CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
CP033467	Enterobacter cloacae strain E3442 plasmid p3442-FRI-1, complete sequence	0 crisprs	RT	0	0
CP033469	Enterobacter cloacae strain E3442 plasmid p3442-IncR, complete sequence	1 crisprs	NA	1	1
CP033468	Enterobacter cloacae strain E3442 plasmid p3442-IMI-2, complete sequence	0 crisprs	DEDDh,WYL	0	1
CP033466	Enterobacter cloacae strain E3442 chromosome, complete genome	0 crisprs	DEDDh,DinG,cas3,csa3,WYL	0	5

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP033469_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP033469_1

1582-1672

Orphan

Consensus_repeat	Method
ATGAAATCATGATTTCATCCTTTCAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP033469_1

>merge|CP033469|1|1582-1672|CRISPRCasFinder
TTGAAAGGATGAAATCATGATTTCATCCTTTCATGAAAGTGGGGGGCTGAGGTGTTAATCCGGAAATGAAATCATGATTTCATCATTTCAT

>CP033469|1|1|1582-1672|CRISPRCasFinder
TTGAAAGGATGAAATCATGATTTCAT	CCTTTCATGAAAGTGGGGGGCTGAGGTGTTAATCCGGAA
ATGAAATCATGATTTCATCATTTCAT

Protein	Signature genes	Signature genes Name	Protein_function
CP033469.1\|AYU97919.1\|5705_5912_-\|hypothetical-protein	unknown	unknown	unknown
CP033469.1\|AYU97865.1\|5348_5660_-\|hypothetical-protein	unknown	unknown	unknown
CP033469.1\|AYU97867.1\|6831_7242_+\|PIN-domain-containing-protein	unknown	unknown	gnl\|CDD\|350229
CP033469.1\|AYU97862.1\|3424_4207_-\|phage-integrase-family-protein	unknown	unknown	gnl\|CDD\|334163
CP033469.1\|AYU97868.1\|7568_8198_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|183332
CP033469.1\|AYU97864.1\|4991_5321_-\|hypothetical-protein	unknown	unknown	unknown
CP033469.1\|AYU97866.1\|6604_6835_+\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|226863
CP033469.1\|AYU97863.1\|4203_4539_-\|hypothetical-protein	unknown	unknown	unknown
CP033469.1\|AYU97918.1\|4545_4902_-\|hypothetical-protein	unknown	unknown	unknown
CP033469.1\|AYU97917.1\|944_1271_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377141
CP033469.1\|AYU97861.1\|1935_2562_-\|dna-binding-plasmid-partition-protein	unknown	unknown	gnl\|CDD\|349760
CP033469.1\|AYU97859.1\|144_867_+\|RepB-family-plasmid-replication-initiator-protein	unknown	unknown	gnl\|CDD\|376444

Protein	Function_ID	Function_description	E-value
CP033469.1\|AYU97866.1\|6604_6835_+\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	gnl\|CDD\|226863	COG4456, VagC, Virulence-associated protein and related proteins [Function unknown].	6.15693e-10
CP033469.1\|AYU97867.1\|6831_7242_+\|PIN-domain-containing-protein	gnl\|CDD\|350229	cd09881, PIN_VapC4-5_FitB-like, VapC-like PIN domain of Mycobacterium tuberculosis VapC4 and VapC5, and Neisseria gonorrhoeae FitB and related proteins. This family includes the Virulence associated protein C (VapC)-like PIN (PilT N terminus) domain of Mycobacterium tuberculosis VapC4 and VapC5 ribonuclease toxins of the VapBC toxin/antitoxin (TA) system, and Neisseria gonorrhoeae FitB toxin of the FitAB TA system. This family belongs to the VapC-like family of the PIN domain nuclease superfamily. VapC is the PIN-domain ribonuclease toxin from prokaryotic VapBC toxin-antitoxin (TA) systems. VapB is a transcription factor-like protein antitoxin acting as an inhibitor. Other members of the VapC-like nuclease family include eukaryotic ribonucleases such as Smg6, ribosome assembly factor NOB1, exosome subunit Rrp44 endoribonuclease and rRNA-processing protein Fcf1. The structural properties of the PIN (PilT N terminus) domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions, in some members, additional metal coordinating residues can be found. Some members of the superfamily lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	2.38198e-36
CP033469.1\|AYU97868.1\|7568_8198_-\|hypothetical-protein	gnl\|CDD\|183332	PRK11832, PRK11832, hydrogen peroxide resistance inhibitor IprA.	1.14146e-17
CP033469.1\|AYU97917.1\|944_1271_-\|hypothetical-protein	gnl\|CDD\|377141	pfam03833, PolC_DP2, DNA polymerase II large subunit DP2.	0.00202257
CP033469.1\|AYU97862.1\|3424_4207_-\|phage-integrase-family-protein	gnl\|CDD\|334163	pfam00589, Phage_integrase, Phage integrase family. Members of this family cleave DNA substrates by a series of staggered cuts, during which the protein becomes covalently linked to the DNA through a catalytic tyrosine residue at the carboxy end of the alignment. The catalytic site residues in CRE recombinase are Arg-173, His-289, Arg-292 and Tyr-324.	6.40271e-36
CP033469.1\|AYU97859.1\|144_867_+\|RepB-family-plasmid-replication-initiator-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	1.82506e-54
CP033469.1\|AYU97861.1\|1935_2562_-\|dna-binding-plasmid-partition-protein	gnl\|CDD\|349760	cd02042, ParAB_family, partition proteins ParAB family. ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the initiation of DNA replication. ParB regulates the ParA ATPase activity by promoting nucleotide exchange in a fashion reminiscent of the exchange factors of eukaryotic G proteins. ADP-bound ParA binds single-stranded DNA, whereas the ATP-bound form dissociates ParB from its DNA binding sites. Increasing the fraction of ParA-ADP in the cell inhibits cell division, suggesting that this simple nucleotide switch may regulate cytokinesis. ParA shares sequence similarity to a conserved and widespread family of ATPases which includes the repA protein of the repABC operon in Rhizobium etli symbiotic plasmid. This operon is involved in the plasmid replication and partition.	8.8233e-15

>CP033469.1|AYU97917.1|944_1271_-|hypothetical-protein
MPNCGKQVNFADGPECGKQVNFADGPDCGKQVNFADGPDCGKHVNFADGPDCGKQVNFADCLNCGKQVNFADGRDCGKQVNFMASRECGKEVNLEGSPNCGKQVKFGM
>CP033469.1|AYU97859.1|144_867_+|RepB-family-plasmid-replication-initiator-protein
MDTQALLPATKTFKKRASIKQSNELTEAAYYLPLQAKRVLWLCLMQAYFNDSQDDDPDVLPLFKISVSDYVKYFNVATSVASRDVKAGVNALGESTVTFYPKEGEFEEVKRPWLAEAGMKRGRGSWQIEFNYKVMPFLVGLTSQFTTYSLYDCGQLNSVRVIRLYESLCQFRSTGVWITTHDWLCERFMLPTSQKNNIAEMKRTFLEPALKKINEKTPLKVSYTTEEDGRLLFNFLDKKQ
>CP033469.1|AYU97861.1|1935_2562_-|dna-binding-plasmid-partition-protein
MGKVISIVGQKGGGSKSTKARTLAVGFTEAGWKTHLADIDTKQQTSLKWTERRENNGLSQIDCALYRRVDTAVKMKDSCHLLIIDGRPAAETTSLDVADESDLVIITTGTTIDDLEPSLELARELIKKGIEKNKIVFIVAKSPSQSQGEKAQETIKAWGFKVLNTIIPFKTSYGEALDAGRALHETPFKSLNETAKQMIEEIHAIINS
>CP033469.1|AYU97862.1|3424_4207_-|phage-integrase-family-protein
MMPAIPGHGVSFSAAQLPVAIDYPAALALRQLALAHDELPKYMLSPEVSALLHYIPDLYRKTMVATLWNSGARVNEAVALDRTDFLLQPPYPFVKLATLKQRSEKAARTAGRAPAGSQVHRLVPLSDPLYVSQLEMMVATLKIPLERKNKKTGKMEKARIWNITDRTVRTWLNEAVEAAAADGVRFSVPVTPHTFRHSYAMHMLYNGIPLKVLQSLMGHKSISSTEVYTKVFALDVAARHRVKFQMPESEAVAMLKGNYQ
>CP033469.1|AYU97863.1|4203_4539_-|hypothetical-protein
MNHDLMAVQAASEIVELLTLCQELQSEKDGRERPAPGAYSRDEDAFAERIRSACGHALLLRRLLPVTTTLSAIGAEMERRGEISVLPGEDYAQKALARLTEHYLSNGDIIQ
>CP033469.1|AYU97918.1|4545_4902_-|hypothetical-protein
MATAFSTMRKYGMNILTATQHMDINAYVKSDPRMPRMRLRRYLGQYGLRGEALNREVRRIVAGPERRDSMLQEGIYYTWPYGWEPADFTPMMRRIFRGKRTRHVMLFDELPQLFGKSG
>CP033469.1|AYU97864.1|4991_5321_-|hypothetical-protein
MCDLCRADGNYFHTPECVYDQLVSEYPVMWLRDSTRIGACYTLRELLSPEGMVLAIQNAPPVTGWRLRMQYNEATDEEINPQRGDCTELPSRTDALLAFRSLQDDTASA
>CP033469.1|AYU97865.1|5348_5660_-|hypothetical-protein
MGMFDTVTFRYRLPDGVTGTEFQTKDLDCECESYEISAEGRLFRWTGDGTRSDTCFDGMLTHLSADDGYHLYFEQGTLAWIEVYSQGDRRWPFEPGRFMPDPA
>CP033469.1|AYU97919.1|5705_5912_-|hypothetical-protein
MSAPDLADDIANVRSLTNRCVETSRTGHVLQLECQTMSLRVMTADYARAVRARELTGERREAAPTTTN
>CP033469.1|AYU97866.1|6604_6835_+|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein
MRTVSIFKNGNNRAIRLPRDLDFEGVSELVIVREGDSIILRPVRPTWGSFAQFEKADPDFMAERGDVVSDEGRFNL
>CP033469.1|AYU97867.1|6831_7242_+|PIN-domain-containing-protein
MNKTYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITWSEISFAARAAGPVTQQLAEAFCARLDAILPWDRAAVDATTEVKVALRLAGTPPGPNDTAIAGHAIAAGAVLVTRIGGEFERVPGLMLEDWVK
>CP033469.1|AYU97868.1|7568_8198_-|hypothetical-protein
MMMTSISAQLAAERIIDNIESADCFHRVVAGEKQTIPFRQKETQYVYCLCAGEAEVRRLSDDTVVAYVKAPAVTGLTLREKDTIFHYLRTTRPAELMAVRQERALRLIEEQSLWQEAFTLCVDVVNKCYIRDEAFASRNVYGIVRQHLEMLWEMDEEQRSRFSAFEFILSRTTVSRSSLNKILKALSTGGYITMRRGRLMDKKSLPANY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP033469_1	1.1\|1608\|39\|CP033469\|CRISPRCasFinder	1608-1646	39	NZ_CP033469	Enterobacter cloacae strain E3442 plasmid p3442-IncR, complete sequence	1608-1646	0	1.0

1. spacer 1.1|1608|39|CP033469|CRISPRCasFinder matches to NZ_CP033469 (Enterobacter cloacae strain E3442 plasmid p3442-IncR, complete sequence) position: , mismatch: 0, identity: 1.0

cctttcatgaaagtggggggctgaggtgttaatccggaa	CRISPR spacer
cctttcatgaaagtggggggctgaggtgttaatccggaa	Protospacer
***************************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3424 : 65135

Stx2-converting_phage(20.0%)

integrase,plate,transposase

attL 730:743|attR 21509:21522

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
730:743	attL	NA	NA	NA	NA
AYU97862.1\|3424_4207_-\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	7.3e-49	85.7
AYU97863.1\|4203_4539_-	hypothetical protein	NA	NA	NA	NA
AYU97918.1\|4545_4902_-	hypothetical protein	NA	NA	NA	NA
AYU97864.1\|4991_5321_-	hypothetical protein	NA	NA	NA	NA
AYU97865.1\|5348_5660_-	hypothetical protein	NA	NA	NA	NA
AYU97919.1\|5705_5912_-	hypothetical protein	NA	NA	NA	NA
AYU97866.1\|6604_6835_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
AYU97867.1\|6831_7242_+	PIN domain-containing protein	NA	NA	NA	NA
AYU97868.1\|7568_8198_-	hypothetical protein	NA	NA	NA	NA
AYU97869.1\|8404_8899_-	conjugal transfer protein	NA	NA	NA	NA
AYU97920.1\|9778_10060_-	cytoplasmic protein	NA	NA	NA	NA
AYU97870.1\|10067_10850_-	DsbA family protein	NA	NA	NA	NA
AYU97871.1\|11544_12876_-	hypothetical protein	NA	NA	NA	NA
AYU97872.1\|12862_14200_-	hypothetical protein	NA	NA	NA	NA
AYU97873.1\|14289_14760_-	hypothetical protein	NA	NA	NA	NA
AYU97874.1\|14774_15230_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
AYU97875.1\|15229_15775_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
AYU97876.1\|15752_16838_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
AYU97877.1\|16801_18556_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
AYU97878.1\|18598_20200_-	type VI secretion system protein TssA	NA	NA	NA	NA
AYU97879.1\|20199_23652_-	type VI secretion protein VasK	NA	NA	NA	NA
21509:21522	attR	NA	NA	NA	NA
AYU97880.1\|23635_24775_-	hypothetical protein	NA	NA	NA	NA
AYU97881.1\|24771_25029_-	PAAR domain-containing protein	NA	NA	NA	NA
AYU97882.1\|25048_27502_-	DUF2235 domain-containing protein	NA	NA	NA	NA
AYU97883.1\|27489_28020_-	DUF3304 domain-containing protein	NA	NA	NA	NA
AYU97884.1\|28088_28619_-	DUF3304 domain-containing protein	NA	NA	NA	NA
AYU97885.1\|28708_29461_-	DUF4123 domain-containing protein	NA	NA	NA	NA
AYU97886.1\|29461_31840_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	2.9e-19	34.8
AYU97887.1\|31836_34491_-	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	1.7e-92	31.9
AYU97888.1\|34667_35159_-	Hcp family type VI secretion system effector	NA	NA	NA	NA
AYU97889.1\|35163_36867_-	OmpA family protein	NA	NA	NA	NA
AYU97890.1\|36863_37553_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
AYU97891.1\|37549_38890_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
AYU97892.1\|38907_40455_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
AYU97893.1\|40488_40986_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
AYU97894.1\|41250_41883_+	hypothetical protein	NA	NA	NA	NA
AYU97895.1\|43544_43871_-	hypothetical protein	NA	NA	NA	NA
AYU97896.1\|44651_44963_+	hypothetical protein	A0A0U2RK18	Escherichia_phage	8.0e-15	48.6
AYU97897.1\|45043_45640_+	hypothetical protein	NA	NA	NA	NA
AYU97898.1\|47545_47893_-\|transposase	transposase	A0A0P0ZDM8	Stx2-converting_phage	2.8e-40	67.9
AYU97899.1\|47892_48306_-\|transposase	transposase	A0A0P0ZCV4	Stx2-converting_phage	2.0e-13	39.3
AYU97900.1\|48539_49601_-	restriction endonuclease	NA	NA	NA	NA
AYU97901.1\|50190_53232_-\|transposase	Tn3 family transposase	NA	NA	NA	NA
AYU97902.1\|53381_53960_+	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	1.0e-26	39.1
AYU97903.1\|53962_54265_+	cytoplasmic protein	NA	NA	NA	NA
AYU97904.1\|54270_54633_+	hypothetical protein	NA	NA	NA	NA
AYU97905.1\|54661_54934_+	arylsulfatase regulator	NA	NA	NA	NA
AYU97906.1\|55084_56347_+	DNA (cytosine-5-)-methyltransferase	E5E3X6	Burkholderia_phage	1.4e-211	84.8
AYU97907.1\|56397_57636_+	restriction endonuclease	E5E3X4	Burkholderia_phage	1.1e-128	55.7
AYU97908.1\|57991_58210_+	hypothetical protein	NA	NA	NA	NA
AYU97909.1\|59139_60096_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AYU97910.1\|60211_61213_+	C4-dicarboxylate ABC transporter	NA	NA	NA	NA
AYU97911.1\|61275_61602_+	QacE family quaternary ammonium compound efflux SMR transporter	NA	NA	NA	NA
AYU97912.1\|61704_61836_+	hypothetical protein	NA	NA	NA	NA
AYU97921.1\|64193_65135_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	2.0e-72	54.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP033468

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

7934 : 39662

Salmonella_phage(21.43%)

transposase,protease,integrase

attL 11642:11656|attR 41541:41555

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYU97779.1\|7934_8099_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AYU97780.1\|8137_8539_-	hypothetical protein	NA	NA	NA	NA
AYU97781.1\|8605_9064_-	hypothetical protein	NA	NA	NA	NA
AYU97782.1\|9463_10093_-	resolvase	NA	NA	NA	NA
AYU97783.1\|10261_13249_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.8e-292	53.1
11642:11656	attL	NA	NA	NA	NA
AYU97784.1\|13768_14377_+	DUF2913 family protein	NA	NA	NA	NA
AYU97785.1\|14373_15327_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	2.3e-76	56.4
AYU97786.1\|15383_15563_-	hypothetical protein	NA	NA	NA	NA
AYU97787.1\|15603_16221_-	serine recombinase	A0A219Y912	Aeromonas_phage	2.0e-09	32.3
AYU97788.1\|16645_16852_-	hypothetical protein	NA	NA	NA	NA
AYU97789.1\|16898_17186_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A2H4JBF4	uncultured_Caudovirales_phage	5.8e-20	48.4
AYU97790.1\|17182_17434_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
AYU97791.1\|17695_17989_-	CopG family transcriptional regulator	NA	NA	NA	NA
AYU97792.1\|17988_18627_-	chromosome partitioning protein ParA	A0A222YXS3	Escherichia_phage	2.9e-43	45.8
AYU97793.1\|19986_20994_+\|integrase	site-specific integrase	NA	NA	NA	NA
AYU97794.1\|21199_23188_+\|integrase	site-specific integrase	NA	NA	NA	NA
AYU97795.1\|23353_23809_-	hypothetical protein	NA	NA	NA	NA
AYU97796.1\|23925_24474_-	3'-5' exonuclease	A0A2K9L1H6	Tupanvirus	1.6e-05	26.7
AYU97797.1\|24570_25467_-	AAA family ATPase	B2YG10	Musca_hytrovirus	6.7e-06	25.8
AYU97798.1\|25466_25955_-	hypothetical protein	NA	NA	NA	NA
AYU97799.1\|25951_26896_-	nucleotidyltransferase	NA	NA	NA	NA
AYU97800.1\|27066_27966_+	WYL domain-containing protein	NA	NA	NA	NA
AYU97801.1\|27995_29513_+	purine phosphorylase	NA	NA	NA	NA
AYU97802.1\|29735_29909_-	DNA repair protein	I6RSM4	Salmonella_phage	7.6e-15	77.6
AYU97803.1\|29908_30331_-	peptidase	A0A1W6JNS2	Morganella_phage	2.2e-31	53.0
AYU97804.1\|30510_31182_-	DNA breaking-rejoining protein	A0A2H4J5W2	uncultured_Caudovirales_phage	1.6e-81	60.8
AYU97805.1\|31343_32549_+\|transposase	IS256-like element ISEae1 family transposase	A0A220NQR7	Corynebacterium_phage	7.0e-91	48.1
AYU97806.1\|33720_34221_-	DUF1566 domain-containing protein	NA	NA	NA	NA
AYU97807.1\|34266_35145_-	carbapenem-hydrolyzing class A beta-lactamase IMI-2	A0A1B0VBP7	Salmonella_phage	3.1e-64	48.9
AYU97808.1\|35286_36171_+	LysR family transcriptional regulator	NA	NA	NA	NA
AYU97854.1\|36378_37585_+\|transposase	IS3 family transposase	Q9ZXG3	Shigella_phage	2.5e-96	62.0
AYU97809.1\|37721_38264_-	flavodoxin family protein	NA	NA	NA	NA
AYU97810.1\|38456_39662_+\|transposase	IS256-like element ISEae1 family transposase	A0A220NQR7	Corynebacterium_phage	7.0e-91	47.8
41541:41555	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. CP033466

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

458716 : 469061

Catovirus(22.22%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYU93921.1\|458716_459403_+	hypothetical protein	A0A1V0SBR5	Catovirus	2.0e-10	36.0
AYU93922.1\|459404_460418_+	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	1.2e-83	48.3
AYU93923.1\|460431_461178_+	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	1.2e-11	35.8
AYU93924.1\|461314_462721_+	NADP-dependent phosphogluconate dehydrogenase	M4QQM4	Ostreococcus_lucimarinus_virus	5.2e-37	28.3
AYU93925.1\|462810_463896_+	dTDP-glucose 4,6-dehydratase	A0A291LAD7	Escherichia_phage	3.7e-99	52.6
AYU93926.1\|463896_464778_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	1.2e-103	62.7
AYU93927.1\|465017_466184_+	UDP-glucose 6-dehydrogenase	A0A1J0FA55	Only_Syngen_Nebraska_virus	4.1e-112	54.0
AYU93928.1\|466233_467238_-	NAD-dependent epimerase	A0A2K9L0I7	Tupanvirus	2.5e-33	29.0
AYU93929.1\|467430_468411_+	LPS O-antigen chain length determinant protein WzzB	NA	NA	NA	NA
AYU93930.1\|468449_469061_-	bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE	A0A2H4UVM0	Bodo_saltans_virus	3.5e-14	28.0

DBSCAN-SWA_2

1240581 : 1247831

Escherichia_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYU94604.1\|1240581_1241436_+	benzoate transporter	M1I711	Paramecium_bursaria_Chlorella_virus	8.1e-25	33.2
AYU94605.1\|1241538_1241844_+	DUF1161 domain-containing protein	NA	NA	NA	NA
AYU94606.1\|1241974_1244413_+	dimethyl sulfoxide reductase subunit A	A0A077SK27	Escherichia_phage	6.8e-218	49.8
AYU94607.1\|1244423_1245041_+	dimethylsulfoxide reductase subunit B	A0A077SL61	Escherichia_phage	3.4e-73	58.6
AYU94608.1\|1245042_1245897_+	dimethylsulfoxide reductase	A0A077SK59	Escherichia_phage	4.4e-23	34.6
AYU94609.1\|1245941_1246556_+	Tat proofreading chaperone DmsD	A0A077SLS7	Escherichia_phage	1.5e-28	34.7
AYU94610.1\|1246666_1246978_+	DNA damage-inducible SOS regulon protein	NA	NA	NA	NA
AYU94611.1\|1247153_1247831_-	type A chloramphenicol O-acetyltransferase	G3CFL0	Escherichia_phage	4.2e-77	63.1

DBSCAN-SWA_3

2681827 : 2688481

Enterobacteria_phage(100.0%)

capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYU95910.1\|2681827_2684161_-	DNA primase	Q7M2A8	Enterobacteria_phage	0.0e+00	83.1
AYU95911.1\|2684175_2684496_-	hypothetical protein	NA	NA	NA	NA
AYU97624.1\|2684492_2684720_-	hypothetical protein	NA	NA	NA	NA
AYU95912.1\|2684824_2685274_-	hypothetical protein	Q7M298	Enterobacteria_phage	3.7e-45	69.9
AYU95913.1\|2685266_2685566_-	Derepression protein	Q7M2A0	Enterobacteria_phage	1.1e-32	71.1
AYU95914.1\|2685558_2686113_-	host cell division inhibitor Icd-like protein	Q7M2A7	Enterobacteria_phage	6.6e-36	73.0
AYU95915.1\|2686109_2686376_-	AlpA family transcriptional regulator	Q7M299	Enterobacteria_phage	4.4e-22	62.5
AYU95916.1\|2686924_2687668_+\|capsid	capsid protein	NA	NA	NA	NA
AYU95917.1\|2687670_2687889_+	hypothetical protein	Q7M294	Enterobacteria_phage	1.3e-16	68.2
AYU95918.1\|2687917_2688481_+	Polarity suppression protein	Q7M2A1	Enterobacteria_phage	6.7e-60	64.8

DBSCAN-SWA_4

2795321 : 2862847

Vibrio_phage(18.18%)

transposase,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYU96014.1\|2795321_2796326_-\|protease	protease modulator HflC	NA	NA	NA	NA
AYU96015.1\|2796328_2797588_-\|protease	FtsH protease activity modulator HflK	A0A1L2CVV0	Pectobacterium_phage	3.6e-05	25.5
AYU96016.1\|2797644_2798925_-	GTPase HflX	NA	NA	NA	NA
AYU96017.1\|2798999_2799311_-	RNA-binding protein Hfq	NA	NA	NA	NA
AYU96018.1\|2799396_2800347_-\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
AYU96019.1\|2800339_2802184_-	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	6.4e-59	30.3
AYU96020.1\|2802193_2803540_-	N-acetylmuramoyl-L-alanine amidase AmiB	A0A067ZJB6	Vibrio_phage	2.6e-17	30.1
AYU96021.1\|2803556_2804018_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
AYU96022.1\|2804010_2805534_-	bifunctional ADP-dependent NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase	NA	NA	NA	NA
AYU96023.1\|2805532_2806672_+\|tRNA	tRNA epoxyqueuosine(34) reductase QueG	NA	NA	NA	NA
AYU96024.1\|2807456_2808002_-	oligoribonuclease	Q8B5Y0	Diachasmimorpha_longicaudata_entomopoxvirus	2.6e-29	41.0
AYU96025.1\|2808076_2809162_+	small ribosomal subunit biogenesis GTPase RsgA	NA	NA	NA	NA
AYU97629.1\|2809259_2810228_+	phosphatidylserine decarboxylase	NA	NA	NA	NA
AYU96026.1\|2810247_2813571_+	miniconductance mechanosensitive channel MscM	NA	NA	NA	NA
AYU96027.1\|2813607_2815107_-	glutamate/gamma-aminobutyrate family transporter YjeM	NA	NA	NA	NA
AYU96028.1\|2815285_2816263_-	elongation factor P--(R)-beta-lysine ligase	A0A2K9KZX5	Tupanvirus	5.8e-27	28.8
AYU96029.1\|2816573_2818364_+	fumarate reductase (quinol) flavoprotein subunit	NA	NA	NA	NA
AYU96030.1\|2818356_2819091_+	succinate dehydrogenase/fumarate reductase iron-sulfur subunit	NA	NA	NA	NA
AYU96031.1\|2819101_2819497_+	fumarate reductase subunit FrdC	NA	NA	NA	NA
AYU96032.1\|2819507_2819867_+	fumarate reductase subunit FrdD	NA	NA	NA	NA
AYU96033.1\|2819896_2820772_-	transcriptional activator AmpR	NA	NA	NA	NA
AYU96034.1\|2820904_2822050_+	cephalosporin-hydrolyzing class C beta-lactamase ACT-45	NA	NA	NA	NA
AYU96035.1\|2822208_2822739_+	hypothetical protein	A0A1W6JNX6	Morganella_phage	4.4e-45	51.6
AYU96036.1\|2822735_2823053_-	quaternary ammonium compound efflux SMR transporter SugE	NA	NA	NA	NA
AYU96037.1\|2823315_2823915_+	DNA-binding response regulator	NA	NA	NA	NA
AYU96038.1\|2823952_2824099_-	lipoprotein toxin entericidin B	NA	NA	NA	NA
AYU96039.1\|2824207_2824339_-	entericidin A/B family lipoprotein	NA	NA	NA	NA
AYU96040.1\|2824396_2824963_-	elongation factor P	NA	NA	NA	NA
AYU96041.1\|2825003_2826032_+	EF-P beta-lysylation protein EpmB	NA	NA	NA	NA
AYU96042.1\|2826097_2826451_-	DUF4156 domain-containing protein	NA	NA	NA	NA
AYU96043.1\|2826684_2827332_+	hypothetical protein	NA	NA	NA	NA
AYU96044.1\|2827328_2827790_+	hypothetical protein	NA	NA	NA	NA
AYU96045.1\|2827800_2828964_+	beta-aspartyl-peptidase	NA	NA	NA	NA
AYU96046.1\|2829029_2830676_-	chaperonin GroEL	A0A2I7SAK5	Vibrio_phage	6.9e-190	69.3
AYU96047.1\|2830716_2831010_-	co-chaperone GroES	K4F9I2	Cronobacter_phage	2.1e-12	43.3
AYU96048.1\|2831188_2832436_+	L-methionine/branched-chain amino acid transporter	NA	NA	NA	NA
AYU96049.1\|2832459_2832930_-	membrane protein FxsA	NA	NA	NA	NA
AYU96050.1\|2833259_2834696_+	aspartate ammonia-lyase	NA	NA	NA	NA
AYU96051.1\|2834812_2836114_+	anaerobic C4-dicarboxylate transporter	NA	NA	NA	NA
AYU96052.1\|2836227_2836551_+	divalent cation tolerance protein CutA	NA	NA	NA	NA
AYU96053.1\|2836526_2838236_+	protein-disulfide reductase DsbD	NA	NA	NA	NA
AYU96054.1\|2838285_2838861_+	transcriptional regulator	NA	NA	NA	NA
AYU96055.1\|2838857_2839448_-	LysE family translocator	NA	NA	NA	NA
AYU96056.1\|2839485_2840331_-	AraC family transcriptional regulator	NA	NA	NA	NA
AYU96057.1\|2840769_2842023_+	DUF4102 domain-containing protein	Q7M297	Enterobacteria_phage	9.3e-78	38.3
AYU96058.1\|2842883_2843999_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AYU96059.1\|2847519_2847867_-\|transposase	transposase	A0A0P0ZDM8	Stx2-converting_phage	3.8e-42	71.0
AYU96060.1\|2848583_2849929_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	2.4e-76	51.7
AYU97630.1\|2850126_2850261_-	hypothetical protein	NA	NA	NA	NA
AYU97631.1\|2850421_2850646_-	hypothetical protein	NA	NA	NA	NA
AYU96061.1\|2851446_2851629_-	hypothetical protein	NA	NA	NA	NA
AYU96062.1\|2851639_2852278_-	hypothetical protein	NA	NA	NA	NA
AYU96063.1\|2854374_2855073_-	EAL domain-containing protein	NA	NA	NA	NA
AYU96064.1\|2855852_2856077_-	hypothetical protein	NA	NA	NA	NA
AYU96065.1\|2856242_2856434_+	hypothetical protein	NA	NA	NA	NA
AYU96066.1\|2859670_2860216_+	LuxR family transcriptional regulator	NA	NA	NA	NA
AYU96067.1\|2862110_2862239_+	hypothetical protein	NA	NA	NA	NA
AYU96068.1\|2862334_2862568_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AYU96069.1\|2862586_2862847_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_5

4410989 : 4453048

Salmonella_phage(23.08%)

tail,protease,terminase,holin,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYU97462.1\|4410989_4412165_-	DUF3596 domain-containing protein	I6PDJ1	Cronobacter_phage	3.8e-142	66.2
AYU97463.1\|4412125_4412332_-	excisionase	I6PBM8	Cronobacter_phage	1.4e-23	77.0
AYU97464.1\|4412366_4412939_-	3'-5' exoribonuclease	K7PLW7	Enterobacteria_phage	4.3e-91	81.3
AYU97465.1\|4412935_4413223_-	hypothetical protein	NA	NA	NA	NA
AYU97466.1\|4413219_4413417_-	hypothetical protein	NA	NA	NA	NA
AYU97467.1\|4413404_4413944_-	HD family hydrolase	A0A192Y8M4	Salmonella_phage	5.9e-74	75.1
AYU97468.1\|4414078_4414909_-	DUF2303 family protein	Q8HAA2	Salmonella_phage	2.2e-136	89.4
AYU97469.1\|4414965_4415337_-	hypothetical protein	Q8HAA1	Salmonella_phage	2.2e-56	90.2
AYU97470.1\|4415963_4416590_-	LexA family transcriptional regulator	K7PM82	Enterobacteria_phage	7.2e-47	48.8
AYU97471.1\|4416689_4416905_+	cell division protein	NA	NA	NA	NA
AYU97472.1\|4416927_4417476_+	DNA-binding protein	A0A1C9II13	Salmonella_phage	1.9e-67	67.6
AYU97473.1\|4417648_4417828_+	DUF4222 domain-containing protein	S5M7S5	Escherichia_phage	8.6e-14	69.2
AYU97474.1\|4417817_4418681_+	GntR family transcriptional regulator	U5P0A0	Shigella_phage	5.8e-39	83.9
AYU97673.1\|4418680_4419577_+	phage N-6-adenine-methyltransferase	Q8HA94	Salmonella_phage	8.5e-134	76.5
AYU97475.1\|4419569_4421387_+	DNA cytosine methyltransferase	H9C171	Pectobacterium_phage	1.3e-200	56.2
AYU97476.1\|4421401_4422094_+	phage regulatory protein/antirepressor Ant	G0ZND1	Cronobacter_phage	9.0e-59	55.1
AYU97477.1\|4422090_4423152_+	DUF968 domain-containing protein	A0A291AWV9	Escherichia_phage	2.7e-110	55.1
AYU97478.1\|4423173_4423866_+	antitermination protein	NA	NA	NA	NA
AYU97479.1\|4423987_4424680_+	hypothetical protein	NA	NA	NA	NA
AYU97480.1\|4424844_4425897_+	site-specific DNA-methyltransferase	A5LH81	Enterobacteria_phage	1.3e-170	80.3
AYU97481.1\|4425966_4426308_+\|holin	phage holin, lambda family	Q8SBE1	Shigella_phage	5.7e-30	57.9
AYU97482.1\|4426294_4426735_+	lysozyme	A0A0M4R365	Salmonella_phage	4.1e-57	76.5
AYU97483.1\|4426731_4427277_+	hypothetical protein	K7PHH7	Enterobacteria_phage	9.0e-70	84.6
AYU97484.1\|4427486_4427990_+	DUF1441 family protein	K7PJY2	Enterobacterial_phage	3.4e-47	62.3
AYU97485.1\|4427993_4430114_+\|terminase	phage terminase large subunit family protein	A5LH27	Enterobacteria_phage	1.9e-304	74.7
AYU97486.1\|4430110_4430326_+	hypothetical protein	NA	NA	NA	NA
AYU97487.1\|4431841_4433899_+\|protease	Clp protease ClpP	S5M7Q8	Escherichia_phage	4.6e-199	53.2
AYU97488.1\|4433967_4434303_+	DUF2190 family protein	Q9EYD5	Enterobacteria_phage	9.9e-11	42.7
AYU97489.1\|4434302_4434659_+	hypothetical protein	NA	NA	NA	NA
AYU97490.1\|4434660_4435323_+	hypothetical protein	R9TR34	Vibrio_phage	4.2e-21	34.8
AYU97491.1\|4435331_4435886_+	hypothetical protein	NA	NA	NA	NA
AYU97492.1\|4435878_4436502_+\|plate	phage baseplate assembly protein V	Q8HAB9	Salmonella_phage	7.2e-07	30.8
AYU97493.1\|4436540_4438010_+\|tail	phage tail protein	R9TMQ0	Vibrio_phage	1.9e-77	46.5
AYU97494.1\|4438006_4438513_+\|tail	phage tail protein	NA	NA	NA	NA
AYU97495.1\|4438564_4438852_+\|tail	phage tail assembly protein	NA	NA	NA	NA
AYU97496.1\|4441095_4441566_+\|tail	phage tail protein	D4HTW5	Vibrio_phage	3.8e-16	33.8
AYU97674.1\|4441540_4441756_+\|tail	phage tail protein	R9TR63	Vibrio_phage	1.8e-13	52.9
AYU97497.1\|4441758_4442877_+	late control protein D	R9TNM7	Vibrio_phage	7.8e-36	32.6
AYU97498.1\|4442913_4443267_+\|plate	baseplate assembly protein	V5YTB2	Pseudomonas_phage	6.5e-21	48.2
AYU97499.1\|4443250_4444165_+\|plate	baseplate assembly protein	V5YTH6	Pseudomonas_phage	6.3e-60	46.0
AYU97500.1\|4444157_4444709_+\|tail	phage tail protein I	A0A0F7LDF3	Escherichia_phage	4.3e-27	41.0
AYU97501.1\|4444711_4446889_+\|tail	phage tail protein	A0A0M3ULF6	Salmonella_phage	2.5e-54	39.1
AYU97502.1\|4446888_4447467_+\|tail	tail assembly chaperone	E5G6P1	Salmonella_phage	5.2e-52	54.9
AYU97503.1\|4447543_4448614_+	hypothetical protein	NA	NA	NA	NA
AYU97504.1\|4448654_4449059_-	type II toxin-antitoxin system HicB family antitoxin	Q775F5	Haemophilus_virus	3.1e-35	49.2
AYU97505.1\|4449080_4449236_-	type II toxin-antitoxin system HicA family toxin	A0A0D4DC32	Acinetobacter_phage	1.2e-16	78.4
AYU97675.1\|4449531_4449771_+	hypothetical protein	K7P7E2	Enterobacteria_phage	2.7e-26	69.2
AYU97506.1\|4449770_4450088_+	hypothetical protein	K7PGV5	Enterobacterial_phage	3.3e-24	51.9
AYU97676.1\|4450097_4450769_-	SOS response-associated peptidase	A0A2H4J5W2	uncultured_Caudovirales_phage	5.1e-83	62.2
AYU97677.1\|4451027_4451948_-	hypothetical protein	NA	NA	NA	NA
AYU97507.1\|4452565_4453048_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	6.8e-29	46.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP033469

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP033468

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. CP033466

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection