269_415935_+\|ABC-type-amino-acid-transport/signal-transduction-system,-periplasmic-component/domain	unknown	unknown	gnl\|CDD\|223904
CP027718.1\|AZD76984.1\|424502_425939_-\|Nitrogen-regulation-protein-NtrC	unknown	unknown	gnl\|CDD\|273818
CP027718.1\|AZD76975.1\|416007_416766_-\|Putative-periplasmic-protein-YibQ	unknown	unknown	gnl\|CDD\|377404
CP027718.1\|AZD76985.1\|425935_427021_-\|Nitrogen-regulation-protein-NtrB	unknown	unknown	gnl\|CDD\|226370
CP027718.1\|AZD76992.1\|435363_436566_+\|Acetyl-CoA-acetyltransferase	unknown	unknown	gnl\|CDD\|181242
CP027718.1\|AZD76990.1\|433010_433805_+\|Enoyl-CoA-hydratase/isomerase-family-protein	unknown	unknown	gnl\|CDD\|236162
CP027718.1\|AZD76988.1\|429999_431721_+\|Acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173843
CP027718.1\|AZD76986.1\|427379_428792_-\|putative-MFS-type-transporter	unknown	unknown	gnl\|CDD\|340927
CP027718.1\|AZD76989.1\|431753_432941_+\|L-carnitine-dehydratase/bile-acid-inducible-protein-F	unknown	unknown	gnl\|CDD\|367110
CP027718.1\|AZD76993.1\|436708_437824_+\|Methylphosphotriester-DNA--protein-cysteine-S-methyltransferase	unknown	unknown	gnl\|CDD\|225080
CP027718.1\|AZD76978.1\|419689_421219_-\|2,3-bisphosphoglycerate-independent-phosphoglycerate-mutase	unknown	unknown	gnl\|CDD\|235463
CP027718.1\|AZD76991.1\|433801_435328_+\|3-hydroxyacyl-CoA-dehydrogenase-PaaC	unknown	unknown	gnl\|CDD\|236211
CP027718.1\|AZD76977.1\|418266_419553_-\|Murein-hydrolase-activator-EnvC	unknown	unknown	gnl\|CDD\|227278
CP027718.1\|AZD76979.1\|421370_421784_+\|Rhodanese-related-sulfurtransferase-YibN	unknown	unknown	gnl\|CDD\|238089
CP027718.1\|AZD76987.1\|428987_429887_-\|Transcriptional-regulator,-LysR-family	unknown	unknown	gnl\|CDD\|176139
CP027718.1\|AZD76980.1\|421785_422040_+\|Glutaredoxin-3-(Grx3)	unknown	unknown	gnl\|CDD\|274017

Protein	Function_ID	Function_description	E-value
CP027718.1\|AZD76982.1\|422798_423254_-\|tRNA-(cytidine(34)-2'-O)-methyltransferase	gnl\|CDD\|223297	COG0219, CspR, Predicted rRNA methylase (SpoU class) [Translation, ribosomal structure and biogenesis].	1.05147e-88
CP027718.1\|AZD76981.1\|422096_422579_+\|Protein-export-protein-SecB-(maintains-pre-export-unfolded-state)	gnl\|CDD\|180234	PRK05751, PRK05751, preprotein translocase subunit SecB; Validated.	4.26189e-83
CP027718.1\|AZD76976.1\|416924_418235_-\|Carboxyl-terminal-protease	gnl\|CDD\|223864	COG0793, Prc, Periplasmic protease [Cell envelope biogenesis, outer membrane].	1.95839e-143
CP027718.1\|AZD76974.1\|415269_415935_+\|ABC-type-amino-acid-transport/signal-transduction-system,-periplasmic-component/domain	gnl\|CDD\|223904	COG0834, HisJ, ABC-type amino acid transport/signal transduction systems, periplasmic component/domain [Amino acid transport and metabolism / Signal transduction mechanisms].	3.35917e-21
CP027718.1\|AZD76984.1\|424502_425939_-\|Nitrogen-regulation-protein-NtrC	gnl\|CDD\|273818	TIGR01818, Nitrogen_assimilation_regulatory_protein, nitrogen regulation protein NR(I). This model represents NtrC, a DNA-binding response regulator that is phosphorylated by NtrB and interacts with sigma-54. NtrC usually controls the expression of glutamine synthase, GlnA, and may be called GlnL, GlnG, etc. [Central intermediary metabolism, Nitrogen metabolism, Regulatory functions, DNA interactions, Signal transduction, Two-component systems].	0
CP027718.1\|AZD76975.1\|416007_416766_-\|Putative-periplasmic-protein-YibQ	gnl\|CDD\|377404	pfam04748, Polysacc_deac_2, Divergent polysaccharide deacetylase. This family is divergently related to pfam01522 (personal obs:Yeats C).	3.15613e-91
CP027718.1\|AZD76985.1\|425935_427021_-\|Nitrogen-regulation-protein-NtrB	gnl\|CDD\|226370	COG3852, NtrB, Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms].	1.36849e-164
CP027718.1\|AZD76992.1\|435363_436566_+\|Acetyl-CoA-acetyltransferase	gnl\|CDD\|181242	PRK08131, PRK08131, 3-oxoadipyl-CoA thiolase.	0
CP027718.1\|AZD76990.1\|433010_433805_+\|Enoyl-CoA-hydratase/isomerase-family-protein	gnl\|CDD\|236162	PRK08138, PRK08138, enoyl-CoA hydratase; Provisional.	6.48716e-161
CP027718.1\|AZD76988.1\|429999_431721_+\|Acyl-CoA-dehydrogenase	gnl\|CDD\|173843	cd01154, AidB, Proteins involved in DNA damage response, similar to the AidB gene product. AidB is one of several genes involved in the SOS adaptive response to DNA alkylation damage, whose expression is activated by the Ada protein. Its function has not been entirely elucidated; however, it is similar in sequence and function to acyl-CoA dehydrogenases. It has been proposed that aidB directly destroys DNA alkylating agents such as nitrosoguanidines (nitrosated amides) or their reaction intermediates.	7.17068e-148
CP027718.1\|AZD76986.1\|427379_428792_-\|putative-MFS-type-transporter	gnl\|CDD\|340927	cd17369, MFS_ShiA_like, Shikimate transporter and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli shikimate transporter (ShiA), inner membrane metabolite transport protein YhjE, and other putative metabolite transporters. ShiA is involved in the uptake of shikimate, an aromatic compound involved in siderophore biosynthesis. It has been suggested that YhjE may mediate the uptake of osmoprotectants. The ShiA-like subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.1003e-151
CP027718.1\|AZD76989.1\|431753_432941_+\|L-carnitine-dehydratase/bile-acid-inducible-protein-F	gnl\|CDD\|367110	pfam02515, CoA_transf_3, CoA-transferase family III. CoA-transferases are found in organisms from all lines of descent. Most of these enzymes belong to two well-known enzyme families, but recent work on unusual biochemical pathways of anaerobic bacteria has revealed the existence of a third family of CoA-transferases. The members of this enzyme family differ in sequence and reaction mechanism from CoA-transferases of the other families. Currently known enzymes of the new family are a formyl-CoA: oxalate CoA-transferase, a succinyl-CoA: (R)-benzylsuccinate CoA-transferase, an (E)-cinnamoyl-CoA: (R)-phenyllactate CoA-transferase, and a butyrobetainyl-CoA: (R)-carnitine CoA-transferase. In addition, a large number of proteins of unknown or differently annotated function from Bacteria, Archaea and Eukarya apparently belong to this enzyme family. Properties and reaction mechanisms of the CoA-transferases of family III are described and compared to those of the previously known CoA-transferases.	1.7145e-149
CP027718.1\|AZD76993.1\|436708_437824_+\|Methylphosphotriester-DNA--protein-cysteine-S-methyltransferase	gnl\|CDD\|225080	COG2169, Ada, Adenosine deaminase [Nucleotide transport and metabolism].	1.41374e-81
CP027718.1\|AZD76978.1\|419689_421219_-\|2,3-bisphosphoglycerate-independent-phosphoglycerate-mutase	gnl\|CDD\|235463	PRK05434, PRK05434, 2,3-bisphosphoglycerate-independent phosphoglycerate mutase.	0
CP027718.1\|AZD76991.1\|433801_435328_+\|3-hydroxyacyl-CoA-dehydrogenase-PaaC	gnl\|CDD\|236211	PRK08268, PRK08268, 3-hydroxy-acyl-CoA dehydrogenase; Validated.	0
CP027718.1\|AZD76977.1\|418266_419553_-\|Murein-hydrolase-activator-EnvC	gnl\|CDD\|227278	COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning].	9.03093e-101
CP027718.1\|AZD76979.1\|421370_421784_+\|Rhodanese-related-sulfurtransferase-YibN	gnl\|CDD\|238089	cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein. The cysteine containing enzymatically active version of the domain is also found in the Cdc25 class of protein phosphatases and a variety of proteins such as sulfide dehydrogenases and certain stress proteins such as senesence specific protein 1 in plants, PspE and GlpE in bacteria and cyanide and arsenate resistance proteins. Inactive versions (no active site cysteine) are also seen in dual specificity phosphatases, ubiquitin hydrolases from yeast and in sulfuryltransferases, where they are believed to play a regulatory role in multidomain proteins.	6.79697e-24
CP027718.1\|AZD76987.1\|428987_429887_-\|Transcriptional-regulator,-LysR-family	gnl\|CDD\|176139	cd08448, PBP2_LTTR_aromatics_like_2, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to regulators involved in the catabolism of aromatic compounds, contains type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type regulator similar to CbnR which is involved in the regulation of chlorocatechol breakdown. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.60193e-89
CP027718.1\|AZD76980.1\|421785_422040_+\|Glutaredoxin-3-(Grx3)	gnl\|CDD\|274017	TIGR02181, GRX_bact, Glutaredoxin, GrxC family. Glutaredoxins are thioltransferases (disulfide reductases) which utilize glutathione and NADPH as cofactors. Oxidized glutathione is regenerated by glutathione reductase. Together these components compose the glutathione system. Glutaredoxins utilize the CXXC motif common to thioredoxins and are involved in multiple cellular processes including protection from redox stress, reduction of critical enzymes such as ribonucleotide reductase and the generation of reduced sulfur for iron sulfur cluster formation. Glutaredoxins are capable of reduction of mixed disulfides of glutathione as well as the formation of glutathione mixed disulfides. This family of glutaredoxins includes the E. coli protein GrxC (Grx3) which appears to have a secondary role in reducing ribonucleotide reductase (in the absence of GrxA) possibly indicating a role in the reduction of other protein disulfides. [Energy metabolism, Electron transport].	9.3713e-50

>CP027718.1|AZD76983.1|423318_423693_+|hypothetical-protein
MLRVFGSLAIFGVMVGLMIGRLTTPDPTELQEVQVQPNALVVWFNNEPKVHGEHIDGAVALLFEAEGRAQKGQLKINDKDANWRVRTTEEGLLLNVVAARALHGEWSGSEVDGRWRLELQLREE
>CP027718.1|AZD76982.1|422798_423254_-|tRNA-(cytidine(34)-2'-O)-methyltransferase
MFHVILFQPEIPPNTGNVIRLCANSGCHLHLIEPLGFEMDDKRLRRAGLDYHEYATLQRHADLASCLESLGHPRLFAFTTKGSRPFHDASFAEGDAFLFGPESRGLPAEVLDALPAEQRLRLPMREGCRSLNLSNTVAVAVYEAWRQLGFK
>CP027718.1|AZD76981.1|422096_422579_+|Protein-export-protein-SecB-(maintains-pre-export-unfolded-state)
MTDQQNTAATEDESAPQFSLQRIYVRDLSFEAPKSPAIFRQQWEPSVGLDLNTRQKALEEGFHEVVLTLSVTVKNGEEVAFIAEVQQAGIFLIKNLDDASMSHTLGAFCPNILFPYAREALDSLVTRGSFPALMLAPVNFDALYAQELQRLQAAGEGTVQ
>CP027718.1|AZD76980.1|421785_422040_+|Glutaredoxin-3-(Grx3)
MAAVVVYSSDYCPYCSRAKHLLENKGVAFEEIKVDGKPQVRAEMAQKAGRTSVPQIWIGSTHVGGCDDLFALERAGKLDALLAA
>CP027718.1|AZD76979.1|421370_421784_+|Rhodanese-related-sulfurtransferase-YibN
MVAHLIQFATEHYLLVGAFVILLALLIAHELSRGGRSLSTRELTALVNSEQGVVIDIRPSKDFAAGHIVGALNIPQDKLAARVGELEKHKAKTIILVDALGQHAGTHARELMKSGFTAAKLSGGVGSWKADNLPLVK
>CP027718.1|AZD76978.1|419689_421219_-|2,3-bisphosphoglycerate-independent-phosphoglycerate-mutase
MTTTPKPLVLMILDGFGHSESHESNAIYAAKKPVLDRLCASVPNGLISGSGIDVGLPDGQMGNSEVGHMNLGAGRVVYQDFTRVTKAIRDGEFFENPTICAAVDKAVAADKAVHILGLLSDGGVHSHQDHLVAMAELAFKRGAEKIYLHAFLDGRDTPPKSATSSIELLDETFKTLGKGRIASLIGRYFAMDRDNRWDRVAQAYNLIVDGKGEFNAATAQEGLQAAYERGESDEFVKATTLGEPVKVEDGDAVVFMNFRADRARELSRVFVEDDFKEFARARQPKLAGFVMLTQYAASIPAPSAFAPGSLENVLGDYLAKNGKTQLRIAETEKYAHVTFFFSGGREEPFPGEERILIPSPKVATYDLQPEMSAPEVTDRIVDAIENQRYDVIVVNYANGDMVGHSGVFDAAVKAVECLDLCVGRIVDALEKVGGEALITADHGNVEQMSDAATGQAHTAHTSEPVPFIYVGKRNLKVREGGVLADVAPTMLKLLGLPQPAEMTGTSILV
>CP027718.1|AZD76977.1|418266_419553_-|Murein-hydrolase-activator-EnvC
MLRALITLALICLLQPAFADERAQTQQQLDATRQDIAELKKLLGKLQEEKSGVQKDLRGTETEMGKLEKQVDALQKELKKSESELQRLDEEKKKLQSARIEQQRLIAIQARAAYQNGRQEYLKLLLNQQNPEKFARTLTYYDYLSQARLEQLKNFNETLRQLANVEKEISLQQAQLLVQKSSLDTQREELDKVRKERQVALAKLNDDVKARGDKLKAREQDQADLGKVLKTIEETLARQAREAEEARQKALIAQQEAEKKRLREAQASADDSPRKPPRAAPGPLVSSAGASYGGPFASSRGKLPWPVDGRLLARFGESRGDDARTKWDGVMISASAGSQVHAVHGGRVVFADWLRGAGLLVILDHGNGYLSLYGHNQTLLKEAGDVVKAGESISTVGSSGGQGAPALYFAIRQQGRPSDPAQWCRAQG
>CP027718.1|AZD76976.1|416924_418235_-|Carboxyl-terminal-protease
MLHLSRLTSLALTIALVIGAPLAFAAETAQSTAATTTKAPLPLEELRTFAEVMDRIKAAYVEPVDDKTLLENAIKGMLSNLDPHSAYLGPEDFAELQESTSGEFGGLGIEVGAEDGIIKVVSPIDDTPASKAGIQAGDLIVKINGQPTRGQSMTEAVDKMRGKIGQKITLTLVRDGGAPFDVTLARATIQVKSVKSQLLESGYGYIRITQFQVKTGEEVSKALAKLRKDNGKKLNGIILDLRNNPGGVLQSAVEVVDHFITKGLIVYTKGRIANSELRFSATGKDESEAVPMVVLINGGSASASEIVAGALQDQKRAVLMGTTSFGKGSVQTVLPLNNDRALKITTALYFTPNGRSIQAQGIVPDIEVRRAKITNEAQDNEYFKEADLQGHLGNGNGGADKPTASGSKPKPMPQDDDYQLAQALSLLKGLSITRSK
>CP027718.1|AZD76975.1|416007_416766_-|Putative-periplasmic-protein-YibQ
MIGLLCLLAFTSIQAAEPAARKAYLSLIIDDLGQNLPRDRRVLALPGPVTTAIMPDTPHAAEFAREAHRAGKIVILHMPMDPATGPFAWHPELPIEELERRLNAAFKAVPYTSGINNHMGSRMTSQPQAMAWLMAELQRRHKFFVDSRTSAKTVAAAEAQKIGLASVSRDVFLDDERTEDAISHQLQTAIDLAHKQGSAVVIGHPYPQTLAVLERELPRLKAQGIDWIDIELMISVRSNRAMSGHGKDGVYR
>CP027718.1|AZD76974.1|415269_415935_+|ABC-type-amino-acid-transport/signal-transduction-system,-periplasmic-component/domain
MLLTENFPPYNMAKNGKNFAQGENINGIAVDIVREMFKRAGINYSLTLRFPWERIYKLALEQPGYGVFVTARLPDREPLFKWVGPIGPDDWILLARDDSKIALQSLEQARKYRIGAYKGDAIAETLAKQGLKPQVVLKDQDNARKLVGGQIDLWATGDPAGRYLARQEGVTGLKTVLRFHSTQLYLALNKEVPDETVARLQAALDQLREEGVVEEIMGRYL
>CP027718.1|AZD76984.1|424502_425939_-|Nitrogen-regulation-protein-NtrC
MSRSETVWIVDDDRSIRWVLEKALQQEGMTTQSFDSADGVMSRLARQQPDVIISDIRMPGASGLDLLARIREQHPRLPVIIMTAHSDLDSAVASYQGGAFEYLPKPFDVDEAVSLVKRANQHAQEQQGLEVIPALARTPEIIGEAPAMQEVFRAIGRLSHSNITVLINGESGTGKELVAHALHRHSPRAASPFIALNMAAIPKDLMESELFGHEKGAFTGAANLRRGRFEQADGGTLFLDEIGDMPADTQTRLLRVLADGEFYRVGGHTPVKVDVRIIAATHQNLETLVHAGKFREDLFHRLNVIRIHIPRLSDRREDIPTLAKHFLSRAAQELAVEPKLLKSETEEYLKNLPWPGNVRQLENTCRWITVMASGREVHISDLPPELLSLPQDSAPVTNWEQALRQWADQALARGQSSLLDSAVPSFERIMIETALKHTAGRRRDAAVLLGWGRNTLTRKIKELGMKVDGGDDDDSDEG
>CP027718.1|AZD76985.1|425935_427021_-|Nitrogen-regulation-protein-NtrB
MTISDQLHRLLLDNLTTATILLNADLRLEYMNPAAEMLLAISGQRSHGQFISELFTESAEALSSLRQAVEQAHPFTKREAMLTALTGQTLTVDYAVTPILSNGDTLLLLEVHPRDRLLRITKEEAQLSKQETSKMLVRGLAHEIKNPLGGIRGAAQLLARELPDENLKDYTNVIIEEADRLRNLVDRMLGSNKLPSLAMCNVHEVLERVSSLVEAESQGCITLVRDYDPSIPDVLIDREQMIQAVLNIVRNAMQAISSQNELRLGRICLRTRTMRQFTIGHVRHRLVTKIEIIDNGPGIPAELQETIFFPMVSGRPDGTGLGLAITQNIISQHQGLIECDSHPGHTTFSIFLPLEQGAPST
>CP027718.1|AZD76986.1|427379_428792_-|putative-MFS-type-transporter
MNAAQHAAAHKKARKAGIASFIGTTIEWYDFYAYGIAAALVFGKVFFPADLPAGTATLLSFLTLWAGFIARPVGGIIFGHLGDKIGRKTTLVITLIMMGVATTCIGLLPSYLQIGIWAPTALVVLRIIQGIAVGGEWGGAILIASESAPKGKGILYAAFAQQGSPAGNLLATLVFFGLSALPAPDFLLWGWRIPFLLSAALVLVGMVIRLKLEESDDMKRLIQQKKTVKLPILEVLRNHWQIVLLGAGVLPIIHVTYFKSTFALSWATKELGYSQSTFLSVIVISLVVQFITQPLGAVLVSRMDMRKAVMLMLLPEFFLMPAMFFAVETGTYWIAVLGMCLATVPHSMFYGAVGGILARAFPTKVRYSGLSISYQLCSLLVGGATPVLAQGILNNTGSIVGVAIASACYALVSLVCMLLLLKRIGHNAADLSTAEQADADELAREPRATPLIEDPATLLPSIDKDAQPAH
>CP027718.1|AZD76987.1|428987_429887_-|Transcriptional-regulator,-LysR-family
MDLKQLRYFVAVAEELHFGRAAARLFISQPALSFDIKKLESQLEVQLLTRNNKSVSLTNAGQVLLDEARYLLLRAEQARRLTLRSAQGFVGRLSIGFVNSILHRGLPQAVRTFEQDHPDTEIVLMEMNSAEQAQALQRGQIDIGFVHWSHFPESIRGEPVLAEPFLCCLPQGHRLAGESRIDLAQLANDDFILFPRNVSPHYHDLIIARCVAAGFSPRIRHETRLWQTVVAMVAYDMGVALVPQTLAGTWKEGVHYCEISGDGALSEIHAIRHADKPSAAAESFLTTLKALQKPVAPGL
>CP027718.1|AZD76988.1|429999_431721_+|Acyl-CoA-dehydrogenase
MTALPEPAQDTLNIPDSRGLNLFDCDAGLAALLKVYLPPQLFAQWLPTLRQLGGRAGGELDVLALSADKNPPQLRPRTRRGEDLQSIYKHPDFIALERAAYAELGLASMSHGAEPVLPLVKYALTFLFVQAEFGLCCPVSMTDSLTRTLRKFGSPELVARYLPSLASRDFDRLFQGAMFMTEQAAGSDVSRTETRARLENGEWRLFGDKWFCSNPDADLAMVLARPEDAPEGMKGVSLFLLPKLRPDGSRNAYRILRLKDKLGSRSMASGEISLDGATAYLIGEVGRGFQQMADMINMSRLSNGVRAAGLMRRGVNEALYVARHRRAFGRHLIEMPLMQRQLLKMMLPAEQARSMFMQIATLLPKADAGDEAARKCVRILTPLIKFRACRDARRVTGDAMEVRGGVGYIEEWSDARLVRDAHLGSIWEGTSNIVALDIARAVTREQALEPLRHYLAGLLAETDLPAASQRLFETVLQRAVAAIEKVAQERRDDQVRLAGSALYHTATAIFMAWEASRQAPDYRRLALAHLLLQHKLLLRDPLRPEPALEPELLALLANESPLSKADAMQLLPA
>CP027718.1|AZD76989.1|431753_432941_+|L-carnitine-dehydratase/bile-acid-inducible-protein-F
MNHSKGALAGLKVIDLSRVLGGPYCSQALADHGAEVIKLEPLSGDETRGWGPPFEGADASYFRGVNRNKQGIAVDLSRPAGITLLMRLLEDADVLIENFKPGTLERWGIGYAEVLSQRFPTLIHCAISGFGGDGPLGGLPGYDAVIQAMAGLMSVNGEADSGPLRIGLPIVDMVTGLNALAGILLALNERHRSGLGQSLDITLYDCGVSLLHPHLANYFAAGKTPLRTGNAHPNIAPYDSYRTGTEPIFLAVGNDRQFAKLCEQLDAGALLDDPRFTDNGRRSVNREALKQVLEARLAKHDGTLLAQRLIRLGVPCGSIASIDKVVEHPHTRHRGLLVEIGDYRGVGSPVKLSRTPASYRSAPPALGANTREVLEGLGLDDQTIESLFEHGIVRE
>CP027718.1|AZD76990.1|433010_433805_+|Enoyl-CoA-hydratase/isomerase-family-protein
MSPESVSLQPLVLLEHPAPGVALLRLNRPQALNALNMALREELAEHFRRLDACPQTRVVVLTGGDRVFAAGADLGELVSASALQLYARHAERHWQAISACRKPVIAAVNGYALGGGCELAMHCDLIVAGHSARFAQPEIKVGVMPGAGGTQRLLRAVGKFQALRLLLTGCQVPADEALRLGLVSEVVADSETLPRALALATSIAGMPPLAVAQIKEVVLAGMDLPLEQALVLERKAFQLLFGSHDQREGMQAFLEKRKPEYQGK
>CP027718.1|AZD76991.1|433801_435328_+|3-hydroxyacyl-CoA-dehydrogenase-PaaC
MTAQPLQRIGLVGTGAMGRGIAQVMAMAGLKVFLFDARPGAAGTAREQLATIYAQQIEKARITPQDAAAAMLNLEVVDSLEALCDCQLVIEAIVENLEAKQQLFRQLEEVLAPSAILASNTSSLSITAIASVCRHPERVAGLHFFNPVPRMRIVEVVDGLATRVGARLQELVRAVGYYPARAKDSPGFIVNHAGRAFGTEALRILSEGVAPAWRIDALLRDSAGFAMGPFELLDLIGLDVSVPVMESIYRQFYEEPRYRPHPVLRLMQAGGRLGRKSGQGFYLYDEPGDTRRPPQAVPHCAALPPVWIAADDEVGRLRLLDLLERLGAQVENGLRPSSSALCLVAPLGDDATEAALRHATDPSRTVAIDTLTTLDSQRCLMLNPATREDMQHAAHALFSADGGTVTLIRDSCGFIVQRTLASIVNLACDIAQQGIASVADIDAAVRLGLGYPLGPLEWGDQLGPERLLQILERLHALTGDPRYRPSGWLRRRALLGLSLRQPENPMPA
>CP027718.1|AZD76992.1|435363_436566_+|Acetyl-CoA-acetyltransferase
MLDAYIYSGLRTPFGRHGGSLASVRPDDLVGPLLVRLLETSGLPAEALEEVILGCTNQAGEDSRNLARNALLSAGLPWRVPGQTVNRLCASGLSAVIDAARAITCGEGRLYLAGGVESMSRAPFIMAKAESAYSQTLDVADSTIGARFANPKLVERYGNHSMPETGDNLARRFAISREDADRFAAASQARYQEALLAGVLDDEIMAVEVPIGRKGQSLTVCDDEHPRPRSDLAALSRLPTLFAEGVVTAGNASGINDGAAVLLLGSREIGMEHGVAPMARILSSASVGVEPQFMGIGPHRAILLALQRARIGLEQLDLIEINEAFAPQVLACLKALNLDFDDPRVNPNGGAIAIGHPLGASGARLVLSACRALQRNQQRYAVVSLCVGVGQGVAMVIERA
>CP027718.1|AZD76993.1|436708_437824_+|Methylphosphotriester-DNA--protein-cysteine-S-methyltransferase
MDNAPLLFQLPDDDTLYRALLERDPAYDGFAFVGVKSTGVFCRLTCAARKPKRENTVFFSSIKACVEAGFRACLRCRPLEQTGAQEPLVKQLLALLENNADKRWYEGDLIELGFDPSTVRRAFKRHFGVTFLEMARLRRIGEGMQQLAGGASVIDAQISASFDSDSGFRSAFTRLLGQPPSNLRGRELLKADWLQTPIGVMLAVADAQVLHLLEFFDRPALATELKRLQEHTGSTIGFGRFAPIDQIESELRRFFAGESASFATPLALNASAFTRTVWQALRAIPPGVTRSYAEVASSIGSASAVRAVARANGANQIAIVIACHRVIGSDGSLTGYGGGLWRKRWLLEHERRLYAQVPARQHLRADEPVAG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP027718_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027718_2

973219-973488

Orphan

I-F

Consensus_repeat	Method
GTTCACTGCCGAATAGGCAGCTTAGAAAT	CRISPRCasFinder
GTTCACTGCCGAATAGGCAGCTTAGAAA	CRT

4 spacers

The CRISPR arrays of CP027718_2

>merge|CP027718|2|973219-973488|CRISPRCasFinder,CRT
GTTCACTGCCGAATAGGCAGCTTAGAAATGGTGGATCTGCGCGGCGAAGGTCGCCACCGGGTTCACTGCCGAATAGGCAGTTTAGAAATCAGCGCGGCGATACGCTCCAGGGTTTCTTCATGTTCACTGCTGAATAGGCAGCTTAGAAAGGTTTGGGCTTACGTCACGGATGCCCAGGGTAGTTCACTGCCAAATAGGCAGCTCAGAAAAGCCGGGCTTTTTGGTTTCTGCAATTTGGCTAGCTCACTGCCGCACAGGCAGCCCAAGCGT

>CP027718|2|2|973219-973488|CRISPRCasFinder
GTTCACTGCCGAATAGGCAGCTTAGAAAT	GGTGGATCTGCGCGGCGAAGGTCGCCACCGG
GTTCACTGCCGAATAGGCAGTTTAGAAAT	CAGCGCGGCGATACGCTCCAGGGTTTCTTCAT
GTTCACTGCTGAATAGGCAGCTTAGAAAG	GTTTGGGCTTACGTCACGGATGCCCAGGGTA
GTTCACTGCCAAATAGGCAGCTCAGAAAA	GCCGGGCTTTTTGGTTTCTGCAATTTGGCTA
GCTCACTGCCGCACAGGCAGCCCAAGCGT

>CP027718|2|1|973219-973427|CRT
GTTCACTGCCGAATAGGCAGCTTAGAAA	TGGTGGATCTGCGCGGCGAAGGTCGCCACCGG
GTTCACTGCCGAATAGGCAGTTTAGAAA	TCAGCGCGGCGATACGCTCCAGGGTTTCTTCAT
GTTCACTGCTGAATAGGCAGCTTAGAAA	GGTTTGGGCTTACGTCACGGATGCCCAGGGTA
GTTCACTGCCAAATAGGCAGCTCAGAAA

Protein	Signature genes	Signature genes Name	Protein_function
CP027718.1\|AZD77462.1\|980590_981271_+\|PKHD-type-hydroxylase-YbiX	unknown	unknown	gnl\|CDD\|235483
CP027718.1\|AZD77454.1\|965676_965793_+\|hypothetical-protein	unknown	unknown	unknown
CP027718.1\|AZD77457.1\|969774_971517_+\|PTS-system,-fructose-specific-IIB-component	unknown	unknown	gnl\|CDD\|236740
CP027718.1\|AZD77463.1\|981274_982057_+\|Tetratricopeptide-repeat-family-protein	unknown	unknown	gnl\|CDD\|276807
CP027718.1\|AZD77453.1\|964668_965664_-\|Fructose-repressor-FruR,-LacI-family	unknown	unknown	gnl\|CDD\|236897
CP027718.1\|AZD77466.1\|985066_985720_-\|L-proline-glycine-betaine-ABC-transport-system-permease-protein-ProW	unknown	unknown	gnl\|CDD\|224095
CP027718.1\|AZD77452.1\|963877_964666_-\|Putative-deoxyribonuclease-YjjV	unknown	unknown	gnl\|CDD\|238635
CP027718.1\|AZD77449.1\|960254_960815_+\|1,6-anhydro-N-acetylmuramyl-L-alanine-amidase	unknown	unknown	gnl\|CDD\|236984
CP027718.1\|AZD77456.1\|968821_969763_+\|1-phosphofructokinase	unknown	unknown	gnl\|CDD\|274804
CP027718.1\|AZD77467.1\|985734_986628_-\|Glycine-betaine-binding-protein	unknown	unknown	gnl\|CDD\|270329
CP027718.1\|AZD77458.1\|972605_972977_+\|hypothetical-protein	unknown	unknown	unknown
CP027718.1\|AZD77465.1\|983912_985070_-\|Glycine-betaine/L-proline-transport-ATP-binding-protein-ProV	unknown	unknown	gnl\|CDD\|224050
CP027718.1\|AZD77450.1\|960811_961648_+\|Membrane-protein	unknown	unknown	gnl\|CDD\|226248
CP027718.1\|AZD77461.1\|978111_980385_-\|Ferrichrome-iron-receptor	unknown	unknown	gnl\|CDD\|227115
CP027718.1\|AZD77459.1\|973643_975185_+\|Phosphodiesterase/alkaline-phosphatase-D	unknown	unknown	gnl\|CDD\|226070
CP027718.1\|AZD77455.1\|965960_968822_+\|PTS-system,-fructose-specific-IIA-component	unknown	unknown	gnl\|CDD\|224006
CP027718.1\|AZD77460.1\|975305_977834_-\|putative-iron-regulated-membrane-protein	unknown	unknown	gnl\|CDD\|223446
CP027718.1\|AZD77451.1\|961845_963876_+\|Methyl-accepting-chemotaxis-sensor/transducer-protein	unknown	unknown	gnl\|CDD\|223910
CP027718.1\|AZD77464.1\|982163_983327_-\|Ornithine-decarboxylase,-eukaryotic	unknown	unknown	gnl\|CDD\|143482
CP027718.1\|AZD77468.1\|986648_987365_-\|Glycine-betaine/carnitine/choline-ABC-transporter,-permease-protein	unknown	unknown	gnl\|CDD\|224095

Protein	Function_ID	Function_description	E-value
CP027718.1\|AZD77462.1\|980590_981271_+\|PKHD-type-hydroxylase-YbiX	gnl\|CDD\|235483	PRK05467, PRK05467, Fe(II)-dependent oxygenase superfamily protein; Provisional.	4.49366e-152
CP027718.1\|AZD77468.1\|986648_987365_-\|Glycine-betaine/carnitine/choline-ABC-transporter,-permease-protein	gnl\|CDD\|224095	COG1174, OpuBB, ABC-type proline/glycine betaine transport systems, permease component [Amino acid transport and metabolism].	7.99664e-63
CP027718.1\|AZD77457.1\|969774_971517_+\|PTS-system,-fructose-specific-IIB-component	gnl\|CDD\|236740	PRK10712, PRK10712, PTS system fructose-specific transporter subunits IIBC; Provisional.	0
CP027718.1\|AZD77463.1\|981274_982057_+\|Tetratricopeptide-repeat-family-protein	gnl\|CDD\|276807	sd00010, SLR, Sel1-like repeat. Sel1-like repeats (SLRs) share similar alpha-helical conformations with Tetratricopeptide repeats (TPRs), but with different consensus sequence lengths and superhelical topologies. SLRs contain 36 to 44 amino acids and are present in bacteria and eukaryotes but not in archaea. SLR proteins are involved in a variety of functions, and many serve as adaptor proteins for the assembly of macromolecular complexes. The SLR family was named after the Caenorhabditis elegans Sel1 protein which is predicted to fold into 11 SLRs, a transmembrane domain, and an N-terminal signal sequence. The human Sel1L protein contains an additional fibronectin type-II domain and an N-terminal PEST sequence. Its downregulation is associated with the development of breast and pancreatic carcinomas.	7.16209e-27
CP027718.1\|AZD77453.1\|964668_965664_-\|Fructose-repressor-FruR,-LacI-family	gnl\|CDD\|236897	PRK11303, PRK11303, catabolite repressor/activator.	0
CP027718.1\|AZD77466.1\|985066_985720_-\|L-proline-glycine-betaine-ABC-transport-system-permease-protein-ProW	gnl\|CDD\|224095	COG1174, OpuBB, ABC-type proline/glycine betaine transport systems, permease component [Amino acid transport and metabolism].	5.66041e-71
CP027718.1\|AZD77452.1\|963877_964666_-\|Putative-deoxyribonuclease-YjjV	gnl\|CDD\|238635	cd01310, TatD_DNAse, TatD like proteins; E.coli TatD is a cytoplasmic protein, shown to have magnesium dependent DNase activity.	1.36676e-96
CP027718.1\|AZD77449.1\|960254_960815_+\|1,6-anhydro-N-acetylmuramyl-L-alanine-amidase	gnl\|CDD\|236984	PRK11789, PRK11789, 1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD.	9.70746e-127
CP027718.1\|AZD77456.1\|968821_969763_+\|1-phosphofructokinase	gnl\|CDD\|274804	TIGR03828, pfkB, 1-phosphofructokinase. This enzyme acts in concert with the fructose-specific phosphotransferase system (PTS) which imports fructose as fructose-1-phosphate. The action of 1-phosphofructokinase results in beta-D-fructose-1,6-bisphosphate and is an entry point into glycolysis (GenProp0688).	1.34412e-124
CP027718.1\|AZD77467.1\|985734_986628_-\|Glycine-betaine-binding-protein	gnl\|CDD\|270329	cd13611, PBP2_YehZ, Substrate-binding domain YehZ of an osmoregulated ABC-type transporter; the type 2 periplasmic-binding protein fold. Osmoprotectant binding lipoprotein YehZ of Clostridium sticklandii is predicted to be involved in uptake of compatible solutes such as choline, L-proline and glycine betaine, but the relative substrate preference is not known. To counteract the efflux of water, microorganisms accumulate the compatible solutes for a sustained adjustment to high osmolarity surroundings. YehZ belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	5.7691e-128
CP027718.1\|AZD77465.1\|983912_985070_-\|Glycine-betaine/L-proline-transport-ATP-binding-protein-ProV	gnl\|CDD\|224050	COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism].	4.76498e-156
CP027718.1\|AZD77450.1\|960811_961648_+\|Membrane-protein	gnl\|CDD\|226248	COG3725, AmpE, Membrane protein required for beta-lactamase induction [Defense mechanisms].	3.03551e-57
CP027718.1\|AZD77461.1\|978111_980385_-\|Ferrichrome-iron-receptor	gnl\|CDD\|227115	COG4774, Fiu, Outer membrane receptor for monomeric catechols [Inorganic ion transport and metabolism].	0
CP027718.1\|AZD77459.1\|973643_975185_+\|Phosphodiesterase/alkaline-phosphatase-D	gnl\|CDD\|226070	COG3540, PhoD, Phosphodiesterase/alkaline phosphatase D [Inorganic ion transport and metabolism].	0
CP027718.1\|AZD77455.1\|965960_968822_+\|PTS-system,-fructose-specific-IIA-component	gnl\|CDD\|224006	COG1080, PtsA, Phosphoenolpyruvate-protein kinase (PTS system EI component in bacteria) [Carbohydrate transport and metabolism].	0
CP027718.1\|AZD77460.1\|975305_977834_-\|putative-iron-regulated-membrane-protein	gnl\|CDD\|223446	COG0369, CysJ, Sulfite reductase, alpha subunit (flavoprotein) [Inorganic ion transport and metabolism].	5.98853e-126
CP027718.1\|AZD77451.1\|961845_963876_+\|Methyl-accepting-chemotaxis-sensor/transducer-protein	gnl\|CDD\|223910	COG0840, Tar, Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms].	6.75515e-63
CP027718.1\|AZD77464.1\|982163_983327_-\|Ornithine-decarboxylase,-eukaryotic	gnl\|CDD\|143482	cd00622, PLPDE_III_ODC, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Ornithine Decarboxylase. This subfamily is composed mainly of eukaryotic ornithine decarboxylases (ODC, EC 4.1.1.17) and ODC-like enzymes from prokaryotes represented by Vibrio vulnificus LysineOrnithine decarboxylase. These are fold type III PLP-dependent enzymes that differ from most bacterial ODCs which are fold type I PLP-dependent enzymes. ODC participates in the formation of putrescine by catalyzing the decarboxylation of ornithine, the first step in polyamine biosynthesis. Members of this subfamily contain an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain, similar to bacterial alanine racemases. They exist as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Homodimer formation and the presence of the PLP cofactor are required for catalytic activity. Also members of this subfamily are proteins with homology to ODC but do not possess any catalytic activity, the Antizyme inhibitor (AZI) and ODC-paralogue (ODC-p). AZI binds to the regulatory protein Antizyme with a higher affinity than ODC and prevents ODC degradation. ODC-p is a novel ODC-like protein, present only in mammals, that is specifically exressed in the brain and testes. ODC-p may function as a tissue-specific antizyme inhibitory protein.	1.47141e-173

>CP027718.1|AZD77458.1|972605_972977_+|hypothetical-protein
MKKLVPDPPVSVSFSRRNPDHDQANEQVRQALANHPVEGSLLAALKPTAAGPAGNDSLFTVRPGISAEEALLHVSMLLKSAEEVSDEITEHASGIERGLIWSLVHSVEMARGVVDALLDGNRR
>CP027718.1|AZD77457.1|969774_971517_+|PTS-system,-fructose-specific-IIB-component
MKLAIVTACPNGMVTSVLCARLLDAAAQRQGWSTSVEVHDEAHPERQLSAATLEAAEWVLVVSTGPLDMSRFVGKRVFQSSPSVALQDVDGVLRRGAEEAQVYVAAAAVAEPAPASKSAPRLVAVTACPTGVAHTFMAAEALQQTAKRLGYELQVETQGSVGARNPLSAEAIAAADVVLLAADIEVPTERFAGKKIYRCGTGIALKQSEATLNKALAEGQVESAAAGATAAPAKQEKTGVYKHLLTGVSFMLPMVVAGGLMIALSFVFGITAFKEEGTLAAALMQIGGDTAFKLMVPLLAGYIAYSIADRPGLAPGMIGGMLASTLGAGFIGGIIAGFIAGYAAKAISKYARLPQSLEALKPILIIPLLASLFTGLVMIYVVGKPVAGMLAGLTHFLDSMGTTNAILLGVLLGGMMCVDLGGPINKAAYAFSVGLLASQSYAPMAATMAAGMVPPIGLGIATFIARRKFAQSEREAGKAALVLGLCFISEGAIPFAAKDPLRVIPASIAGGALTGALSMYFGCKLMAPHGGLFVMLIPNAINHALLYLLAIVAGSLLTAVVYAVVKRPEATELALEPVKA
>CP027718.1|AZD77456.1|968821_969763_+|1-phosphofructokinase
MAKILTLTLNPALDLTVQLARLEPGQVNRSEAMHTHAAGKGVNVAQVLADLGHQLTVSGFLGEDNPQAFEALFARRGFVDAFVRVPGETRSNIKLAEQDGRITDLNGPGPEVDEAAQQALLARLEQIAPGHDAVVVAGSLPRGVSPQWLHALLTRLKALGLKVALDTSGEALRAGLAAGPWLVKPNTEELAEALGSPVLSLATQAEAARRLHAQGVEHVVISHGAEGVNWFSAAPALQALPPKVSVASTVGAGDSLLAGMLHGLLSAHAFEQTLRTATAIAAMAVTQIGFGITDATQLAQLEQGVRVHPLIEQ
>CP027718.1|AZD77455.1|965960_968822_+|PTS-system,-fructose-specific-IIA-component
MLELTIEQISMGQSAVDKSAALHLLADKLVADGLVAEGYLAGLQAREAQGSTFLGQGIAIPHGTPETRDQVFATGVRLLQFPEGVDWGDGQIVYLAIGIAAKSDEHLRLLQLLTRALGETDLGQALRRASSPEALLKLLQGAPQELALDAQMIGLGVAAEDFEELVWRGARLLRQADCVSNGFAAVLQQVEALPLGDGLWWLHSEQTVKRPGLAFVTPDKPIRYLGQPLAGLFCLASLGEAHQALLERLCALLIEGRGHELGRATSSRAVLEVLGGELPADWPSARIVLANAHGLHARPAKILAQLAKSFEGEVRVRIVDTPGSAVSVKSLSKLLSLGARRGQTLELIAEPNIAADALPALLAAIAEGLGEEVEPVPEASAPQEVPEEVEVPISAPASGSLVQAIPAAPGIAIGPAHIQVIQPFDYPLRGESTAIERERLQRALAEVRHDIDGLIQRSKAKAIREIFVTHQEMLDDPELTDEVDTRLKQGESAEAAWMTVIEAAARQQEALHDALLAERAADLRDIGRRVLAQLCGIETPTEPDEPYILVMDEVGPSDVARLDPARVAGILTARGGATAHSAIVARALGIPALVGAGAGVLLLKPGTPLLLDGQRGRLHVDADASTLQRATEERDTREQRLKAAAEQRHQLAHTTDGHHVEVFANIGESAGVASAVENGAEGIGLLRTELIFMAHPQAPDEATQEAEYRRVLDGLAGRPLVVRTLDVGGDKPLPYWPIAKEENPFLGVRGIRLTLQRPQIMEAQLRALLRSADNRPLRIMFPMVGSVDEWRAARDMTECLRQEIPVADLQLGIMIEVPSAALLAPVLAKEVDFFSVGTNDLTQYTLAIDRGHPTLSAQADGLHPAVLQLIDITVRAAHAHGKWVGVCGELAADPLAVPVLVGLGVDELSVSGRSIAEVKARIRELSLTQAQTLAEQALAVGSANDVRALVEAM
>CP027718.1|AZD77454.1|965676_965793_+|hypothetical-protein
MFSGACPDIFANPNRYRQATNVGTCSRQVGLQGWKIIE
>CP027718.1|AZD77453.1|964668_965664_-|Fructose-repressor-FruR,-LacI-family
MKLSDIARLAGVSVTTASYVINGKAEQQRISNATVERVRAVVEEHGFTPNPQAAGLRSRRTRTLGFILPDLENPSYARIAKLLEQGARARGYQLLIASSDDAPDSERQLLQLFRARRCDALFVASCLPPEDDTYRLLQAQGLPIIAIDRVMEPEFFCSVISDDQQASLHLTRSLLQPQPRQIALIGARPELGISQERAAGFKQALEGFDGQVLIEQGEAFSRDCGRQLMEALLERLGHLPDALVTTSYVLLQGVFDALHDFPLKSRPLRLGTFGDTQLLDFLPLPVNAMAQQHQLIADKALQLALAAIEEAHYQPGVNAIARTFKQRIHEA
>CP027718.1|AZD77452.1|963877_964666_-|Putative-deoxyribonuclease-YjjV
MELIDSHTHLDFPDFDADRQALLAASRALGVRRIVVLGVYQHNWQRLWELVQSDADLHAAFGLHPVYLDEHSPADLIELGDWLTRLAGHPQLCAVGEFGLDYFLEQLDRQRQQQLFEAQLQLAADFQLPALLHVRRSHAAVIATLKHFKLKRAGIIHAFAGSREEAREYLKLGFKLGLGGAATWPQALRLRKVIADLPLDAVVLETDSPDMAPAMYPGQRNSPQHLPEICAALAEIMAVSPEQLAAASTANACALFGWPHNA
>CP027718.1|AZD77451.1|961845_963876_+|Methyl-accepting-chemotaxis-sensor/transducer-protein
MKSLLYPAIALMNRLSFGMKFSLISVLFFLPMLVTNFYLVRDSYREFQGTQVELQSLDLLGSSLTLRRDLETLNNLVQINATLGQSGKAGDIESKIVTLEKSVLERLQGLAAVTVDPEQIGVFDGKRDEMIAAFKAQQAESSLQSKSALIGKLLGSAQIFSQIIASQSGLSRDTQSDVRQLSELVTSVTPQVTQVLGEGRAMGAYSLGQGFLNSSASTRFDELLVQLEKLQAEYGLKLQDALGSSKAAQGALDSLASASKGSLKQASELFEEQVVMADTLDAPWQGFYDQVSGLMAQTYQLNEATLKFLGEELQQRLGQNRTQMVLLVVALAAVFLLIFYLYGAFYVSTRTTLKRLGAMMDRVAAGDMTVTFNAQSRDELGELGTVFNGTVAKIHDLIELVGKTVGEVERQAGQVEAVSAQSNQAVAGQRSQIEQVATAMNQMSATSQEVARSAAAAVSSAHSVNDETISGRGLVESQQGSIAQLASEIDQSVLVINQLASDSQAISRVLEVIKSIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRTLAKRTQQSTEEIEQMIVKLHGGVGAAVKAMGISHEMANGTVGQSEKVQQALENILGAVGMIVDQNQQIAAAVEQQTAVAHDIDQNIVEINRAGERAAEGAYQTENASRQLSAQVVQLKQLISAFRV
>CP027718.1|AZD77450.1|960811_961648_+|Membrane-protein
MSFLVLLLAVWIEKFSALRQRVQHDEPWLRQLFRQEASPRLAKRPWWVLALLVLLPAVVLGLLLLVLEPLAYGLLALPVHLLVVIYSLGRGDLLGELGPFRDAWRREDLQAAAHVAKRDLDICADSGEQLLERVQGHLLWQAYQSFFAVIFWYFLLGPVAALSYRLLALAAEHSKNPAVAERAGQLRHAFDWLPVRLLAASFALVGNFVAVSRVMLHELLNWNISAAQLVEKVGLVAAEIPAPLTGPDGIVSLDRIWELLLRAAVLWYAAFALWTVLP
>CP027718.1|AZD77449.1|960254_960815_+|1,6-anhydro-N-acetylmuramyl-L-alanine-amidase
MQLDPASGWCHGVRHCPSPNFNARPADEISLLVIHNISLPPAQFATGKVQEFFQNRLDVTEHPYFAGIADLRVSAHFLIERDGTVTQFVSCLDRAWHAGVSWFDGRESCNDFSLGIELEGTDELPFTDAQYDALIALTRQLRQAFKAITPQRICGHSDIAPGRKTDPGPGFDWVRYRVALNEGEGQ
>CP027718.1|AZD77459.1|973643_975185_+|Phosphodiesterase/alkaline-phosphatase-D
MSDFTLGRRRLIQVAGAGLLLPGLAPAVIASGKDRPKMVDGVQSGDLLGDRAMVWSRTDRPARMVVEWDTRSLFSNPRKFVSPLADARTDFTARLELGGLPTDQAIFYRVYFEDAQTGVRSKPWFGHLRSVPQTRRDIRFVWSGDTVGQGFGINPDIGGMRIYEAMRRRLPDFFIHSGDTIYADGPVPAQLTTESGRVWRNITTEAKSKVAETLDEYRGNYRYNLLDENVRRFNAEVPQIWQWDDHEVVNNWSPSKVLDERYTTKDIHTLVGRARQAWLEYAPMRLQSADQGGRIYRKLSYGPLLDVFVLDMRSYRGGNDDNLGAAKPFLGREQLDWLKQGLKHSKAQWKVVAADMPIGLGVPDGEVSPGVPRWEAIANGDPGPAQGRELEIAELLAFLRKHKVRNHVWLTADVHYCAAHHYHPDRAAFQDFEPFWEFVAGPLNAGSFGPNALDKTFGPEVVFQKAPPAQNTSPFAGFQFFGEVQIEGQSGELSVILRDLDGVAVFERKLQPV
>CP027718.1|AZD77460.1|975305_977834_-|putative-iron-regulated-membrane-protein
MLKKTLFQLHWFFGISAGLVLALMGITGATVSFQDEILRALNPSTLQVEKQPAGVLPPAELVEKIQAASGKTVSMLTVEADSGNAARVWFTPPPGQRRGEMRYFDPYTGEFMGTALGQEFFGLMLQLHRFLAMGDSGRQITGACTLILIFFCLSGLYLRWPRQVASWRAWLTLDWAKKGRGFNWDLHAVAGTWCLLFYLLAALTGLSWSYEWYNKGLNKLLADSPQGQRMKGGRGAPPQGPAPTADYNAMWLGIYSTAGKDLSSYNIRMPAVAGQPATVFYLLKNSPHDRALNQITIDPNSGVVSRHDRYSDKSLKAQLLTSIYALHVGSYFGIVGRILVTLASLTMPLFFITGWLLYLDRRRKKRQIKDARQGLSADTGDASAWLIGFASQSGFAEQLAWQTAGQLQAAGVPARVQPLASVSEQDLLNTQNALFVVSTFGDGEAPDSARGFERKVLSRALSLDNLKYAVLGLGDRQYPHFCGFAKRLHGWLAEHGGNTLFAPVEVDSGDSYALRHWQQQLGQLIGQAPVDLWQAPAYDNWTLNQRVLLNPDSSGSGVYLLGLTPPQPSSWLAGDLVEVLPRNCAWAIEFFLDGLGLDGSATVQLDGLTETLTQALASRQLPENRAHLVGLHAQALVDALVPLAMREYSIASLASDGQLELLVRQERHPDGSLGIGSGWLTEHAPVGSSISLRVRRNSGFHLPAEPCPLILLGNGTGLAGLRSLLKARIAGGQQDNWLIFGERNAEHDFYCKDELQEWLTAGDLRRLDLAFSRDQADKIYVQDRLRQQAERLKQWLADGASIYICGSLQGMASGVDQVLNEVLGAEVVERLIEQGRYRRDVY
>CP027718.1|AZD77461.1|978111_980385_-|Ferrichrome-iron-receptor
MSRQQPPLPLGSPRLLASAIGVAITAGSAAHMAFAAENTEKKAAGNAISLDATSITGEAQDQTSYQVEKASSQKYTAPLVNTPRSVTVVPQQVLKDTAATSLQDALRTVPGITFGAGEGGNPQGDRPFIRGFDAQGDTYLDGVRDTGGQSREIFDIESIEVSKGPNSSFGGRGSAGGSLNLVSKTPKQQDFLNGGFTYGSDQTRRYVLDVNRQFLDSAAFRLNLMSHEQNVAGRDAVNYDRWGVAPSLTFGLGTPTRVNFSYYHMESDDLPDSGIPYGYSSASATAHKHDKPTDGGNSDNFYGLKDRDFRKTRADISTVSIEHDLNDNMTLKNTLRHGNTGQDYILTQPDDSKFNVNKYGTVWRRANSRVSTTETTTNQTDLFGEFQALGFKHNYSTGLEFTGEETRVSSYNIAGNTAKVCNPGSIPSCTSLSNPNPDDAWTGAISRNYYGTNTKATSRAAYVFDTIELDPQWLLNVGLRYDTFDTVANTDTATGRTKIKDDSQFWNWQAGLVWKPTDNGSVYASYATSATPPGGLVGEGADGNPLSAGASVSDLQPEETVNYELGTKWDVFNDRLSLTAAVFRTEKKNTRILVDALTYQNAGESRVDGLELSASGKITDKWQVFAGYSYLKSELVDAGLNGRNGVVSAGSNKGNEMPNTPKNSFSLWTTYEVLPKLTVGGGAFYVDEVYGDAGNTVYVPSYTRYDAMASYKLSKNVDLQLNVQNLTDKTYYDKAYSAHFANQAAGRTALFTTNFHF
>CP027718.1|AZD77462.1|980590_981271_+|PKHD-type-hydroxylase-YbiX
MLLHIPGLFSREEVLRIREALEQADWADGKITAGYQSAKAKHNLQLPEGHPLAQEIGAAMLERLWQHPRFMSAALPHKVFPPLLNCYTAGGSFDFHIDNAVRQPKGSIERVRTDLSSTLFFSDPEDYDGGELEIQDTFGTQRVKLPAGDMVLYPGTSLHKVNAVTRGTRYASFFWTQSLVREDSQRALLFEMDEAIQQLTRDMPDHPSLIRLTGTYHNLLRRWVEV
>CP027718.1|AZD77463.1|981274_982057_+|Tetratricopeptide-repeat-family-protein
MSFQLRREEVLDGEQLRAMLEQSPARAAQAILLAAGEGVLDAQALLGQILLDGLGIERDQALALRWFTIAAKGGHPMARNMLGRCCEHGWGCEADARAAAGHYRQAAEAGLDWALYNYANLLATGRGVAENQALALNCYQRAAAMGHAKSMNLLGRYLEEGRHCPRDVAAACDWYRRSAEGGDFRGQFSHAAVLADAGRIDEALGWLGKALEGGNLNFLRVARGALLQAAHPQIRGLALAYHQRAAELGDETDREALAQR
>CP027718.1|AZD77464.1|982163_983327_-|Ornithine-decarboxylase,-eukaryotic
MSIQVEDYFARETFQKMKAFADKQETPFVVIDTQMIAQAYDDLRAGFEFAKVYYAVKANPAVEIIDLLREKGSNFDIASIYELDKVLSRGVSPDQISYGNTIKKSKDIRYFYEKGVRLYATDSEADLRNIAKAAPGSKVYVRILTEGSTTADWPLSRKFGCQTDMAMDLLILARDLGLVPYGVSFHVGSQQRDISVWDAAIAKVKVIFERLKEEDGIHLKLINMGGGFPANYITRTNSLETYAEEIIRFLKEDFGDELPEIILEPGRSLIANAGILVSEVVLVARKSRTAVERWVYTDVGKFSGLIETMDEAIKFPIWTEKKGEMEEVVIAGPTCDSADIMYENYKYGLPLNLAIGDRLYWLSTGAYTTSYSAVEFNGFPPLKSFYV
>CP027718.1|AZD77465.1|983912_985070_-|Glycine-betaine/L-proline-transport-ATP-binding-protein-ProV
MIELQNLTKTFQSNGKTITAVDSVSLTVNEGEICVFLGPSGCGKSTTLKMINRLIMPTSGKVLINGEDTTGLDEVTLRRNIGYVIQQIGLFPNMTIEENIVVVPRLLGWDKQKCHERARELMSMIKLEPKQYLHRYPRELSGGQQQRIGVIRALAADAPLLLMDEPFGAVDPINREMIQNEFFEMQRALNKTVIMVSHDIDEAIKLGDKIAIFRAGKLLQIDHPDTLLAHPADDFVSNFVGQDSTLKRLLLVKAEDAADNAPSVSPQTPVADALELMDEHDRRYLVVTCAENKALGYVRRRDLHRQTGTCAQYLREFNATAAYDEHLRILLSRMYEFNRSWLPVLDAERVFLGEVTQESIAAYLSSGRSRGMKTNIVSPAETALA
>CP027718.1|AZD77466.1|985066_985720_-|L-proline-glycine-betaine-ABC-transport-system-permease-protein-ProW
MELLNAFSHLDWQQVIQLTWQHITLVGIAVTLAILFGVPLGILMTRFPTLAGPLQASATVLLTIPSIALFGLLLPFYSKFGQGLGPLPAITAVFLYSLLPIMRNTYLALTGVEPGIREAARGIGMTFGQRLRMVELPIAVPVILAGVRTAVVMNIGVMTIAATIGAGGLGVLILASISRSDMSMLIVGAVLVSLLAIFADLLLQWLQRSLTPKGLLK
>CP027718.1|AZD77467.1|985734_986628_-|Glycine-betaine-binding-protein
MKKIALIIGCVLLCAGIAQAAQKPVIRIGARVFTEQTLLAEITSQYLRSKGYDTRVTGGLGSNLARSAHESGQLDMLWEYTGVSLVAYNHVTEKLDSQQSYERVKELDGKKGLVWLTPSKFSNTYALALPKNVADAYPQINSVSDLKHVLDAERQDHHLIALDTEFANRSDGLQGMVKLYGMDLTRKNIRQMDAGLVYTALRNGQVFAGLVYTTDGRLNAFNLKLLDDDLHYFPDYTAAPVVRQAYLDAHPQLAADLKPLAELFDDQTMRQLNARVDVDHESPSAVAADFLRQHPLN
>CP027718.1|AZD77468.1|986648_987365_-|Glycine-betaine/carnitine/choline-ABC-transporter,-permease-protein
MAIRYGKGLIGGAAVIALLALLVHWIGISTIKHYRDDLLFYLQAHLYLVLASMFAALVVGIPAGIFLSRPQMVGRAERFMQLFNIGNTVPPLAVLAIALGILGIGSGPAIFALFLASLLPIVRNTYEGLKNVQGSLKEAAVGIGMTPRQVLWKVELPNAVPIIIGGVRVALAINVGTAPLAFLIGANSLGSLIFPGIALNNQPQLLLGAACTALLALLLDGLVTLASRLWLERGLRPS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP027718_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027718_3

1666595-1666675

Unclear

Consensus_repeat	Method
TGTAGCCGCTGGCGAAGGCTGCGAT	CRISPRCasFinder

1 spacers

cas3

The CRISPR arrays of CP027718_3

>merge|CP027718|3|1666595-1666675|CRISPRCasFinder
TGTAGCCGCTGGCGAAGGCTGCGATGGGCGGGTAGTGATTGAAGTAGCCGCCCCCTTGTAGCCGCTGCCGAAGGCTGCGAT

>CP027718|3|3|1666595-1666675|CRISPRCasFinder
TGTAGCCGCTGGCGAAGGCTGCGAT	GGGCGGGTAGTGATTGAAGTAGCCGCCCCCT
TGTAGCCGCTGCCGAAGGCTGCGAT

Protein	Signature genes	Signature genes Name	Protein_function
CP027718.1\|AZD78114.1\|1671127_1671442_+\|3-phosphoglycerate-kinase	unknown	unknown	unknown
CP027718.1\|AZD78101.1\|1657317_1659027_-\|Lysine-2-monooxygenase	unknown	unknown	gnl\|CDD\|366721
CP027718.1\|AZD78117.1\|1673714_1675013_-\|Small-conductance-mechanosensitive-channel	unknown	unknown	gnl\|CDD\|223740
CP027718.1\|AZD78115.1\|1671591_1672191_+\|FMN-dependent-NADH-azoreductase	unknown	unknown	gnl\|CDD\|224103
CP027718.1\|AZD78103.1\|1659508_1660810_-\|3-phenylpropionate-dioxygenase-alpha-subunit	unknown	unknown	gnl\|CDD\|239612
CP027718.1\|AZD78100.1\|1655937_1657281_-\|Indoleacetamide-hydrolase	unknown	unknown	gnl\|CDD\|236030
CP027718.1\|AZD78105.1\|1661785_1662187_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226867
CP027718.1\|AZD78110.1\|1666768_1668601_-\|Efflux-ABC-transporter,-permease/ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
CP027718.1\|AZD78102.1\|1659045_1659516_-\|3-phenylpropionate-dioxygenase-beta-subunit	unknown	unknown	gnl\|CDD\|238357
CP027718.1\|AZD78116.1\|1672786_1673647_+\|MadN-protein	unknown	unknown	gnl\|CDD\|273359
CP027718.1\|AZD78109.1\|1665727_1666426_-\|Aquaporin-Z	unknown	unknown	gnl\|CDD\|235453
CP027718.1\|AZD78111.1\|1668740_1669304_-\|Peptidyl-prolyl-cis-trans-isomerase-PpiA-precursor	unknown	unknown	gnl\|CDD\|182824
CP027718.1\|AZD78113.1\|1670154_1671078_-\|Transcriptional-regulator,-LysR-family	unknown	unknown	gnl\|CDD\|223656
CP027718.1\|AZD78118.1\|1675205_1676543_+\|ATP-dependent-RNA-helicase-SrmB	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|236877
CP027718.1\|AZD78108.1\|1664587_1665712_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377314
CP027718.1\|AZD78119.1\|1676599_1676875_-\|hypothetical-protein	unknown	unknown	unknown
CP027718.1\|AZD78104.1\|1660823_1661771_-\|Flavodoxin-reductase-(ferredoxin-NADPH-reductase)-family-1	unknown	unknown	gnl\|CDD\|99782
CP027718.1\|AZD78112.1\|1669307_1670111_-\|Beta-ketoadipate-enol-lactone-hydrolase,-putative	unknown	unknown	gnl\|CDD\|131480
CP027718.1\|AZD78107.1\|1663654_1664542_+\|Transcriptional-regulator,-LysR-family	unknown	unknown	gnl\|CDD\|176114
CP027718.1\|AZD78106.1\|1662167_1663535_-\|Efflux-pump-transporter-of-major-facilitator-superfamily-(MFS)	unknown	unknown	gnl\|CDD\|129794

Protein	Function_ID	Function_description	E-value
CP027718.1\|AZD78101.1\|1657317_1659027_-\|Lysine-2-monooxygenase	gnl\|CDD\|366721	pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase. This family consists of various amine oxidases, including maze polyamine oxidase (PAO) and various flavin containing monoamine oxidases (MAO). The aligned region includes the flavin binding site of these enzymes. The family also contains phytoene dehydrogenases and related enzymes. In vertebrates MAO plays an important role regulating the intracellular levels of amines via there oxidation; these include various neurotransmitters, neurotoxins and trace amines. In lower eukaryotes such as aspergillus and in bacteria the main role of amine oxidases is to provide a source of ammonium. PAOs in plants, bacteria and protozoa oxidase spermidine and spermine to an aminobutyral, diaminopropane and hydrogen peroxide and are involved in the catabolism of polyamines. Other members of this family include tryptophan 2-monooxygenase, putrescine oxidase, corticosteroid binding proteins and antibacterial glycoproteins.	6.92378e-68
CP027718.1\|AZD78117.1\|1673714_1675013_-\|Small-conductance-mechanosensitive-channel	gnl\|CDD\|223740	COG0668, MscS, Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane].	5.42701e-30
CP027718.1\|AZD78115.1\|1671591_1672191_+\|FMN-dependent-NADH-azoreductase	gnl\|CDD\|224103	COG1182, AcpD, Acyl carrier protein phosphodiesterase [Lipid metabolism].	7.15676e-96
CP027718.1\|AZD78103.1\|1659508_1660810_-\|3-phenylpropionate-dioxygenase-alpha-subunit	gnl\|CDD\|239612	cd03538, Rieske_RO_Alpha_AntDO, Rieske non-heme iron oxygenase (RO) family, Anthranilate 1,2-dioxygenase (AntDO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth. The oxygenase alpha subunit contains an N-terminal Rieske domain with an [2Fe-2S] cluster and a C-terminal catalytic domain with a mononuclear Fe(II) binding site. The Rieske [2Fe-2S] cluster accepts electrons from a reductase or ferredoxin component and transfers them to the mononuclear iron for catalysis. AntDO converts anthranilate to catechol, a naturally occurring compound formed through tryptophan degradation and an important intermediate in the metabolism of many N-heterocyclic compounds such as indole, o-nitrobenzoate, carbazole, and quinaldine.	4.83975e-67
CP027718.1\|AZD78100.1\|1655937_1657281_-\|Indoleacetamide-hydrolase	gnl\|CDD\|236030	PRK07488, PRK07488, indoleacetamide hydrolase.	1.47236e-142
CP027718.1\|AZD78105.1\|1661785_1662187_-\|hypothetical-protein	gnl\|CDD\|226867	COG4460, COG4460, Uncharacterized protein conserved in bacteria [Function unknown].	2.67816e-13
CP027718.1\|AZD78110.1\|1666768_1668601_-\|Efflux-ABC-transporter,-permease/ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	6.5594e-150
CP027718.1\|AZD78102.1\|1659045_1659516_-\|3-phenylpropionate-dioxygenase-beta-subunit	gnl\|CDD\|238357	cd00667, ring_hydroxylating_dioxygenases_beta, Ring hydroxylating dioxygenase beta subunit. This subunit has a similar structure to NTF-2, Ketosteroid isomerase and scytalone dehydratase.The degradation of aromatic compounds by aerobic bacteria frequently begins with the dihydroxylation of the substrate by nonheme iron-containing dioxygenases. These enzymes consist of two or three soluble proteins that interact to form an electron-transport chain that transfers electrons from reduced nucleotides (NADH) via flavin and [2Fe-2S] redox centers to a terminal dioxygenase. Aromatic-ring-hydroxylating dioxygenases oxidize aromatic hydrocarbons and related compounds to cis-arene diols. These enzymes utilize a mononuclear non-heme iron center to catalyze the addition of dioxygen to their respective substrates. The active site of these enzymes however is in the alpha sub-unit. No functional role has been attributed to the beta sub-unit except for a structural role.	1.53453e-22
CP027718.1\|AZD78116.1\|1672786_1673647_+\|MadN-protein	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	1.72582e-52
CP027718.1\|AZD78109.1\|1665727_1666426_-\|Aquaporin-Z	gnl\|CDD\|235453	PRK05420, PRK05420, aquaporin Z; Provisional.	1.40668e-138
CP027718.1\|AZD78111.1\|1668740_1669304_-\|Peptidyl-prolyl-cis-trans-isomerase-PpiA-precursor	gnl\|CDD\|182824	PRK10903, PRK10903, peptidylprolyl isomerase A.	4.6289e-84
CP027718.1\|AZD78113.1\|1670154_1671078_-\|Transcriptional-regulator,-LysR-family	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	1.40071e-38
CP027718.1\|AZD78118.1\|1675205_1676543_+\|ATP-dependent-RNA-helicase-SrmB	gnl\|CDD\|236877	PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional.	7.30566e-137
CP027718.1\|AZD78108.1\|1664587_1665712_+\|hypothetical-protein	gnl\|CDD\|377314	pfam04339, FemAB_like, Peptidogalycan biosysnthesis/recognition. FemAB_like is a family of both baterial and Viridiplantae proteins with responsibility for building interpeptide bridges in peptidoglycan. Such a function is feasible for bacteria but less likely for the plant members of this family. Perhaps the plant-members are using homologous proteins to recognize bacterial peptidoglcans as part of their innate immune system.	0
CP027718.1\|AZD78104.1\|1660823_1661771_-\|Flavodoxin-reductase-(ferredoxin-NADPH-reductase)-family-1	gnl\|CDD\|99782	cd06185, PDR_like, Phthalate dioxygenase reductase (PDR) is an FMN-dependent reductase that mediates electron transfer from NADH to FMN to an iron sulfur cluster. PDR has an an N-terminal ferrredoxin reductase (FNR)-like NAD(H) binding domain and a C-terminal iron-sulfur [2Fe-2S] cluster domain. Although structurally homologous to FNR, PDR binds FMN rather than FAD in it's FNR-like domain. Electron transfer between pyrimidines and iron-sulfur clusters (Rieske center [2Fe-2S]) or heme groups is mediated by flavins in respiration, photosynthesis, and oxygenase systems. Type I dioxygenase systems, including the hydroxylate phthalate system, have 2 components, a monomeric reductase consisting of a flavin and a 2Fe-2S center and a multimeric oxygenase. In contrast to other Rieske dioxygenases the ferredoxin like domain is C-, not N-terminal.	1.28564e-43
CP027718.1\|AZD78112.1\|1669307_1670111_-\|Beta-ketoadipate-enol-lactone-hydrolase,-putative	gnl\|CDD\|131480	TIGR02427, b-ketoadipate_enol-lactone_hydrolase, 3-oxoadipate enol-lactonase. Members of this family are 3-oxoadipate enol-lactonase. Note that the substrate is known as 3-oxoadipate enol-lactone, 2-oxo-2,3-dihydrofuran-5-acetate, 4,5-Dihydro-5-oxofuran-2-acetate, and 5-oxo-4,5-dihydrofuran-2-acetate. The enzyme the catalyzes the fourth step in the protocatechuate degradation to beta-ketoadipate and then to succinyl-CoA and acetyl-CoA. 4-hydroxybenzoate, 3-hydroxybenzoate, and vanillate all can be converted in one step to protocatechuate. This enzyme also acts in catechol degradation. In genomes that catabolize both catechol and protocatechuate, two forms of this enzyme may be found. All members of the seed alignment for this model were chosen from within protocatechuate degradation operons of at least three genes of the pathway, from genomes with the complete pathway through beta-ketoadipate. [Energy metabolism, Other].	1.47065e-47
CP027718.1\|AZD78107.1\|1663654_1664542_+\|Transcriptional-regulator,-LysR-family	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	5.87672e-68
CP027718.1\|AZD78106.1\|1662167_1663535_-\|Efflux-pump-transporter-of-major-facilitator-superfamily-(MFS)	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.49837e-53

>CP027718.1|AZD78109.1|1665727_1666426_-|Aquaporin-Z
MSLFKRSVTELLGTFWLVLGGCGSAVLAAAFPEVGIGLLGVALAFGLTVLTMAFAIGHISGCHLNPAVSVGLVVGGRFPLKELPAYVIAQVLGGVIAAALLYFIASGKPGFELASGLASNGYGEHSPGGYSLAAGFVSELVMTGMFVVIILGATDKRAPVGFAPIAIGLALTLIHLISIPVTNTSVNPARSTGPALIVGGWAIQQLWLFWLAPILGAVVGGGIYRWLGKEDS
>CP027718.1|AZD78108.1|1664587_1665712_+|hypothetical-protein
MPLQSLTSLAAVDPQQWDGLLSDGQPFLRHAFLSTLEDSGSLGPRSGWQAEHLLHVQDGRLIAALPSYRKWHSYGEYVFDHGWADACARAGIEYYPKLLSAVPFSPVSGARLLAASLEDGLELLQSLPGYLEIEGLSSAHINFTDAFTDAALAGQDGWLQRLGCQFHWQNRGYRDFQDFLDSLSSRKRKQMRKEREQVAGQGIEFEWLEGRQLSEAQWDFVYACYANTYAVRRQSPYLTRAFFSLLAERMPEAIRVVLAKQNARPVAMAFSLIGGDSFYGRYWGCLAEFDRLHFETCFYQGMDYAIAQGMQRFDAGAQGEHKLIRGFEPVITRSWHYLRHPGLKAAVEDFLRQERAGVLAYAEEARAALPYRQA
>CP027718.1|AZD78107.1|1663654_1664542_+|Transcriptional-regulator,-LysR-family
MHTHLNRVQTFLAVVDFGSYTKAANYLCISKAMASLHVKALEEVLSATLLIRNTRNISLTEIGQDFYNEFKGIVADIDNAFENVLHGHNRISGKLRFSSTSEYGERYILPIISKFTERYPEIRLCYNFNSSLNDLVAEKLDLVIRLGNLADSAFKSRKLADYDIVLVASPDFLARHPVVEPLDLNSVPWIANSNLQGPTNWTLSHPQLGQVEVSGPNHFESNSSTAIRAMTLSSLGVSVLPGWVVEDDLASGRLVRLLPDYALPSQSVNVVFPNSSHLPHKSRAFIDFLLLHLGQ
>CP027718.1|AZD78106.1|1662167_1663535_-|Efflux-pump-transporter-of-major-facilitator-superfamily-(MFS)
MTYRYKVALIFLIGFFIDCINIFMSAVALPSIAHDMHVSTSSVAWVANAYILGLTLIIPVSTWLAGRFGSRETLTASMLVFSTAVWMCGMAGSFPELVIWRFVQGIGGGLLIPVGQALTFNLFQGPQRAKISTLVMAVALIAPAISPTIGGVIVDSSSWRWVFHSNIPFSLIAAALSWLWIKEARPASLARPDIKGLLLVSAALGSLLMGMSLYGGDYPPLAALGCLMLGVTCVVLYVLHYRRCDNAIVELSLLKSKKLSTSIFIYYAIPGVFTGVNLLSIFFLQNSLHFSAKLTGMFMILYASGAFIAMLVCGRVYNRFGARRLFTLGMLLHSAGIATLYLVDSAADLPIIVIAYCLMGIGGGIGANTAQTTSLMDFQGADTHKGSVIWNINRQMSFSIGAALFLMIYNLLLASLASTPAYHLTFVIAAVMGLLPLLQMSNLTTQKECHAQHNR
>CP027718.1|AZD78105.1|1661785_1662187_-|hypothetical-protein
MHNTIVEQAKHSIHAVHELIHAVFTDQDGNGAAAIDRLLPAFAEHFSMVTTAGAIVSREQVEQMFRGAVGARPGLEILVSDMHTVWHEGHSAAIRYKETHRLEQKETSRLSVVVIRIHEHSAQWLYLHETPLS
>CP027718.1|AZD78104.1|1660823_1661771_-|Flavodoxin-reductase-(ferredoxin-NADPH-reductase)-family-1
MNYQITQCLMLSPSIKEITLAPLVPAPCEATAGAHFKWWIPTLEQWRHYSRVELAEHELPQGSLVFAIRLNPDSPSSAYIRQLSVGDQVRFDGPFNAFDYQLDDSDGADIALAGGIGITPLTGILGHLRAQQRPARLHYFAKSADDAAYAAQMRELLQDSLSLHCSDSAEGRPSVAAVLGQLQPRDRLYVCGPQAMLNDVFSHAQNLGFPRERIHFEIFNTTLAEDDPGFAVHAADSGIDLRVQPGQSLLDALEEAGLEPLYDCRRGECGVCELDVLEGEVDHRDFIMSPQQAACSNKIYPCVSRAKGPSLKLVI
>CP027718.1|AZD78103.1|1659508_1660810_-|3-phenylpropionate-dioxygenase-alpha-subunit
MDNYFNGKEVHRTLFLDPSLFEREQQQVFAASWCYLGHESLVPETGDFFTADIAGQPLAMVRQKNGEIVVLHNRCPHKGVKVLAEPQGNVGRFIRCPYHAWTFKTDGQLLSIPVKKEYDDCDLSNCAAHKGMQPVAAVENYRGFVFVRLKEQGVGFSEFFGDSLSTLDNMVMRSPQGQLRAIGQPLLHRHRCNWKMVVDNQTDTCHPMVAHESSAGEAIRLWKETGHDGQPPMAVELFSPFMASYEFFSAMGIRTWPNGHGHTGVSNSIHKAYSSIPGYWELMAESYGETQAAAILDDTRHNTVYFPNLMVKGPIQTLRVIRPISACETVVESWIFELVGAPVQLLERTVQYNNLINSPCSMVAHDDVEMYERAMDGLRSQANDWVNVARLFEPGESHEQTQVVSGTSERAMRNFYNTWQQLMQAPDGSTAHG
>CP027718.1|AZD78102.1|1659045_1659516_-|3-phenylpropionate-dioxygenase-beta-subunit
MDNSPLEQLIYQEIALLDQQDFAAWQQLLCDDFHYWIPLRHDQPCPLRESSLLYEDRFLTTLRINRLASARNFSQQPKSRSLHIAQRPAISLDPDGLSARCLTPMLYCEARGDSEWHYPVTVEHQLLCLAGQWKIQRKKVLLLNPSRAFESLQLII
>CP027718.1|AZD78101.1|1657317_1659027_-|Lysine-2-monooxygenase
MNSSHSGFEETQGTRSFPNIDLLYDYGQFLRRATQAIGHLPPAIADKHIGIVGAGLSGVIAAYELLRAGATRITLFEASKDHLGGRFLTQCFDETQPQFIAEMGAMRFPPSEVGLFHYLDRFGIGTTEAFPDPGVVDTEIHYRGETHHWPAGENPPPIFNTVHQGWNAFLKEGVRLDDGTFLAPPLLLTELLEKQQYAEVQPEWQRYLDCFGDHSFYSAMVQIFTSKNPPGGKRWRKPEDFHLFGSLGIGSGGFQSVYRASFTEILRLVINAFEVNQRLVPNGISTLWERIADEEFHGIALRDRICRTRIESISKGADGQILLQGCNGETYGCDRVITTATTRALQVNMRLTQAEQFVNRDVARAINETHMVGSSKLFILTRDKFWLKHGLAQNIQTDTLVKGVYCLDYAPQDPDSWGVVLISYTWEDDSHKMVSMTDKVQRCKRLVDELAMSSPEFARHLVPLDGDYQRYVLEYDWLTDKQALGAFKLNFPGDDLYSQRLFYQFKTALDPQQDTGLYLAGCGSSFTGGWAEGAVQTALNGACAVIASLGGELLEGNPLFDLQSHFRYC
>CP027718.1|AZD78100.1|1655937_1657281_-|Indoleacetamide-hydrolase
MYSQLSIEALVDGFRQGKLCLDSWHRALLEQYADAGHLNSFISFAPQAFSGDTGTPEQRQAPLYGIPVSFKDNINASGLPTTAGTPGLADYHPATDAGIVQRFKALGARVAGKNNMHELSFGVTSANLSYGAVVNPRHLQHSAGGSSGGCAAAVAAGLVPCAVGTDTGGSVRIPAAFCGVVGFRPSTGAYPGDGIVPVSQTKDSPGLLTRSLEDALFVHRQLTGASCAAPTEAKRLRIGIPQQFFWSELETKVHSDCRAAIDCLADQGVEMVPVDDRLIGEINESIQFPLPIFEFFIDFPRFLLKAGQGERFLDILAQIRDPQIKKTLMAQLESPAISYEDYVQALMSKIRLDREYAGLFQQHRLDLIAYPTVCCTAPLLSDSGAQEHFERFVRNTDPASNLAAPSVSVPVAAAGSLPVGLSFDALPGQDDRLLHMTQQLSRLLALR
>CP027718.1|AZD78110.1|1666768_1668601_-|Efflux-ABC-transporter,-permease/ATP-binding-protein
MLYRRFEQLIDIFRDAPTAAPPNRVLPFYLYYIKQVWPSFVALLVVGLFVALIEVSLFSYLSTIIDLAQGTPNVEIFKTHGLELAWMAVVALIFRPLFVALHDLLVHQTISPGMTSLIRWQNHSYVLKQSLNFFQNDFAGRIAQRIMQTGNSLRDSAVQAVDALWHVLIYAVSALVLFAEADWHLMIPLLIWIASYIGALWYFVPRVKERSVISSDANSKLVGRIVDGYTNITTLKLFAHTHFEQNYAREAIGEQTEKSQLAGRVITSMDVVITAMNGLLIVSTTGLALWLWTQSLISVGAIALATGLVIRIVNMSGWIMWVVNGIFENIGMVQDGLQTIAQPISVSDREQAPRLAVASGEVRFEHVDFHYGKKTGVISDLNLTIRPGEKIGLIGPSGAGKSTLVNLLLRLYDLESGRILIDNQNIADVTQESLRERIGMITQDTSLLHRSIRDNLLYGKPDATDEELWEAVRKARADEFIPLLSDAQGRTGFDAHVGERGVKLSGGQRQRIAIARVLLKDAPILIMDEATSALDSEVEAAIQESLETLMQGKTVIAIAHRLSTIARMDRLVVLEKGRIAETGSHAELLAHGGLYARLWQHQTGGFVGID
>CP027718.1|AZD78111.1|1668740_1669304_-|Peptidyl-prolyl-cis-trans-isomerase-PpiA-precursor
MLKKIALVAGSVLFAANLMAAQPAKAPHVLLDTSFGKIEVELDPVKAPISSKNFLDYVDSGFYTNTIFHRVIPGFMVQGGGFTPQMVQKETRDPIKNEASNGLHNVRGTLSMARTSNPNSATSQFFINVADNAFLDPGRDAGYAVFAKVVSGMDVVDQIVNSQTTTKQGMQNVPIDPVLIKSAKRID
>CP027718.1|AZD78112.1|1669307_1670111_-|Beta-ketoadipate-enol-lactone-hydrolase,-putative
MAYFEHEGCTLHYEEYGHGEPLVLVHGLGSSTRDWEKQIAELSAHYRLILPDVRGHGRSDKPRGPYSIAGFSADLVALLEHLNLSRVHLVGLSMGGMIAFQLAVDQPGLLKSLCIVNSAPEVKIRSANDAWQWFKRWSLMRLLSLEAIGTALAGKLFPKPEQAELRQKMAERWAKNDKRAYLASFDAIVGWGVQERLSQVACPTLVISADRDYTPVALKESYVKLLPDGRLVVIADSRHATPLDQPQRFNQTLLEFLTAVDTTTQDH
>CP027718.1|AZD78113.1|1670154_1671078_-|Transcriptional-regulator,-LysR-family
MKAPRVTLDQWRTLQAVVDHGGFAQAAEALHRSQSSVSYTVARMQDQLGVPLLRIDGRKAVLTEAGGVLLRRSRQLVKQASQLEDLAHHMEQGWEAEVRLVVDAAYPNARLVRALTAFMPQSRGCRVRLREEVLSGVEEVLLEGVADLAISGFNISGYLGTEMSSVEFVAVAHPEHALHRLNRELSFQDLESQLQVVIRDSGRQQPRDVGWLGAEQRWTVGSLATAATFVGSGLGFAWLPRHMIERELREGLLKVLPLDQGGSRHPTFYLYSNKDKPLGPATQILVELLRTFDTAPLDAPFAAPEQA
>CP027718.1|AZD78114.1|1671127_1671442_+|3-phosphoglycerate-kinase
MRKFCCVLLALLPLSAFAYPIDVQKHLEGVSIDYTAYDTDADIGSIQVNNYGTTDAACTVVFRNGPEAPRTRKVEVAAGKFKNATAKFNRSIIKLRIDLTCTAK
>CP027718.1|AZD78115.1|1671591_1672191_+|FMN-dependent-NADH-azoreductase
MSRVLIIESSARQQDSVSRQLTQTFIKQWQAAHPGDQITVRDLAVTPVPHLDSNLLGGWMKPAEQRNEIEEASLQRSNELTDELLAADVLVMAAPMYNFAIPSTLKAWLDHVLRAGVTFKYTATGPQGLLNGKRAYVLTARGGIYAGSTADHQEPYLRQVMGFIGIHDVEFIHAEGMNLGGDFQEKGLNQANAKLAQVA
>CP027718.1|AZD78116.1|1672786_1673647_+|MadN-protein
MGYLLFVTLIQAFSFSLIGEYLAGHVDSYFAVLVRVLLAGLVFIPLTRWRQVEPAFMRGMLLIGALQFGVTYVCLYLSFRVLTVPEVLLFTILTPLHVTLIEDALNRRFNPWGLLAALVAVAGAAVIRYDRISPDFFMGFLLLQLANFTYAAGQVLYKHLVARHPSDLPHYRRFGYFYLGALLVVLPAFLLFGKQNFLPEAPLQWAVLLFLGLVSTALGLYWWNKGACLVTGATLAVMNNLHVPVGLLINLLIWNQHEALGRLFLGALVILAAVWISRRGTKATIL
>CP027718.1|AZD78117.1|1673714_1675013_-|Small-conductance-mechanosensitive-channel
MDFKQLWLNVQDLWGALDEHPLLHSSLALVILLVVALLVGRVARYLILHAVKLLGRQPSLHWLNDLRQNKVFHRLAQMTPSLVVQFGLHLVPELSKTSLVFLGNLALAFTILFQVLAISALLNALLDIYARTEHARTRSIKGYVQLAKMVLFVFGAIIIVATLIDRSPLLLLSGLGAMSAVILLVYKDTLLSFVASVQLTSNDMLRVGDWIEMPQVGADGDVVDITLHTVKVQNFDKTIVSIPTWRLMSESFKNWRGMQQSGGRRIKRSLYIDASGVRFINDEEEARLGKVHLLTDYISRKQAELKSWNEAQGNVAAMSANRRRMTNLGTFRAYALAYLKSHPDIQPNMTCMVRQMQTTAQGIPLEIYCFTRTTAWTDYERIQGDIFDYLLAVMPEFGLSLYQQPSGNDLRAGLLPAVLGASHIPEAEKRAL
>CP027718.1|AZD78118.1|1675205_1676543_+|ATP-dependent-RNA-helicase-SrmB
MFSQFALHERLLKAVAELKFVEPTPVQAAAIPLALQGRDLRVTAQTGSGKTAAFVLPILNRLIGPAKIRVSIKTLILLPTRELAQQTLKEVERFSQFTFIKAGLITGGEDFKIQAAMLRKVPDILIGTPGRLIEQLNAGNLDLKEVEVLVLDEADRMLDMGFADDVQRLVDECPNRQQTMLFSATTGGSGLREMVAKVLNNPEHLQLNAVSQLNDTTRQQIITADHNQHKEQIVNWLLANETYQKAIVFTNTRAMADRIYGRLVAQEYKAFVLHGEKDQKDRKLAIDRLKQGGVKILVATDVAARGLDVDGLDLVINFDMPRSGDEYVHRIGRTGRAGNDGLAISLICHGDWNLMSSIERYLKQHFERRTIKEVKGTYSGPKKVKASGKAAGVKKKKTDAKGDKKKAVAKAPTKRKTANRPKSDALVSQDGMAPLKRRKPAPAAE
>CP027718.1|AZD78119.1|1676599_1676875_-|hypothetical-protein
MKALLSLSIATALFCALPAWACTLDEATAKREQLAQEVAKLTEQNPAKAKEINDELQKMELSTASKDLPDKCQLIDQRLKELGAAEKRADS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP027718_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027718_6

4857383-4857460

Orphan

Consensus_repeat	Method
CAGCCTTCGGCAGCGGCTACAGG	CRISPRCasFinder

1 spacers

DEDDh

The CRISPR arrays of CP027718_6

>merge|CP027718|6|4857383-4857460|CRISPRCasFinder
CAGCCTTCGGCAGCGGCTACAGGGACAGCGAGCAGTTCCGCAACGGCGGTGTTTTCGGCCTTCGGCAGCGGCTACAGG

>CP027718|6|6|4857383-4857460|CRISPRCasFinder
CAGCCTTCGGCAGCGGCTACAGG	GACAGCGAGCAGTTCCGCAACGGCGGTGTTTT
CGGCCTTCGGCAGCGGCTACAGG

Protein	Signature genes	Signature genes Name	Protein_function
CP027718.1\|AZD80892.1\|4836777_4849794_-\|Pyoverdine-chromophore-precursor-synthetase-PvdL	unknown	unknown	gnl\|CDD\|235564
CP027718.1\|AZD80898.1\|4853009_4854800_+\|Terpene-utilization-protein-AtuA	unknown	unknown	gnl\|CDD\|377804
CP027718.1\|AZD80893.1\|4850169_4850718_+\|Sigma-factor-PvdS,-controling-pyoverdin-biosynthesis	unknown	unknown	gnl\|CDD\|180803
CP027718.1\|AZD80904.1\|4861535_4862078_+\|Inhibitor-of-the-KinA-pathway-to-sporulation,-predicted-exonuclease	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|227351
CP027718.1\|AZD80910.1\|4865881_4866775_+\|Sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|226951
CP027718.1\|AZD80906.1\|4862531_4863335_-\|Flavodoxin-reductase-(ferredoxin-NADPH-reductase)-family-1	unknown	unknown	gnl\|CDD\|225758
CP027718.1\|AZD80903.1\|4859504_4861466_+\|Geranyl-CoA-carboxylase-biotin-containing-subunit	unknown	unknown	gnl\|CDD\|227111
CP027718.1\|AZD80900.1\|4855685_4857302_+\|Geranyl-CoA-carboxylase-carboxyl-transferase-subunit	unknown	unknown	gnl\|CDD\|227136
CP027718.1\|AZD80894.1\|4850774_4851212_-\|hypothetical-protein	unknown	unknown	unknown
CP027718.1\|AZD80896.1\|4852175_4852799_-\|Acyclic-terpenes-utilization-regulator-AtuR,-TetR-family	unknown	unknown	gnl\|CDD\|380061
CP027718.1\|AZD80902.1\|4858664_4859501_+\|Isohexenylglutaconyl-CoA-hydratase	unknown	unknown	gnl\|CDD\|235664
CP027718.1\|AZD80895.1\|4851283_4852075_-\|Periplasmic-binding-protein	unknown	unknown	gnl\|CDD\|214497
CP027718.1\|AZD80891.1\|4835784_4836603_-\|Beta-ketoadipate-enol-lactone-hydrolase	unknown	unknown	gnl\|CDD\|131480
CP027718.1\|AZD80908.1\|4864910_4865378_+\|hypothetical-protein	unknown	unknown	unknown
CP027718.1\|AZD80909.1\|4865511_4865640_-\|hypothetical-protein	unknown	unknown	unknown
CP027718.1\|AZD80901.1\|4857510_4858668_+\|Citronellyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173847
CP027718.1\|AZD80897.1\|4852826_4852970_-\|hypothetical-protein	unknown	unknown	unknown
CP027718.1\|AZD80907.1\|4863434_4864370_-\|Chemotaxis-protein-CheV	unknown	unknown	gnl\|CDD\|223905
CP027718.1\|AZD80905.1\|4862160_4862445_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377724
CP027718.1\|AZD80899.1\|4854812_4855682_+\|Citronellol-dehydrogenase	unknown	unknown	gnl\|CDD\|187627

Protein	Function_ID	Function_description	E-value
CP027718.1\|AZD80892.1\|4836777_4849794_-\|Pyoverdine-chromophore-precursor-synthetase-PvdL	gnl\|CDD\|235564	PRK05691, PRK05691, peptide synthase; Validated.	0
CP027718.1\|AZD80898.1\|4853009_4854800_+\|Terpene-utilization-protein-AtuA	gnl\|CDD\|377804	pfam07287, AtuA, Acyclic terpene utilisation family protein AtuA. This family consists of several bacterial and plant proteins of around 400 residues in length. One member of this family has been characterized in Pseudomonas citronellolis as AtuA, a member of a gene cluster that is essential for the acyclic terpene utilisation (Atu) pathway.	4.56306e-176
CP027718.1\|AZD80893.1\|4850169_4850718_+\|Sigma-factor-PvdS,-controling-pyoverdin-biosynthesis	gnl\|CDD\|180803	PRK07037, PRK07037, extracytoplasmic-function sigma-70 factor; Validated.	7.5382e-107
CP027718.1\|AZD80904.1\|4861535_4862078_+\|Inhibitor-of-the-KinA-pathway-to-sporulation,-predicted-exonuclease	gnl\|CDD\|227351	COG5018, KapD, Inhibitor of the KinA pathway to sporulation, predicted exonuclease [General function prediction only].	5.36071e-75
CP027718.1\|AZD80906.1\|4862531_4863335_-\|Flavodoxin-reductase-(ferredoxin-NADPH-reductase)-family-1	gnl\|CDD\|225758	COG3217, COG3217, Uncharacterized Fe-S protein [General function prediction only].	5.55321e-84
CP027718.1\|AZD80903.1\|4859504_4861466_+\|Geranyl-CoA-carboxylase-biotin-containing-subunit	gnl\|CDD\|227111	COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism].	0
CP027718.1\|AZD80900.1\|4855685_4857302_+\|Geranyl-CoA-carboxylase-carboxyl-transferase-subunit	gnl\|CDD\|227136	COG4799, COG4799, Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism].	0
CP027718.1\|AZD80907.1\|4863434_4864370_-\|Chemotaxis-protein-CheV	gnl\|CDD\|223905	COG0835, CheW, Chemotaxis signal transduction protein [Cell motility and secretion / Signal transduction mechanisms].	7.93708e-50
CP027718.1\|AZD80896.1\|4852175_4852799_-\|Acyclic-terpenes-utilization-regulator-AtuR,-TetR-family	gnl\|CDD\|380061	pfam17932, TetR_C_24, Tetracyclin repressor-like, C-terminal domain. TetR family regulators are involved in the transcriptional control of multidrug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity. The TetR proteins identified in overm ultiple genera of bacteria and archaea share a common helix-turn-helix (HTH) structure in their DNA-binding domain. However, TetR proteins can work in different ways: they can bind a target operator directly to exert their effect (e.g. TetR binds Tet(A) gene to repress it in the absence of tetracycline), or they can be involved in complex regulatory cascades in which the TetR protein can either be modulated by another regulator or TetR can trigger the cellular response. TetR regulates the expression of the membrane-associated tetracycline resistance protein, TetA, which exports the tetracycline antibiotic out of the cell before it can attach to the ribosomes and inhibit protein synthesis. TetR blocks transcription from the genes encoding both TetA and TetR in the absence of antibiotic. The C-terminal domain is multi-helical and is interlocked in the homodimer with the helix-turn-helix (HTH) DNA-binding domain. This entry represents the C-terminal domain present in family members such as HTH-type transcriptional repressor KstR2 as well as fatty acid metabolism regulator proteins. In Mycobacterium smegmatis, KstR2 is involved in involved in cholesterol catabolism, while YsiA in Bacillus subtilis is involved in fatty acid degradation.	6.0138e-21
CP027718.1\|AZD80895.1\|4851283_4852075_-\|Periplasmic-binding-protein	gnl\|CDD\|214497	smart00062, PBPb, Bacterial periplasmic substrate-binding proteins. bacterial proteins, eukaryotic ones are in PBPe.	1.06061e-11
CP027718.1\|AZD80891.1\|4835784_4836603_-\|Beta-ketoadipate-enol-lactone-hydrolase	gnl\|CDD\|131480	TIGR02427, b-ketoadipate_enol-lactone_hydrolase, 3-oxoadipate enol-lactonase. Members of this family are 3-oxoadipate enol-lactonase. Note that the substrate is known as 3-oxoadipate enol-lactone, 2-oxo-2,3-dihydrofuran-5-acetate, 4,5-Dihydro-5-oxofuran-2-acetate, and 5-oxo-4,5-dihydrofuran-2-acetate. The enzyme the catalyzes the fourth step in the protocatechuate degradation to beta-ketoadipate and then to succinyl-CoA and acetyl-CoA. 4-hydroxybenzoate, 3-hydroxybenzoate, and vanillate all can be converted in one step to protocatechuate. This enzyme also acts in catechol degradation. In genomes that catabolize both catechol and protocatechuate, two forms of this enzyme may be found. All members of the seed alignment for this model were chosen from within protocatechuate degradation operons of at least three genes of the pathway, from genomes with the complete pathway through beta-ketoadipate. [Energy metabolism, Other].	1.99105e-44
CP027718.1\|AZD80901.1\|4857510_4858668_+\|Citronellyl-CoA-dehydrogenase	gnl\|CDD\|173847	cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases. Short chain acyl-CoA dehydrogenase (SCAD). SCAD is a mitochondrial beta-oxidation enzyme. It catalyzes the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of SCAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. This subgroup also contains the eukaryotic short/branched chain acyl-CoA dehydrogenase(SBCAD), the bacterial butyryl-CoA dehydorgenase(BCAD) and 2-methylbutyryl-CoA dehydrogenase, which is involved in isoleucine catabolism. These enzymes are homotetramers.	3.79949e-117
CP027718.1\|AZD80902.1\|4858664_4859501_+\|Isohexenylglutaconyl-CoA-hydratase	gnl\|CDD\|235664	PRK05995, PRK05995, enoyl-CoA hydratase; Provisional.	4.16812e-66
CP027718.1\|AZD80910.1\|4865881_4866775_+\|Sensor-histidine-kinase	gnl\|CDD\|226951	COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms].	2.31711e-46
CP027718.1\|AZD80905.1\|4862160_4862445_+\|hypothetical-protein	gnl\|CDD\|377724	pfam06865, DUF1255, Protein of unknown function (DUF1255). This family consists of several conserved hypothetical bacterial proteins of around 95 residues in length. The function of this family is unknown.	2.25415e-53
CP027718.1\|AZD80899.1\|4854812_4855682_+\|Citronellol-dehydrogenase	gnl\|CDD\|187627	cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reductase (TER) and 2,4-dienoyl-CoA reductase (DECR), atypical (a) SDR. TTER is a peroxisomal protein with a proposed role in fatty acid elongation. Fatty acid synthesis is known to occur in the both endoplasmic reticulum and mitochondria; peroxisomal TER has been proposed as an additional fatty acid elongation system, it reduces the double bond at C-2 as the last step of elongation. This system resembles the mitochondrial system in that acetyl-CoA is used as a carbon donor. TER may also function in phytol metabolism, reducting phytenoyl-CoA to phytanoyl-CoA in peroxisomes. DECR processes double bonds in fatty acids to increase their utility in fatty acid metabolism; it reduces 2,4-dienoyl-CoA to an enoyl-CoA. DECR is active in mitochondria and peroxisomes. This subgroup has the Gly-rich NAD-binding motif of the classical SDR family, but does not display strong identity to the canonical active site tetrad, and lacks the characteristic Tyr at the usual position. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs.	8.8371e-104

>CP027718.1|AZD80900.1|4855685_4857302_+|Geranyl-CoA-carboxylase-carboxyl-transferase-subunit
MPVIQSQLDPHSAQFQQNREAMLAGLAQIRQLEQNLLAKAAEAKAKFEKRGQLLPRERLNLLLDPGAPFLELASLAGYKLHDDKDGSQAGGGLIAGIGYVSGVRVLVVANNSAIKGGTISPSGLKKSLRLQQIAMENKLPVVTLAESGGANLNYAAEIFVEGARSFANQARMSAMGLPQITVVHGSATAGGAYQPGLSDYVVVVRGKAKLFLAGPPLLKAATGEVATDEELGGAEMHAQVAGTAEYLAENDGDGVRIVREILDALPWNARLPQQPTRAYAEPLYPIDELLGLIPDDPKKPYDAREIVARIADGSNFLEFKGEFDQQTLCGHLQIQGRPCGFIGNNGPITPKGASKAAQFIQLCDQSGTPLLFFHNTTGFMVGTESEQQGVIKHGSKLIQAVANARVPKLTIVVGGSYGAGNYAMCGRGLDPRFIFAWPNSRTAVMGGAQAGKVLRIVTEAKHAKQGQAADPQMLDMLEQVTAQKLDSQSTALYGSANLWDDGLIDPRDTRTLLGYLLDICHEAQVRRLQPNSFGVARF
>CP027718.1|AZD80899.1|4854812_4855682_+|Citronellol-dehydrogenase
MTYDSIFKPDLFAGQTIIVTGGGSGIGRCTAHELAALGARVLLVGRKADKLEKVAAEIAEDGGQASGHACDIRDEEAVKALVSELIRDHGPLHGLVNNAGGQYPSPLASINQKGFETVLRTNLVGGFLMAREVFNQSMSKHGGSIVNMLADMWGGMPGMGHSGAARSGMDNFTKTAAFEWGHAGVRVNAVAPGWIASSGMDTYEGAFKAVIPTLREHVPLKRIGTESEVSAAIVFLLSPAAAFISGSTLRIDGAASLGSRAWPLHKASHSQSYNGFHRAYLPDVLKDQE
>CP027718.1|AZD80898.1|4853009_4854800_+|Terpene-utilization-protein-AtuA
MTKTLRIGCASAFWGDTSSAAAQLVQGGRLDYLVFDYLAEITMSIMAGARMKDPTAGYATDFVEILSPLLGEIARQNIRVISNAGGVNPQACAAALQAACDQAGVALKIAVLLGDDLQPRFKQLSGSGIHEMFSGAPLPPMCVSTNAYLGAPGIVEALKLGADIVITGRGVDSAVVSAALVHEFGWSWHDYDKLAQAALAGHIIECGAQCTGGNFTDWRDVPDYEHIGFPIVEVSADGQFVVSKPEGSGGLVTPLTVGEQLLYEIGDPRAYLLPDVVCDFTQVKLRQQGKNAVSVHGAKGLPPTGQYKVSATYPDGFRCTASCLIAGIDAVAKARRVSQAIIDKTAEMFGQRGWAPYSEVNIELLGSEATYGPHGQRQDSREVVIKLAVRHPDKRALVLFSREIAQAATGMAPGLTGIVGGRPTVYPLIRLFSFLIDKSACTLEVEMAGQRHRVELPELDSLDSSALPAPHAVASPVGRADASVALVKLAVARSGDKGNHSNIGVMARAPEYLPWIAEALTPAVLVDWMSHVLDPIHGRVQRWYLPGSHSLNFLLENALGGGGVASLRIDPQGKAFAQQLLEIQIPVPQSIADAVN
>CP027718.1|AZD80897.1|4852826_4852970_-|hypothetical-protein
MTELHRDYQASAWFVNVGNIFFPSACLVVPTGLNCARKLPVSAGCAA
>CP027718.1|AZD80896.1|4852175_4852799_-|Acyclic-terpenes-utilization-regulator-AtuR,-TetR-family
MDEQKALLVMRQLVANGQLTDPDSARGKLLQTAAHLFRNKGYERTTVRDLASAVGIQSGSIFHHFKSKDEILRAVMEETIHYNTALMRAELAEAGSVRERVLALIRCELQSIMGGSGEAMAVLVYEWRSLSAQGQADVLALRDIYEQIWLQVLGEAKEAGFIKGDVFITRRFLTGALSWTTTWFRAEGSLTLEQLAEEALTLVLNEP
>CP027718.1|AZD80895.1|4851283_4852075_-|Periplasmic-binding-protein
MSSPMRTALRMLVWGLATLTVFPVCAAQLVRVGAAHFPPYTVRPEQGADTGLLPQLVEALNALQSDYQFVLVPTSIPRRFRDFEQGRVDMAIFENPAWGWQDIPHTSVDMGLEDAEIFTAQREPGRGQEYFADLKGKRLALFSGYHYAFANFNADPKYLADTYNATLTYSHDSNLLMVLRGRADIALVTRSYLSDFLSHNADTAQQLFASERIDQVYHHYALIRPMAPITGEDFAKLLGRLRDSGELLKIFDPYRIVVMPPAK
>CP027718.1|AZD80894.1|4850774_4851212_-|hypothetical-protein
MSSLDTLSAVAVADTCRCVADAAGLQPLRLAGIETSGASRGPGAPLPPAGSEVLQALRGQDGWREEWMAGWLSTLVHSLCLDHGPSERLAEDAGHRLEQQERCLHCGRAFDFSHKRAALLILAQGCGVERHQGVEKIGRERSCSR
>CP027718.1|AZD80893.1|4850169_4850718_+|Sigma-factor-PvdS,-controling-pyoverdin-biosynthesis
MTEQVSTSRCDSPLLQAFVDNRLILVKIAARITGCRSRAEDVVQDAFFRLQSAPQITSSFKAQLSYLFQIVRNLAIDHYRKQALEQKYSGTEEEGLNVVVQGASPETSHINFSTLEHIADALTELPSRTRYAFEMYRLHGVPQKDIAKELGVSPTLVNFMIRDALVHCRKVSGSRADTYARH
>CP027718.1|AZD80892.1|4836777_4849794_-|Pyoverdine-chromophore-precursor-synthetase-PvdL
MMDAFELPSTLAQALQRRAAQTPDQVALRFLAEEQDQSVVLSYRDLDLRARTIAAALQANAGLGDRAVLLFPSGPDYVAAFFACLYAGVIAVPAYPPESSRRHHQERLISIIADAEPRLLLTSSGLRDSLAQMDELQGADAPQLLCVDTLEASLAEGWTATELRGDDIAFLQYTSGSTALPKGVQVSHGNLVANEVLIRRGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVLMSPAYFLGRPLRWLEAISEYGGTISGGPDFAYRLCSERVSESALERLDLSRWRVAYSGSEPIRLDTLERFAEKFAACGFTPNNFFASYGLAEATLFVAGGTRGQGIPALRLDEQALAQNRAEPGTGNAMMSCGTSQPEHAVLIVEPHTLVELEDNLVGEVWAAGPSIAHGYWRNPEASAKTFVQHAGQTWLRTGDLGFMRGGELFITGRLKDMLIVRGHNLYPQDIEQTIEREVEVVRKGRVAAFAVTEQGEEGIGIAAEISRSVQKILTPDALIKLIRQTVAEAYQQAPSVVVLLNPGALPKTSSGKLQRSACRNRLADGSLDSYAQFPSRQAVAGEASGEASSELQELIGRIWREQLQVEQVASDDHFFLLGGNSIAATQVVARLREELGLELNLRLLFEAPTLGAFAAQVAQLQQDGGLAQGAINALSRAEALPQSLAQNRLWITWQLDPQSSAYNIPGGLRLRGELDEDALRASFQQLIERHESLRTRFFEHDGQALQQVLPAGEFNLQVIDLSDLPLAEREARAQQIREEEARTQFDLEQGPLLWVTLVRLDDEEHQLLVTLHHIIADGWSLNVLIDEFSRLYAAAVQGQAASLAPLPLQYADYGSWQRQWLAQGEGERQLAYWKQQLGDEHPSLSLATDHPRSAQRQHSAARHSLRLGASLSDAIRQTAQAHESTPFMLLLTAFQSLLHRYSGQRDIRIGVPNANRPRLETQGLIGFFINTLVLRAEVDGRLSFSALLAQTRQAALEAQAHQDLPFEQLLKAFPQAREQGLFQVMFNHQQRDLGALRRLPGLLAEELPWHSREAKFDLQLHSEEDRNGRLSLSFDYAAELFEAATIERLAEHFVSLLREACERPQTAIADLPLLNPCEQAQQQQWSEAPCAAASQWLPELLDAQLQQTPERTALVWQGGELSFAELHAQANRLAHYLRDKGVGPDVCVAIAAERSPQLLIGLLAIVKAGGAYVPLDPDYPAERLAYMLADSGVELLLTQTQLLERLPQAEGVSAIAMDSLKLDSWPSHAPGLHLHGDNLAYVIYTSGSTGQPKGVGNTHAALSERLQWMQNTYRLDASDVLMQKAPISFDVSVWECFWPLITGCRLLLAAPGEHRDPHRIAQLVQQYGVTTLHFVPPLLQLFVDEPLSAECGSLRRLFSGGEALPAELRDRVLEQLPNVQLHNRYGPTETAINVTHWHCRSGDGERSPIGRPLGNVICRVLDADLNPVPAGVPGELCIAGIGLARGYLGRPGLSAERFVVDPLSTEGTRLYRTGDRVRWAVDGALEYLGRLDQQVKLRGFRVEPQEIEARLLAQEGVAQAAVLVRETAAGAQLIGYYTATADVEDEEAQTARLKTALASELPEYMVPAQLMLLSAMPLSPSGKLDRRALPEPQWQVREHVEPATELQQQIAAIWREVLGQQRIGLRDDFFALGGHSLLATQIISRTRQACDVELPLRALFEASELGDFAEQVRLIQASGKRNQQPPIAKVDRSQPVPLSYSQQRMWFLWQMEPDSPAYNVGGMARFKGVLDVGRFEAALQALILRHETLRTTFPSVDGVAQQRVHAETGVRMAWKDFSSLDAAAREQRLQQLADSEAHQPFDLETGPLLRACLVKAAEHEHYFVLTLHHIVTEGWAMDIFARELSALYEAFIDDRDSPLEPLPVQYLDYSVWQRQWLESGERQRQLDYWTAQLGNEHPLLELPGDRPRPPVQSHQGELYRFDLSDELAARVRRFNAEHGLTLFMTMTATLAVLLYRYSGQTDLRIGAPVANRIRPESEGLIGAFLNTQVLRCQLDGQMSVGELFEQVRHTVIEGQSHQDLPFDHLVEALQPPRSAAYNPLFQVMCNVQRWEFQQSRSLAGMTVEYLANDARATKFDLNLEVTDLDHRLGCCLTYSTDLFDEPRIARMAAHWRNLLEALIESPEQRLSELPLLDRAEQQQLLDSLGVEPGEHRLDQCIHHLFSEQALLRPDAPALTFAGQTLSYAELDSRANRLAWMLRERGVGPQVRVGLALERSLEMVIGLLAILKAGGAYVPLDPEYPLDRLHYMIEDSGIGLLLSDAAMFQALGQLPPSVARWCLEEDGAQLANYPASELPFISLPQHQAYLIYTSGSTGKPKGVVVSHGEIAMHCRAVIERFGMRPDDCELHFYSINFDAATERLLVPLLSGAQVVLRAQGQWDTEEICQLIRQHRINILGFTPSYGSQLAQWLATQGETLPVRMCITGGEALTGEHLSRIRAAFKPSLFFNAYGPTETVVMPLASLAPEQLEEGAGSVPIGTVVGERVAYILDADLALVPQGATGELYVGGAGLAQGYHQRPGMSAERFVADPFSTNGGRLYRTGDLVRQCADGQVEYIGRVDHQVKIRGFRIELGEIENRLLEHEAVREAVVLALDMPGGKQLAGYLVTDVAEQSDEQQAALREAIKAQLKIHLPDYMVPTHLVLLASMPLTANGKLDRRALPAPDLELNRQQYVAPSNELEQTLAQVWCDVLNLRQVGLHDNFFELGGDSILSIQVVSRARQLGIHFSPRDLFQHQTVQTLAAVASRSERIVAEQGVLSGESGLTPIQHWFFDSEIPERQHWNQALLLAPTQTLDGPLLEQALHAVLAQHDALRLRFTQVDGQWQAMHQPLSEAPLLVQMHVASMDQCVALFAEAQRSLDLSNGPLLRALLVDGPQEQQRLFIAIHHLVVDGVSWRVLLEDLQNVYRQLEAQQTPRLPAKTSALRDWASRLQAYAGSESLREELSWWQDQLAGPAATLPVQHAQGGRQNKHARTVSVKLDAERTRQLLQQAPSAYRTQVNDLLLTALARVLCRWTGEASALIQLEGHGRETLFDEIDLTRTVGWFTSAYPLRLTPQAIEEAAGQGASIKAIKEQLRAVPHKGLGYGVLRYLADAAIQQGMAALPQAPITFNYLGQFDQSFASDALFRPLDEPVGAAHSPEAPLPNELSIDSQVYAGELVLRWTFSGERFDPQTIDELAQAYLGELHSLIAHCLEDDAGGLTPSDFPLARLTQAQLDALPVAAGVIEDVYPLTPMQEGMLLHTLLEPGTGLYYMQDRYRINSELDPARFAQAWQAVVARHEALRASFCWNVGEDMLQVIHKPGSTPIEFLDWSLVAEAEQEPKLQALLKSEREAGFDLLEQAPFHLRLIRVGAARYWFMMSNHHILIDAWCRSLLMNDFFEIYTALGEGREAQLSVPPRYRDYIGWLQRQSLAEARQWWKNNLQGFERTTPIPSDRPFLREHAGDSGGMIVGDCYTRLDARDGAQLRELAQQHQLTVNTFAQAAWALVLRRLSGERDVLFGVTVAGRPVEMPEMQRTVGLFINSIALRVQLPEDGQRLSVRQWLGGLLERNMELREYEYLPLVAIQENSELPKGQPLFDSLFVFENAPVEVSVLDRAQSLNATSDSGRTHTNFPLTAVCYPGDDLGLHLSYDQRYFEQATIERMLGEFKRLLLALVQGFHGDMAELPLLGAAEQDFLLAGCNQSEHDYPLERSYVELFEAQVAAHPQRIAASCQELQYSYAELNQRSNRLGHALIANGVGLDQPVALLAERSLDLLGMIIGSFKAGAGYLPLDPGLPGQRLGRIIELSRTPLLVCTAACQAQAQALLDEFACANRPRLLVWEEVQAADHSLDNPGIYSGPDNLAYVIYTSGSTGLPKGVMVEQRGMLNNQLSKVPYLQLSEADVIAQTASQSFDISVWQFLAAPLFGARVDIVPNAIGHDPQGLLAHVQAQGITVLESVPSLIQGMLAQESIHLDGLRWMLPTGEAMPPELAHQWLLRYPQIGLVNAYGPAECSDDVAFYRVDMASTRGSYLPIGTPTDNNRLYLMDGALDLVPLGAVGELCVAGIGVGRGYVSDPLRTAQVFVPHPFGAPGERLYRTGDLARRRADGVLEYVGRIDHQVKIRGYRIELGEIEARLHEQPEVRDAAVGVQEGVNGKHLVGYLVASDSALNPSERLERIKQRLRAELPEYMVPLHWLWLERLPLNANGKLDRKALPALEIGQLHSQDYLAPRSELEQTLAAIWAEVFKVERVGVRDNFFELGGHSLLATQIASRVQKTLQRNVPLRAMFECSTVEELAQYIDSLASSEISEEKVDRLSDLMAELEGL
>CP027718.1|AZD80891.1|4835784_4836603_-|Beta-ketoadipate-enol-lactone-hydrolase
MPFATIDGQALHYLDQGSGPAVLLAGSYLWDLNMWAPQIEALSRQYRVIALDLWGHGQSGALPQGTASLDDIARQVLALLDHLEIERITLVGLSVGGMWGARLALAVPQRINGLVLMDTYLGAEPEPTRQYYFSLFKQIEESGVIAPQLLDIVVPIFFRPGIDPQSALYQDFRAVLAALPSERLRESVVPMGRITFSRADLLSRLNQLDPKSTLLLCGDQDKPRPPSETREMAELIGCPYQLVPEAGHISNLENPEFVTEALLAFLAQRYSC
>CP027718.1|AZD80901.1|4857510_4858668_+|Citronellyl-CoA-dehydrogenase
MIFTQEHEELRRTVHNFVEREINPYVDEWEKAGRFPIHEIFRKAGELGLLGISKPEKFGGMGLDYSYSIVAAEEFGTIHCGGIPMAIGVQTDMCTPALARFGSDELREEFLRPAISGEMVGCIGVSEVGAGSDVAGLKTTARKDGDDYVINGSKMWITNSPSADFICLLANTSDDKPHVNKSLIMVPMNSPGISLSPHLDKLGMRSSETAQVFFDNVRVPQRYRIGHEGAGFMMQMLQFQEERLFGAANMIKGLEYCVDSTIEYCKERQTFGSALIDNQVIHFRLAELSTEIECLRALVYQATEQYVRGQDVTRLASMAKLKAGRLGREVSDSCLQYWGGMGFMWDNPVARAYRDVRLVSIGGGADEIMLGIICKLMGILPGKRK
>CP027718.1|AZD80902.1|4858664_4859501_+|Isohexenylglutaconyl-CoA-hydratase
MSRLPACETLLLAPRGGVLHITLDRPDSRNAMSLQMVAELRTVLAAVRDDRDIRALVLRGAGGHFCAGGDLKDMANARTQGASAYRELNRAFGTLLEEAQHSPQVLIVLLQGAVLGGGFGLACVSDIAIADHQAQFGMPETSLGLLPAQIAPFVVKRIGLTQARRLALTAARFDGHEAKRLGLVHFVENSPEALAERLDEVLAHVLCCAPEANAATKALLLASAEEPLAPLLDRAAEQFATAVTGAEGIEGTMAFVQKRKPAWASEPPPEQTPPTSGT
>CP027718.1|AZD80903.1|4859504_4861466_+|Geranyl-CoA-carboxylase-biotin-containing-subunit
MPAFSKILIANRGEIACRIQRTAQALGYRTVAVFSDADADALHVRMADEAVRIGPAAVQQSYLNSQAILDAARRTGADALHPGYGFLSENAEFARACEAAGITFIGPSAEAIELMGSKRLSKLAMLAAGVPCIAGYQGTEQDDTTLQQEAERIGYPLMIKASAGGGGRGMRLVQRADELLAQVRTARSEALHAFGSDELILEQALIEPRHVEIQVFGDRHGQLIYLGERDCSIQRRHQKVVEEAPCPVMTAELRQAMGEAALKAGRAVNYVGAGTVEFLLDARGQFYFLEMNTRLQVEHPVTEMITGLDLVALQLQVAAGQPLPLRQEQVELKGHAIEVRLYAEDPAQDFLPQTGQVRRWEPALGVDVRIDHGLLEGQSVSPFYDPMLGKLIAHGATREEARRKLLRAVEDTVLTGVASNQKLLANLLRHPGFASGEFSTAFIAEHFADDPSLHPQPPSGAELALAAALLYQHAAQRHGAALAGWRNNASVPLHYRLGSGEAVWNLELNNQQAGTLQIQHADESFEVQLLEADGRWACATIDGIRRRYAYTLEAGQLWLFTRPGSLHLQDLSHAPVASQAGAHSGMLKAPMDGAIVDVLVSEGATVSKGQLLLVLEAMKMEHPLKAGIDGVIKRLQVNLGDQVKNRQVLLEVE
>CP027718.1|AZD80904.1|4861535_4862078_+|Inhibitor-of-the-KinA-pathway-to-sporulation,-predicted-exonuclease
MPHWLVIDLEATTDEGGWPVTDMEIIEIGATLVNREGRELDHFQRFVRPLRRPMLTPFCRELTRISQAQIDGAQPLSEVWPLFERWLGQHHARLEGWASWGDYDRKQLLQEWQRAQLHSALAQLPHMNLKQRFAKARRLERPLGLNGALQLAGLQFTGQQHRALEDARNTARLLPLILPG
>CP027718.1|AZD80905.1|4862160_4862445_+|hypothetical-protein
MFKVNEYFDGTVKSIAFGTAEGPATIGVMAPGEYEFGTAQREIMHVVSGALTVKLPDSNDWETFAAGSQFNVPANSKFQLKVAVDTAYLCEYRG
>CP027718.1|AZD80906.1|4862531_4863335_-|Flavodoxin-reductase-(ferredoxin-NADPH-reductase)-family-1
MRLSALYRYPLKSGKGESLQQVALDRLGLEGDRRWMLVDEPSGRFLTQRAVPHMSQLSALWNAEGGLTLSAPGYPALDVPLPGADAPLRGVTIWRDTLRVPDAGEAAHAWLSEFIGKPTRLVQVPLDRARTTQAGYGKDDDQVAFADGFPLLLIGESSREDLSSRVGRPLEMLRFRPNLVIEGFPAFAEDGWKRIRIGDIEFRVVKPCARCILTTIDPQTGERSADREPLATLQQYRAQEGGAMFGQNLVNDGIGRLEVGMPVTVLE
>CP027718.1|AZD80907.1|4863434_4864370_-|Chemotaxis-protein-CheV
MAGILDTVDQRTQLVGENRLEILMFRLAGRQLFAINVFKVQEVLQLPKLTLMPQRHPFVCGVVNLRGQTLPVIDLSQAIGMRPLVPGPNSTIIVTEYNRSVQAFLVGGVDRIVNMNWEAILPPPTSAGRQHYLTAISKVDDQLVEIIDVEKVLAEIVPYNAKVSRDKLDDPVLERARGREVLLVDDSNVALSQLRDTLGQLGVKMHIASDGLKALKMLKAWADTGVDMTDKLLMVFTDAEMPEMDGYRLTTEIRNDPRLRGLYVVLHTSLSGSFNESMVKKVGCDNFLSKFQPDKLVDVVRQRLMLDEVPA
>CP027718.1|AZD80908.1|4864910_4865378_+|hypothetical-protein
MLIDDQTWHQSPDFLLEAEALLAKSVECLNHLNLIKNDQDAIDCMLSTLLKLAEKTDALALRSTAEFSRQVHALLDHSHPHPDMNEQILDTLGECFSLMAWQLELVDPVTGQLNLDGNEQATLIETLAVQMDPLPAPLSCQHNSFKVFSIAKRNA
>CP027718.1|AZD80909.1|4865511_4865640_-|hypothetical-protein
MSRESGISPFWTYVPIRLFQLATLKQCLYLALSERAGEIQDT
>CP027718.1|AZD80910.1|4865881_4866775_+|Sensor-histidine-kinase
MYASLKSTATRLLSRIHLRWLNLLLCSCSALGSLAVYCLSTTFPLSLLILNLAALAGVWAYYGDSRKSINFQPQELADRLLEVQENERHRLSRELHDDIGQLLTAAKLQSEWLKRRLPEELQQHCTTLQSTLEETLAKVRDVSAILNPRQLASLGLEASLRAHLLKTLENTSVHWSLECKQRLAGIPEEMAVAAFRITQEAVTNMLRHAQANNLLVRLQRLPEGLSLFISDDGRGFSPAANPGAQGQRGMAGMSERIAQLGGTLKVSSQPDQGTQIEALFPWAPRALERASTNKVLH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP031228	Pseudomonas amygdali pv. lachrymans str. M301315 plasmid pPla107-2	27385-27415	1	0.968
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_KY362373	Pseudomonas syringae pv. syringae strain 7B44 plasmid pPs7B44, complete sequence	71473-71503	2	0.935
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP041755	Pseudomonas sp. KBS0707 plasmid unnamed1, complete sequence	131670-131700	2	0.935
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP007015	Pseudomonas syringae CC1557 plasmid pCC1557, complete sequence	32883-32913	2	0.935
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NC_019328	Pseudomonas syringae plasmid pB76-81, complete sequence	6796-6826	2	0.935
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT222315	Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf plasmid p58T3	121404-121434	3	0.903
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT963397	Pseudomonas cerasi isolate PL963 plasmid PP2, complete sequence	46611-46641	3	0.903
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_KY362371	Pseudomonas syringae pv. syringae strain UMAF1029 plasmid pPs1029, complete sequence	62710-62740	3	0.903
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_KY362370	Pseudomonas syringae pv. syringae strain UMAF0158 plasmid pPs0158, complete sequence	62701-62731	3	0.903
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP005971	Pseudomonas syringae UMAF0158 plasmid unnamed, complete sequence	26893-26923	3	0.903
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	CP050261	Pseudomonas coronafaciens strain X-1 plasmid unnamed1	4199-4229	3	0.903
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	CP046442	Pseudomonas coronafaciens pv. coronafaciens strain B19001 plasmid unnamed1, complete sequence	112609-112639	3	0.903
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP046036	Pseudomonas coronafaciens pv. oryzae str. 1_6 plasmid pPor1_6, complete sequence	51230-51260	3	0.903
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP034081	Pseudomonas syringae pv. pisi str. PP1 plasmid pPP1-3, complete sequence	26313-26343	3	0.903
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT963403	Pseudomonas syringae pv. avii isolate CFBP3846 plasmid PP1, complete sequence	30814-30844	4	0.871
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP024714	Pseudomonas syringae pv. actinidiae strain MAFF212063 plasmid pMAFF212063-B, complete sequence	28775-28805	4	0.871
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT985191	Pseudomonas syringae group genomosp. 3 strain CFBP 3800 plasmid PP2, complete sequence	12950-12980	4	0.871
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NC_005919	Pseudomonas syringae pv. maculicola strain ES4326 plasmid pPMA4326B, complete sequence	39807-39837	4	0.871
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP047263	Pseudomonas syringae pv. maculicola str. ES4326 plasmid pPma4326B, complete sequence	39545-39575	4	0.871
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NC_007274	Pseudomonas savastanoi pv. phaseolicola 1448A plasmid large, complete sequence	1-29	4	0.871
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP015640	Pseudomonas lurida strain L228 plasmid unnamed, complete sequence	34831-34861	4	0.871
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NC_021361	Pseudomonas fluorescens A506 plasmid pA506, complete sequence	574-604	4	0.871
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	NZ_CP054028	Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence	988670-988700	5	0.839
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	NZ_CP013600	Rhizobium sp. N741 plasmid pRspN741e, complete sequence	78773-78803	5	0.839
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	NZ_CP013504	Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence	78773-78803	5	0.839
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	NZ_CP013510	Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence	78773-78803	5	0.839
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	NZ_CP013521	Rhizobium sp. N113 plasmid pRspN113d, complete sequence	78773-78803	5	0.839
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	NZ_CP013494	Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence	78773-78803	5	0.839
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	NZ_CP013594	Rhizobium sp. N871 plasmid pRspN871d, complete sequence	78773-78803	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT222314	Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf plasmid p58T2, complete sequence	69167-69197	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT963399	Pseudomonas cerasi isolate PL963 plasmid PP4, complete sequence	49449-49479	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT985212	Pseudomonas syringae pv. cerasicola strain CFBP 6110 plasmid PP3, complete sequence	6632-6662	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP026557	Pseudomonas amygdali pv. morsprunorum strain R15244 plasmid p1_tig4, complete sequence	44519-44549	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT985191	Pseudomonas syringae group genomosp. 3 strain CFBP 3800 plasmid PP2, complete sequence	4647-4677	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT963394	Pseudomonas syringae pv. cerasicola isolate CFBP6109 plasmid PP3, complete sequence	9977-10007	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NC_019265	Pseudomonas savastanoi NCPPB 3335 native plasmid pPsv48A complete sequence	78067-78097	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_FR820585	Pseudomonas savastanoi pv. savastanoi strain NCPPB 3335 plasmid pPsv48A, complete sequence	79833-79863	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP032870	Pseudomonas syringae pv. actinidiae strain P220 plasmid pLKQG722, complete sequence	75686-75716	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP032632	Pseudomonas syringae pv. actinidiae str. Shaanxi_M228 plasmid pM228, complete sequence	49555-49585	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP011973	Pseudomonas syringae pv. actinidiae ICMP 18884 plasmid unnamed, complete sequence	45365-45395	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP012180	Pseudomonas syringae pv. actinidiae ICMP 18708 plasmid unnamed, complete sequence	47782-47812	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP018203	Pseudomonas syringae pv. actinidiae ICMP 9853 plasmid p9853_A, complete sequence	19757-19787	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP019733	Pseudomonas syringae pv. actinidiae strain CRAFRU 14.08 plasmid unnamed, complete sequence	35980-36010	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP017010	Pseudomonas syringae pv. actinidiae strain NZ-47 plasmid pPsa22180a, complete sequence	45364-45394	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP017008	Pseudomonas syringae pv. actinidiae strain ICMP 20586 plasmid pPsa20586, complete sequence	45365-45395	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP019731	Pseudomonas syringae pv. actinidiae strain CRAFRU 12.29 plasmid unnamed, complete sequence	35983-36013	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT222316	Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf plasmid p58T4	15793-15823	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT222317	Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf plasmid p58T5, complete sequence	11860-11890	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT963407	Pseudomonas syringae pv. avii isolate CFBP3846 plasmid PP5, complete sequence	31826-31856	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT963398	Pseudomonas cerasi isolate PL963 plasmid PP3, complete sequence	22617-22647	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT963401	Pseudomonas cerasi isolate PL963 plasmid PP6, complete sequence	16597-16627	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP015000	Pseudomonas aeruginosa strain PA7790 plasmid pPA7790, complete sequence	46648-46678	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP049162	Pseudomonas aeruginosa strain MS14403 plasmid pMS14403A, complete sequence	44468-44498	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT963410	Pseudomonas syringae isolate CFBP3840 plasmid PP1, complete sequence	34012-34042	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_KY362366	Pseudomonas amygdali pv. tabaci strain 0893-29 plasmid pPt0893-29, complete sequence	73538-73568	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP026561	Pseudomonas amygdali pv. morsprunorum strain R15244 plasmid p4_tig6, complete sequence	8324-8354	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP019873	Pseudomonas syringae pv. tomato strain B13-200 plasmid pB13-200B, complete sequence	90446-90476	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT222313	Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf plasmid p58T1, complete sequence	22886-22916	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT222318	Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf plasmid p58T6	1411-1441	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT963404	Pseudomonas syringae pv. avii isolate CFBP3846 plasmid PP2, complete sequence	85434-85464	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT963405	Pseudomonas syringae pv. avii isolate CFBP3846 plasmid PP3, complete sequence	27117-27147	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT963400	Pseudomonas cerasi isolate PL963 plasmid PP5, complete sequence	45633-45663	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP025052	Pseudomonas aeruginosa strain PB353 plasmid pPB353_1, complete sequence	259-289	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NC_019292	Pseudomonas savastanoi pv. savastanoi native plasmid pPsv48C complete sequence	41801-41831	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NC_004633	Pseudomonas syringae pv. tomato str. DC3000 plasmid pDC3000A, complete sequence	46-76	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NC_004632	Pseudomonas syringae pv. tomato str. DC3000 plasmid pDC3000B, complete sequence	45-75	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP027175	Pseudomonas aeruginosa strain AR_0230 plasmid unnamed1	19750-19780	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	LT985194	Pseudomonas syringae strain CFBP 2116 genome assembly, plasmid: PP3	65135-65165	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	LT985195	Pseudomonas syringae strain CFBP 2116 genome assembly, plasmid: PP4	35878-35908	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT963411	Pseudomonas syringae isolate CFBP3840 plasmid PP2, complete sequence	89436-89466	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT963412	Pseudomonas syringae isolate CFBP3840 plasmid PP3, complete sequence	29692-29722	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP026564	Pseudomonas avellanae strain R2leaf plasmid p2_tig5, complete sequence	48248-48278	5	0.839
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NC_022437	Pseudomonas fluorescens R124 plasmid pMP-R124, complete sequence	43604-43634	5	0.839
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	NC_009717	Xanthobacter autotrophicus Py2 plasmid pXAUT01, complete sequence	129019-129049	6	0.806
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	ASHF01000034	Streptomyces sp. GBA 94-10 plasmid pGBA1, complete sequence, whole genome shotgun sequence	20684-20714	6	0.806
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	NZ_CP018229	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence	781495-781525	6	0.806
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	NZ_CP016287	Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence	121091-121121	6	0.806
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	NZ_CP048281	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248e, complete sequence	209023-209053	6	0.806
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	NZ_CP020911	Rhizobium etli strain NXC12 plasmid pRetNXC12e, complete sequence	790724-790754	6	0.806
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	NZ_CP021033	Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence	71832-71862	6	0.806
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	NZ_CP021029	Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence	83136-83166	6	0.806
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	NZ_CP013526	Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence	81947-81977	6	0.806
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	NZ_CP013556	Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence	81948-81978	6	0.806
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	NZ_CP013562	Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence	81946-81976	6	0.806
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	NZ_CP013567	Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence	81948-81978	6	0.806
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	NZ_CP013515	Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence	82807-82837	6	0.806
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	NZ_CP013605	Rhizobium sp. N731 plasmid pRspN731d, complete sequence	82801-82831	6	0.806
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	NZ_CP022568	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK04, complete sequence	259341-259371	6	0.806
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT222315	Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf plasmid p58T3	65624-65654	6	0.806
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT963397	Pseudomonas cerasi isolate PL963 plasmid PP2, complete sequence	114203-114233	6	0.806
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP045801	Pseudomonas syringae USA011 plasmid pUSA011-2, complete sequence	21905-21935	6	0.806
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT963410	Pseudomonas syringae isolate CFBP3840 plasmid PP1, complete sequence	19934-19964	6	0.806
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT963405	Pseudomonas syringae pv. avii isolate CFBP3846 plasmid PP3, complete sequence	35630-35660	6	0.806
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NC_019292	Pseudomonas savastanoi pv. savastanoi native plasmid pPsv48C complete sequence	29396-29426	6	0.806
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP041756	Pseudomonas sp. KBS0707 plasmid unnamed2, complete sequence	40868-40898	6	0.806
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP006257	Pseudomonas syringae pv. syringae HS191 plasmid unnamed, complete sequence	52320-52350	6	0.806
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT963392	Pseudomonas syringae pv. cerasicola isolate CFBP6109 plasmid PP1, complete sequence	770-800	6	0.806
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT963392	Pseudomonas syringae pv. cerasicola isolate CFBP6109 plasmid PP1, complete sequence	70451-70481	6	0.806
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT963393	Pseudomonas syringae pv. cerasicola isolate CFBP6109 plasmid PP2, complete sequence	33457-33487	6	0.806
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT985210	Pseudomonas syringae pv. cerasicola strain CFBP 6110 plasmid PP1, complete sequence	54715-54745	6	0.806
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT985210	Pseudomonas syringae pv. cerasicola strain CFBP 6110 plasmid PP1, complete sequence	76572-76602	6	0.806
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT985211	Pseudomonas syringae pv. cerasicola strain CFBP 6110 plasmid PP2, complete sequence	67134-67164	6	0.806
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP026563	Pseudomonas avellanae strain R2leaf plasmid p1_tig4, complete sequence	15920-15950	6	0.806
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP026566	Pseudomonas avellanae strain R2leaf plasmid p4_tig8, complete sequence	3878-3908	6	0.806
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NC_002759	Pseudomonas syringae pv. maculicola str. M6 plasmid pFKN, complete sequence	39293-39323	6	0.806
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT985190	Pseudomonas syringae group genomosp. 3 strain CFBP 3800 plasmid PP1, complete sequence	53232-53262	6	0.806
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP018204	Pseudomonas syringae pv. actinidiae ICMP 9853 plasmid p9853_B, complete sequence	4521-4551	6	0.806
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP031227	Pseudomonas amygdali pv. lachrymans str. M301315 plasmid pPla107-1, complete sequence	34056-34086	6	0.806
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP034079	Pseudomonas syringae pv. pisi str. PP1 plasmid pPP1-1, complete sequence	61847-61877	6	0.806
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	NZ_CP013600	Rhizobium sp. N741 plasmid pRspN741e, complete sequence	78772-78803	6	0.812
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	NZ_CP013504	Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence	78772-78803	6	0.812
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	NZ_CP013510	Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence	78772-78803	6	0.812
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	NZ_CP013521	Rhizobium sp. N113 plasmid pRspN113d, complete sequence	78772-78803	6	0.812
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	NZ_CP013494	Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence	78772-78803	6	0.812
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	NZ_CP054028	Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence	988670-988701	6	0.812
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	NZ_CP013594	Rhizobium sp. N871 plasmid pRspN871d, complete sequence	78772-78803	6	0.812
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	NZ_CP038146	Streptomyces sp. S501 plasmid unnamed, complete sequence	190988-191019	6	0.812
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	KU716095	Mycobacterium phage Myxus, complete genome	23207-23237	7	0.774
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	MK061409	Mycobacterium phage ExplosioNervosa, complete genome	23240-23270	7	0.774
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	MG872842	Mycobacterium phage Scherzo, complete genome	23240-23270	7	0.774
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	MK559428	Mycobacterium phage Elephantoon, complete genome	22645-22675	7	0.774
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	KX585252	Mycobacterium phage HortumSL17, complete genome	23207-23237	7	0.774
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	MN369741	Mycobacterium phage LoneWolf, complete genome	22800-22830	7	0.774
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	KT285706	Mycobacterium phage Pioneer, complete genome	23240-23270	7	0.774
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	MK977713	Mycobacterium phage Tubs, complete genome	23207-23237	7	0.774
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	MN369763	Mycobacterium phage Aliter, complete genome	23135-23165	7	0.774
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	MG872835	Mycobacterium phage Conquerage, complete genome	23237-23267	7	0.774
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	MK524489	Mycobacterium phage Ugenie5, complete genome	23240-23270	7	0.774
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	KX664447	Mycobacterium phage Phaeder, complete genome	23207-23237	7	0.774
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	MN585978	Mycobacterium phage Beemo, complete genome	23241-23271	7	0.774
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	KU613353	Mycobacterium phage Catalina, complete genome	23207-23237	7	0.774
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	MG872840	Mycobacterium phage Phonnegut, complete genome	23240-23270	7	0.774
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	NC_042314	Mycobacterium virus PackMan, complete genome	23207-23237	7	0.774
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	KX685355	Mycobacterium phage Qobbit, complete genome	23237-23267	7	0.774
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT222315	Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf plasmid p58T3	83-113	7	0.774
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	LT985195	Pseudomonas syringae strain CFBP 2116 genome assembly, plasmid: PP4	25873-25903	7	0.774
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP019874	Pseudomonas syringae pv. tomato strain B13-200 plasmid pB13-200C, complete sequence	70884-70914	7	0.774
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT963392	Pseudomonas syringae pv. cerasicola isolate CFBP6109 plasmid PP1, complete sequence	10147-10177	7	0.774
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NC_019334	Pseudomonas syringae plasmid pPT14-32, complete sequence	4049-4079	7	0.774
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT985210	Pseudomonas syringae pv. cerasicola strain CFBP 6110 plasmid PP1, complete sequence	101767-101797	7	0.774
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT985190	Pseudomonas syringae group genomosp. 3 strain CFBP 3800 plasmid PP1, complete sequence	5745-5775	7	0.774
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NC_007275	Pseudomonas savastanoi pv. phaseolicola 1448A plasmid small, complete sequence	1-29	7	0.774
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP026560	Pseudomonas amygdali pv. morsprunorum strain R15244 plasmid p3_tig5, complete sequence	3184-3214	7	0.774
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	LT985193	Pseudomonas syringae strain CFBP 2116 genome assembly, plasmid: PP2	14501-14531	7	0.774
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT963413	Pseudomonas syringae isolate CFBP3840 plasmid PP4, complete sequence	49260-49290	7	0.774
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP026565	Pseudomonas avellanae strain R2leaf plasmid p3_tig6, complete sequence	32493-32523	7	0.774
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_KY362367	Pseudomonas coronafaciens pv. garcae strain 2708 plasmid pPg2708, complete sequence	72369-72399	7	0.774
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP026559	Pseudomonas amygdali pv. morsprunorum strain R15244 plasmid p2_tig3, complete sequence	39698-39728	7	0.774
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_LT963406	Pseudomonas syringae pv. avii isolate CFBP3846 plasmid PP4, complete sequence	18468-18498	7	0.774
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	CP046443	Pseudomonas coronafaciens pv. coronafaciens strain B19001 plasmid unnamed2, complete sequence	45668-45698	7	0.774
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NC_019266	Pseudomonas savastanoi NCPPB 3335 native plasmid pPsv48B complete sequence	44917-44947	7	0.774
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP034080	Pseudomonas syringae pv. pisi str. PP1 plasmid pPP1-2, complete sequence	54690-54720	7	0.774
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NC_005918	Pseudomonas syringae pv. maculicola strain ES4326 plasmid pPMA4326A, complete sequence	46394-46424	7	0.774
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP047262	Pseudomonas syringae pv. maculicola str. ES4326 plasmid pPma4326A, complete sequence	46243-46273	7	0.774
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	NC_009717	Xanthobacter autotrophicus Py2 plasmid pXAUT01, complete sequence	129019-129050	7	0.781
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	NZ_LR536451	Methylocella tundrae isolate MTUNDRAET4 annotated genome plasmid 2	154880-154911	7	0.781
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	NZ_CP021033	Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence	71831-71862	7	0.781
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	NZ_CP021029	Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence	83135-83166	7	0.781
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	NZ_CP013526	Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence	81946-81977	7	0.781
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	NZ_CP013556	Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence	81947-81978	7	0.781
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	NZ_CP020911	Rhizobium etli strain NXC12 plasmid pRetNXC12e, complete sequence	790724-790755	7	0.781
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	NZ_CP013562	Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence	81945-81976	7	0.781
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	NZ_CP013567	Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence	81947-81978	7	0.781
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	NZ_CP013515	Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence	82806-82837	7	0.781
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	NZ_CP013605	Rhizobium sp. N731 plasmid pRspN731d, complete sequence	82800-82831	7	0.781
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	NZ_CP022568	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK04, complete sequence	259340-259371	7	0.781
CP027718_6	6.1\|4857406\|32\|CP027718\|CRISPRCasFinder	4857406-4857437	32	NC_002147	Agrobacterium tumefaciens MAFF301001 plasmid pTi-SAKURA, complete sequence	73694-73725	7	0.781
CP027718_6	6.1\|4857406\|32\|CP027718\|CRISPRCasFinder	4857406-4857437	32	NZ_MK439386	Agrobacterium tumefaciens strain T37 plasmid pTiT37, complete sequence	106539-106570	7	0.781
CP027718_6	6.1\|4857406\|32\|CP027718\|CRISPRCasFinder	4857406-4857437	32	NZ_KY000041	Agrobacterium tumefaciens strain CFBP296 plasmid pTi_CFBP296, complete sequence	128326-128357	7	0.781
CP027718_6	6.1\|4857406\|32\|CP027718\|CRISPRCasFinder	4857406-4857437	32	NZ_KY000044	Agrobacterium fabrum strain CFBP1933 plasmid pTi_CFBP1933, complete sequence	62771-62802	7	0.781
CP027718_6	6.1\|4857406\|32\|CP027718\|CRISPRCasFinder	4857406-4857437	32	NZ_KY000057	Agrobacterium fabrum strain CFBP5505 plasmid pTi_CFBP5505, complete sequence	106062-106093	7	0.781
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	NC_014811	Mycolicibacterium gilvum Spyr1 plasmid pMSPYR101, complete sequence	26959-26989	8	0.742
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	NZ_CP032156	Mycobacterium sp. ELW1 plasmid pELW1-1, complete sequence	203846-203876	8	0.742
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	NZ_LR536451	Methylocella tundrae isolate MTUNDRAET4 annotated genome plasmid 2	154881-154911	8	0.742
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	KC170282	Uncultured bacterium plasmid pMBUI6, complete sequence	41316-41346	8	0.742
CP027718_2	2.3\|973369\|31\|CP027718\|CRISPRCasFinder	973369-973399	31	NZ_CP050084	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b2, complete sequence	160702-160732	8	0.742
CP027718_2	2.3\|973369\|31\|CP027718\|CRISPRCasFinder	973369-973399	31	NZ_CP053209	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1A, complete sequence	65731-65761	8	0.742
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	KU716095	Mycobacterium phage Myxus, complete genome	23207-23238	8	0.75
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	MK061409	Mycobacterium phage ExplosioNervosa, complete genome	23240-23271	8	0.75
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	MG872842	Mycobacterium phage Scherzo, complete genome	23240-23271	8	0.75
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	MK559428	Mycobacterium phage Elephantoon, complete genome	22645-22676	8	0.75
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	KX585252	Mycobacterium phage HortumSL17, complete genome	23207-23238	8	0.75
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	MN369741	Mycobacterium phage LoneWolf, complete genome	22800-22831	8	0.75
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	KT285706	Mycobacterium phage Pioneer, complete genome	23240-23271	8	0.75
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	MK977713	Mycobacterium phage Tubs, complete genome	23207-23238	8	0.75
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	MN369763	Mycobacterium phage Aliter, complete genome	23135-23166	8	0.75
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	MG872835	Mycobacterium phage Conquerage, complete genome	23237-23268	8	0.75
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	MK524489	Mycobacterium phage Ugenie5, complete genome	23240-23271	8	0.75
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	KX664447	Mycobacterium phage Phaeder, complete genome	23207-23238	8	0.75
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	MN585978	Mycobacterium phage Beemo, complete genome	23241-23272	8	0.75
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	KU613353	Mycobacterium phage Catalina, complete genome	23207-23238	8	0.75
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	MG872840	Mycobacterium phage Phonnegut, complete genome	23240-23271	8	0.75
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	NC_042314	Mycobacterium virus PackMan, complete genome	23207-23238	8	0.75
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	KX685355	Mycobacterium phage Qobbit, complete genome	23237-23268	8	0.75
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	KC170282	Uncultured bacterium plasmid pMBUI6, complete sequence	41316-41347	8	0.75
CP027718_6	6.1\|4857406\|32\|CP027718\|CRISPRCasFinder	4857406-4857437	32	MK864265	Gordonia phage Barb, complete genome	34903-34934	8	0.75
CP027718_6	6.1\|4857406\|32\|CP027718\|CRISPRCasFinder	4857406-4857437	32	MK864266	Gordonia phage Arri, complete genome	34886-34917	8	0.75
CP027718_6	6.1\|4857406\|32\|CP027718\|CRISPRCasFinder	4857406-4857437	32	MK864264	Gordonia phage VanDeWege, complete genome	34951-34982	8	0.75
CP027718_6	6.1\|4857406\|32\|CP027718\|CRISPRCasFinder	4857406-4857437	32	MH479910	Gordonia phage Danyall, complete genome	34706-34737	8	0.75
CP027718_6	6.1\|4857406\|32\|CP027718\|CRISPRCasFinder	4857406-4857437	32	MT639651	Gordonia phage Portcullis, complete genome	34225-34256	8	0.75
CP027718_6	6.1\|4857406\|32\|CP027718\|CRISPRCasFinder	4857406-4857437	32	MH479917	Gordonia phage KimmyK, complete genome	35439-35470	8	0.75
CP027718_6	6.1\|4857406\|32\|CP027718\|CRISPRCasFinder	4857406-4857437	32	MK814761	Gordonia phage SmokingBunny, complete genome	34714-34745	8	0.75
CP027718_6	6.1\|4857406\|32\|CP027718\|CRISPRCasFinder	4857406-4857437	32	KX557286	Gordonia phage Twister6, complete genome	34617-34648	8	0.75
CP027718_6	6.1\|4857406\|32\|CP027718\|CRISPRCasFinder	4857406-4857437	32	MK864267	Gordonia phage Valary, complete genome	35659-35690	8	0.75
CP027718_6	6.1\|4857406\|32\|CP027718\|CRISPRCasFinder	4857406-4857437	32	MK967381	Gordonia phage RogerDodger, complete genome	35054-35085	8	0.75
CP027718_6	6.1\|4857406\|32\|CP027718\|CRISPRCasFinder	4857406-4857437	32	MT310872	Gordonia phage Evamon, complete genome	34725-34756	8	0.75
CP027718_6	6.1\|4857406\|32\|CP027718\|CRISPRCasFinder	4857406-4857437	32	MT521998	Gordonia phage Jambalaya, complete genome	34504-34535	8	0.75
CP027718_6	6.1\|4857406\|32\|CP027718\|CRISPRCasFinder	4857406-4857437	32	NC_030913	Gordonia phage Wizard, complete genome	34857-34888	8	0.75
CP027718_6	6.1\|4857406\|32\|CP027718\|CRISPRCasFinder	4857406-4857437	32	MN010760	Gordonia phage Nubi, complete genome	34728-34759	8	0.75
CP027718_6	6.1\|4857406\|32\|CP027718\|CRISPRCasFinder	4857406-4857437	32	CP003957	Rhodococcus opacus PD630 plasmid 8, complete sequence	85746-85777	8	0.75
CP027718_6	6.1\|4857406\|32\|CP027718\|CRISPRCasFinder	4857406-4857437	32	NZ_CP020393	Burkholderia vietnamiensis strain FDAARGOS_239 plasmid unnamed, complete sequence	27812-27843	8	0.75
CP027718_6	6.1\|4857406\|32\|CP027718\|CRISPRCasFinder	4857406-4857437	32	NZ_CP009629	Burkholderia vietnamiensis LMG 10929 plasmid pBVB_1, complete sequence	52738-52769	8	0.75
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1020155-1020185	9	0.71
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	NZ_CP025548	Mycobacterium paragordonae strain 49061 plasmid unnamed2, complete sequence	89187-89217	9	0.71
CP027718_2	2.1\|973248\|31\|CP027718\|CRISPRCasFinder	973248-973278	31	NZ_CP015740	Shinella sp. HZN7 plasmid pShin-04, complete sequence	186782-186812	9	0.71
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NC_015184	Agrobacterium sp. H13-3 plasmid pAspH13-3a, complete sequence	146081-146111	9	0.71
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NZ_CP032923	Agrobacterium tumefaciens strain 1D1108 plasmid pAt1D1108a, complete sequence	53806-53836	9	0.71
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	MN694729	Marine virus AFVG_250M1111, complete genome	30630-30660	9	0.71
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	NC_014811	Mycolicibacterium gilvum Spyr1 plasmid pMSPYR101, complete sequence	26959-26990	9	0.719
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	NZ_CP032156	Mycobacterium sp. ELW1 plasmid pELW1-1, complete sequence	203845-203876	9	0.719
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	NC_004719	Streptomyces avermitilis MA-4680 = NBRC 14893 plasmid SAP1, complete sequence	9771-9802	9	0.719
CP027718_2	2.7\|973368\|32\|CP027718\|CRT	973368-973399	32	NZ_CP050084	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b2, complete sequence	160701-160732	9	0.719
CP027718_2	2.7\|973368\|32\|CP027718\|CRT	973368-973399	32	NZ_CP053209	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1A, complete sequence	65731-65762	9	0.719
CP027718_6	6.1\|4857406\|32\|CP027718\|CRISPRCasFinder	4857406-4857437	32	MN284907	Gordonia phage Fireball, complete genome	34848-34879	9	0.719
CP027718_6	6.1\|4857406\|32\|CP027718\|CRISPRCasFinder	4857406-4857437	32	MK524505	Gordonia phage Dogfish, complete genome	21138-21169	9	0.719
CP027718_6	6.1\|4857406\|32\|CP027718\|CRISPRCasFinder	4857406-4857437	32	MH669015	Gordonia phage TillyBobJoe, complete genome	34518-34549	9	0.719
CP027718_6	6.1\|4857406\|32\|CP027718\|CRISPRCasFinder	4857406-4857437	32	NC_031004	Gordonia phage Nyceirae, complete genome	21733-21764	9	0.719
CP027718_6	6.1\|4857406\|32\|CP027718\|CRISPRCasFinder	4857406-4857437	32	NZ_KY270855	Pseudomonas putida strain 12969 plasmid p12969-2, complete sequence	68547-68578	9	0.719
CP027718_6	6.1\|4857406\|32\|CP027718\|CRISPRCasFinder	4857406-4857437	32	NZ_CP041206	Rhizobium sp. NIBRBAC000502774 plasmid pMK-3, complete sequence	193401-193432	9	0.719
CP027718_6	6.1\|4857406\|32\|CP027718\|CRISPRCasFinder	4857406-4857437	32	NZ_CP022563	Pseudomonas monteilii strain B5 plasmid pSH5-1, complete sequence	107944-107975	9	0.719
CP027718_6	6.1\|4857406\|32\|CP027718\|CRISPRCasFinder	4857406-4857437	32	NC_009958	Dinoroseobacter shibae DFL 12 = DSM 16493 plasmid pDSHI04, complete sequence	13945-13976	9	0.719
CP027718_6	6.1\|4857406\|32\|CP027718\|CRISPRCasFinder	4857406-4857437	32	NC_009955	Dinoroseobacter shibae DFL 12 = DSM 16493 plasmid pDSHI01, complete sequence	86335-86366	9	0.719
CP027718_6	6.1\|4857406\|32\|CP027718\|CRISPRCasFinder	4857406-4857437	32	NC_009956	Dinoroseobacter shibae DFL 12 = DSM 16493 plasmid pDSHI02, complete sequence	100053-100084	9	0.719
CP027718_2	2.2\|973308\|32\|CP027718\|CRISPRCasFinder	973308-973339	32	NZ_LR594663	Variovorax sp. RA8 plasmid 2	8820-8851	10	0.688
CP027718_2	2.4\|973429\|31\|CP027718\|CRISPRCasFinder	973429-973459	31	NC_020060	Rhizobium tropici CIAT 899 plasmid pRtrCIAT899a, complete sequence	61091-61121	10	0.677
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	NZ_CP025548	Mycobacterium paragordonae strain 49061 plasmid unnamed2, complete sequence	89186-89217	10	0.688
CP027718_2	2.5\|973247\|32\|CP027718\|CRT	973247-973278	32	NZ_CP015740	Shinella sp. HZN7 plasmid pShin-04, complete sequence	186782-186813	10	0.688
CP027718_6	6.1\|4857406\|32\|CP027718\|CRISPRCasFinder	4857406-4857437	32	NZ_CP024907	Paraburkholderia caledonica strain PHRS4 plasmid pPHRS4, complete sequence	216630-216661	11	0.656

1. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP031228 (Pseudomonas amygdali pv. lachrymans str. M301315 plasmid pPla107-2) position: , mismatch: 1, identity: 0.968

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gccgggctttttggtttctgcaatctggcta	Protospacer
************************.******

2. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_KY362373 (Pseudomonas syringae pv. syringae strain 7B44 plasmid pPs7B44, complete sequence) position: , mismatch: 2, identity: 0.935

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgctatttggcta	Protospacer
** ****************** *********

3. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP041755 (Pseudomonas sp. KBS0707 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.935

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgctatttggcta	Protospacer
** ****************** *********

4. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP007015 (Pseudomonas syringae CC1557 plasmid pCC1557, complete sequence) position: , mismatch: 2, identity: 0.935

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgctatttggcta	Protospacer
** ****************** *********

5. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NC_019328 (Pseudomonas syringae plasmid pB76-81, complete sequence) position: , mismatch: 2, identity: 0.935

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgctatttggcta	Protospacer
** ****************** *********

6. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT222315 (Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf plasmid p58T3) position: , mismatch: 3, identity: 0.903

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgctatttggcta	Protospacer
 * ****************** *********

7. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT963397 (Pseudomonas cerasi isolate PL963 plasmid PP2, complete sequence) position: , mismatch: 3, identity: 0.903

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgctatttggcta	Protospacer
 * ****************** *********

8. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_KY362371 (Pseudomonas syringae pv. syringae strain UMAF1029 plasmid pPs1029, complete sequence) position: , mismatch: 3, identity: 0.903

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgctatttggcta	Protospacer
 * ****************** *********

9. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_KY362370 (Pseudomonas syringae pv. syringae strain UMAF0158 plasmid pPs0158, complete sequence) position: , mismatch: 3, identity: 0.903

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgctatttggcta	Protospacer
 * ****************** *********

10. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP005971 (Pseudomonas syringae UMAF0158 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgctatttggcta	Protospacer
 * ****************** *********

11. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to CP050261 (Pseudomonas coronafaciens strain X-1 plasmid unnamed1) position: , mismatch: 3, identity: 0.903

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgctatttggcta	Protospacer
 * ****************** *********

12. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to CP046442 (Pseudomonas coronafaciens pv. coronafaciens strain B19001 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgctatttggcta	Protospacer
 * ****************** *********

13. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP046036 (Pseudomonas coronafaciens pv. oryzae str. 1_6 plasmid pPor1_6, complete sequence) position: , mismatch: 3, identity: 0.903

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgctatttggcta	Protospacer
 * ****************** *********

14. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP034081 (Pseudomonas syringae pv. pisi str. PP1 plasmid pPP1-3, complete sequence) position: , mismatch: 3, identity: 0.903

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
accgggctttttggtttctgcattttggtta	Protospacer
.********************* *****.**

15. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT963403 (Pseudomonas syringae pv. avii isolate CFBP3846 plasmid PP1, complete sequence) position: , mismatch: 4, identity: 0.871

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcaatttgtgaa	Protospacer
** ************************   *

16. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP024714 (Pseudomonas syringae pv. actinidiae strain MAFF212063 plasmid pMAFF212063-B, complete sequence) position: , mismatch: 4, identity: 0.871

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcaatttgtgaa	Protospacer
** ************************   *

17. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT985191 (Pseudomonas syringae group genomosp. 3 strain CFBP 3800 plasmid PP2, complete sequence) position: , mismatch: 4, identity: 0.871

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcaatttgtgaa	Protospacer
** ************************   *

18. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NC_005919 (Pseudomonas syringae pv. maculicola strain ES4326 plasmid pPMA4326B, complete sequence) position: , mismatch: 4, identity: 0.871

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcaatttgtgaa	Protospacer
** ************************   *

19. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP047263 (Pseudomonas syringae pv. maculicola str. ES4326 plasmid pPma4326B, complete sequence) position: , mismatch: 4, identity: 0.871

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcaatttgtgaa	Protospacer
** ************************   *

20. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NC_007274 (Pseudomonas savastanoi pv. phaseolicola 1448A plasmid large, complete sequence) position: , mismatch: 4, identity: 0.871

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgctatttggc--	Protospacer
** ****************** *******

21. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP015640 (Pseudomonas lurida strain L228 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gccgggctttctggtttctgcaattccgtta	Protospacer
**********.**************. *.**

22. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NC_021361 (Pseudomonas fluorescens A506 plasmid pA506, complete sequence) position: , mismatch: 4, identity: 0.871

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gccgggctttttggtttctgcgattccgtta	Protospacer
*********************.***. *.**

23. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to NZ_CP054028 (Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence) position: , mismatch: 5, identity: 0.839

ggtggatctgcgcggcgaaggtcgccaccgg-	CRISPR spacer
gttggatctgcgcggcgaagatcg-cgccgtc	Protospacer
* ******************.*** *.***

24. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to NZ_CP013600 (Rhizobium sp. N741 plasmid pRspN741e, complete sequence) position: , mismatch: 5, identity: 0.839

ggtggatctgcgcggcgaaggtcgccaccgg-	CRISPR spacer
gctggatctgcgcggcgaagatcg-cgccgtc	Protospacer
* ******************.*** *.***

25. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to NZ_CP013504 (Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence) position: , mismatch: 5, identity: 0.839

ggtggatctgcgcggcgaaggtcgccaccgg-	CRISPR spacer
gctggatctgcgcggcgaagatcg-cgccgtc	Protospacer
* ******************.*** *.***

26. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to NZ_CP013510 (Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence) position: , mismatch: 5, identity: 0.839

ggtggatctgcgcggcgaaggtcgccaccgg-	CRISPR spacer
gctggatctgcgcggcgaagatcg-cgccgtc	Protospacer
* ******************.*** *.***

27. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to NZ_CP013521 (Rhizobium sp. N113 plasmid pRspN113d, complete sequence) position: , mismatch: 5, identity: 0.839

ggtggatctgcgcggcgaaggtcgccaccgg-	CRISPR spacer
gctggatctgcgcggcgaagatcg-cgccgtc	Protospacer
* ******************.*** *.***

28. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to NZ_CP013494 (Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence) position: , mismatch: 5, identity: 0.839

ggtggatctgcgcggcgaaggtcgccaccgg-	CRISPR spacer
gctggatctgcgcggcgaagatcg-cgccgtc	Protospacer
* ******************.*** *.***

29. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to NZ_CP013594 (Rhizobium sp. N871 plasmid pRspN871d, complete sequence) position: , mismatch: 5, identity: 0.839

ggtggatctgcgcggcgaaggtcgccaccgg-	CRISPR spacer
gctggatctgcgcggcgaagatcg-cgccgtc	Protospacer
* ******************.*** *.***

30. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT222314 (Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf plasmid p58T2, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gccgggctttttggtttctgcaattctagtt	Protospacer
*************************. . *

31. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT963399 (Pseudomonas cerasi isolate PL963 plasmid PP4, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gccgggctttttggtttctgcaattctagtt	Protospacer
*************************. . *

32. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT985212 (Pseudomonas syringae pv. cerasicola strain CFBP 6110 plasmid PP3, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gccgggctttttggtttctgcaattctagtt	Protospacer
*************************. . *

33. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP026557 (Pseudomonas amygdali pv. morsprunorum strain R15244 plasmid p1_tig4, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gccgggctttttggtttctgcaattctagtt	Protospacer
*************************. . *

34. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT985191 (Pseudomonas syringae group genomosp. 3 strain CFBP 3800 plasmid PP2, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcaattcgtgaa	Protospacer
** **********************.*   *

35. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT963394 (Pseudomonas syringae pv. cerasicola isolate CFBP6109 plasmid PP3, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gccgggctttttggtttctgcaattctagtt	Protospacer
*************************. . *

36. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NC_019265 (Pseudomonas savastanoi NCPPB 3335 native plasmid pPsv48A complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gccgggctttttggtttctgcaattctagtt	Protospacer
*************************. . *

37. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_FR820585 (Pseudomonas savastanoi pv. savastanoi strain NCPPB 3335 plasmid pPsv48A, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gccgggctttttggtttctgcaattctagtt	Protospacer
*************************. . *

38. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP032870 (Pseudomonas syringae pv. actinidiae strain P220 plasmid pLKQG722, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgcaatttgtgaa	Protospacer
 * ************************   *

39. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP032632 (Pseudomonas syringae pv. actinidiae str. Shaanxi_M228 plasmid pM228, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgcaatttgtgaa	Protospacer
 * ************************   *

40. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP011973 (Pseudomonas syringae pv. actinidiae ICMP 18884 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgcaatttgtgaa	Protospacer
 * ************************   *

41. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP012180 (Pseudomonas syringae pv. actinidiae ICMP 18708 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgcaatttgtgaa	Protospacer
 * ************************   *

42. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP018203 (Pseudomonas syringae pv. actinidiae ICMP 9853 plasmid p9853_A, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgcaatttgtgaa	Protospacer
 * ************************   *

43. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP019733 (Pseudomonas syringae pv. actinidiae strain CRAFRU 14.08 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgcaatttgtgaa	Protospacer
 * ************************   *

44. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP017010 (Pseudomonas syringae pv. actinidiae strain NZ-47 plasmid pPsa22180a, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgcaatttgtgaa	Protospacer
 * ************************   *

45. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP017008 (Pseudomonas syringae pv. actinidiae strain ICMP 20586 plasmid pPsa20586, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgcaatttgtgaa	Protospacer
 * ************************   *

46. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP019731 (Pseudomonas syringae pv. actinidiae strain CRAFRU 12.29 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgcaatttgtgaa	Protospacer
 * ************************   *

47. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT222316 (Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf plasmid p58T4) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcaattcgtgaa	Protospacer
** **********************.*   *

48. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT222317 (Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf plasmid p58T5, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcaattcgtgaa	Protospacer
** **********************.*   *

49. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT963407 (Pseudomonas syringae pv. avii isolate CFBP3846 plasmid PP5, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcaattcgtgaa	Protospacer
** **********************.*   *

50. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT963398 (Pseudomonas cerasi isolate PL963 plasmid PP3, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcaattcgtgaa	Protospacer
** **********************.*   *

51. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT963401 (Pseudomonas cerasi isolate PL963 plasmid PP6, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcaattcgtgaa	Protospacer
** **********************.*   *

52. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP015000 (Pseudomonas aeruginosa strain PA7790 plasmid pPA7790, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gccgggctttttggtttctgcgattctgttt	Protospacer
*********************.***. *.*

53. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP049162 (Pseudomonas aeruginosa strain MS14403 plasmid pMS14403A, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gccgggctttttggtttctgcgattctgttt	Protospacer
*********************.***. *.*

54. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT963410 (Pseudomonas syringae isolate CFBP3840 plasmid PP1, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcattttgtgaa	Protospacer
** ******************* ****   *

55. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_KY362366 (Pseudomonas amygdali pv. tabaci strain 0893-29 plasmid pPt0893-29, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcattttgtgaa	Protospacer
** ******************* ****   *

56. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP026561 (Pseudomonas amygdali pv. morsprunorum strain R15244 plasmid p4_tig6, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcaattcgtgaa	Protospacer
** **********************.*   *

57. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP019873 (Pseudomonas syringae pv. tomato strain B13-200 plasmid pB13-200B, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcaattcgtgaa	Protospacer
** **********************.*   *

58. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT222313 (Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf plasmid p58T1, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcaattcgtgaa	Protospacer
** **********************.*   *

59. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT222318 (Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf plasmid p58T6) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcaattcgtgaa	Protospacer
** **********************.*   *

60. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT963404 (Pseudomonas syringae pv. avii isolate CFBP3846 plasmid PP2, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcaattcgtgaa	Protospacer
** **********************.*   *

61. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT963405 (Pseudomonas syringae pv. avii isolate CFBP3846 plasmid PP3, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcaattcgtgaa	Protospacer
** **********************.*   *

62. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT963400 (Pseudomonas cerasi isolate PL963 plasmid PP5, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcaattcgtgaa	Protospacer
** **********************.*   *

63. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP025052 (Pseudomonas aeruginosa strain PB353 plasmid pPB353_1, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gccgggctttttggtttctgcgattctgttt	Protospacer
*********************.***. *.*

64. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NC_019292 (Pseudomonas savastanoi pv. savastanoi native plasmid pPsv48C complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcattttgtgaa	Protospacer
** ******************* ****   *

65. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NC_004633 (Pseudomonas syringae pv. tomato str. DC3000 plasmid pDC3000A, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcattttgtgaa	Protospacer
** ******************* ****   *

66. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NC_004632 (Pseudomonas syringae pv. tomato str. DC3000 plasmid pDC3000B, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcaattcgtgaa	Protospacer
** **********************.*   *

67. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP027175 (Pseudomonas aeruginosa strain AR_0230 plasmid unnamed1) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gccgggctttttggtttctgcgattctgttt	Protospacer
*********************.***. *.*

68. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to LT985194 (Pseudomonas syringae strain CFBP 2116 genome assembly, plasmid: PP3) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcattttgtgaa	Protospacer
** ******************* ****   *

69. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to LT985195 (Pseudomonas syringae strain CFBP 2116 genome assembly, plasmid: PP4) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcattttgtgaa	Protospacer
** ******************* ****   *

70. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT963411 (Pseudomonas syringae isolate CFBP3840 plasmid PP2, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcaattcgtgaa	Protospacer
** **********************.*   *

71. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT963412 (Pseudomonas syringae isolate CFBP3840 plasmid PP3, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcaattcgtgaa	Protospacer
** **********************.*   *

72. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP026564 (Pseudomonas avellanae strain R2leaf plasmid p2_tig5, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcaattcgtgaa	Protospacer
** **********************.*   *

73. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NC_022437 (Pseudomonas fluorescens R124 plasmid pMP-R124, complete sequence) position: , mismatch: 5, identity: 0.839

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gccgggctttttggtttctacgattccgtta	Protospacer
*******************.*.***. *.**

74. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to NC_009717 (Xanthobacter autotrophicus Py2 plasmid pXAUT01, complete sequence) position: , mismatch: 6, identity: 0.806

ggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
ggaagatctgcggcgcgaaggtcgccaccac	Protospacer
** .********  ***************.

75. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to ASHF01000034 (Streptomyces sp. GBA 94-10 plasmid pGBA1, complete sequence, whole genome shotgun sequence) position: , mismatch: 6, identity: 0.806

ggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
gcgggtgctgcgcggcgacggtcgccaccag	Protospacer
*  **  *********** **********.*

76. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to NZ_CP018229 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

--ggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
ccgctg--ttcgcgcggcgatggtcgccaccgg	Protospacer
  * **  *..********* ************

77. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to NZ_CP016287 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

--ggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
ccgctg--ttcgcgcggcgatggtcgccaccgg	Protospacer
  * **  *..********* ************

78. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to NZ_CP048281 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248e, complete sequence) position: , mismatch: 6, identity: 0.806

--ggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
ccgctg--ttcgcgcggcgatggtcgccaccgg	Protospacer
  * **  *..********* ************

79. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to NZ_CP020911 (Rhizobium etli strain NXC12 plasmid pRetNXC12e, complete sequence) position: , mismatch: 6, identity: 0.806

ggtggatctgcgcggcgaaggtcgccaccgg-	CRISPR spacer
gctgaatctgcgcggcgaagatcg-cgccgtc	Protospacer
* **.***************.*** *.***

80. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to NZ_CP021033 (Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence) position: , mismatch: 6, identity: 0.806

ggtggatctgcgcggcgaaggt--cgccaccgg	CRISPR spacer
gctggatctgcgcggcgaagattgcgccgtc--	Protospacer
* ******************.*  ****..*

81. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to NZ_CP021029 (Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence) position: , mismatch: 6, identity: 0.806

ggtggatctgcgcggcgaaggt--cgccaccgg	CRISPR spacer
gctggatctgcgcggcgaagattgcgccgtc--	Protospacer
* ******************.*  ****..*

82. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to NZ_CP013526 (Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence) position: , mismatch: 6, identity: 0.806

ggtggatctgcgcggcgaaggtcgccaccgg-	CRISPR spacer
gctggatctgcgccgcgaagatcg-cgccgtc	Protospacer
* *********** ******.*** *.***

83. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to NZ_CP013556 (Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence) position: , mismatch: 6, identity: 0.806

ggtggatctgcgcggcgaaggtcgccaccgg-	CRISPR spacer
gctggatctgcgccgcgaagatcg-cgccgtc	Protospacer
* *********** ******.*** *.***

84. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to NZ_CP013562 (Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence) position: , mismatch: 6, identity: 0.806

ggtggatctgcgcggcgaaggtcgccaccgg-	CRISPR spacer
gctggatctgcgccgcgaagatcg-cgccgtc	Protospacer
* *********** ******.*** *.***

85. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to NZ_CP013567 (Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence) position: , mismatch: 6, identity: 0.806

ggtggatctgcgcggcgaaggtcgccaccgg-	CRISPR spacer
gctggatctgcgccgcgaagatcg-cgccgtc	Protospacer
* *********** ******.*** *.***

86. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to NZ_CP013515 (Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence) position: , mismatch: 6, identity: 0.806

ggtggatctgcgcggcgaaggt--cgccaccgg	CRISPR spacer
gctggatctgcgcggcgaagattgcgccgtc--	Protospacer
* ******************.*  ****..*

87. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to NZ_CP013605 (Rhizobium sp. N731 plasmid pRspN731d, complete sequence) position: , mismatch: 6, identity: 0.806

ggtggatctgcgcggcgaaggt--cgccaccgg	CRISPR spacer
gctggatctgcgcggcgaagattgcgccgtc--	Protospacer
* ******************.*  ****..*

88. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to NZ_CP022568 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK04, complete sequence) position: , mismatch: 6, identity: 0.806

ggtggatctgcgcggcgaaggtcgccaccgg-	CRISPR spacer
gctggatctgggcggcgaagatcg-cgccgtc	Protospacer
* ******** *********.*** *.***

89. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT222315 (Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf plasmid p58T3) position: , mismatch: 6, identity: 0.806

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcgattcgtgaa	Protospacer
** ******************.***.*   *

90. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT963397 (Pseudomonas cerasi isolate PL963 plasmid PP2, complete sequence) position: , mismatch: 6, identity: 0.806

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcgattcgtgaa	Protospacer
** ******************.***.*   *

91. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP045801 (Pseudomonas syringae USA011 plasmid pUSA011-2, complete sequence) position: , mismatch: 6, identity: 0.806

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gccgggctttttggtttctgcatttctagtt	Protospacer
********************** **. . *

92. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT963410 (Pseudomonas syringae isolate CFBP3840 plasmid PP1, complete sequence) position: , mismatch: 6, identity: 0.806

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcgattcgtgaa	Protospacer
** ******************.***.*   *

93. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT963405 (Pseudomonas syringae pv. avii isolate CFBP3846 plasmid PP3, complete sequence) position: , mismatch: 6, identity: 0.806

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcgattcgtgaa	Protospacer
** ******************.***.*   *

94. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NC_019292 (Pseudomonas savastanoi pv. savastanoi native plasmid pPsv48C complete sequence) position: , mismatch: 6, identity: 0.806

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcgattcgtgaa	Protospacer
** ******************.***.*   *

95. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP041756 (Pseudomonas sp. KBS0707 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.806

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgcaattcaagta	Protospacer
 * **********************... **

96. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP006257 (Pseudomonas syringae pv. syringae HS191 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.806

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgcaattcaagta	Protospacer
 * **********************... **

97. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT963392 (Pseudomonas syringae pv. cerasicola isolate CFBP6109 plasmid PP1, complete sequence) position: , mismatch: 6, identity: 0.806

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcgattcgtgaa	Protospacer
** ******************.***.*   *

98. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT963392 (Pseudomonas syringae pv. cerasicola isolate CFBP6109 plasmid PP1, complete sequence) position: , mismatch: 6, identity: 0.806

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcgattcgtgaa	Protospacer
** ******************.***.*   *

99. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT963393 (Pseudomonas syringae pv. cerasicola isolate CFBP6109 plasmid PP2, complete sequence) position: , mismatch: 6, identity: 0.806

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcgattcgtgaa	Protospacer
** ******************.***.*   *

100. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT985210 (Pseudomonas syringae pv. cerasicola strain CFBP 6110 plasmid PP1, complete sequence) position: , mismatch: 6, identity: 0.806

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcgattcgtgaa	Protospacer
** ******************.***.*   *

101. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT985210 (Pseudomonas syringae pv. cerasicola strain CFBP 6110 plasmid PP1, complete sequence) position: , mismatch: 6, identity: 0.806

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcgattcgtgaa	Protospacer
** ******************.***.*   *

102. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT985211 (Pseudomonas syringae pv. cerasicola strain CFBP 6110 plasmid PP2, complete sequence) position: , mismatch: 6, identity: 0.806

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcgattcgtgaa	Protospacer
** ******************.***.*   *

103. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP026563 (Pseudomonas avellanae strain R2leaf plasmid p1_tig4, complete sequence) position: , mismatch: 6, identity: 0.806

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgctattcgtgaa	Protospacer
** ****************** ***.*   *

104. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP026566 (Pseudomonas avellanae strain R2leaf plasmid p4_tig8, complete sequence) position: , mismatch: 6, identity: 0.806

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcgattcgtgaa	Protospacer
** ******************.***.*   *

105. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NC_002759 (Pseudomonas syringae pv. maculicola str. M6 plasmid pFKN, complete sequence) position: , mismatch: 6, identity: 0.806

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcgattcgtgaa	Protospacer
** ******************.***.*   *

106. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT985190 (Pseudomonas syringae group genomosp. 3 strain CFBP 3800 plasmid PP1, complete sequence) position: , mismatch: 6, identity: 0.806

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcgattcgtgaa	Protospacer
** ******************.***.*   *

107. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP018204 (Pseudomonas syringae pv. actinidiae ICMP 9853 plasmid p9853_B, complete sequence) position: , mismatch: 6, identity: 0.806

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcgattcgtgaa	Protospacer
** ******************.***.*   *

108. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP031227 (Pseudomonas amygdali pv. lachrymans str. M301315 plasmid pPla107-1, complete sequence) position: , mismatch: 6, identity: 0.806

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcgattcgtgaa	Protospacer
** ******************.***.*   *

109. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP034079 (Pseudomonas syringae pv. pisi str. PP1 plasmid pPP1-1, complete sequence) position: , mismatch: 6, identity: 0.806

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcgattcgtgaa	Protospacer
** ******************.***.*   *

110. spacer 2.5|973247|32|CP027718|CRT matches to NZ_CP013600 (Rhizobium sp. N741 plasmid pRspN741e, complete sequence) position: , mismatch: 6, identity: 0.812

tggtggatctgcgcggcgaaggtcgccaccgg-	CRISPR spacer
ggctggatctgcgcggcgaagatcg-cgccgtc	Protospacer
 * ******************.*** *.***

111. spacer 2.5|973247|32|CP027718|CRT matches to NZ_CP013504 (Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence) position: , mismatch: 6, identity: 0.812

tggtggatctgcgcggcgaaggtcgccaccgg-	CRISPR spacer
ggctggatctgcgcggcgaagatcg-cgccgtc	Protospacer
 * ******************.*** *.***

112. spacer 2.5|973247|32|CP027718|CRT matches to NZ_CP013510 (Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence) position: , mismatch: 6, identity: 0.812

tggtggatctgcgcggcgaaggtcgccaccgg-	CRISPR spacer
ggctggatctgcgcggcgaagatcg-cgccgtc	Protospacer
 * ******************.*** *.***

113. spacer 2.5|973247|32|CP027718|CRT matches to NZ_CP013521 (Rhizobium sp. N113 plasmid pRspN113d, complete sequence) position: , mismatch: 6, identity: 0.812

tggtggatctgcgcggcgaaggtcgccaccgg-	CRISPR spacer
ggctggatctgcgcggcgaagatcg-cgccgtc	Protospacer
 * ******************.*** *.***

114. spacer 2.5|973247|32|CP027718|CRT matches to NZ_CP013494 (Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence) position: , mismatch: 6, identity: 0.812

tggtggatctgcgcggcgaaggtcgccaccgg-	CRISPR spacer
ggctggatctgcgcggcgaagatcg-cgccgtc	Protospacer
 * ******************.*** *.***

115. spacer 2.5|973247|32|CP027718|CRT matches to NZ_CP054028 (Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence) position: , mismatch: 6, identity: 0.812

tggtggatctgcgcggcgaaggtcgccaccgg-	CRISPR spacer
ggttggatctgcgcggcgaagatcg-cgccgtc	Protospacer
 * ******************.*** *.***

116. spacer 2.5|973247|32|CP027718|CRT matches to NZ_CP013594 (Rhizobium sp. N871 plasmid pRspN871d, complete sequence) position: , mismatch: 6, identity: 0.812

tggtggatctgcgcggcgaaggtcgccaccgg-	CRISPR spacer
ggctggatctgcgcggcgaagatcg-cgccgtc	Protospacer
 * ******************.*** *.***

117. spacer 2.5|973247|32|CP027718|CRT matches to NZ_CP038146 (Streptomyces sp. S501 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

tggtggatctgcgcggcgaaggt-cgccaccgg	CRISPR spacer
tggtggatctgagcggcgagggtacggagccg-	Protospacer
*********** *******.*** **  .***

118. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to KU716095 (Mycobacterium phage Myxus, complete genome) position: , mismatch: 7, identity: 0.774

ggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
cgtggatctgcgcggcgatggccgcgaaggc	Protospacer
 ***************** **.*** *  *

119. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to MK061409 (Mycobacterium phage ExplosioNervosa, complete genome) position: , mismatch: 7, identity: 0.774

ggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
cgtggatctgcgcggcgatggccgcgaaggc	Protospacer
 ***************** **.*** *  *

120. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to MG872842 (Mycobacterium phage Scherzo, complete genome) position: , mismatch: 7, identity: 0.774

ggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
cgtggatctgcgcggcgatggccgcgaaggc	Protospacer
 ***************** **.*** *  *

121. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to MK559428 (Mycobacterium phage Elephantoon, complete genome) position: , mismatch: 7, identity: 0.774

ggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
agtggatctgcgcggcgatggccgcgaaggc	Protospacer
.***************** **.*** *  *

122. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to KX585252 (Mycobacterium phage HortumSL17, complete genome) position: , mismatch: 7, identity: 0.774

ggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
cgtggatctgcgcggcgatggccgcgaaggc	Protospacer
 ***************** **.*** *  *

123. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to MN369741 (Mycobacterium phage LoneWolf, complete genome) position: , mismatch: 7, identity: 0.774

ggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
agtggatctgcgcggcgatggccgcgaaggc	Protospacer
.***************** **.*** *  *

124. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to KT285706 (Mycobacterium phage Pioneer, complete genome) position: , mismatch: 7, identity: 0.774

ggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
cgtggatctgcgcggcgatggccgcgaaggc	Protospacer
 ***************** **.*** *  *

125. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to MK977713 (Mycobacterium phage Tubs, complete genome) position: , mismatch: 7, identity: 0.774

ggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
cgtggatctgcgcggcgatggccgcgaaggc	Protospacer
 ***************** **.*** *  *

126. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to MN369763 (Mycobacterium phage Aliter, complete genome) position: , mismatch: 7, identity: 0.774

ggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
cgtggatctgcgcggcgatggccgcgaaggc	Protospacer
 ***************** **.*** *  *

127. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to MG872835 (Mycobacterium phage Conquerage, complete genome) position: , mismatch: 7, identity: 0.774

ggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
cgtggatctgcgcggcgatggccgcgaaggc	Protospacer
 ***************** **.*** *  *

128. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to MK524489 (Mycobacterium phage Ugenie5, complete genome) position: , mismatch: 7, identity: 0.774

ggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
cgtggatctgcgcggcgatggccgcgaaggc	Protospacer
 ***************** **.*** *  *

129. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to KX664447 (Mycobacterium phage Phaeder, complete genome) position: , mismatch: 7, identity: 0.774

ggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
cgtggatctgcgcggcgatggccgcgaaggc	Protospacer
 ***************** **.*** *  *

130. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to MN585978 (Mycobacterium phage Beemo, complete genome) position: , mismatch: 7, identity: 0.774

ggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
cgtggatctgcgcggcgatggccgcgaaggc	Protospacer
 ***************** **.*** *  *

131. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to KU613353 (Mycobacterium phage Catalina, complete genome) position: , mismatch: 7, identity: 0.774

ggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
cgtggatctgcgcggcgatggccgcgaaggc	Protospacer
 ***************** **.*** *  *

132. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to MG872840 (Mycobacterium phage Phonnegut, complete genome) position: , mismatch: 7, identity: 0.774

ggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
cgtggatctgcgcggcgatggccgcgaaggc	Protospacer
 ***************** **.*** *  *

133. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to NC_042314 (Mycobacterium virus PackMan, complete genome) position: , mismatch: 7, identity: 0.774

ggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
cgtggatctgcgcggcgatggccgcgaaggc	Protospacer
 ***************** **.*** *  *

134. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to KX685355 (Mycobacterium phage Qobbit, complete genome) position: , mismatch: 7, identity: 0.774

ggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
cgtggatctgcgcggcgatggccgcgaaggc	Protospacer
 ***************** **.*** *  *

135. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT222315 (Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf plasmid p58T3) position: , mismatch: 7, identity: 0.774

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
agcgggctttttggtttctgcgattcgtgaa	Protospacer
. *******************.***.*   *

136. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to LT985195 (Pseudomonas syringae strain CFBP 2116 genome assembly, plasmid: PP4) position: , mismatch: 7, identity: 0.774

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgcgattcgtgaa	Protospacer
 * ******************.***.*   *

137. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP019874 (Pseudomonas syringae pv. tomato strain B13-200 plasmid pB13-200C, complete sequence) position: , mismatch: 7, identity: 0.774

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcgattcatgaa	Protospacer
** ******************.***..   *

138. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT963392 (Pseudomonas syringae pv. cerasicola isolate CFBP6109 plasmid PP1, complete sequence) position: , mismatch: 7, identity: 0.774

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgcgattcgtgaa	Protospacer
 * ******************.***.*   *

139. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NC_019334 (Pseudomonas syringae plasmid pPT14-32, complete sequence) position: , mismatch: 7, identity: 0.774

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gccgggctttctggtttctgctattccaatt	Protospacer
**********.********** ***. . *

140. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT985210 (Pseudomonas syringae pv. cerasicola strain CFBP 6110 plasmid PP1, complete sequence) position: , mismatch: 7, identity: 0.774

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgcgattcgtgaa	Protospacer
 * ******************.***.*   *

141. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT985190 (Pseudomonas syringae group genomosp. 3 strain CFBP 3800 plasmid PP1, complete sequence) position: , mismatch: 7, identity: 0.774

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgcgattcgtgaa	Protospacer
 * ******************.***.*   *

142. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NC_007275 (Pseudomonas savastanoi pv. phaseolicola 1448A plasmid small, complete sequence) position: , mismatch: 7, identity: 0.774

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
gcggggctttttggtttctgcgattcgtg--	Protospacer
** ******************.***.*

143. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP026560 (Pseudomonas amygdali pv. morsprunorum strain R15244 plasmid p3_tig5, complete sequence) position: , mismatch: 7, identity: 0.774

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgcgattcgtgaa	Protospacer
 * ******************.***.*   *

144. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to LT985193 (Pseudomonas syringae strain CFBP 2116 genome assembly, plasmid: PP2) position: , mismatch: 7, identity: 0.774

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgcgattcgtgaa	Protospacer
 * ******************.***.*   *

145. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT963413 (Pseudomonas syringae isolate CFBP3840 plasmid PP4, complete sequence) position: , mismatch: 7, identity: 0.774

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgcgattcgtgaa	Protospacer
 * ******************.***.*   *

146. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP026565 (Pseudomonas avellanae strain R2leaf plasmid p3_tig6, complete sequence) position: , mismatch: 7, identity: 0.774

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgcgattcgtgaa	Protospacer
 * ******************.***.*   *

147. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_KY362367 (Pseudomonas coronafaciens pv. garcae strain 2708 plasmid pPg2708, complete sequence) position: , mismatch: 7, identity: 0.774

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgcgattcgtgaa	Protospacer
 * ******************.***.*   *

148. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP026559 (Pseudomonas amygdali pv. morsprunorum strain R15244 plasmid p2_tig3, complete sequence) position: , mismatch: 7, identity: 0.774

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgcgattcgtgaa	Protospacer
 * ******************.***.*   *

149. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_LT963406 (Pseudomonas syringae pv. avii isolate CFBP3846 plasmid PP4, complete sequence) position: , mismatch: 7, identity: 0.774

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgcgattcgtgaa	Protospacer
 * ******************.***.*   *

150. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to CP046443 (Pseudomonas coronafaciens pv. coronafaciens strain B19001 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgcgattcgtgaa	Protospacer
 * ******************.***.*   *

151. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NC_019266 (Pseudomonas savastanoi NCPPB 3335 native plasmid pPsv48B complete sequence) position: , mismatch: 7, identity: 0.774

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgcgattcgtgaa	Protospacer
 * ******************.***.*   *

152. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP034080 (Pseudomonas syringae pv. pisi str. PP1 plasmid pPP1-2, complete sequence) position: , mismatch: 7, identity: 0.774

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgcgattcgtgaa	Protospacer
 * ******************.***.*   *

153. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NC_005918 (Pseudomonas syringae pv. maculicola strain ES4326 plasmid pPMA4326A, complete sequence) position: , mismatch: 7, identity: 0.774

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgcgattcgtgaa	Protospacer
 * ******************.***.*   *

154. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP047262 (Pseudomonas syringae pv. maculicola str. ES4326 plasmid pPma4326A, complete sequence) position: , mismatch: 7, identity: 0.774

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
ccggggctttttggtttctgcgattcgtgaa	Protospacer
 * ******************.***.*   *

155. spacer 2.5|973247|32|CP027718|CRT matches to NC_009717 (Xanthobacter autotrophicus Py2 plasmid pXAUT01, complete sequence) position: , mismatch: 7, identity: 0.781

tggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
gggaagatctgcggcgcgaaggtcgccaccac	Protospacer
 ** .********  ***************.

156. spacer 2.5|973247|32|CP027718|CRT matches to NZ_LR536451 (Methylocella tundrae isolate MTUNDRAET4 annotated genome plasmid 2) position: , mismatch: 7, identity: 0.781

tggtgg-atctgcgcggcgaaggtcgccaccgg	CRISPR spacer
-gacggcttctacgcggccaaggtcgccaccgc	Protospacer
 *..**  ***.****** *************

157. spacer 2.5|973247|32|CP027718|CRT matches to NZ_CP021033 (Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence) position: , mismatch: 7, identity: 0.781

tggtggatctgcgcggcgaaggt--cgccaccgg	CRISPR spacer
ggctggatctgcgcggcgaagattgcgccgtc--	Protospacer
 * ******************.*  ****..*

158. spacer 2.5|973247|32|CP027718|CRT matches to NZ_CP021029 (Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence) position: , mismatch: 7, identity: 0.781

tggtggatctgcgcggcgaaggt--cgccaccgg	CRISPR spacer
ggctggatctgcgcggcgaagattgcgccgtc--	Protospacer
 * ******************.*  ****..*

159. spacer 2.5|973247|32|CP027718|CRT matches to NZ_CP013526 (Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence) position: , mismatch: 7, identity: 0.781

tggtggatctgcgcggcgaaggtcgccaccgg-	CRISPR spacer
ggctggatctgcgccgcgaagatcg-cgccgtc	Protospacer
 * *********** ******.*** *.***

160. spacer 2.5|973247|32|CP027718|CRT matches to NZ_CP013556 (Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence) position: , mismatch: 7, identity: 0.781

tggtggatctgcgcggcgaaggtcgccaccgg-	CRISPR spacer
ggctggatctgcgccgcgaagatcg-cgccgtc	Protospacer
 * *********** ******.*** *.***

161. spacer 2.5|973247|32|CP027718|CRT matches to NZ_CP020911 (Rhizobium etli strain NXC12 plasmid pRetNXC12e, complete sequence) position: , mismatch: 7, identity: 0.781

tggtggatctgcgcggcgaaggtcgccaccgg-	CRISPR spacer
ggctgaatctgcgcggcgaagatcg-cgccgtc	Protospacer
 * **.***************.*** *.***

162. spacer 2.5|973247|32|CP027718|CRT matches to NZ_CP013562 (Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence) position: , mismatch: 7, identity: 0.781

tggtggatctgcgcggcgaaggtcgccaccgg-	CRISPR spacer
ggctggatctgcgccgcgaagatcg-cgccgtc	Protospacer
 * *********** ******.*** *.***

163. spacer 2.5|973247|32|CP027718|CRT matches to NZ_CP013567 (Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence) position: , mismatch: 7, identity: 0.781

tggtggatctgcgcggcgaaggtcgccaccgg-	CRISPR spacer
ggctggatctgcgccgcgaagatcg-cgccgtc	Protospacer
 * *********** ******.*** *.***

164. spacer 2.5|973247|32|CP027718|CRT matches to NZ_CP013515 (Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence) position: , mismatch: 7, identity: 0.781

tggtggatctgcgcggcgaaggt--cgccaccgg	CRISPR spacer
ggctggatctgcgcggcgaagattgcgccgtc--	Protospacer
 * ******************.*  ****..*

165. spacer 2.5|973247|32|CP027718|CRT matches to NZ_CP013605 (Rhizobium sp. N731 plasmid pRspN731d, complete sequence) position: , mismatch: 7, identity: 0.781

tggtggatctgcgcggcgaaggt--cgccaccgg	CRISPR spacer
ggctggatctgcgcggcgaagattgcgccgtc--	Protospacer
 * ******************.*  ****..*

166. spacer 2.5|973247|32|CP027718|CRT matches to NZ_CP022568 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK04, complete sequence) position: , mismatch: 7, identity: 0.781

tggtggatctgcgcggcgaaggtcgccaccgg-	CRISPR spacer
ggctggatctgggcggcgaagatcg-cgccgtc	Protospacer
 * ******** *********.*** *.***

167. spacer 6.1|4857406|32|CP027718|CRISPRCasFinder matches to NC_002147 (Agrobacterium tumefaciens MAFF301001 plasmid pTi-SAKURA, complete sequence) position: , mismatch: 7, identity: 0.781

gacagcgagcagttccgcaacggcggtgtttt	CRISPR spacer
cagtgcaagcagttccgcaacggcggtgtcga	Protospacer
 *  **.**********************.

168. spacer 6.1|4857406|32|CP027718|CRISPRCasFinder matches to NZ_MK439386 (Agrobacterium tumefaciens strain T37 plasmid pTiT37, complete sequence) position: , mismatch: 7, identity: 0.781

gacagcgagcagttccgcaacggcggtgtttt	CRISPR spacer
cagtgcaagcagttccgcaacggcggtgtcga	Protospacer
 *  **.**********************.

169. spacer 6.1|4857406|32|CP027718|CRISPRCasFinder matches to NZ_KY000041 (Agrobacterium tumefaciens strain CFBP296 plasmid pTi_CFBP296, complete sequence) position: , mismatch: 7, identity: 0.781

gacagcgagcagttccgcaacggcggtgtttt	CRISPR spacer
cagtgcaagcagttccgcaacggcggtgtcga	Protospacer
 *  **.**********************.

170. spacer 6.1|4857406|32|CP027718|CRISPRCasFinder matches to NZ_KY000044 (Agrobacterium fabrum strain CFBP1933 plasmid pTi_CFBP1933, complete sequence) position: , mismatch: 7, identity: 0.781

gacagcgagcagttccgcaacggcggtgtttt	CRISPR spacer
cagtgcaagcagttccgcaacggcggtgtcga	Protospacer
 *  **.**********************.

171. spacer 6.1|4857406|32|CP027718|CRISPRCasFinder matches to NZ_KY000057 (Agrobacterium fabrum strain CFBP5505 plasmid pTi_CFBP5505, complete sequence) position: , mismatch: 7, identity: 0.781

gacagcgagcagttccgcaacggcggtgtttt	CRISPR spacer
cagtgcaagcagttccgcaacggcggtgtcga	Protospacer
 *  **.**********************.

172. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to NC_014811 (Mycolicibacterium gilvum Spyr1 plasmid pMSPYR101, complete sequence) position: , mismatch: 8, identity: 0.742

ggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
tgtggatcggcgcggcgatggtcgccgggtt	Protospacer
 ******* ********* *******.

173. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to NZ_CP032156 (Mycobacterium sp. ELW1 plasmid pELW1-1, complete sequence) position: , mismatch: 8, identity: 0.742

ggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
tgtggatcggcgcggcgatggtcgccgggtt	Protospacer
 ******* ********* *******.

174. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to NZ_LR536451 (Methylocella tundrae isolate MTUNDRAET4 annotated genome plasmid 2) position: , mismatch: 8, identity: 0.742

ggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
acggcttctacgcggccaaggtcgccaccgc	Protospacer
.  *  ***.****** *************

175. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to KC170282 (Uncultured bacterium plasmid pMBUI6, complete sequence) position: , mismatch: 8, identity: 0.742

ggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
tgtggatctgcgcggccaagctcggaaaggc	Protospacer
 *************** *** ***  *  *

176. spacer 2.3|973369|31|CP027718|CRISPRCasFinder matches to NZ_CP050084 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b2, complete sequence) position: , mismatch: 8, identity: 0.742

gtttgggcttacgtcacggatgcccagggta	CRISPR spacer
cttgcctattacgtcaccgatgcgcagggta	Protospacer
 **     ********* ***** *******

177. spacer 2.3|973369|31|CP027718|CRISPRCasFinder matches to NZ_CP053209 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1A, complete sequence) position: , mismatch: 8, identity: 0.742

gtttgggcttacgtcacggatgcccagggta	CRISPR spacer
cttgcctattacgtcaccgatgcgcagggta	Protospacer
 **     ********* ***** *******

178. spacer 2.5|973247|32|CP027718|CRT matches to KU716095 (Mycobacterium phage Myxus, complete genome) position: , mismatch: 8, identity: 0.75

tggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
gcgtggatctgcgcggcgatggccgcgaaggc	Protospacer
  ***************** **.*** *  *

179. spacer 2.5|973247|32|CP027718|CRT matches to MK061409 (Mycobacterium phage ExplosioNervosa, complete genome) position: , mismatch: 8, identity: 0.75

tggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
gcgtggatctgcgcggcgatggccgcgaaggc	Protospacer
  ***************** **.*** *  *

180. spacer 2.5|973247|32|CP027718|CRT matches to MG872842 (Mycobacterium phage Scherzo, complete genome) position: , mismatch: 8, identity: 0.75

tggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
gcgtggatctgcgcggcgatggccgcgaaggc	Protospacer
  ***************** **.*** *  *

181. spacer 2.5|973247|32|CP027718|CRT matches to MK559428 (Mycobacterium phage Elephantoon, complete genome) position: , mismatch: 8, identity: 0.75

tggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
gagtggatctgcgcggcgatggccgcgaaggc	Protospacer
 .***************** **.*** *  *

182. spacer 2.5|973247|32|CP027718|CRT matches to KX585252 (Mycobacterium phage HortumSL17, complete genome) position: , mismatch: 8, identity: 0.75

tggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
gcgtggatctgcgcggcgatggccgcgaaggc	Protospacer
  ***************** **.*** *  *

183. spacer 2.5|973247|32|CP027718|CRT matches to MN369741 (Mycobacterium phage LoneWolf, complete genome) position: , mismatch: 8, identity: 0.75

tggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
gagtggatctgcgcggcgatggccgcgaaggc	Protospacer
 .***************** **.*** *  *

184. spacer 2.5|973247|32|CP027718|CRT matches to KT285706 (Mycobacterium phage Pioneer, complete genome) position: , mismatch: 8, identity: 0.75

tggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
gcgtggatctgcgcggcgatggccgcgaaggc	Protospacer
  ***************** **.*** *  *

185. spacer 2.5|973247|32|CP027718|CRT matches to MK977713 (Mycobacterium phage Tubs, complete genome) position: , mismatch: 8, identity: 0.75

tggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
gcgtggatctgcgcggcgatggccgcgaaggc	Protospacer
  ***************** **.*** *  *

186. spacer 2.5|973247|32|CP027718|CRT matches to MN369763 (Mycobacterium phage Aliter, complete genome) position: , mismatch: 8, identity: 0.75

tggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
gcgtggatctgcgcggcgatggccgcgaaggc	Protospacer
  ***************** **.*** *  *

187. spacer 2.5|973247|32|CP027718|CRT matches to MG872835 (Mycobacterium phage Conquerage, complete genome) position: , mismatch: 8, identity: 0.75

tggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
gcgtggatctgcgcggcgatggccgcgaaggc	Protospacer
  ***************** **.*** *  *

188. spacer 2.5|973247|32|CP027718|CRT matches to MK524489 (Mycobacterium phage Ugenie5, complete genome) position: , mismatch: 8, identity: 0.75

tggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
gcgtggatctgcgcggcgatggccgcgaaggc	Protospacer
  ***************** **.*** *  *

189. spacer 2.5|973247|32|CP027718|CRT matches to KX664447 (Mycobacterium phage Phaeder, complete genome) position: , mismatch: 8, identity: 0.75

tggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
gcgtggatctgcgcggcgatggccgcgaaggc	Protospacer
  ***************** **.*** *  *

190. spacer 2.5|973247|32|CP027718|CRT matches to MN585978 (Mycobacterium phage Beemo, complete genome) position: , mismatch: 8, identity: 0.75

tggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
gcgtggatctgcgcggcgatggccgcgaaggc	Protospacer
  ***************** **.*** *  *

191. spacer 2.5|973247|32|CP027718|CRT matches to KU613353 (Mycobacterium phage Catalina, complete genome) position: , mismatch: 8, identity: 0.75

tggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
gcgtggatctgcgcggcgatggccgcgaaggc	Protospacer
  ***************** **.*** *  *

192. spacer 2.5|973247|32|CP027718|CRT matches to MG872840 (Mycobacterium phage Phonnegut, complete genome) position: , mismatch: 8, identity: 0.75

tggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
gcgtggatctgcgcggcgatggccgcgaaggc	Protospacer
  ***************** **.*** *  *

193. spacer 2.5|973247|32|CP027718|CRT matches to NC_042314 (Mycobacterium virus PackMan, complete genome) position: , mismatch: 8, identity: 0.75

tggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
gcgtggatctgcgcggcgatggccgcgaaggc	Protospacer
  ***************** **.*** *  *

194. spacer 2.5|973247|32|CP027718|CRT matches to KX685355 (Mycobacterium phage Qobbit, complete genome) position: , mismatch: 8, identity: 0.75

tggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
gcgtggatctgcgcggcgatggccgcgaaggc	Protospacer
  ***************** **.*** *  *

195. spacer 2.5|973247|32|CP027718|CRT matches to KC170282 (Uncultured bacterium plasmid pMBUI6, complete sequence) position: , mismatch: 8, identity: 0.75

tggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
ttgtggatctgcgcggccaagctcggaaaggc	Protospacer
* *************** *** ***  *  *

196. spacer 6.1|4857406|32|CP027718|CRISPRCasFinder matches to MK864265 (Gordonia phage Barb, complete genome) position: , mismatch: 8, identity: 0.75

gacagcgagcagttccgcaacggcggtgtttt	CRISPR spacer
ggcagcgagaagttccgcaacggcggccaacg	Protospacer
*.******* ****************.   .

197. spacer 6.1|4857406|32|CP027718|CRISPRCasFinder matches to MK864266 (Gordonia phage Arri, complete genome) position: , mismatch: 8, identity: 0.75

gacagcgagcagttccgcaacggcggtgtttt	CRISPR spacer
ggcagcgagaagttccgcgacggcggtcaacg	Protospacer
*.******* ********.********   .

198. spacer 6.1|4857406|32|CP027718|CRISPRCasFinder matches to MK864264 (Gordonia phage VanDeWege, complete genome) position: , mismatch: 8, identity: 0.75

gacagcgagcagttccgcaacggcggtgtttt	CRISPR spacer
ggcagcgagaagttccgcgacggcggtcaacg	Protospacer
*.******* ********.********   .

199. spacer 6.1|4857406|32|CP027718|CRISPRCasFinder matches to MH479910 (Gordonia phage Danyall, complete genome) position: , mismatch: 8, identity: 0.75

gacagcgagcagttccgcaacggcggtgtttt	CRISPR spacer
ggcagcgagaagttccgcgacggcggtcaacg	Protospacer
*.******* ********.********   .

200. spacer 6.1|4857406|32|CP027718|CRISPRCasFinder matches to MT639651 (Gordonia phage Portcullis, complete genome) position: , mismatch: 8, identity: 0.75

gacagcgagcagttccgcaacggcggtgtttt	CRISPR spacer
ggcagcgagaagttccgcgacggcggtcaacg	Protospacer
*.******* ********.********   .

201. spacer 6.1|4857406|32|CP027718|CRISPRCasFinder matches to MH479917 (Gordonia phage KimmyK, complete genome) position: , mismatch: 8, identity: 0.75

gacagcgagcagttccgcaacggcggtgtttt	CRISPR spacer
ggcagcgagaagttccgcgacggcggtcaacg	Protospacer
*.******* ********.********   .

202. spacer 6.1|4857406|32|CP027718|CRISPRCasFinder matches to MK814761 (Gordonia phage SmokingBunny, complete genome) position: , mismatch: 8, identity: 0.75

gacagcgagcagttccgcaacggcggtgtttt	CRISPR spacer
ggcagcgagaagttccgcgacggcggtcaacg	Protospacer
*.******* ********.********   .

203. spacer 6.1|4857406|32|CP027718|CRISPRCasFinder matches to KX557286 (Gordonia phage Twister6, complete genome) position: , mismatch: 8, identity: 0.75

gacagcgagcagttccgcaacggcggtgtttt	CRISPR spacer
ggcagcgagaagttccgcgacggcggtcaacg	Protospacer
*.******* ********.********   .

204. spacer 6.1|4857406|32|CP027718|CRISPRCasFinder matches to MK864267 (Gordonia phage Valary, complete genome) position: , mismatch: 8, identity: 0.75

gacagcgagcagttccgcaacggcggtgtttt	CRISPR spacer
ggcagcgagaagttccgcgacggcggtcaacg	Protospacer
*.******* ********.********   .

205. spacer 6.1|4857406|32|CP027718|CRISPRCasFinder matches to MK967381 (Gordonia phage RogerDodger, complete genome) position: , mismatch: 8, identity: 0.75

gacagcgagcagttccgcaacggcggtgtttt	CRISPR spacer
ggcagcgagaagttccgcgacggcggtcaacg	Protospacer
*.******* ********.********   .

206. spacer 6.1|4857406|32|CP027718|CRISPRCasFinder matches to MT310872 (Gordonia phage Evamon, complete genome) position: , mismatch: 8, identity: 0.75

gacagcgagcagttccgcaacggcggtgtttt	CRISPR spacer
ggcagcgagaagttccgcgacggcggtcaacg	Protospacer
*.******* ********.********   .

207. spacer 6.1|4857406|32|CP027718|CRISPRCasFinder matches to MT521998 (Gordonia phage Jambalaya, complete genome) position: , mismatch: 8, identity: 0.75

gacagcgagcagttccgcaacggcggtgtttt	CRISPR spacer
ggcagcgagaagttccgcgacggcggtcaacg	Protospacer
*.******* ********.********   .

208. spacer 6.1|4857406|32|CP027718|CRISPRCasFinder matches to NC_030913 (Gordonia phage Wizard, complete genome) position: , mismatch: 8, identity: 0.75

gacagcgagcagttccgcaacggcggtgtttt	CRISPR spacer
ggcagcgagaagttccgcgacggcggtcaacg	Protospacer
*.******* ********.********   .

209. spacer 6.1|4857406|32|CP027718|CRISPRCasFinder matches to MN010760 (Gordonia phage Nubi, complete genome) position: , mismatch: 8, identity: 0.75

gacagcgagcagttccgcaacggcggtgtttt	CRISPR spacer
ggcagcgagaagttccgcgacggcggtcaacg	Protospacer
*.******* ********.********   .

210. spacer 6.1|4857406|32|CP027718|CRISPRCasFinder matches to CP003957 (Rhodococcus opacus PD630 plasmid 8, complete sequence) position: , mismatch: 8, identity: 0.75

gacagcgagcagttccgcaacggcggtgtttt	CRISPR spacer
gcccgcgagcagttcggcaacagcggtgacag	Protospacer
* * *********** *****.****** .

211. spacer 6.1|4857406|32|CP027718|CRISPRCasFinder matches to NZ_CP020393 (Burkholderia vietnamiensis strain FDAARGOS_239 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

gacagcgagcagttccgcaacggcggtgtttt	CRISPR spacer
gcgatcgagcagttccgcaagggcgatggcct	Protospacer
*  * *************** ****.** ..*

212. spacer 6.1|4857406|32|CP027718|CRISPRCasFinder matches to NZ_CP009629 (Burkholderia vietnamiensis LMG 10929 plasmid pBVB_1, complete sequence) position: , mismatch: 8, identity: 0.75

gacagcgagcagttccgcaacggcggtgtttt	CRISPR spacer
gcgatcgagcagttccgcaagggcgatggcct	Protospacer
*  * *************** ****.** ..*

213. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.71

ggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
tccgctcgtgcgcggcgaaggtctccaccgt	Protospacer
  .*  . *************** ******

214. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to NZ_CP025548 (Mycobacterium paragordonae strain 49061 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.71

ggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
tctggatcggcgcggcgatggtcgccgggct	Protospacer
  ****** ********* *******.

215. spacer 2.1|973248|31|CP027718|CRISPRCasFinder matches to NZ_CP015740 (Shinella sp. HZN7 plasmid pShin-04, complete sequence) position: , mismatch: 9, identity: 0.71

ggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
tcgcgatcggcgcggcgaaggtcggcatgga	Protospacer
    **** *************** **. *.

216. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NC_015184 (Agrobacterium sp. H13-3 plasmid pAspH13-3a, complete sequence) position: , mismatch: 9, identity: 0.71

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
attctactttctggtttcggcaatttggctg	Protospacer
...  .****.******* ***********.

217. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NZ_CP032923 (Agrobacterium tumefaciens strain 1D1108 plasmid pAt1D1108a, complete sequence) position: , mismatch: 9, identity: 0.71

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
attctactttctggtttcggcaatttggctg	Protospacer
...  .****.******* ***********.

218. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to MN694729 (Marine virus AFVG_250M1111, complete genome) position: , mismatch: 9, identity: 0.71

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
atccatcttttttgtttctgcaatttggaac	Protospacer
..* . ****** ***************

219. spacer 2.5|973247|32|CP027718|CRT matches to NC_014811 (Mycolicibacterium gilvum Spyr1 plasmid pMSPYR101, complete sequence) position: , mismatch: 9, identity: 0.719

tggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
ctgtggatcggcgcggcgatggtcgccgggtt	Protospacer
. ******* ********* *******.

220. spacer 2.5|973247|32|CP027718|CRT matches to NZ_CP032156 (Mycobacterium sp. ELW1 plasmid pELW1-1, complete sequence) position: , mismatch: 9, identity: 0.719

tggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
ctgtggatcggcgcggcgatggtcgccgggtt	Protospacer
. ******* ********* *******.

221. spacer 2.5|973247|32|CP027718|CRT matches to NC_004719 (Streptomyces avermitilis MA-4680 = NBRC 14893 plasmid SAP1, complete sequence) position: , mismatch: 9, identity: 0.719

tggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
tggaggatctgcgcggcgtaggtgggcgagat	Protospacer
*** ************** **** * *.  .

222. spacer 2.7|973368|32|CP027718|CRT matches to NZ_CP050084 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b2, complete sequence) position: , mismatch: 9, identity: 0.719

ggtttgggcttacgtcacggatgcccagggta	CRISPR spacer
ccttgcctattacgtcaccgatgcgcagggta	Protospacer
  **     ********* ***** *******

223. spacer 2.7|973368|32|CP027718|CRT matches to NZ_CP053209 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1A, complete sequence) position: , mismatch: 9, identity: 0.719

ggtttgggcttacgtcacggatgcccagggta	CRISPR spacer
ccttgcctattacgtcaccgatgcgcagggta	Protospacer
  **     ********* ***** *******

224. spacer 6.1|4857406|32|CP027718|CRISPRCasFinder matches to MN284907 (Gordonia phage Fireball, complete genome) position: , mismatch: 9, identity: 0.719

gacagcgagcagttccgcaacggcggtgtttt	CRISPR spacer
ggcagcgagaagttccgcgacggcggccaacg	Protospacer
*.******* ********.*******.   .

225. spacer 6.1|4857406|32|CP027718|CRISPRCasFinder matches to MK524505 (Gordonia phage Dogfish, complete genome) position: , mismatch: 9, identity: 0.719

gacagcgagcagttccgcaacggcggtgtttt	CRISPR spacer
ggcagcgagaagttccgcgacggcggccaacg	Protospacer
*.******* ********.*******.   .

226. spacer 6.1|4857406|32|CP027718|CRISPRCasFinder matches to MH669015 (Gordonia phage TillyBobJoe, complete genome) position: , mismatch: 9, identity: 0.719

gacagcgagcagttccgcaacggcggtgtttt	CRISPR spacer
ggcagcgagaagttccgcgacggcggccaacg	Protospacer
*.******* ********.*******.   .

227. spacer 6.1|4857406|32|CP027718|CRISPRCasFinder matches to NC_031004 (Gordonia phage Nyceirae, complete genome) position: , mismatch: 9, identity: 0.719

gacagcgagcagttccgcaacggcggtgtttt	CRISPR spacer
ggcagcgagaagttccgcgacggcggccagcg	Protospacer
*.******* ********.*******.   .

228. spacer 6.1|4857406|32|CP027718|CRISPRCasFinder matches to NZ_KY270855 (Pseudomonas putida strain 12969 plasmid p12969-2, complete sequence) position: , mismatch: 9, identity: 0.719

gacagcgagcagttccgcaacggcggtgtttt	CRISPR spacer
ggcatcgagcagttccgcaagggcgacagcct	Protospacer
*.** *************** ****... ..*

229. spacer 6.1|4857406|32|CP027718|CRISPRCasFinder matches to NZ_CP041206 (Rhizobium sp. NIBRBAC000502774 plasmid pMK-3, complete sequence) position: , mismatch: 9, identity: 0.719

gacagcgagcagttccgcaacggcggtgtttt	CRISPR spacer
tagcgccagcagttccgcgacggcggtatcaa	Protospacer
 *  ** ***********.********.*.

230. spacer 6.1|4857406|32|CP027718|CRISPRCasFinder matches to NZ_CP022563 (Pseudomonas monteilii strain B5 plasmid pSH5-1, complete sequence) position: , mismatch: 9, identity: 0.719

gacagcgagcagttccgcaacggcggtgtttt	CRISPR spacer
ggcatcgagcagttccgcaagggcgacagcct	Protospacer
*.** *************** ****... ..*

231. spacer 6.1|4857406|32|CP027718|CRISPRCasFinder matches to NC_009958 (Dinoroseobacter shibae DFL 12 = DSM 16493 plasmid pDSHI04, complete sequence) position: , mismatch: 9, identity: 0.719

gacagcgagcagttccgcaacggcggtgtttt	CRISPR spacer
atggccgagaagttccgcaaaggcggtgatct	Protospacer
.  . **** ********** ******* *.*

232. spacer 6.1|4857406|32|CP027718|CRISPRCasFinder matches to NC_009955 (Dinoroseobacter shibae DFL 12 = DSM 16493 plasmid pDSHI01, complete sequence) position: , mismatch: 9, identity: 0.719

gacagcgagcagttccgcaacggcggtgtttt	CRISPR spacer
atggccgagaagttccgcaaaggcggtgatct	Protospacer
.  . **** ********** ******* *.*

233. spacer 6.1|4857406|32|CP027718|CRISPRCasFinder matches to NC_009956 (Dinoroseobacter shibae DFL 12 = DSM 16493 plasmid pDSHI02, complete sequence) position: , mismatch: 9, identity: 0.719

gacagcgagcagttccgcaacggcggtgtttt	CRISPR spacer
atggccgagaagttccgcaaaggcggtgatct	Protospacer
.  . **** ********** ******* *.*

234. spacer 2.2|973308|32|CP027718|CRISPRCasFinder matches to NZ_LR594663 (Variovorax sp. RA8 plasmid 2) position: , mismatch: 10, identity: 0.688

cagcgcggcgatacgctccagggtttcttcat	CRISPR spacer
gccggcggcgatgcgctccaaggtttcaacgg	Protospacer
    ********.*******.******  *.

235. spacer 2.4|973429|31|CP027718|CRISPRCasFinder matches to NC_020060 (Rhizobium tropici CIAT 899 plasmid pRtrCIAT899a, complete sequence) position: , mismatch: 10, identity: 0.677

gccgggctttttggtttctgcaatttggcta	CRISPR spacer
attttattttctggtttcggcaatttggctg	Protospacer
...  ..***.******* ***********.

236. spacer 2.5|973247|32|CP027718|CRT matches to NZ_CP025548 (Mycobacterium paragordonae strain 49061 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.688

tggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
gtctggatcggcgcggcgatggtcgccgggct	Protospacer
   ****** ********* *******.

237. spacer 2.5|973247|32|CP027718|CRT matches to NZ_CP015740 (Shinella sp. HZN7 plasmid pShin-04, complete sequence) position: , mismatch: 10, identity: 0.688

tggtggatctgcgcggcgaaggtcgccaccgg	CRISPR spacer
ctcgcgatcggcgcggcgaaggtcggcatgga	Protospacer
.    **** *************** **. *.

238. spacer 6.1|4857406|32|CP027718|CRISPRCasFinder matches to NZ_CP024907 (Paraburkholderia caledonica strain PHRS4 plasmid pPHRS4, complete sequence) position: , mismatch: 11, identity: 0.656

gacagcgagcagttccgcaacggcggtgtttt	CRISPR spacer
gaccgcgagcagttcctcaacggtttcaacac	Protospacer
*** ************ ******.  .. . .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1310879 : 1400744

Pseudomonas_phage(41.18%)

protease,plate,tail,tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZD77774.1\|1310879_1312232_+\|protease	Intramembrane protease RasP/YluC, implicated in cell division based on FtsL cleavage	NA	NA	NA	NA
AZD77775.1\|1312306_1314694_+	Outer membrane protein assembly factor YaeT	NA	NA	NA	NA
AZD77776.1\|1314739_1315243_+	Outer membrane chaperone Skp, precursor	NA	NA	NA	NA
AZD77777.1\|1315246_1316302_+	UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase	NA	NA	NA	NA
AZD77778.1\|1316411_1316852_+	3-hydroxyacyl-ACP dehydratase	NA	NA	NA	NA
AZD77779.1\|1316848_1317625_+	Acyl-ADP--UDP-N- acetylglucosamine O-acyltransferase	NA	NA	NA	NA
AZD77780.1\|1317627_1318758_+	Lipid-A-disaccharide synthase	NA	NA	NA	NA
AZD77781.1\|1318769_1319402_+	Ribonuclease HII	V5LS49	Emiliania_huxleyi_virus	1.7e-27	38.9
AZD77782.1\|1319471_1322996_+	DNA polymerase III alpha subunit	A0A2L1IZ23	Streptomyces_phage	6.2e-196	38.0
AZD77783.1\|1323136_1324084_+	Acetyl-coenzyme A carboxyl transferase alpha chain	NA	NA	NA	NA
AZD77784.1\|1324203_1325532_+\|tRNA	tRNA(Ile)-lysidine synthetase	NA	NA	NA	NA
AZD77785.1\|1325577_1325721_+	hypothetical protein	NA	NA	NA	NA
AZD77786.1\|1325806_1327438_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	6.9e-158	53.5
AZD77787.1\|1327443_1328289_+	2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase	E3T537	Cafeteria_roenbergensis_virus	1.2e-49	42.8
AZD77788.1\|1328446_1329736_+	Enolase	A0A1X9I5Z8	Streptococcus_phage	9.0e-137	59.2
AZD77789.1\|1329908_1330187_+	Cell division protein DivIC (FtsB), stabilizes FtsL against RasP cleavage	NA	NA	NA	NA
AZD77790.1\|1330183_1330891_+	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	NA	NA	NA	NA
AZD77791.1\|1331056_1331953_-	Transcriptional regulator, LysR family, in formaldehyde detoxification operon	NA	NA	NA	NA
AZD77792.1\|1332059_1333172_+	S-(hydroxymethyl)glutathione dehydrogenase	E3SJ82	Synechococcus_phage	8.3e-30	27.2
AZD77793.1\|1333260_1334106_+	S-formylglutathione hydrolase	NA	NA	NA	NA
AZD77794.1\|1334158_1334632_+	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
AZD77795.1\|1334628_1335687_+\|tRNA	tRNA pseudouridine(13) synthase	NA	NA	NA	NA
AZD77796.1\|1335674_1336424_+	5'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	2.3e-68	52.6
AZD77797.1\|1336423_1337101_+	Protein-L-isoaspartate O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	8.9e-43	52.0
AZD77798.1\|1337310_1338144_+	Murein hydrolase activator NlpD	A0A0S2SXL7	Bacillus_phage	6.3e-06	33.3
AZD77799.1\|1338250_1339255_+	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	5.0e-34	35.8
AZD77800.1\|1339755_1340079_-	4Fe-4S dicluster domain	NA	NA	NA	NA
AZD77801.1\|1340221_1342801_-	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	3.1e-27	23.5
AZD77802.1\|1342997_1343723_+	Transcriptional regulator	B5TK58	Pseudomonas_phage	2.9e-124	91.0
AZD77803.1\|1344462_1345044_+	hypothetical protein	NA	NA	NA	NA
AZD77804.1\|1345146_1345494_+	Holin	B5TK61	Pseudomonas_phage	7.7e-51	87.7
AZD77805.1\|1345665_1346430_+	N-acetylmuramoyl-L-alanine amidase	A0A1W6DX33	Sphingobium_phage	8.9e-07	26.8
AZD77806.1\|1346652_1347177_+	hypothetical protein	NA	NA	NA	NA
AZD77807.1\|1347180_1347789_+\|plate	Baseplate assembly protein V	A0A2H4JBW8	uncultured_Caudovirales_phage	8.2e-48	59.7
AZD77808.1\|1347802_1348135_+\|plate	Baseplate assembly protein W	A0A2H4JI46	uncultured_Caudovirales_phage	2.1e-37	69.1
AZD77809.1\|1348131_1349127_+\|plate	Phage-related baseplate assembly protein	A0A2H4JC04	uncultured_Caudovirales_phage	1.8e-108	62.9
AZD77810.1\|1349123_1349759_+	Tail protein I	A0A2H4JDK0	uncultured_Caudovirales_phage	5.4e-42	53.1
AZD77811.1\|1349759_1351271_+\|tail	Prophage long tail fiber protein	A0A1I9KF43	Aeromonas_phage	1.1e-29	40.9
AZD77812.1\|1351319_1351745_+	hypothetical protein	Q9ZXK5	Pseudomonas_virus	1.1e-22	51.4
AZD77813.1\|1351844_1352066_+	hypothetical protein	NA	NA	NA	NA
AZD77814.1\|1352068_1353235_+\|tail	Major tail sheath protein	B0ZSG8	Halomonas_phage	1.4e-125	57.5
AZD77815.1\|1353234_1353741_+	hypothetical protein	Q6R4W3	Vibrio_virus	2.1e-25	36.9
AZD77816.1\|1353868_1354450_+	hypothetical protein	B0ZSH0	Halomonas_phage	9.1e-28	39.4
AZD77817.1\|1354446_1354572_+	hypothetical protein	NA	NA	NA	NA
AZD77818.1\|1354578_1356849_+	Phage protein	A2I2Y1	Vibrio_virus	6.0e-35	35.1
AZD77819.1\|1356848_1357232_+\|tail	Unclassified tail protein	A0A2H4JAC8	uncultured_Caudovirales_phage	4.7e-33	53.5
AZD77820.1\|1357224_1357437_+\|tail	P2-like prophage tail protein X	A0A2H4JGD9	uncultured_Caudovirales_phage	3.9e-21	68.6
AZD77821.1\|1357446_1358466_+\|tail	Phage tail protein D	A0A2H4JH05	uncultured_Caudovirales_phage	7.2e-105	56.8
AZD77822.1\|1358646_1359231_+	hypothetical protein	B5TK65	Pseudomonas_phage	1.3e-74	71.0
AZD77823.1\|1359227_1359410_+	Mu-like prophage FluMu protein GP38	B5TK66	Pseudomonas_phage	6.5e-25	93.3
AZD77824.1\|1359409_1360906_+\|tail	Bacteriophage tail sheath protein	B5TK67	Pseudomonas_phage	1.0e-256	90.6
AZD77825.1\|1360972_1361320_+\|tail	Phage tail tube protein	B5TK68	Pseudomonas_phage	2.9e-58	93.9
AZD77826.1\|1361316_1361613_+\|tail	Phage small tail protein E	B5TK69	Pseudomonas_phage	2.3e-43	94.9
AZD77827.1\|1361743_1363819_+\|tail	Phage tail length tape-measure protein	B5TK70	Pseudomonas_phage	2.0e-37	48.1
AZD77828.1\|1363805_1365044_+\|tail	Phage tail/DNA circulation protein	B5TK71	Pseudomonas_phage	5.7e-181	75.7
AZD77829.1\|1365047_1366088_+\|tail	Prophage tail protein	B5TK72	Pseudomonas_phage	3.8e-162	82.7
AZD77830.1\|1366121_1366715_+\|plate	Prophage baseplate assembly protein V	B5TK73	Pseudomonas_phage	5.2e-79	89.3
AZD77831.1\|1366714_1367113_+	Bacteriophage protein GP46	B5TK74	Pseudomonas_phage	1.7e-65	89.4
AZD77832.1\|1367102_1368143_+	Phage FluMu protein gp47	B5TK75	Pseudomonas_phage	3.0e-167	87.3
AZD77833.1\|1368130_1368730_+\|tail	Prophage tail protein	B5TK76	Pseudomonas_phage	3.8e-106	92.0
AZD77834.1\|1368741_1369599_+\|tail	Prophage tail fiber protein	B5TK77	Pseudomonas_phage	1.5e-23	76.4
AZD77835.1\|1369603_1370245_+	hypothetical protein	B5TK78	Pseudomonas_phage	2.5e-39	61.9
AZD77836.1\|1370443_1370575_-	hypothetical protein	NA	NA	NA	NA
AZD77837.1\|1370628_1372182_+\|tail	Prophage tail fiber protein	A4PE45	Ralstonia_virus	1.0e-38	54.8
AZD77838.1\|1372183_1372654_+	hypothetical protein	A0A2H4EXG4	Aeromonas_phage	3.2e-07	35.0
AZD77839.1\|1372798_1372912_-	hypothetical protein	NA	NA	NA	NA
AZD77840.1\|1373048_1374113_+\|tail	Prophage tail fiber protein	B5TK79	Pseudomonas_phage	1.7e-117	58.5
AZD77841.1\|1374119_1374722_+\|tail	Putative tail fiber assembly protein p37	B5TK80	Pseudomonas_phage	5.5e-44	45.3
AZD77842.1\|1374743_1375307_+	Lytic enzyme	B5TK83	Pseudomonas_phage	2.2e-87	83.3
AZD77843.1\|1375288_1375825_+	hypothetical protein	B5TK84	Pseudomonas_phage	3.1e-59	69.7
AZD77844.1\|1375907_1376408_+	Nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	3.6e-73	86.7
AZD77845.1\|1376491_1377544_+	RecA protein	A0A0S2MVG1	Bacillus_phage	4.4e-113	60.9
AZD77846.1\|1377552_1378020_+	Regulatory protein RecX	NA	NA	NA	NA
AZD77847.1\|1378065_1379181_-	Decarboxylase family protein	NA	NA	NA	NA
AZD77848.1\|1379664_1379859_+	hypothetical protein	NA	NA	NA	NA
AZD77849.1\|1379860_1380283_-	Putative NADPH-quinone reductase (modulator of drug activity B)	NA	NA	NA	NA
AZD77850.1\|1380472_1381183_+	putative conserved protein YfiP, contains DTW domain	NA	NA	NA	NA
AZD77851.1\|1381517_1382168_+	Transcriptional regulator, LuxR family	NA	NA	NA	NA
AZD77852.1\|1382243_1382606_+	Diacylglycerol kinase	NA	NA	NA	NA
AZD77853.1\|1382602_1383529_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZD77854.1\|1383662_1384442_+	Ferredoxin--NADP(+) reductase	NA	NA	NA	NA
AZD77855.1\|1384514_1385243_-	S-adenosylmethionine-dependent methyltransferase YaeB	NA	NA	NA	NA
AZD77856.1\|1385331_1386102_-	Rhamnolipid biosynthesis 3-oxoacyl-ACP reductase RhlG	NA	NA	NA	NA
AZD77857.1\|1386235_1386697_-	Uncharacterized protein YehS	Q9EYF4	Enterobacteria_phage	8.5e-37	51.3
AZD77858.1\|1386763_1387474_-	Ribosomal large subunit pseudouridine synthase F	NA	NA	NA	NA
AZD77859.1\|1387556_1388030_-	Acetyltransferase	NA	NA	NA	NA
AZD77860.1\|1388136_1389474_-	Ribosomal protein S12p Asp88 methylthiotransferase	NA	NA	NA	NA
AZD77861.1\|1389806_1391708_+	Kup system potassium uptake protein	M1HZV6	Acanthocystis_turfacea_Chlorella_virus	1.2e-76	35.0
AZD77862.1\|1391910_1393206_-	Alanylphosphatidylglycerol hydrolase, periplasmic	NA	NA	NA	NA
AZD77863.1\|1393205_1395854_-	Alanylphosphatidylglycerol synthase	NA	NA	NA	NA
AZD77864.1\|1396791_1397856_+	DNA polymerase IV	NA	NA	NA	NA
AZD77865.1\|1398057_1399011_-	putative lipoprotein	NA	NA	NA	NA
AZD77866.1\|1399028_1400744_-\|tRNA	Prolyl-tRNA synthetase, bacterial type	NA	NA	NA	NA

DBSCAN-SWA_2

2318573 : 2326480

Pseudomonas_phage(55.56%)

integrase,tail

attL 2317895:2317908|attR 2328401:2328414

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2317895:2317908	attL	NA	NA	NA	NA
AZD78690.1\|2318573_2318876_+	Integration host factor alpha subunit	A0A0H3UZA0	Geobacillus_virus	1.8e-11	38.9
AZD78691.1\|2318856_2319213_+	Transcriptional regulator, MerR family	NA	NA	NA	NA
AZD78692.1\|2319450_2320131_-\|integrase	Phage integrase family protein	A0A059VF45	Pseudomonas_phage	6.7e-91	71.9
AZD78693.1\|2320499_2320901_-	hypothetical protein	A0A059VFY6	Pseudomonas_phage	2.8e-44	68.6
AZD78694.1\|2320936_2321521_-	hypothetical protein	NA	NA	NA	NA
AZD78695.1\|2321797_2322193_+\|tail	Phage tail fiber protein	A0A2P1JUG3	Erwinia_phage	6.2e-12	40.2
AZD78696.1\|2322251_2322677_+	Cell wall hydrolase	A0A1B0VMI2	Pseudomonas_phage	2.7e-69	85.8
AZD78697.1\|2322676_2323048_+	hypothetical protein	H2BDA0	Pseudomonas_phage	5.8e-20	49.2
AZD78698.1\|2323044_2323302_+	Phage protein	H2BDA1	Pseudomonas_phage	1.4e-20	69.1
AZD78699.1\|2323363_2325421_-	O-antigen acetylase	A0A1R3Y5Q6	Salmonella_virus	1.8e-91	39.8
AZD78700.1\|2325940_2326054_-	Gifsy-2 prophage protein	NA	NA	NA	NA
AZD78701.1\|2326183_2326480_+	hypothetical protein	A0A2H4JER5	uncultured_Caudovirales_phage	3.9e-11	36.7
2328401:2328414	attR	NA	NA	NA	NA

DBSCAN-SWA_3

4310093 : 4316351

uncultured_Caudovirales_phage(83.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZD80451.1\|4310093_4310486_+\|tRNA	tRNA 5-methylaminomethyl-2-thiouridine synthase subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	6.7e-59	84.6
AZD80452.1\|4310489_4310852_+\|tRNA	tRNA 5-methylaminomethyl-2-thiouridine synthase subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	2.5e-44	74.2
AZD80453.1\|4310851_4311151_+\|tRNA	tRNA 5-methylaminomethyl-2-thiouridine synthase subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	5.3e-32	70.7
AZD80454.1\|4311147_4311483_+\|tRNA	tRNA 2-thiouridine synthesis protein TusE	A0A2H4J8B6	uncultured_Caudovirales_phage	1.9e-46	82.0
AZD80455.1\|4311479_4312481_+	Anthranilate phosphoribosyltransferase like	A0A2H4JBY5	uncultured_Caudovirales_phage	9.4e-166	85.3
AZD80456.1\|4312569_4313577_+	Glutathione S-transferase, omega	NA	NA	NA	NA
AZD80457.1\|4313675_4315070_-	Precorrin-2 oxidase	NA	NA	NA	NA
AZD80458.1\|4315070_4316351_-\|tRNA	Seryl-tRNA synthetase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.1e-101	55.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP027718

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection