CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP027743	Pseudomonas chlororaphis subsp. aurantiaca strain CW2 chromosome, complete genome	2 crisprs	DinG,csa3,cas3,PD-DExK,DEDDh,WYL	0	0	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP027743_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027743_1

420934-421036

Orphan

Consensus_repeat	Method
GCGCCGGGCCCGGTGTAAAGAGGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP027743_1

>merge|CP027743|1|420934-421036|CRISPRCasFinder
GCGCCGGGCCCGGTGTAAAGAGGGGAAGCCCCGGCCTGCCTGTACCAAGGTTCCCGAAAGCGTGAGGGCCGCGCTGATTGCGCTGGGCCCGGTGTAAAGAGGG

>CP027743|1|1|420934-421036|CRISPRCasFinder
GCGCCGGGCCCGGTGTAAAGAGGG	GAAGCCCCGGCCTGCCTGTACCAAGGTTCCCGAAAGCGTGAGGGCCGCGCTGATT
GCGCTGGGCCCGGTGTAAAGAGGG

Protein	Signature genes	Signature genes Name	Protein_function
CP027743.1\|AZD45828.1\|423112_424198_-\|Nitrogen-regulation-protein-NtrB	unknown	unknown	gnl\|CDD\|226370
CP027743.1\|AZD45833.1\|428930_430118_+\|L-carnitine-dehydratase/bile-acid-inducible-protein-F	unknown	unknown	gnl\|CDD\|367110
CP027743.1\|AZD45817.1\|412289_413045_+\|ABC-type-amino-acid-transport/signal-transduction-system,-periplasmic-component/domain	unknown	unknown	gnl\|CDD\|223904
CP027743.1\|AZD45821.1\|416866_418396_-\|2,3-bisphosphoglycerate-independent-phosphoglycerate-mutase	unknown	unknown	gnl\|CDD\|235463
CP027743.1\|AZD45834.1\|430187_430982_+\|Enoyl-CoA-hydratase/isomerase-family-protein	unknown	unknown	gnl\|CDD\|236162
CP027743.1\|AZD45827.1\|421679_423116_-\|Nitrogen-regulation-protein-NtrC	unknown	unknown	gnl\|CDD\|273818
CP027743.1\|AZD45820.1\|415443_416730_-\|Murein-hydrolase-activator-EnvC	unknown	unknown	gnl\|CDD\|227278
CP027743.1\|AZD45832.1\|427176_428898_+\|Acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173843
CP027743.1\|AZD45822.1\|418547_418961_+\|Rhodanese-related-sulfurtransferase-YibN	unknown	unknown	gnl\|CDD\|238089
CP027743.1\|AZD45823.1\|418962_419217_+\|Glutaredoxin-3-(Grx3)	unknown	unknown	gnl\|CDD\|274017
CP027743.1\|AZD45831.1\|426164_427064_-\|Transcriptional-regulator,-LysR-family	unknown	unknown	gnl\|CDD\|176139
CP027743.1\|AZD45835.1\|430978_432505_+\|3-hydroxyacyl-CoA-dehydrogenase-PaaC	unknown	unknown	gnl\|CDD\|236211
CP027743.1\|AZD45826.1\|420495_420870_+\|hypothetical-protein	unknown	unknown	unknown
CP027743.1\|AZD45824.1\|419273_419756_+\|Protein-export-protein-SecB-(maintains-pre-export-unfolded-state)	unknown	unknown	gnl\|CDD\|180234
CP027743.1\|AZD45819.1\|414101_415412_-\|Carboxyl-terminal-protease	unknown	unknown	gnl\|CDD\|223864
CP027743.1\|AZD45836.1\|432540_433851_+\|Acetyl-CoA-acetyltransferase	unknown	unknown	gnl\|CDD\|181242
CP027743.1\|AZD45829.1\|424194_424506_-\|hypothetical-protein	unknown	unknown	unknown
CP027743.1\|AZD45825.1\|419975_420431_-\|tRNA-(cytidine(34)-2'-O)-methyltransferase	unknown	unknown	gnl\|CDD\|223297
CP027743.1\|AZD45830.1\|424556_425969_-\|putative-MFS-type-transporter	unknown	unknown	gnl\|CDD\|340927
CP027743.1\|AZD45818.1\|413176_413935_-\|Putative-periplasmic-protein-YibQ	unknown	unknown	gnl\|CDD\|377404

Protein	Function_ID	Function_description	E-value
CP027743.1\|AZD45828.1\|423112_424198_-\|Nitrogen-regulation-protein-NtrB	gnl\|CDD\|226370	COG3852, NtrB, Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms].	1.36849e-164
CP027743.1\|AZD45833.1\|428930_430118_+\|L-carnitine-dehydratase/bile-acid-inducible-protein-F	gnl\|CDD\|367110	pfam02515, CoA_transf_3, CoA-transferase family III. CoA-transferases are found in organisms from all lines of descent. Most of these enzymes belong to two well-known enzyme families, but recent work on unusual biochemical pathways of anaerobic bacteria has revealed the existence of a third family of CoA-transferases. The members of this enzyme family differ in sequence and reaction mechanism from CoA-transferases of the other families. Currently known enzymes of the new family are a formyl-CoA: oxalate CoA-transferase, a succinyl-CoA: (R)-benzylsuccinate CoA-transferase, an (E)-cinnamoyl-CoA: (R)-phenyllactate CoA-transferase, and a butyrobetainyl-CoA: (R)-carnitine CoA-transferase. In addition, a large number of proteins of unknown or differently annotated function from Bacteria, Archaea and Eukarya apparently belong to this enzyme family. Properties and reaction mechanisms of the CoA-transferases of family III are described and compared to those of the previously known CoA-transferases.	4.38871e-150
CP027743.1\|AZD45817.1\|412289_413045_+\|ABC-type-amino-acid-transport/signal-transduction-system,-periplasmic-component/domain	gnl\|CDD\|223904	COG0834, HisJ, ABC-type amino acid transport/signal transduction systems, periplasmic component/domain [Amino acid transport and metabolism / Signal transduction mechanisms].	1.09565e-23
CP027743.1\|AZD45821.1\|416866_418396_-\|2,3-bisphosphoglycerate-independent-phosphoglycerate-mutase	gnl\|CDD\|235463	PRK05434, PRK05434, 2,3-bisphosphoglycerate-independent phosphoglycerate mutase.	0
CP027743.1\|AZD45834.1\|430187_430982_+\|Enoyl-CoA-hydratase/isomerase-family-protein	gnl\|CDD\|236162	PRK08138, PRK08138, enoyl-CoA hydratase; Provisional.	4.00656e-160
CP027743.1\|AZD45820.1\|415443_416730_-\|Murein-hydrolase-activator-EnvC	gnl\|CDD\|227278	COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning].	9.03093e-101
CP027743.1\|AZD45832.1\|427176_428898_+\|Acyl-CoA-dehydrogenase	gnl\|CDD\|173843	cd01154, AidB, Proteins involved in DNA damage response, similar to the AidB gene product. AidB is one of several genes involved in the SOS adaptive response to DNA alkylation damage, whose expression is activated by the Ada protein. Its function has not been entirely elucidated; however, it is similar in sequence and function to acyl-CoA dehydrogenases. It has been proposed that aidB directly destroys DNA alkylating agents such as nitrosoguanidines (nitrosated amides) or their reaction intermediates.	2.27727e-148
CP027743.1\|AZD45822.1\|418547_418961_+\|Rhodanese-related-sulfurtransferase-YibN	gnl\|CDD\|238089	cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein. The cysteine containing enzymatically active version of the domain is also found in the Cdc25 class of protein phosphatases and a variety of proteins such as sulfide dehydrogenases and certain stress proteins such as senesence specific protein 1 in plants, PspE and GlpE in bacteria and cyanide and arsenate resistance proteins. Inactive versions (no active site cysteine) are also seen in dual specificity phosphatases, ubiquitin hydrolases from yeast and in sulfuryltransferases, where they are believed to play a regulatory role in multidomain proteins.	6.79697e-24
CP027743.1\|AZD45823.1\|418962_419217_+\|Glutaredoxin-3-(Grx3)	gnl\|CDD\|274017	TIGR02181, GRX_bact, Glutaredoxin, GrxC family. Glutaredoxins are thioltransferases (disulfide reductases) which utilize glutathione and NADPH as cofactors. Oxidized glutathione is regenerated by glutathione reductase. Together these components compose the glutathione system. Glutaredoxins utilize the CXXC motif common to thioredoxins and are involved in multiple cellular processes including protection from redox stress, reduction of critical enzymes such as ribonucleotide reductase and the generation of reduced sulfur for iron sulfur cluster formation. Glutaredoxins are capable of reduction of mixed disulfides of glutathione as well as the formation of glutathione mixed disulfides. This family of glutaredoxins includes the E. coli protein GrxC (Grx3) which appears to have a secondary role in reducing ribonucleotide reductase (in the absence of GrxA) possibly indicating a role in the reduction of other protein disulfides. [Energy metabolism, Electron transport].	9.3713e-50
CP027743.1\|AZD45835.1\|430978_432505_+\|3-hydroxyacyl-CoA-dehydrogenase-PaaC	gnl\|CDD\|236211	PRK08268, PRK08268, 3-hydroxy-acyl-CoA dehydrogenase; Validated.	0
CP027743.1\|AZD45827.1\|421679_423116_-\|Nitrogen-regulation-protein-NtrC	gnl\|CDD\|273818	TIGR01818, Nitrogen_assimilation_regulatory_protein, nitrogen regulation protein NR(I). This model represents NtrC, a DNA-binding response regulator that is phosphorylated by NtrB and interacts with sigma-54. NtrC usually controls the expression of glutamine synthase, GlnA, and may be called GlnL, GlnG, etc. [Central intermediary metabolism, Nitrogen metabolism, Regulatory functions, DNA interactions, Signal transduction, Two-component systems].	0
CP027743.1\|AZD45824.1\|419273_419756_+\|Protein-export-protein-SecB-(maintains-pre-export-unfolded-state)	gnl\|CDD\|180234	PRK05751, PRK05751, preprotein translocase subunit SecB; Validated.	4.26189e-83
CP027743.1\|AZD45819.1\|414101_415412_-\|Carboxyl-terminal-protease	gnl\|CDD\|223864	COG0793, Prc, Periplasmic protease [Cell envelope biogenesis, outer membrane].	1.95839e-143
CP027743.1\|AZD45836.1\|432540_433851_+\|Acetyl-CoA-acetyltransferase	gnl\|CDD\|181242	PRK08131, PRK08131, 3-oxoadipyl-CoA thiolase.	0
CP027743.1\|AZD45831.1\|426164_427064_-\|Transcriptional-regulator,-LysR-family	gnl\|CDD\|176139	cd08448, PBP2_LTTR_aromatics_like_2, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to regulators involved in the catabolism of aromatic compounds, contains type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type regulator similar to CbnR which is involved in the regulation of chlorocatechol breakdown. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.60193e-89
CP027743.1\|AZD45825.1\|419975_420431_-\|tRNA-(cytidine(34)-2'-O)-methyltransferase	gnl\|CDD\|223297	COG0219, CspR, Predicted rRNA methylase (SpoU class) [Translation, ribosomal structure and biogenesis].	9.49717e-89
CP027743.1\|AZD45830.1\|424556_425969_-\|putative-MFS-type-transporter	gnl\|CDD\|340927	cd17369, MFS_ShiA_like, Shikimate transporter and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli shikimate transporter (ShiA), inner membrane metabolite transport protein YhjE, and other putative metabolite transporters. ShiA is involved in the uptake of shikimate, an aromatic compound involved in siderophore biosynthesis. It has been suggested that YhjE may mediate the uptake of osmoprotectants. The ShiA-like subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.2238e-152
CP027743.1\|AZD45818.1\|413176_413935_-\|Putative-periplasmic-protein-YibQ	gnl\|CDD\|377404	pfam04748, Polysacc_deac_2, Divergent polysaccharide deacetylase. This family is divergently related to pfam01522 (personal obs:Yeats C).	1.92074e-91

>CP027743.1|AZD45826.1|420495_420870_+|hypothetical-protein
MLRVFGSLAIFGVMVGLMIGRLTTPDPTELQEVQVQPNALVVWFNNEPKVHGEHIDGAVALLFEAEGRAQKGQLKINDKDANWRVRATEEGLLLNVVAARALHGEWSGSEVDGRWRLELQLREE
>CP027743.1|AZD45825.1|419975_420431_-|tRNA-(cytidine(34)-2'-O)-methyltransferase
MFHVILFQPEIPPNTGNVIRLCANSGCHLHLIEPLGFEMDDKRLRRAGLDYHEYATLQRHADLASCLESLGHPRLFAFTTKGSRPFHDASFAEGDAFLFGPESRGLPAEVLDALPTEQRLRLPMREGCRSLNLSNTVAVAVYEAWRQLGFK
>CP027743.1|AZD45824.1|419273_419756_+|Protein-export-protein-SecB-(maintains-pre-export-unfolded-state)
MTDQQNTAATEDESAPQFSLQRIYVRDLSFEAPKSPAIFRQQWEPSVGLDLNTRQKALEEGFHEVVLTLSVTVKNGEEVAFIAEVQQAGIFLIKNLDDASMSHTLGAFCPNILFPYAREALDSLVTRGSFPALMLAPVNFDALYAQELQRLQAAGEGTVQ
>CP027743.1|AZD45823.1|418962_419217_+|Glutaredoxin-3-(Grx3)
MAAVVVYSSDYCPYCSRAKHLLENKGVAFEEIKVDGKPQVRAEMAQKAGRTSVPQIWIGSTHVGGCDDLFALERAGKLDALLAA
>CP027743.1|AZD45822.1|418547_418961_+|Rhodanese-related-sulfurtransferase-YibN
MVAHLIQFATEHYLLVGAFVILLALLIAHELSRGGRSLSTRELTALVNSEQGVVIDIRPSKDFAAGHIVGALNIPQDKLAARVGELEKHKAKTIILVDALGQHAGTHARELMKSGFTAAKLSGGVGSWKADNLPLVK
>CP027743.1|AZD45821.1|416866_418396_-|2,3-bisphosphoglycerate-independent-phosphoglycerate-mutase
MTTTPKPLVLMILDGFGHSESHESNAIYAAKKPVLDRLCASVPNGLISGSGMDVGLPDGQMGNSEVGHMNLGAGRVVYQDFTRVTKAIRDGEFFENPTICAAVDKAVAADKAVHILGLLSDGGVHSHQDHLVAMAELAFKRGAEKIYLHAFLDGRDTPPKSATSSIELLDETFKTLGKGRIASLIGRYFAMDRDNRWDRVAQAYNLIVDGKGEFNAATAQEGLLAAYERGESDEFVKATTLGEPVKVEDGDAVVFMNFRADRARELSRVFVEDDFKEFARARQPKLAGFVMLTQYAASIPAPSAFAPGSLENVLGDYLAKNGKTQLRIAETEKYAHVTFFFSGGREEPFPGEERILIPSPKVATYDLQPEMSAPEVTDRIVDAIENQRYDVIVVNYANGDMVGHSGVFDAAVKAVECLDLCVGRIVDALEKVGGEALITADHGNVEQMSDAATGQAHTAHTSEPVPFIYVGKRNLKVREGGVLADVAPTMLKLLGLPQPAEMTGTSILV
>CP027743.1|AZD45820.1|415443_416730_-|Murein-hydrolase-activator-EnvC
MLRALITLALICLLQPAFADERAQTQQQLDATRQDIAELKKLLGKLQEEKSGVQKDLRGTETEMGKLEKQVDALQKELKKSESELQRLDEEKKKLQSARIEQQRLIAIQARAAYQNGRQEYLKLLLNQQNPEKFARTLTYYDYLSQARLEQLKNFNETLRQLANVEKEISLQQAQLLVQKSSLDTQREELDKVRKERQVALAKLNDDVKARGDKLKAREQDQADLGKVLKTIEETLARQAREAEEARQKALIAQQEAEKKRLREAQASADDSPRKPPRAAPGPLVSSAGASYGGPFASSRGKLPWPVDGRLLARFGESRGDDARTKWDGVMISASAGSQVHAVHGGRVVFADWLRGAGLLVILDHGNGYLSLYGHNQTLLKEAGDVVKAGESISTVGSSGGQGAPALYFAIRQQGRPSDPAQWCRAQG
>CP027743.1|AZD45819.1|414101_415412_-|Carboxyl-terminal-protease
MLHLSRLTSLALTIALVIGAPLAFAAETAQSTAATTTKAPLPLEELRTFAEVMDRIKAAYVEPVDDKTLLENAIKGMLSNLDPHSAYLGPEDFAELQESTSGEFGGLGIEVGAEDGIIKVVSPIDDTPASKAGIQAGDLIVKINGQPTRGQSMTEAVDKMRGKIGQKITLTLVRDGGAPFDVTLARATIQVKSVKSQLLESGYGYIRITQFQVKTGEEVSKALAKLRKDNGKKLNGIILDLRNNPGGVLQSAVEVVDHFITKGLIVYTKGRIANSELRFSATGKDESEAVPMVVLINGGSASASEIVAGALQDQKRAVLMGTTSFGKGSVQTVLPLNNDRALKITTALYFTPNGRSIQAQGIVPDIEVRRAKITNEAQDNEYFKEADLQGHLGNGNGGADKPTASGSKPKPMPQDDDYQLAQALSLLKGLSITRSK
>CP027743.1|AZD45818.1|413176_413935_-|Putative-periplasmic-protein-YibQ
MLGLLCLLAFTSTQAAEPAARKAYLSLIIDDLGQNLPRDRRVLALPGPVTTAIMPDTPHAAEFAREAHRAGKIVILHMPMDPATGPFAWHPELPIEELERRLNAAFKAVPYTSGINNHMGSRMTSQPQAMAWLMAELQRRHKFFVDSRTSAKTVAAAEAQKIGLASVSRDVFLDDERTEDAISHQLQTAIDLAHKQGSAVVIGHPYPQTLAVLERELPRLKAQGIDWIDIELMISVRSNRAMSGHGKDGVYR
>CP027743.1|AZD45817.1|412289_413045_+|ABC-type-amino-acid-transport/signal-transduction-system,-periplasmic-component/domain
MFKRLLLVLASASVLFAAGARAAQTPDTSLVLLTENFPPYNMAKNGKNFAQGENINGIAVDIVREMFKRAGINYSLTLRFPWERIYKLALEQPGYGVFVTARLPDREPLFKWVGPIGPDDWIMLARDDSKIALQSLEQARKYRIGAYKGDAIAETLAKQGLKPQVVLKDQDNARKLVGGQIDLWATGDPAGRYLARQEGVTGLKTVLRFHSTQLYLALNKEVPDETVARLQAALDQLREEGVVEEIMGRYL
>CP027743.1|AZD45827.1|421679_423116_-|Nitrogen-regulation-protein-NtrC
MSRSETVWIVDDDRSIRWVLEKALQQEGMTTQSFDSADGVMSRLARQQPDVIISDIRMPGASGLDLLARIREQHPRLPVIIMTAHSDLDSAVASYQGGAFEYLPKPFDVDEAVSLVKRANQHAQEQQGLEVIPALARTPEIIGEAPAMQEVFRAIGRLSHSNITVLINGESGTGKELVAHALHRHSPRAASPFIALNMAAIPKDLMESELFGHEKGAFTGAANLRRGRFEQADGGTLFLDEIGDMPADTQTRLLRVLADGEFYRVGGHTPVKVDVRIIAATHQNLETLVHAGKFREDLFHRLNVIRIHIPRLSDRREDIPTLAKHFLSRAAQELAVEPKLLKSETEEYLKNLPWPGNVRQLENTCRWITVMASGREVHISDLPPELLSLPQDSAPVTNWEQALRQWADQALARGQSSLLDSAVPSFERIMIETALKHTAGRRRDAAVLLGWGRNTLTRKIKELGMKVDGGDDDDSDEG
>CP027743.1|AZD45828.1|423112_424198_-|Nitrogen-regulation-protein-NtrB
MTISDQLHRLLLDNLTTATILLNADLRLEYMNPAAEMLLAISGQRSHGQFISELFTESAEALSSLRQAVEQAHPFTKREAMLTALTGQTLTVDYAVTPILSNGDTLLLLEVHPRDRLLRITKEEAQLSKQETSKMLVRGLAHEIKNPLGGIRGAAQLLARELPDENLKDYTNVIIEEADRLRNLVDRMLGSNKLPSLAMCNVHEVLERVSSLVEAESQGCITLVRDYDPSIPDVLIDREQMIQAVLNIVRNAMQAISSQNELRLGRICLRTRTMRQFTIGHVRHRLVTKIEIIDNGPGIPAELQETIFFPMVSGRPDGTGLGLAITQNIISQHQGLIECDSHPGHTTFSIFLPLEQGAPST
>CP027743.1|AZD45829.1|424194_424506_-|hypothetical-protein
MRRKFSARRAAGHSLAQPGINRTILVHQAAPSSIRSPFWFESTQRSRQNAAKENFKRLFQGSSASFRSLGLVFAFSRYQRLIRARNPGPARDCLVSKEVNIYP
>CP027743.1|AZD45830.1|424556_425969_-|putative-MFS-type-transporter
MNAAQHAAAHKKARKAGIASFIGTTIEWYDFYAYGIAAALVFGKVFFPADLPAGTATLLSFLTLWAGFIARPVGGIIFGHLGDKIGRKTTLVITLIMMGVATTCIGLLPSYLQIGIWAPTALVVLRIIQGIAVGGEWGGAILIASESAPKGKGILYAAFAQQGSPAGNLLATLVFFGLSALPAPDFLLWGWRIPFLLSAALVLVGMVIRLKLEESDDMKRLIQQKKTVKLPILEVLRNHWQIVLLGAGVLPIIHVTYFKSTFALSWATKELGYSQSTFLSVIVISLVVQFITQPLGAVLVSRMDMRKAVMLMLLPEFLLMPAMFFAVETGTYWIAVLGMCLATVPHSMFYGAVGGILARAFPTKVRYSGLSISYQLCSLLVGGATPVLAQGILNNTGSIVGVAIASACYALVSLVCMLLLLKRIGHNAADLSTAEQADADELAREPRVTPLIEGPATLQPSIDKDAQPAH
>CP027743.1|AZD45831.1|426164_427064_-|Transcriptional-regulator,-LysR-family
MDLKQLRYFVAVAEELHFGRAAARLFISQPALSFDIKKLESQLEVQLLTRNNKSVSLTNAGQVLLDEARYLLLRAEQARRLTLRSAQGFVGRLSIGFVNSILHRGLPQAVRTFEQDHPDTEIVLMEMNSAEQAQALQRGQIDIGFVHWSHFPESIRGEPVLAEPFLCCLPQGHRLAGESRIDLAQLANDDFILFPRNVSPHYHDLIIARCVAAGFSPRIRHETRLWQTVVAMVAYDMGVALVPQTLAGTWKEGVHYCEISGDGALSEIHAIRHADKPSAAAESFLTTLKALQKPVAPGL
>CP027743.1|AZD45832.1|427176_428898_+|Acyl-CoA-dehydrogenase
MTALPEPAQDTLNIPDSRGLNLFDCDAGLAALLKVYLPPQLFAQWLPTLRQLGGRAGGELDVLALSADKNPPQLRPRTRRGEDLQSIYKHPDFIALERAAYAELGLASMSHCAEPVLPLVKYALTFLFVQAEFGLCCPVSMTDSLTRTLRKFGSPELVARYLPSLASRDFDRLFQGAMFMTEQAAGSDVSRTETRARLENGEWRLFGDKWFCSNPDADLAMVLARPEDAPEGMKGVSLFLLPKLRPDGSRNAYRILRLKDKLGSRSMASGEISLDGATAYLIGEVGRGFQQMADMINMSRLSNGVRAAGLMRRGVNEALYVARHRRAFGRHLIEMPLMQRQLLKMMLPAEQARSMFMQIATLLPKADAGDEAARKCVRILTPLIKFRACRDARRVTGDAMEVRGGVGYIEEWSDARLVRDAHLGSIWEGTSNIVALDIARAVTREQALEPLRHYLAGLLAETDLPAASQRLFETVLQRAVAAIEKVAQERRDDQVRLAGSALYHTATAIFMAWEASRQAPDYRRLALAHLLLQHKLLPRDPLRPEPVLEPELLALLANESPLSKADAMQLLPA
>CP027743.1|AZD45833.1|428930_430118_+|L-carnitine-dehydratase/bile-acid-inducible-protein-F
MNHSKGALAGLKVIDLSRVLGGPYCSQALADHGAEVIKLEPLSGDETRGWGPPFEGADASYFRGVNRNKQGIAVDLSRPAGITLLMRLLEDADVLIENFKPGTLERWGIGYAEVLSQRFPTLIHCAVSGFGSDGPLGGLPGYDAVIQAMAGLMSVNGEADSGPLRIGLPIVDMVTGLNALAGILLALNERHRSGLGQSLDITLYDCGVSLLHPHLANYFAAGKTPLRTGNAHPNIAPYDSYRTGTEPIFLAVGNDRQFAKLCEQLDAGALLDDPRFADNGRRSVNREALKQVLEARLAEHDGTLLAQRLIRLGVPCGSIASIDKVVEHPHTRHRGLLVEIGDYRGVGSPVKLSRTPASYRTAPPALGANTREVLEGLGLDGQTIESLFEHGIVRE
>CP027743.1|AZD45834.1|430187_430982_+|Enoyl-CoA-hydratase/isomerase-family-protein
MNPESVSPQPLVLLEHPAPGVALLRLNRPQALNALNMALREELAEHFRRLDACPQTRVVVLTGGATVFAAGADLSELVNASALQLYARHAERHWQAISACRKPVIAAVNGYALGGGCELAMHCDLIVAGHSARFAQPEIKVGVMPGAGGTQRLLRAVGKFQALRLLLTGCQVPADEALRLGLVSEVVADSETLPRALALATSIAGMPPLAVAQIKEVVLAGMDLPLEQALVLERKAFQLLFGSHDQREGMQAFLEKRKPEYQGK
>CP027743.1|AZD45835.1|430978_432505_+|3-hydroxyacyl-CoA-dehydrogenase-PaaC
MTAQPLQRIGLVGTGAMGRGIAQVMAMAGLKVFLFDARPGAAGTAREQLATIFAQQIEKARITPQDAAAAMLNLEVVDSLEALCDCQLVIEAIVENLEAKQQLFRQLEEVLAPSAILASNTSSLSITAIASVCRHPERVAGLHFFNPVPRMRIVEVVDGLATRVGARLQELVRAIGYYPARAKDSPGFIVNHAGRAFGTEALRILSEGVAPAWRIDALLRDSAGFAMGPFELLDLIGLDVSVPVMESIYRQFYEEPRYRPHPVLRLMQAGGHLGRKSGQGFYLYDEPGDTRRPPQAVPHCAELPPVWIVADDEVGRLRLLDLLERLGAQVENGLRPSTSALCLVAPLGDDATEAALRHATDPSRTVAIDTLTTLDSQRCLMLNPATREDMQHAAHALFSADGGTVTIIRDSCGFIVQRTLASIVNLACDIAQQGIASVADIDAAVRLGLGYPLGPLEWGDQLGPERLLQILERLHALTGDPRYRPSGWLRRRALLGLSLRQPENPLPA
>CP027743.1|AZD45836.1|432540_433851_+|Acetyl-CoA-acetyltransferase
MLDAYIYSGLRTPFGRHGGSLASMRPDDLVGPLLVRLLETSGLPVEALEEVILGCTNQAGEDSRNLARNALLSAGLPWRVPGQTVNRLCASGLSAVIDAARAITCGEGRLYLAGGVESMSRAPFIMAKAESAYSRTLDVADSTIGARFANPKLVERYGNHSMPETGDNLARRFAISREDADRFAAASQARYQEALLAGVLDDEIMAVEVPIGRKGQSLTVCDDEHPRPRSDLAALSRLPTLFAEGVVTAGNASGINDGAAVLLLGSREIGMEHGVAPMARILSSASVGVEPQFMGIGPHRAILLALQRARIGLEQLDLIEINEAFAPQVLACLKALNLDFDDPRVNPNGGAIAIGHGDRARLRRSYRSALFRAGRKVGAPLANQRLICGGIRCGAALQCTDIFSGAGDGHGQRPLAVPTARRRYPVPRLARTRPGL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP027743_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027743_3

5177533-5177628

Orphan

Consensus_repeat	Method
TAGTACTGGGAATTTTTCCCAGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP027743_3

>merge|CP027743|3|5177533-5177628|CRISPRCasFinder
TAGTACTGGGAATTTTTCCCAGTCGTCAAGCGCTTACTGTCCCGTTGTGTCCCATTGTTTTTATGAACAGGTGTAGTACTGGGATTTTTTCCCAGT

>CP027743|3|3|5177533-5177628|CRISPRCasFinder
TAGTACTGGGAATTTTTCCCAGT	CGTCAAGCGCTTACTGTCCCGTTGTGTCCCATTGTTTTTATGAACAGGTG
TAGTACTGGGATTTTTTCCCAGT

Protein	Signature genes	Signature genes Name	Protein_function
CP027743.1\|AZD50077.1\|5177096_5177501_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379352
CP027743.1\|AZD50087.1\|5183889_5184111_+\|hypothetical-protein	unknown	unknown	unknown
CP027743.1\|AZD50079.1\|5178296_5178545_-\|hypothetical-protein	unknown	unknown	unknown
CP027743.1\|AZD50072.1\|5172015_5173128_+\|Aminotransferase,-DegT/DnrJ/EryC1/StrS-family	unknown	unknown	gnl\|CDD\|99740
CP027743.1\|AZD50068.1\|5167046_5168651_-\|Response-regulator-VieB	unknown	unknown	gnl\|CDD\|381123
CP027743.1\|AZD50075.1\|5176656_5176800_+\|hypothetical-protein	unknown	unknown	unknown
CP027743.1\|AZD50085.1\|5183211_5183475_+\|hypothetical-protein	unknown	unknown	unknown
CP027743.1\|AZD50084.1\|5182885_5183062_+\|hypothetical-protein	unknown	unknown	unknown
CP027743.1\|AZD50078.1\|5177973_5178300_-\|hypothetical-protein	unknown	unknown	unknown
CP027743.1\|AZD50080.1\|5178541_5178769_-\|hypothetical-protein	unknown	unknown	unknown
CP027743.1\|AZD50069.1\|5169036_5169969_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|368580
CP027743.1\|AZD50081.1\|5178882_5179113_-\|hypothetical-protein	unknown	unknown	unknown
CP027743.1\|AZD50070.1\|5170046_5171615_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|368006
CP027743.1\|AZD50083.1\|5181005_5182019_-\|hypothetical-protein	unknown	unknown	unknown
CP027743.1\|AZD50086.1\|5183471_5183903_+\|hypothetical-protein	unknown	unknown	unknown
CP027743.1\|AZD50076.1\|5176796_5177033_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379462
CP027743.1\|AZD50074.1\|5174592_5175804_+\|site-specific-recombinase,-phage-integrase-family	unknown	unknown	gnl\|CDD\|271177
CP027743.1\|AZD50082.1\|5179496_5180936_+\|hypothetical-protein	unknown	unknown	unknown
CP027743.1\|AZD50073.1\|5173147_5174326_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|187712
CP027743.1\|AZD50071.1\|5171611_5172010_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377522

Protein	Function_ID	Function_description	E-value
CP027743.1\|AZD50070.1\|5170046_5171615_+\|hypothetical-protein	gnl\|CDD\|368006	pfam04577, DUF563, Protein of unknown function (DUF563). Family of uncharacterized proteins.	3.63673e-27
CP027743.1\|AZD50077.1\|5177096_5177501_+\|hypothetical-protein	gnl\|CDD\|379352	pfam13730, HTH_36, Helix-turn-helix domain.	0.00508802
CP027743.1\|AZD50076.1\|5176796_5177033_+\|hypothetical-protein	gnl\|CDD\|379462	pfam14090, HTH_39, Helix-turn-helix domain. This helix-turn-helix domain is often found in phage proteins and is likely to be DNA-binding.	1.41114e-17
CP027743.1\|AZD50072.1\|5172015_5173128_+\|Aminotransferase,-DegT/DnrJ/EryC1/StrS-family	gnl\|CDD\|99740	cd00616, AHBA_syn, 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn). AHBA_syn family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The members of this CD are involved in various biosynthetic pathways for secondary metabolites. Some well studied proteins in this CD are AHBA_synthase, protein product of pleiotropic regulatory gene degT, Arnb aminotransferase and pilin glycosylation protein. The prototype of this family, the AHBA_synthase, is a dimeric PLP dependent enzyme. AHBA_syn is the terminal enzyme of 3-amino-5-hydroxybenzoic acid (AHBA) formation which is involved in the biosynthesis of ansamycin antibiotics, including rifamycin B. Some members of this CD are involved in 4-amino-6-deoxy-monosaccharide D-perosamine synthesis. Perosamine is an important element in the glycosylation of several cell products, such as antibiotics and lipopolysaccharides of gram-positive and gram-negative bacteria. The pilin glycosylation protein encoded by gene pglA, is a galactosyltransferase involved in pilin glycosylation. Additionally, this CD consists of ArnB (PmrH) aminotransferase, a 4-amino-4-deoxy-L-arabinose lipopolysaccharide-modifying enzyme. This CD also consists of several predicted pyridoxal phosphate-dependent enzymes apparently involved in regulation of cell wall biogenesis. The catalytic lysine which is present in all characterized PLP dependent enzymes is replaced by histidine in some members of this CD.	2.47561e-132
CP027743.1\|AZD50074.1\|5174592_5175804_+\|site-specific-recombinase,-phage-integrase-family	gnl\|CDD\|271177	cd00796, INT_Rci_Hp1_C, Shufflon-specific DNA recombinase Rci and Bacteriophage Hp1_like integrase, C-terminal catalytic domain. Rci protein is a tyrosine recombinase specifically involved in Shufflon type of DNA rearrangement in bacteria. The shufflon of plasmid R64 consists of four invertible DNA segments which are separated and flanked by seven 19-bp repeat sequences. RCI recombinase facilitates the site-specific recombination between any inverted repeats results in an inversion of the DNA segment(s) either independently or in groups. HP1 integrase promotes site-specific recombination of the HP1 genome into that of Haemophilus influenza. Bacteriophage Hp1_like integrases are tyrosine based site specific recombinases. They belong to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	1.80078e-37
CP027743.1\|AZD50068.1\|5167046_5168651_-\|Response-regulator-VieB	gnl\|CDD\|381123	cd17589, REC_TPR, phosphoacceptor receiver (REC) domain of uncharacterized tetratricopeptide repeat (TPR)-containing response regulators. Response regulators share the common phosphoacceptor REC domain and different output domains. This subfamily contains uncharacterized response regulators with TPR repeats as the effector or output domain, which might contain between 3 to 16 TPR repeats (each about 34 amino acids). TPR-containing proteins occur in all domains of life and the abundance of TPR-containing proteins in a bacterial proteome is not indicative of virulence. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays. Some members in this subfamily may contain inactive REC domains lacking canonical metal-binding and active site residues.	1.02531e-55
CP027743.1\|AZD50069.1\|5169036_5169969_+\|hypothetical-protein	gnl\|CDD\|368580	pfam05721, PhyH, Phytanoyl-CoA dioxygenase (PhyH). This family is made up of several eukaryotic phytanoyl-CoA dioxygenase (PhyH) proteins, ectoine hydroxylases and a number of bacterial deoxygenases. PhyH is a peroxisomal enzyme catalyzing the first step of phytanic acid alpha-oxidation. PhyH deficiency causes Refsum's disease (RD) which is an inherited neurological syndrome biochemically characterized by the accumulation of phytanic acid in plasma and tissues.	3.04982e-05
CP027743.1\|AZD50073.1\|5173147_5174326_-\|hypothetical-protein	gnl\|CDD\|187712	cd08369, FMT_core, Formyltransferase, catalytic core domain. Formyltransferase, catalytic core domain. The proteins of this superfamily contain a formyltransferase domain that hydrolyzes the removal of a formyl group from its substrate as part of a multistep transfer mechanism, and this alignment model represents the catalytic core of the formyltransferase domain. This family includes the following known members; Glycinamide Ribonucleotide Transformylase (GART), Formyl-FH4 Hydrolase, Methionyl-tRNA Formyltransferase, ArnA, and 10-Formyltetrahydrofolate Dehydrogenase (FDH). Glycinamide Ribonucleotide Transformylase (GART) catalyzes the third step in de novo purine biosynthesis, the transfer of a formyl group to 5'-phosphoribosylglycinamide. Formyl-FH4 Hydrolase catalyzes the hydrolysis of 10-formyltetrahydrofolate (formyl-FH4) to FH4 and formate. Methionyl-tRNA Formyltransferase transfers a formyl group onto the amino terminus of the acyl moiety of the methionyl aminoacyl-tRNA, which plays important role in translation initiation. ArnA is required for the modification of lipid A with 4-amino-4-deoxy-l-arabinose (Ara4N) that leads to resistance to cationic antimicrobial peptides (CAMPs) and clinical antimicrobials such as polymyxin. 10-formyltetrahydrofolate dehydrogenase (FDH) catalyzes the conversion of 10-formyltetrahydrofolate, a precursor for nucleotide biosynthesis, to tetrahydrofolate. Members of this family are multidomain proteins. The formyltransferase domain is located at the N-terminus of FDH, Methionyl-tRNA Formyltransferase and ArnA, and at the C-terminus of Formyl-FH4 Hydrolase. Prokaryotic Glycinamide Ribonucleotide Transformylase (GART) is a single domain protein while eukaryotic GART is a trifunctional protein that catalyzes the second, third and fifth steps in de novo purine biosynthesis.	4.07761e-37
CP027743.1\|AZD50071.1\|5171611_5172010_+\|hypothetical-protein	gnl\|CDD\|377522	pfam05523, FdtA, WxcM-like, C-terminal. This family includes FdtA from Aneurinibacillus thermoaerophilus, which has been characterized as a dtdp-6-deoxy-3,4-keto-hexulose isomerase. It also includes WxcM from Xanthomonas campestris (pv. campestris).	1.40515e-65

>CP027743.1|AZD50077.1|5177096_5177501_+|hypothetical-protein
MARKTKYKVDFGGGRVLALPYRLLISDAFDNLSTKAVTVLIKLARNYNGRNNGDLSCTTSMMAKGKSMDAKTLASALAELMDAGLIVRTRESRKGGREQGMARCALYAITWAAIDDCPGKDLEISPGPPRFRFI
>CP027743.1|AZD50076.1|5176796_5177033_+|hypothetical-protein
MTRHSSTEQDRKMMEALRNGPVSTIEAAKELDIVQPPNTIRRLRKKGHEIRTYWTYQSTEPDRPPHRVAKYILMREAS
>CP027743.1|AZD50075.1|5176656_5176800_+|hypothetical-protein
MTSVMPLETGSKWIQPGEQNDRESVKAVFEHRPNENTLDSTNVRNEL
>CP027743.1|AZD50074.1|5174592_5175804_+|site-specific-recombinase,-phage-integrase-family
MKDKLTAKLLASLQITGHEYEVHDTTVGGLFVRITAAGAKSYVVSWARGRKKTLGRVGILTLEQARAEATQYLAEARMLGEPLAVTQGRRGATLPTLREFIDDTYMPWFKTHHKGHEKTLHTLDHNFEAIMAQRLDAITGRDLDQIRTGWMQSGNKPSTVNRKMGSISGVFSRAVEWEYIDAHPMDRLKALKVDSMGLVRYLDAEETRRLREALDARQDEARTERERANKWRADRGKELMPSLLQVAFTDHLKPMVLVSLNTGMRRGELFDLKWSAVNFQTKTITAAGATTKTSDTRHIPMNKETVRVLEDWKKLAGKSQYVFPSQAGGRLEDVKSAWLKLLERANIEGFRWHDMRHDFASRLVMAGVPLNTVRDLLGHADIKMTLRYAHLAPGTKAAAVELI
>CP027743.1|AZD50073.1|5173147_5174326_-|hypothetical-protein
MIVIAGKNNISVFGLEQALQQFSPDEIAVVCNRNDTGVDGWQRSLRAAALKYGVREISLERAYELASVAFISLEFDRIVVPERFSISRVFNIHFSKLPEYKGMFTSVWPLLESRAEAGVTLHFIDRGIDTGDIVAQQVFPIPSWWTCRDLYFAFNQHAAQLLEQWFATLVDGDVKAQPQSAVGSSYFSKDAIDYGALKIDSLSTAWALRNQIRAFAFREYQFLRWEGKPVVSATILPGRSQFKAGTLINATEDYVELCTIDYDVRLSFDRLPEMLKACEQGDLEAVMALRANIAGYNDANPQGWTPLIVASYAGAYEVVDWLMQQGADPERTNNKGTTPLMYAKDAFLAGRCRKTFPLLLRKGAKLEAVDHSGRALADYVTSEQFAQLRGAF
>CP027743.1|AZD50072.1|5172015_5173128_+|Aminotransferase,-DegT/DnrJ/EryC1/StrS-family
MMNIPFLDLKGINHEYADQLKAACNRVIDSGWYLMGRELEQFEAAFAEYCGSQHAIGVANGLDALTLILRAWKEQGKLQAGDEVIVQSNTFIATISAILANDLAPILVDVDPATHNLEIEAVERAISDKTRVILPVHLYGQLSPMPQIMALAHKHGLLVLEDAAQAHGAELAGRKAGNWGDAAAFSFYPGKNLGALGDGGAITTNDAELAALVRALGNYGSRIKYQHDYQGVNSRLDEIQAAMLGVKLAHLDSDTARRRSVARYYSEHIQHPGITLPSVTTASAHVWHLYVITCPWRDQLKAYLAERGIQCLVHYPLAITEQRAYRDLARTSKASRAPLHDSILSLPIYPTLSQEQQQHIVTTINQFTAH
>CP027743.1|AZD50071.1|5171611_5172010_+|hypothetical-protein
MKIHILPLQTHGDDRGSLIALEEGKNIPFPVKRVYYMFNTGEGVRRGYHAHKTLKQVAIAVRGSCRFLLDDGREKIDITLDNPCQGLLIESFIWREMYNFSPDCVLMVLADQLYEEGDYVRDYAQFMDMVGQ
>CP027743.1|AZD50070.1|5170046_5171615_+|hypothetical-protein
MSTGFGQKARVLIFGTGAGGVNFYKYNRRRYRVIGFVDNNQQKQGQRLFGKLIHAPQQLSSLAFDKIIIASDYYREIHPQLTEKLAINEQKVEVFHGAQISSQLPWFQRIGKRLEQLGYERLCRKPGLISDLLYRLFFRRQDTRRLALRWLDESDEHKVHVFRPSQPGTSQPPRFIHQSTPAITLELPEIALYHFRQGQVCSVSRSVILPDGQLVLERVPTAKSLQADYRAAHLLYHGQRLALVRSGKPVELEKGLLISGCNEQNYYHWTVEVLSQLQFVAELPPHYADYPLLISKSSQNIPSIKALIEAIGVDRPLVLLENITSYQVTDLLLISAPNNMIPNFKGPAQNSASSGFVRPESIHFLREKALHLARDIPISELPKRVFLARKGFLRHYNQAEILKLLEPYGFTCVYMEEQDINHQVAIMANAEVIVGPTGAAWTNLIFASKNARALCWMAEEYAELSCFSNLAAVVGVEMDYIAYRVGSTDSRELYYRNYRVDAKSVENWLQQHLSKRLEGETR
>CP027743.1|AZD50069.1|5169036_5169969_+|hypothetical-protein
MQTCIQNLIDQGAHIFGEILDADRTQALYREMVAARAFGAGLFMDEAEYLAQENHLNANPNKTFNFLNGFEPQLQFIEQDPRLTAVLDEVLGADYEVVIKKAVCGVPDSWLPDWVREKIRDVNVANLGPYIKKPFRDITYFRGIDFHQDIIDWPQGRVELDPSTFLTLYVYLHEVTENDSPLHLMPGTHRFGATLFPHQLEHQEHDQWIYADDQGQQMACQDYRLTGGPGYVGLWHNCTLHGTRPVANESEQFRLSLRYLLGKSRSNTGKTAIDTINAAIQGELQPIRTRRDLNAKGIAQIKGNIINNNG
>CP027743.1|AZD50068.1|5167046_5168651_-|Response-regulator-VieB
MLAYHQKSFLIVDDFSDFRSSVRSMLRELGVKDVDTADTGEQALRMCAQKRYDFILQDYHLGDGKKNGQQVLEDLMTDKLISHESVFLMVTAETSQSMVLSALEHEPDAYLTKPFNRSSLAQRLERLQQRKSLLKPILQALDRGKPLEVLNACIALCKQDPRYSPLCLRYRADALRDMNQNEALERLYESILADRPLPWAYVGLGRLLFKRGQVTQAKAIYEKALKAFPMMPALYDGMAEVLLAEGDSKRAQSVLEEAVRLSPLAVRRQALLGKLAMTNEDFETASRAYRQAVSQGAQSRFKDPESNLGLAHALISKGSERGLDTRTRLEINSTLSAVAKENPSDPGLQIRARLMKATSLLLNDAETAEKLTEQAMLRLDGMEQFMSPEAALLVAKQLQMLGQADAGASMLKNCAEIYGDDPKVMEGIAKLTDDPAILNSANAAADMNRQGVRSYKAGALGEARDLFRRALAMQPKNISIALNMAQSLLHGTDITQDAALLEECRTCLKMVGLMPDTDARYPRYQKLRSKAFGE
>CP027743.1|AZD50078.1|5177973_5178300_-|hypothetical-protein
MSAAIQSRDDLSFTARDVEGRLINWPRNNPGVPADWEKGIACFDDEITEMAAHDETEAFNAIRFAIVGMGGWYTNLEIGFIDRVARAAVIGLRALRDGAEPFVPADTD
>CP027743.1|AZD50079.1|5178296_5178545_-|hypothetical-protein
MKLQTHANVASDAIDLIHSTREHVTWLTALLNAVRADVTHGKGLNVKALTGLGQYIGDDWANYLDCQTAELQEKLDAVEVAK
>CP027743.1|AZD50080.1|5178541_5178769_-|hypothetical-protein
MQLNQNTSNTPKDQGKALQGRLSRELSSKYCVCMLKVVMRFSDDQGRSGLIGADEAQVSTMARQCFNPGLKGGVQ
>CP027743.1|AZD50081.1|5178882_5179113_-|hypothetical-protein
MADQDKQKQPLSAAERQRLFKERQREAGFRHTTVWIHTETEGEGRQAARDGKPLKPQGSKDPVSWAIGWLNEKGKK
>CP027743.1|AZD50082.1|5179496_5180936_+|hypothetical-protein
MLFWEWERLESYVENNFFQISDPGKLLSPIRSVRVWRDQNLRIVMETKSAEHPMTARKQEHPPGTVRVNDDAVDFTSPGGGVARAFGVDIRKSKTHTNHQYGKHETVQTCSLHHFESNTSYKGAVAYTFDWIANVERGHYFWPDGVQESTQEISTRTLGYVTDPVTFTATSSDESGSRSCLDINVGGFRIILGSSKLATELDNTKPGYILYIGDPDEETRKRIRDSLSFALGFPIIYLGHAKHSEDFKLLSLKAINGYSMDGRAFNVPVMPPAPICTPPGSNMLDKGKVEKVVNSFFANYSSYSLSSLNWIYWHAVTAPAHMAAAYFGAAIEKIQKKYIDGQGKNFNNLIIPKQKYNALKRNIFAAIKECDLSTEDKKTFEEKINGGNVVSLKVRSQRFFDHIGLDMGSAELTAWQRRNDAAHGNELADGDYISLIRDTKLLKLILHRIVLKITVASVLYIDYYSLNFPEREVTHGVSE
>CP027743.1|AZD50083.1|5181005_5182019_-|hypothetical-protein
MPTPPLYNAVRNHDFAETTCFLCGDHVENNQRSREHVFPKWLLRHFSLRDHPLTLLNGTTVAYRNLVIPCCQTCNNEYLSNIEREVQTRFLKGAAEVASMDRGRLLLWVLKIFYGLLYRELFLPIDRRDPCAGSIVNAEDMEQFQLLHFVLQSCRVPMDFSIMDSDIPASIFVFEVQEPSNEDLRFDYKDDVVNRTLYLRLGKVGILAAFDMGAQTLPGAEYFSRFQGYALHPLQLAELGANLFMKARVLKRTPKVIIGESPDRVNFSVLSIGGLSSNPIFGSWESEDMAQMLMFFLGFPLDVVMPVKGRVATWLINNDGSLRTINLDTPPWVVPEK
>CP027743.1|AZD50084.1|5182885_5183062_+|hypothetical-protein
MNTAKTARGRQHKPTRSEVAAAWGRLRDAASEGSIQASALLIALAENKPVIAMESPAA
>CP027743.1|AZD50085.1|5183211_5183475_+|hypothetical-protein
MQACRLILERLVPPIKPTSEPVQFELDDTDLPSAAKSIMRAVAGGQLAPDQGKSLIEGLGAVARVIEVAELQKAVEELRTQMEGMQQ
>CP027743.1|AZD50086.1|5183471_5183903_+|hypothetical-protein
MSIKSLKAELQRIAQKIGAADESVVLIVLAVIRANTREIQAEEDFPKTAGHQVDYRIQGQNVSLFFPFAEMDSDQGEQMAKAIILHTRQTERAGRTPQVGVLNMRAVPEEGAWIVTWPPEGVSVEQHAAEQYKRIVEARNEHP
>CP027743.1|AZD50087.1|5183889_5184111_+|hypothetical-protein
MNIRNQIARLKQTAGDSQFSNDVRQISQLMDELSAEAVGGAAASGEASLLEIFNASTSSDRPTPIPNNPKVTQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1314372 : 1404201

Pseudomonas_phage(42.0%)

tRNA,tail,protease,plate

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZD46626.1\|1314372_1315725_+\|protease	Intramembrane protease RasP/YluC, implicated in cell division based on FtsL cleavage	NA	NA	NA	NA
AZD46627.1\|1315799_1318187_+	Outer membrane protein assembly factor YaeT	NA	NA	NA	NA
AZD46628.1\|1318232_1318736_+	Outer membrane chaperone Skp, precursor	NA	NA	NA	NA
AZD46629.1\|1318739_1319795_+	UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase	NA	NA	NA	NA
AZD46630.1\|1319904_1320345_+	3-hydroxyacyl-ACP dehydratase	NA	NA	NA	NA
AZD46631.1\|1320341_1321118_+	Acyl-ADP--UDP-N- acetylglucosamine O-acyltransferase	NA	NA	NA	NA
AZD46632.1\|1321120_1322251_+	Lipid-A-disaccharide synthase	NA	NA	NA	NA
AZD46633.1\|1322262_1322895_+	Ribonuclease HII	V5LS49	Emiliania_huxleyi_virus	1.7e-27	38.9
AZD46634.1\|1322964_1326489_+	DNA polymerase III alpha subunit	A0A2L1IZ23	Streptomyces_phage	1.1e-195	37.9
AZD46635.1\|1326629_1327577_+	Acetyl-coenzyme A carboxyl transferase alpha chain	NA	NA	NA	NA
AZD46636.1\|1327696_1329025_+\|tRNA	tRNA(Ile)-lysidine synthetase	NA	NA	NA	NA
AZD46637.1\|1329070_1329214_+	hypothetical protein	NA	NA	NA	NA
AZD46638.1\|1329299_1330931_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	6.9e-158	53.5
AZD46639.1\|1330936_1331782_+	2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase	E3T537	Cafeteria_roenbergensis_virus	1.2e-49	42.8
AZD46640.1\|1331939_1333229_+	Enolase	A0A1X9I5Z8	Streptococcus_phage	9.0e-137	59.2
AZD46641.1\|1333401_1333680_+	Cell division protein DivIC (FtsB), stabilizes FtsL against RasP cleavage	NA	NA	NA	NA
AZD46642.1\|1333676_1334384_+	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	NA	NA	NA	NA
AZD46643.1\|1334545_1335442_-	Transcriptional regulator, LysR family, in formaldehyde detoxification operon	NA	NA	NA	NA
AZD46644.1\|1335548_1336661_+	S-(hydroxymethyl)glutathione dehydrogenase	E3SJ82	Synechococcus_phage	8.3e-30	27.2
AZD46645.1\|1336749_1337595_+	S-formylglutathione hydrolase	NA	NA	NA	NA
AZD46646.1\|1337647_1338121_+	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
AZD46647.1\|1338117_1339176_+\|tRNA	tRNA pseudouridine(13) synthase	NA	NA	NA	NA
AZD46648.1\|1339163_1339913_+	5'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.4e-68	52.6
AZD46649.1\|1339912_1340590_+	Protein-L-isoaspartate O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	8.9e-43	52.0
AZD46650.1\|1340799_1341633_+	Murein hydrolase activator NlpD	A0A0S2SXL7	Bacillus_phage	6.3e-06	33.3
AZD46651.1\|1341739_1342744_+	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	5.0e-34	35.8
AZD46652.1\|1343245_1343569_-	4Fe-4S dicluster domain	NA	NA	NA	NA
AZD46653.1\|1343711_1346291_-	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	1.8e-27	23.5
AZD46654.1\|1346487_1347213_+	Transcriptional regulator	B5TK58	Pseudomonas_phage	3.8e-124	90.6
AZD46655.1\|1347952_1348534_+	hypothetical protein	NA	NA	NA	NA
AZD46656.1\|1348636_1348984_+	Holin	B5TK61	Pseudomonas_phage	7.7e-51	87.7
AZD46657.1\|1349150_1349915_+	N-acetylmuramoyl-L-alanine amidase	A0A1W6DX33	Sphingobium_phage	8.9e-07	26.8
AZD46658.1\|1349925_1350060_-	hypothetical protein	NA	NA	NA	NA
AZD46659.1\|1350138_1350663_+	hypothetical protein	NA	NA	NA	NA
AZD46660.1\|1350666_1351275_+\|plate	Baseplate assembly protein V	A0A2H4JBW8	uncultured_Caudovirales_phage	1.1e-47	59.7
AZD46661.1\|1351289_1351622_+\|plate	Baseplate assembly protein W	A0A2H4JI46	uncultured_Caudovirales_phage	2.1e-37	69.1
AZD46662.1\|1351618_1352614_+\|plate	Phage-related baseplate assembly protein	A0A2H4JC04	uncultured_Caudovirales_phage	1.6e-109	64.4
AZD46663.1\|1352610_1353246_+	Tail protein I	A0A2H4JDK0	uncultured_Caudovirales_phage	2.9e-43	53.1
AZD46664.1\|1353246_1354779_+\|tail	Prophage long tail fiber protein	A0A1I9KF43	Aeromonas_phage	4.2e-32	42.3
AZD46665.1\|1355317_1355539_+	hypothetical protein	NA	NA	NA	NA
AZD46666.1\|1355541_1356708_+\|tail	Major tail sheath protein	B0ZSG8	Halomonas_phage	1.9e-125	57.5
AZD46667.1\|1356707_1357214_+	hypothetical protein	Q6R4W3	Vibrio_virus	2.1e-25	36.9
AZD46668.1\|1357341_1357923_+	hypothetical protein	B0ZSH0	Halomonas_phage	2.6e-27	39.4
AZD46669.1\|1357919_1358045_+	hypothetical protein	NA	NA	NA	NA
AZD46670.1\|1358051_1360313_+	Phage protein	A0A2H4JAA5	uncultured_Caudovirales_phage	6.3e-08	41.7
AZD46671.1\|1360312_1360696_+\|tail	Unclassified tail protein	A0A2H4JAC8	uncultured_Caudovirales_phage	4.7e-33	53.5
AZD46672.1\|1360688_1360901_+\|tail	P2-like prophage tail protein X	A0A2H4JGD9	uncultured_Caudovirales_phage	3.9e-21	68.6
AZD46673.1\|1360910_1361930_+\|tail	Phage tail protein D	A0A2H4JH05	uncultured_Caudovirales_phage	7.2e-105	56.8
AZD46674.1\|1362110_1362695_+	hypothetical protein	B5TK65	Pseudomonas_phage	1.3e-74	71.0
AZD46675.1\|1362691_1362874_+	Mu-like prophage FluMu protein GP38	B5TK66	Pseudomonas_phage	6.5e-25	93.3
AZD46676.1\|1362873_1364370_+\|tail	Bacteriophage tail sheath protein	B5TK67	Pseudomonas_phage	1.0e-256	90.6
AZD46677.1\|1364436_1364784_+\|tail	Phage tail tube protein	B5TK68	Pseudomonas_phage	2.9e-58	93.9
AZD46678.1\|1364780_1365077_+\|tail	Phage small tail protein E	B5TK69	Pseudomonas_phage	2.3e-43	94.9
AZD46679.1\|1365207_1367283_+\|tail	Phage tail length tape-measure protein	B5TK70	Pseudomonas_phage	3.1e-38	48.2
AZD46680.1\|1367269_1368508_+\|tail	Phage tail/DNA circulation protein	B5TK71	Pseudomonas_phage	5.7e-181	75.7
AZD46681.1\|1368511_1369552_+\|tail	Prophage tail protein	B5TK72	Pseudomonas_phage	3.8e-162	82.7
AZD46682.1\|1369585_1370179_+\|plate	Prophage baseplate assembly protein V	B5TK73	Pseudomonas_phage	5.2e-79	89.3
AZD46683.1\|1370178_1370577_+	Bacteriophage protein GP46	B5TK74	Pseudomonas_phage	1.7e-65	89.4
AZD46684.1\|1370566_1371607_+	Phage FluMu protein gp47	B5TK75	Pseudomonas_phage	3.0e-167	87.3
AZD46685.1\|1371594_1372194_+\|tail	Prophage tail protein	B5TK76	Pseudomonas_phage	3.8e-106	92.0
AZD46686.1\|1372205_1373063_+\|tail	Prophage tail fiber protein	B5TK77	Pseudomonas_phage	1.5e-23	76.4
AZD46687.1\|1373067_1373709_+	hypothetical protein	B5TK78	Pseudomonas_phage	2.5e-39	61.9
AZD46688.1\|1373907_1374039_-	hypothetical protein	NA	NA	NA	NA
AZD46689.1\|1374092_1375646_+\|tail	Prophage tail fiber protein	A4PE45	Ralstonia_virus	1.4e-38	54.2
AZD46690.1\|1375647_1376118_+	hypothetical protein	A0A2H4EXG4	Aeromonas_phage	3.2e-07	35.0
AZD46691.1\|1376262_1376376_-	hypothetical protein	NA	NA	NA	NA
AZD46692.1\|1376512_1377577_+\|tail	Prophage tail fiber protein	B5TK79	Pseudomonas_phage	1.7e-117	58.5
AZD46693.1\|1377583_1378186_+\|tail	Putative tail fiber assembly protein p37	B5TK80	Pseudomonas_phage	5.5e-44	45.3
AZD46694.1\|1378207_1378771_+	Lytic enzyme	B5TK83	Pseudomonas_phage	2.2e-87	83.3
AZD46695.1\|1378752_1379289_+	hypothetical protein	B5TK84	Pseudomonas_phage	3.7e-60	70.2
AZD46696.1\|1379371_1379872_+	Nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	3.6e-73	86.7
AZD46697.1\|1379955_1381008_+	RecA protein	A0A0S2MVG1	Bacillus_phage	4.4e-113	60.9
AZD46698.1\|1381016_1381484_+	Regulatory protein RecX	NA	NA	NA	NA
AZD46699.1\|1381529_1382645_-	Decarboxylase family protein	NA	NA	NA	NA
AZD46700.1\|1383128_1383323_+	hypothetical protein	NA	NA	NA	NA
AZD46701.1\|1383324_1383747_-	Putative NADPH-quinone reductase (modulator of drug activity B)	NA	NA	NA	NA
AZD46702.1\|1383936_1384647_+	putative conserved protein YfiP, contains DTW domain	NA	NA	NA	NA
AZD46703.1\|1384982_1385633_+	Transcriptional regulator, LuxR family	NA	NA	NA	NA
AZD46704.1\|1385708_1386071_+	Diacylglycerol kinase	NA	NA	NA	NA
AZD46705.1\|1386067_1386994_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZD46706.1\|1387127_1387907_+	Ferredoxin--NADP(+) reductase	NA	NA	NA	NA
AZD46707.1\|1387979_1388708_-	S-adenosylmethionine-dependent methyltransferase YaeB	NA	NA	NA	NA
AZD46708.1\|1388796_1389567_-	Rhamnolipid biosynthesis 3-oxoacyl-ACP reductase RhlG	NA	NA	NA	NA
AZD46709.1\|1389701_1390163_-	Uncharacterized protein YehS	Q9EYF4	Enterobacteria_phage	8.5e-37	51.3
AZD46710.1\|1390229_1390940_-	Ribosomal large subunit pseudouridine synthase F	NA	NA	NA	NA
AZD46711.1\|1391022_1391496_-	Acetyltransferase	NA	NA	NA	NA
AZD46712.1\|1391602_1392940_-	Ribosomal protein S12p Asp88 methylthiotransferase	NA	NA	NA	NA
AZD46713.1\|1393134_1393311_-	hypothetical protein	NA	NA	NA	NA
AZD46714.1\|1393332_1395174_+	Kup system potassium uptake protein	M1HZV6	Acanthocystis_turfacea_Chlorella_virus	2.6e-76	35.3
AZD46715.1\|1395367_1396663_-	Alanylphosphatidylglycerol hydrolase, periplasmic	NA	NA	NA	NA
AZD46716.1\|1396662_1399311_-	Alanylphosphatidylglycerol synthase	NA	NA	NA	NA
AZD46717.1\|1400248_1401313_+	DNA polymerase IV	NA	NA	NA	NA
AZD46718.1\|1401514_1402468_-	putative lipoprotein	NA	NA	NA	NA
AZD46719.1\|1402485_1404201_-\|tRNA	Prolyl-tRNA synthetase, bacterial type	NA	NA	NA	NA

DBSCAN-SWA_2

2306685 : 2313943

Pseudomonas_phage(57.14%)

integrase

attL 2306007:2306020|attR 2314637:2314650

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2306007:2306020	attL	NA	NA	NA	NA
AZD47541.1\|2306685_2306988_+	Integration host factor alpha subunit	A0A0H3UZA0	Geobacillus_virus	1.8e-11	38.9
AZD47542.1\|2306968_2307325_+	Transcriptional regulator, MerR family	NA	NA	NA	NA
AZD47543.1\|2307762_2308443_-\|integrase	Phage integrase family protein	A0A059VF45	Pseudomonas_phage	3.0e-83	63.5
AZD47544.1\|2308610_2309012_-	hypothetical protein	A0A059VFY6	Pseudomonas_phage	2.0e-42	66.4
AZD47545.1\|2309051_2309630_-	hypothetical protein	NA	NA	NA	NA
AZD47546.1\|2309665_2310025_+	hypothetical protein	H2BDA0	Pseudomonas_phage	1.8e-18	51.3
AZD47547.1\|2310021_2310279_+	Lipoprotein	A0A125RNP3	Pseudomonas_phage	6.6e-23	69.1
AZD47548.1\|2310322_2310667_-	hypothetical protein	NA	NA	NA	NA
AZD47549.1\|2311051_2311453_-	Gifsy-2 prophage protein	A0A2H4J991	uncultured_Caudovirales_phage	3.8e-49	76.5
AZD47550.1\|2312040_2313036_+	hypothetical protein	NA	NA	NA	NA
AZD47551.1\|2313235_2313943_-	Gifsy-2 prophage protein	A0A2H4J991	uncultured_Caudovirales_phage	5.7e-93	70.0
2314637:2314650	attR	NA	NA	NA	NA

DBSCAN-SWA_3

4338665 : 4344923

uncultured_Caudovirales_phage(83.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZD49327.1\|4338665_4339058_+\|tRNA	tRNA 5-methylaminomethyl-2-thiouridine synthase subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	1.1e-58	83.8
AZD49328.1\|4339061_4339424_+\|tRNA	tRNA 5-methylaminomethyl-2-thiouridine synthase subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	2.5e-44	74.2
AZD49329.1\|4339423_4339723_+\|tRNA	tRNA 5-methylaminomethyl-2-thiouridine synthase subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	2.4e-32	69.7
AZD49330.1\|4339719_4340055_+\|tRNA	tRNA 2-thiouridine synthesis protein TusE	A0A2H4J8B6	uncultured_Caudovirales_phage	1.9e-46	82.0
AZD49331.1\|4340051_4341053_+	Anthranilate phosphoribosyltransferase like	A0A2H4JBY5	uncultured_Caudovirales_phage	1.2e-165	84.8
AZD49332.1\|4341141_4342149_+	Glutathione S-transferase, omega	NA	NA	NA	NA
AZD49333.1\|4342247_4343642_-	Precorrin-2 oxidase	NA	NA	NA	NA
AZD49334.1\|4343642_4344923_-\|tRNA	Seryl-tRNA synthetase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.7e-101	54.8

DBSCAN-SWA_4

5610682 : 5657281

Pseudomonas_phage(45.95%)

tail,holin,terminase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZD50502.1\|5610682_5611804_+	Exopolysaccharide production protein ExoZ	A0A2H4JA46	uncultured_Caudovirales_phage	1.0e-144	70.8
AZD50503.1\|5611839_5613777_-\|tail	Phage tail fiber protein	A0A2H4J3Z5	uncultured_Caudovirales_phage	2.5e-255	69.6
AZD50504.1\|5613847_5619967_-	hypothetical protein	K4NZ44	Pseudomonas_phage	7.2e-208	35.1
AZD50505.1\|5619963_5622066_-	Soluble lytic murein transglycosylase precursor	K4NWI2	Pseudomonas_phage	1.8e-89	34.5
AZD50506.1\|5622065_5622536_-	hypothetical protein	K4NYZ0	Pseudomonas_phage	9.3e-23	47.0
AZD50507.1\|5622538_5623006_-	hypothetical protein	A0A2R2ZGD5	Ralstonia_phage	6.6e-21	38.2
AZD50508.1\|5622992_5625335_-	hypothetical protein	K4NWU8	Pseudomonas_phage	1.9e-209	46.8
AZD50509.1\|5625331_5625931_-	hypothetical protein	NA	NA	NA	NA
AZD50510.1\|5625989_5626277_-	hypothetical protein	NA	NA	NA	NA
AZD50511.1\|5626286_5626727_-	hypothetical protein	A0A193GYT9	Enterobacter_phage	2.6e-35	58.3
AZD50512.1\|5626762_5627755_-	hypothetical protein	G9L6C5	Escherichia_phage	9.8e-107	56.4
AZD50513.1\|5627773_5628496_-\|protease	putative endoprotease	Q775C6	Bordetella_phage	3.9e-20	40.1
AZD50514.1\|5628492_5628813_-	hypothetical protein	NA	NA	NA	NA
AZD50515.1\|5628812_5630507_-\|tail	putative tail protein	K4NWH1	Pseudomonas_phage	1.5e-147	49.0
AZD50516.1\|5630508_5630862_-	hypothetical protein	NA	NA	NA	NA
AZD50517.1\|5630863_5632267_-\|terminase	Phage terminase, large subunit	Q2A0C1	Sodalis_phage	1.9e-148	56.0
AZD50518.1\|5632286_5632913_-	hypothetical protein	G8C7P2	Escherichia_phage	1.8e-42	52.6
AZD50519.1\|5633121_5633580_-	Endopeptidase	B5TK84	Pseudomonas_phage	7.9e-11	38.2
AZD50520.1\|5633591_5634023_-	hypothetical protein	A0A2H4J3Y5	uncultured_Caudovirales_phage	5.7e-19	49.6
AZD50521.1\|5634019_5634535_-	prophage LambdaSo, lysozyme, putative	I6X6V3	Burkholderia_virus	3.5e-55	62.6
AZD50522.1\|5634531_5634816_-\|holin	holin	A0A0U1UNM6	Pseudomonas_phage	1.0e-16	56.5
AZD50523.1\|5634991_5635186_-	hypothetical protein	W6MWX0	Pseudomonas_phage	3.6e-05	47.9
AZD50524.1\|5635339_5636221_-	hypothetical protein	J7HXH6	Pseudomonas_phage	2.5e-82	55.8
AZD50525.1\|5636258_5636357_-	hypothetical protein	NA	NA	NA	NA
AZD50526.1\|5636353_5636797_-	hypothetical protein	H2BD71	Pseudomonas_phage	1.3e-45	59.2
AZD50527.1\|5636993_5637329_-	hypothetical protein	NA	NA	NA	NA
AZD50528.1\|5637321_5638041_-	hypothetical protein	A0A2H4J6S4	uncultured_Caudovirales_phage	1.6e-98	74.4
AZD50529.1\|5638743_5639055_-	putative DNA-binding protein	NA	NA	NA	NA
AZD50530.1\|5639376_5640084_+	prophage MuSo1, transcriptional regulator, Cro/CI family	A0A2D1GNH0	Pseudomonas_phage	1.5e-40	39.3
AZD50531.1\|5640711_5640846_+	hypothetical protein	NA	NA	NA	NA
AZD50532.1\|5640874_5641354_+	hypothetical protein	NA	NA	NA	NA
AZD50533.1\|5642022_5642265_+	hypothetical protein	NA	NA	NA	NA
AZD50534.1\|5642261_5642411_+	hypothetical protein	NA	NA	NA	NA
AZD50535.1\|5642400_5642553_+	hypothetical protein	NA	NA	NA	NA
AZD50536.1\|5642549_5642726_+	hypothetical protein	NA	NA	NA	NA
AZD50537.1\|5642722_5642842_+	hypothetical protein	NA	NA	NA	NA
AZD50538.1\|5642851_5643067_+	hypothetical protein	B5WZV1	Pseudomonas_phage	1.6e-09	50.0
AZD50539.1\|5643076_5643595_+	Phage protein	J7I0S8	Pseudomonas_phage	3.3e-45	56.1
AZD50540.1\|5643591_5644398_+	hypothetical protein	J7HXJ4	Pseudomonas_phage	9.7e-113	72.5
AZD50541.1\|5644403_5644634_+	hypothetical protein	J7I4L3	Pseudomonas_phage	4.5e-15	62.9
AZD50542.1\|5644630_5645578_+	hypothetical protein	J7HXB6	Pseudomonas_phage	1.0e-124	82.8
AZD50543.1\|5645585_5645786_+	hypothetical protein	A0A2H4J6K7	uncultured_Caudovirales_phage	1.1e-17	63.6
AZD50544.1\|5645797_5646856_+	DNA translocase FtsK	A0A2H4J7E6	uncultured_Caudovirales_phage	6.0e-70	48.4
AZD50545.1\|5646862_5648617_+	hypothetical protein	J7HXJ7	Pseudomonas_phage	7.3e-97	41.1
AZD50546.1\|5648681_5649293_+	DNA polymerase III alpha subunit	A0A2H4J7C9	uncultured_Caudovirales_phage	4.1e-87	76.4
AZD50547.1\|5649292_5649502_+	hypothetical protein	NA	NA	NA	NA
AZD50548.1\|5649517_5649832_+	hypothetical protein	A0A2H4J405	uncultured_Caudovirales_phage	7.0e-35	76.0
AZD50549.1\|5649831_5650089_+	hypothetical protein	NA	NA	NA	NA
AZD50550.1\|5650085_5650262_+	hypothetical protein	A0A2H4J6V8	uncultured_Caudovirales_phage	5.0e-14	70.7
AZD50551.1\|5650254_5650518_+	hypothetical protein	A0A2H4J2S6	uncultured_Caudovirales_phage	1.2e-14	60.3
AZD50552.1\|5650614_5650860_+	hypothetical protein	NA	NA	NA	NA
AZD50553.1\|5651293_5652382_+	Polyphosphate kinase 2	NA	NA	NA	NA
AZD50554.1\|5652447_5653791_-	sensor histidine kinase	W8CYF6	Bacillus_phage	3.5e-14	24.5
AZD50555.1\|5653787_5654486_-	DNA-binding response regulator GltR, controls specific porins for the entry of glucose	W8CYM9	Bacillus_phage	8.3e-28	35.3
AZD50556.1\|5654666_5655455_+	Outer-membrane-phospholipid-binding lipoprotein MlaA	NA	NA	NA	NA
AZD50557.1\|5655441_5655714_+	hypothetical protein	NA	NA	NA	NA
AZD50558.1\|5655811_5657281_+	hypothetical protein	A0A2H4JEI9	uncultured_Caudovirales_phage	1.2e-95	57.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP027743

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection