CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP030937	Bacillus sp. DM2 chromosome, complete genome	1 crisprs	csa3,DinG,cas3,DEDDh,WYL	0	1	10	0
CP030938	Bacillus sp. DM2 plasmid unnamed, complete sequence	0 crisprs	NA	0	0	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP030937_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP030937_2

3177281-3177388

Orphan

Consensus_repeat	Method
TGATGGGAATCGAACCCACGACAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP030937_2

>merge|CP030937|2|3177281-3177388|CRISPRCasFinder
TGATGGGAATCGAACCCACGACATCAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGATTGATGGGAATCGAACCCACGAATG

>CP030937|2|2|3177281-3177388|CRISPRCasFinder
TGATGGGAATCGAACCCACGACAT	CAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGAT
TGATGGGAATCGAACCCACGAATG

Protein	Signature genes	Signature genes Name	Protein_function
CP030937.1\|AXF34378.1\|3164267_3164702_-\|hypothetical-protein	unknown	unknown	unknown
CP030937.1\|AXF34385.1\|3172594_3173626_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	unknown	unknown	gnl\|CDD\|273966
CP030937.1\|AXF34394.1\|3191863_3192406_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|224427
CP030937.1\|AXF34387.1\|3174788_3176672_-\|1,4-alpha-glucan-branching-enzyme	unknown	unknown	gnl\|CDD\|273667
CP030937.1\|AXF34391.1\|3187807_3188296_+\|DinB-family-protein	unknown	unknown	gnl\|CDD\|378981
CP030937.1\|AXF34393.1\|3190192_3191665_-\|betaine-aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143437
CP030937.1\|AXF34390.1\|3185565_3187095_-\|flotillin-family-protein	unknown	unknown	gnl\|CDD\|225177
CP030937.1\|AXF34386.1\|3173649_3174792_-\|glucose-1-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|179997
CP030937.1\|AXF35532.1\|3188967_3190176_-\|alcohol-dehydrogenase-EutG	unknown	unknown	gnl\|CDD\|341481
CP030937.1\|AXF34379.1\|3164703_3165759_-\|spore-coat-protein-S	unknown	unknown	gnl\|CDD\|131952
CP030937.1\|AXF34381.1\|3167096_3168170_+\|CotS-family-spore-coat-protein	unknown	unknown	gnl\|CDD\|131952
CP030937.1\|AXF35531.1\|3187115_3187640_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376684
CP030937.1\|AXF34380.1\|3165773_3166907_-\|glycosyltransferase-family-1-protein	unknown	unknown	gnl\|CDD\|340831
CP030937.1\|AXF34395.1\|3192603_3193149_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379999
CP030937.1\|AXF34392.1\|3188301_3188880_-\|MOSC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377051
CP030937.1\|AXF34382.1\|3168262_3168730_+\|tryptophan-rich-sensory-protein	unknown	unknown	gnl\|CDD\|226007
CP030937.1\|AXF34384.1\|3171143_3172598_-\|glycogen-synthase-GlgA	unknown	unknown	gnl\|CDD\|234809
CP030937.1\|AXF34383.1\|3168760_3171157_-\|glycogen/starch/alpha-glucan-phosphorylase	unknown	unknown	gnl\|CDD\|273967
CP030937.1\|AXF34389.1\|3185026_3185548_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224168
CP030937.1\|AXF34388.1\|3184406_3184985_+\|thiamine-transporter-ThiT	unknown	unknown	gnl\|CDD\|226377

Protein	Function_ID	Function_description	E-value
CP030937.1\|AXF34385.1\|3172594_3173626_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	gnl\|CDD\|273966	TIGR02092, Glycogen_biosynthesis_protein_GlgD, glucose-1-phosphate adenylyltransferase, GlgD subunit. This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, TIGR02091) in a subset of bacteria that use GlgC for glycogen biosynthesis. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
CP030937.1\|AXF34394.1\|3191863_3192406_+\|transcriptional-regulator	gnl\|CDD\|224427	COG1510, COG1510, Predicted transcriptional regulators [Transcription].	1.21185e-72
CP030937.1\|AXF34387.1\|3174788_3176672_-\|1,4-alpha-glucan-branching-enzyme	gnl\|CDD\|273667	TIGR01515, branching_enzym, alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase. This model describes the glycogen branching enzymes which are responsible for the transfer of chains of approx. 7 alpha(1--4)-linked glucosyl residues to other similar chains (in new alpha(1--6) linkages) in the biosynthesis of glycogen. This enzyme is a member of the broader amylase family of starch hydrolases which fold as (beta/alpha)8 barrels, the so-called TIM-barrel structure. All of the sequences comprising the seed of this model have been experimentally characterized. This model encompasses both bacterial and eukaryotic species. No archaea have this enzyme, although Aquifex aolicus does. Two species, Bacillus thuringiensis and Clostridium perfringens have two sequences each which are annotated as amylases. These annotations are aparrently in error. GP\|18143720 from C. perfringens, for instance, contains the note "674 aa, similar to gp:A14658_1 amylase (1,4-alpha-glucan branching enzyme (EC 2.4.1.18) ) from Bacillus thuringiensis (648 aa); 51.1% identity in 632 aa overlap." A branching enzyme from Porphyromonas gingivales, OMNI\|PG1793, appears to be more closely related to the eukaryotic species (across a deep phylogenetic split) and may represent an instance of lateral transfer from this species' host. A sequence from Arabidopsis thaliana, GP\|9294564, scores just above trusted, but appears either to contain corrupt sequence or, more likely, to be a pseudogene as some of the conserved catalytic residues common to the alpha amylase family are not conserved here. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
CP030937.1\|AXF34391.1\|3187807_3188296_+\|DinB-family-protein	gnl\|CDD\|378981	pfam12867, DinB_2, DinB superfamily. The DinB family are an uncharacterized family of potential enzymes. The structure of these proteins is composed of a four helix bundle.	3.20062e-17
CP030937.1\|AXF34393.1\|3190192_3191665_-\|betaine-aldehyde-dehydrogenase	gnl\|CDD\|143437	cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like. Included in this CD is the NAD+-dependent, betaine aldehyde dehydrogenase (BADH, GbsA, EC=1.2.1.8) of Bacillus subtilis involved in the synthesis of the osmoprotectant glycine betaine from choline or glycine betaine aldehyde.	0
CP030937.1\|AXF34390.1\|3185565_3187095_-\|flotillin-family-protein	gnl\|CDD\|225177	COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown].	1.47358e-122
CP030937.1\|AXF34386.1\|3173649_3174792_-\|glucose-1-phosphate-adenylyltransferase	gnl\|CDD\|179997	PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional.	0
CP030937.1\|AXF35532.1\|3188967_3190176_-\|alcohol-dehydrogenase-EutG	gnl\|CDD\|341481	cd08551, Fe-ADH, iron-containing alcohol dehydrogenases (Fe-ADH)-like. This family contains large metal-containing alcohol dehydrogenases (ADH), known as iron-containing alcohol dehydrogenases. They contain a dehydroquinate synthase-like protein structural fold and mostly contain iron. They are distinct from other alcohol dehydrogenases which contains different protein domains. There are several distinct families of alcohol dehydrogenases: Zinc-containing long-chain alcohol dehydrogenases, insect-type, or short-chain alcohol dehydrogenases, iron-containing alcohol dehydrogenases, among others. The iron-containing family has a Rossmann fold-like topology that resembles the fold of the zinc-dependent alcohol dehydrogenases, but lacks sequence homology, and differs in strand arrangement. ADH catalyzes the reversible oxidation of alcohol to acetaldehyde with the simultaneous reduction of NAD(P)+ to NAD(P)H.	1.69004e-175
CP030937.1\|AXF34379.1\|3164703_3165759_-\|spore-coat-protein-S	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	3.56293e-130
CP030937.1\|AXF34381.1\|3167096_3168170_+\|CotS-family-spore-coat-protein	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	2.35695e-133
CP030937.1\|AXF35531.1\|3187115_3187640_-\|hypothetical-protein	gnl\|CDD\|376684	pfam01957, NfeD, NfeD-like C-terminal, partner-binding. NfeD-like proteins are widely distributed throughout prokaryotes and are frequently associated with genes encoding stomatin-like proteins (slipins). There appear to be three major groups: an ancestral group with only an N-terminal serine protease domain and this C-terminal beta sheet-rich domain which is structurally very similar to the OB-fold domain, associated with its neighboring slipin cluster; a second major group with an additional middle, membrane-spanning domain, associated in some species with eoslipin and in others with yqfA; a final 'artificial' group which unites truncated forms lacking the protease region and associated with their ancestral gene partner, either yqfA or eoslipin. This NefD, C-terminal, domain appears to be the major one for relating to the associated protein. NfeD homologs are clearly reliant on their conserved gene neighbor which is assumed to be necessary for function, either through direct physical interaction or by functioning in the same pathway, possibly involve with lipid-rafts.	0.000174975
CP030937.1\|AXF34380.1\|3165773_3166907_-\|glycosyltransferase-family-1-protein	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	2.08958e-74
CP030937.1\|AXF34395.1\|3192603_3193149_+\|hypothetical-protein	gnl\|CDD\|379999	pfam17735, BslA, Biofilm surface layer A. This family includes members such as BslA (previously called YuaB). Secreted BslA from Bacillus subtillis has been shown to form surface layers around the biofilm self-assembling at interfaces of B. subtilis biofilms, forming an elastic film. structural analysis revealed that BslA consists of an Ig-type fold with the addition of an unusual, extremely hydrophobic cap region. The hydrophobic cap exhibits physiochemical properties similar to the hydrophobic surface found in fungal hydrophobins; thus, BslA is defined as member of a class of bacterially produced hydrophobins.	5.35887e-46
CP030937.1\|AXF34392.1\|3188301_3188880_-\|MOSC-domain-containing-protein	gnl\|CDD\|377051	pfam03473, MOSC, MOSC domain. The MOSC (MOCO sulfurase C-terminal) domain is a superfamily of beta-strand-rich domains identified in the molybdenum cofactor sulfurase and several other proteins from both prokaryotes and eukaryotes. These MOSC domains contain an absolutely conserved cysteine and occur either as stand-alone forms or fused to other domains such as NifS-like catalytic domain in Molybdenum cofactor sulfurase. The MOSC domain is predicted to be a sulfur-carrier domain that receives sulfur abstracted by the pyridoxal phosphate-dependent NifS-like enzymes, on its conserved cysteine, and delivers it for the formation of diverse sulfur-metal clusters.	5.86032e-06
CP030937.1\|AXF34382.1\|3168262_3168730_+\|tryptophan-rich-sensory-protein	gnl\|CDD\|226007	COG3476, COG3476, Tryptophan-rich sensory protein (mitochondrial benzodiazepine receptor homolog) [Signal transduction mechanisms].	8.80778e-40
CP030937.1\|AXF34384.1\|3171143_3172598_-\|glycogen-synthase-GlgA	gnl\|CDD\|234809	PRK00654, glgA, glycogen synthase GlgA.	0
CP030937.1\|AXF34383.1\|3168760_3171157_-\|glycogen/starch/alpha-glucan-phosphorylase	gnl\|CDD\|273967	TIGR02093, Glycogen_phosphorylase, glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
CP030937.1\|AXF34389.1\|3185026_3185548_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224168	COG1247, COG1247, Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane].	1.32253e-10
CP030937.1\|AXF34388.1\|3184406_3184985_+\|thiamine-transporter-ThiT	gnl\|CDD\|226377	COG3859, COG3859, Predicted membrane protein [Function unknown].	1.328e-72

>CP030937.1|AXF34387.1|3174788_3176672_-|1,4-alpha-glucan-branching-enzyme
MAAASPTAHDVYLFHEGSLFKSYQLFGSHYRELNGKSGYEFCVWAPHASEVRVAGDFNSWSGEEHVMHRVNDNGIWTLFIPSIGEKERYKYEIVTNNGEIRLKADPYAIYSEVRPNTASLTYDLEGYSWQDQKWQKKQKAKTLYEKPVFIYELHLGSWKKHSDGRHYSYKELSQTLIPYIKEHGFTHIELLPVYEHPYDRSWGYQGTGYYSPTSRFGTPHDLMKFVDECHQQNIGVILDWVPGHFCKDAHGLYMFDGEPLYEYKEERDRENWLWGTANFDLGKPEVHSFLISNALYWAEFYHIDGFRVDAVANILYWPNQDERHTNPYAVDFLKKLNQTMREAYPHVIMIAEDSTEWPQVTGAVEEGGLGFHYKWNMGWMNDVLKYMETPPEERRHCHQLISFSLLYAFSEHFVLPFSHDEVVYGKKSLLNKMPGDYWQKFAQYRLLLGYMTVHPGKKLIFMGSEFAQFDEWKDTEQLDWFLDSFPMHQKASVFTQDLLRFYQKSKILYEHDHRAQSFEWIDVHNDEQSIFSFIRYGKKHGEALVIICNFTPVVYHQYDVGVPFFTQYIEVLNSDSETYGGSGQINKKPLSAKKGALHHKPCYITMTIPPYGISILRAVKKRGEIKR
>CP030937.1|AXF34386.1|3173649_3174792_-|glucose-1-phosphate-adenylyltransferase
MKKQCVAMLLAGGKGSRLSGLTKNMAKPAVSFGGKYRIIDFTLSNCSNSGIDTVGILTQYQPLELNSYIGIGSAWDLDRYNGGVTVLPPYAESSEVKWYKGTASAIYENLNYLNQYDPEYVLILSGDHIYKMDYGKMLDYHIEKKADVTISVIEVGWEEASRFGIMKANPDGTITHFDEKPKFPKSNLASMGIYIFNWPLLKQYLEMDDQNPYSSHDFGKDIIPLLLEEKKKLSAYPFKGYWKDVGTVQSLWEANMDLLKEDSELKLFERKWKIYSVNPNQPPQFISSDAQVQDSLVNEGCVVYGNVSHSVLFQGVTVGKHTTVTSSVIMPDVTIGEHVVIENAIVPNGMVLPDGAVIRSEKDIEEVLLVSEEFVEKELI
>CP030937.1|AXF34385.1|3172594_3173626_-|glucose-1-phosphate-adenylyltransferase-subunit-GlgD
MFNNQMLGVIDETTYKHSLQDLTAQRSLGAIPFAGRYRLIDFMLSNMVNADIRSVAIFPKYRYRSLMDHLGAGKEWDLHRKKDGLFFFPSPHLHHEYDEFGSFRQFSDHLDYFHRSTQQYAVISNSHTVCNIQFQYVLKRHQEVGCDVTEVFQDGQSLQIYIMSTTLLKDLIHGHSEKGYKTIQEAVEKESSALTICPYEYSGYAAVIDSVEKYYTHSMELIQPRFWQQVFLPQQPIYTKVKDEPPTKYGKHSTVKNSLVANGCVLEGEVENCILFRAVHVGKGTKLKNCIIMQKTQIGEDCLLEQVISDKDVKIGKATEAAGTADQPLVLRKGLVQGELMNS
>CP030937.1|AXF34384.1|3171143_3172598_-|glycogen-synthase-GlgA
MKILFAVSECTPFVKSGGLADVAGALPKALARLGNEVYVMLPKYSQIPEPWKKRMKKKAECTVAVGWRQQYCGIEHMDEDDVNYYFIDNEYYFNRDSLYGHYDDGERFAFFSRAVLEAAKVVNVPADIVHTHDWHTAMVNYLLKEEYRKHPFYERMKSVLTIHNLQFQGIFPPDVTHDLLGLEMDHFHYERLECNGFVNFMKAGIIAADHVTTVSPTYRNEIMTPYYGEQLEQVLQYREDDVTGILNGIDDTFYQPKSDPYIEAQYDSGDLACKLENKTKLQQRMGLPEKNDIPLISMVTRLTKQKGLDLVRRIMHELLEEQDIQLVVLGTGEREFEDYFRYAEFAFYEKCRAYIGFDEPLAHQIYAGSDMFLMPSKFEPCGLGQLIALQYGAIPIVRETGGLYDTVRAYQEEEGTGNGFTFSAFNAHDLKFTIERALSFYRQQDVWKSIVKTAMNADYSWGKSAKEYQRIFEQVTRSGRDVLE
>CP030937.1|AXF34383.1|3168760_3171157_-|glycogen/starch/alpha-glucan-phosphorylase
MFSSKERFADLFLKRLEMTCGKSFKDSAKLDQYKTLGNMVREYISADWIETNEKSRSNSGKQTYYLSIEFLLGQLLEQNLMNLGVRDVVEAGLKEIGINLEEILQIENDAGLGNGGLGRLAACFLDSLASLNLPGHGMGIRYKHGLFEQKIVDGHQVELPEQWLKNGNVWEVRNADQAVDVPFWGEVHMTEKSGRLHFRHEQATIVTAVPYDIPIIGYETGTVNTLRLWNAEPYAHYHGGNILSYKRETEAVSEFLYPDDTHDEGKILRLKQQYFLVCASLKSIVNNYRKTHKSLSGLHKKVSIHINDTHPALAVPELMRILLDEENMGWEEAWHITVHTISYTNHTTLSEALEKWPIHLFKPLLPRMYMIIEEINERFCRAVWEKYPGDWKRIENMAITAHGVVKMAHLAIVGSYSVNGVAKIHSDILKEREMRDFHLLFPNRFNNKTNGIAHRRWLLKANPGLSAIITEAIGDEWVKQPESLIRLEPYATDPAFIEQFQNNKSKKKQELADLIFCTAGVVVNPESIFDVQVKRLHAYKRQLLNVLHIMYLYNRLKEDSGFSIYPQTFIFGAKASPSYYYAKKIIKLIHSVAEKVNYDPAVKQLIKVVFLENYRVSMAERIFPASDVSEQISTASKEASGTGNMKFMMNGALTIGTHDGANIEILERVGPDCIYTFGLKADEVLSYQENGGYRSREYYQHDRRIRQVADQLINGFFEGEADEFESIFDSLLPHNDEYFVLKDFSSYADAQERIQADYRERRKWSERSIVNIAHSGYFSSDRTIREYAKDIWGIKPMM
>CP030937.1|AXF34382.1|3168262_3168730_+|tryptophan-rich-sensory-protein
MKKIFGAIAVFVITYALFSAAGYLFPVDQEWYNSLKKPDWTPSGTAIGIIWAILFALISLSAAIVYAAFSFKGAKSFWFTLLINYVLNQAFSYFQFTQKNLLAASLDCLLVAITAIVLLIIAKKYSRTASYLLLPYFLWSAFATFLSFTINSMNL
>CP030937.1|AXF34381.1|3167096_3168170_+|CotS-family-spore-coat-protein
MCPLMAENHEVIEEGNSSELPLSAEDAKKLTELAENVLQGWDVQAEKIDVIQGNQMALVWKVHTDSGAVCLKRIHRPEKKALFSIFAQDYLAKKGMNVPGILPNKKGSLYSKHGSFLFVVYDWIEGRPFELTVKQDLEFIMKGLADFHTASVGYQPPNGVPIFTKLGRWPNHYTKRCKQMETWKLMAEAEKEDPFSQLYLQEIDGFIEDGLRIKDRLLQSTYVPWTEQLKKSPNLCHQDYGTGNTLLGENEQIWVIDLDTVSFDLPIRDLRKMIIPLLDTTGVWDDETFHVMLNAYESRAPLTEEQKQVMFIDMLFPYELYDVIREKYVRKSALPKEELESAFEYERIKSNALQQLI
>CP030937.1|AXF34380.1|3165773_3166907_-|glycosyltransferase-family-1-protein
MKIALIATEKLPVPSVRGGAIQIYLEAVAPLIAKKHEVTVFSIKDPNLADREKVDGVHYVHLDEDRYEEAVGAELKKSRFDLVHVCNRPSWVPKLKKQAPDAVFILSVHNEMFAYDKISQAEGEICIDSVAQIVTVSDYIGQTITSRFPSARSKTKTVYSGVDLKTYHPHWTNEGQRAREEMRSELGLHGKKIVLFVGRLSKVKGPHILLQALPDIIEEHPDVMMVFIGSKWFGDNELNNYVKHLHTLGAMQKDHVTFIQFVKPKDIPRLYTMSDVFVCSSQWQEPLARVHYEAMAAGLPIITSNRGGNPEVIEEGKNGYIIHDFENPKQYAERINDLLSSSEKRERLGKYSRREAESNFGWQRVAENLLSVYEKNR
>CP030937.1|AXF34379.1|3164703_3165759_-|spore-coat-protein-S
MYQKEHEEQIVSEILSYYPFHIDHVALKSNKSGRKIWEVETDHGPKLLKEAQMKPERMLFITQAHAHLQEKGLPIAPIHQTKNGGSCLGTDQVSYSLYDKVTGKEMIYYDAEQMKKVMSFAGHFHHASKGYVCTDESKKRSRLGKWHKLYRWKLQELEGNMQIAASYPDDVFSQTFLKHADKMLARGKEALRALDDSEYETWTKETLEHGGFCFQDFTLARLTEIEGEPFLKELHSITYDLPSRDLRILLNKVMVKLSVWDTDFMVALLAAYDAVYPLTEKQYEVLWIDLAFPHLFCAIGHKYYLKQKKTWSDEKYNWALQNMISVEESKDSFLDKLPELYKKIKAYREAN
>CP030937.1|AXF34378.1|3164267_3164702_-|hypothetical-protein
MRSSRQKASISKLDLDQFVFTPPGPMGWQAHDSISAEKEEEEKHLDVGSIRELPHINAPKEYQKETKEKETDRKIVDDEEETKFETTLEPEEERDSKRSAPPYVEEEEEDEEPDLAEEARVEIIILPSESKPAPWFSQTVKRKA
>CP030937.1|AXF34388.1|3184406_3184985_+|thiamine-transporter-ThiT
MNQSKQLVRLIEIAIMTAAAVILDIVSGMFLSMPQGGSVSIMMIPIFLISFRWGVKAGLTTGLLTGLVQIAIGNLFAQHPVQLLLDYIVAFAAIGISGCFASSVRKAAVSKTKGKLIVSVVSAVFIGSLLRYAAHVISGAVFFGSFAPKGTPVWIYSLTYNATYMVPSFIICAIVLCLLFMTAPRLLKSDKA
>CP030937.1|AXF34389.1|3185026_3185548_-|GNAT-family-N-acetyltransferase
MVTVREAKLEDIKDIAKVHVDSWRTTYHEIIPIDYLNSLNYKEFEDKWKSRSLKGVFVAQDEKGSVFGFASFGPIRSEQEGYDGELYAIYLLEERQRQGAGRALLAKGAEFLHQHGFSSMFVWVIEQNPSIIFYQAYSPERVAEDNFEIAGVRLKEVGLGWLDLSALKTLLNR
>CP030937.1|AXF34390.1|3185565_3187095_-|flotillin-family-protein
MTMPIIMIIGVVFFLLIALIAVFITKYRTAGPDEALIVTGSYLGNKNVHVDEGGNRIKIVRGGGTFVLPVFQQAEPLSLLSSKLDVSTPEVYTEQGVPVMADGTAIIKIGGSIGEIATAAEQFLGKSKDDREQEAREVLEGHLRSILGSMTVEEIYKNREKFSQEVQRVASQDLAKMGLVIVSFTIKDVRDKNGYLESLGKPRIAQVKRDADIATAEADKETRIKRAEADKDAKKSELERATEIAEAEKLNQLKMAEFRREQDTAKANADQAYDLETARARQQVTEQEMQVKIIERQKQIELEEKEILRRERQYDSEVKKKADADRYSVEQSAAAEKAKQLAEADAKKYSIEAMAKAEAEKVRIDGLAKAEAEKAKGETEAEVIRLKGLAEAEAKEKIAAAFEQYGQAAIFDMIVKMLPEYAKQAAAPLSNIDKITVVDTGGSGESSGANKVTSYATNLMSSLQESLKASSGIDVKEMLENFSGKGNVKQSINELTNEIKEAKTIQKSE
>CP030937.1|AXF35531.1|3187115_3187640_-|hypothetical-protein
MELFGVPIQTMYLYTLIIAGSLTLLFLFFGDVFAGLPEGIPFLNPTLVLSFFTCFSAGGYIGELVLPLSSLLIALLSCILSIMLVVLLHIFVLVPLSSAEESLAYREDDLRGRLGKVITAVPVDGFGEVVIEGIGGTISKSAVSFDNQQISYGTTVLVVDINNGVLSVTPHEPI
>CP030937.1|AXF34391.1|3187807_3188296_+|DinB-family-protein
MSIFNEARLETWNELKGLSDEKLNQKPSAEEWSIREVLDHLKKIDMTAQKMLKERVKDAPIKEIEEKPLEVAQDRNNKRKAPSHLEPAHDFISGSQMKRELDVVREQLTAAIASLKEEDFERVLPHPVFQELTVRQWIDFIGHHEKRHLSQMKEIKEKIERA
>CP030937.1|AXF34392.1|3188301_3188880_-|MOSC-domain-containing-protein
MWKRMTAKAEGLYIADTKSFVTKQMDKLDFDYGGIPGDLHFGLTKKAGAREPMFSRGTEIFNRRQISIVSIEECNEIALKMGVPRILPEWLGANVAVSGMPDLTSLKEGSRIIFPSGAALLCEGENDPCIQPGEVIQSYYPDQPKLAPAFVRHALGIRGIVCIVERPGAVYTGDEIEVHSYQRKVKRKAERV
>CP030937.1|AXF35532.1|3188967_3190176_-|alcohol-dehydrogenase-EutG
MTLNMKVESMQKFHTFEIPTVIKHGIGAIKHTGEEVAALGVSKALLVTDPGIYKAGVADPVIESLKEAGIEVVLFNKVEPNPPVRLVNEGSELYKKENCNGLVAVGGGSSMDTAKAIGVEATHEGSVLDYEAADGKKPLENRIPPLTTIPTTAGTGSEVTQWAVITDEEREFKFNTGGPLIAAHLTIIDPELHVSMPPHVTAMTGIDALAHAIECYTMKFAQPITDAVALMAIEYAAHYIKRAFADGEDLEARYGMAQAAMLAGLSYGSESAGAAHAMSQTLGGIIPVAHGQCVAAMMGPVMEYNWKGYPEKFARIAKAFGIDTSKMTTEEAAKASVNWMYDLVEDLEVPTLEEQGVSPDMIERLSKEAMKDPQTFGNPRDLNEKAYNWIYKRCFNLTPKTV
>CP030937.1|AXF34393.1|3190192_3191665_-|betaine-aldehyde-dehydrogenase
MSQTLFIDGEWISAEKEQIRSIINPFNQEEIATVSEGGREDAIKAIAAARRAFDKGEWSALSGLERGKIVLKIAELIRRDLEELAELESLDTGKTLEESKADMDDIANVFQYYAGLADKDGGEIISSPIPDSESKIIREPIGVCGQITPWNYPLLQASWKIAPALAAGNTIVMKPSEITPLTTIKVFKLMEEAGVPKGVANLVLGPGATVGDELAVNKDVDLISFTGGIETGKKIMRAASGNVKKIALELGGKNPNIVFKDADLEVAVDQALNAVFFHAGQVCSAGSRLLVEDAIHDQFLAELVKRAKRIKLGNGFHAETESGPLISAEHRAKVEKYVEIGIEEGAKLETGGKRPEDPELQNGFFYEPTIFSNCNSDMRIVQEEVFGPVLTVETFSSEEEVIELANDTIYGLAGAVWSKDIEKCERVAARLRMGTVWINDFHPYFAQAPWGGYKQSGFGRELGKIGLEEYTEVKHVYRNTKPAAVNWFNS
>CP030937.1|AXF34394.1|3191863_3192406_+|transcriptional-regulator
MDENPEFAAIEQARDLVIDSIAETMDLYGITRSVGILYGTMYMRDEMTLDEMREELQMSKPSMSTGVKKLQDLNVVKKTFHRGIRKHTFVAEKDFFKFFTNFFPPKWEREVQVNVAAIEEAQADLQKVLCKEDLDEDIKNEALQLYDQLESSKAYYDWLKRLAESVQTGEIFKFIPIETK
>CP030937.1|AXF34395.1|3192603_3193149_+|hypothetical-protein
MKRKLLSSLAISALSLGLLVSAPTASFAAESTSTKAHTESTMRTQSTASLFATITGASKTEWSFSDIELTYRPNTLLSLGVMEFTLPSGFTANTKDTLNGNALRTTQILNNGKTVRVPLALDLLGAGEFKLKLNNKTLPAAGTYTFRAENKSLSIGNKFYAEASIDVAKRSTPPTQPCGCN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP030937_2	2.1\|3177305\|60\|CP030937\|CRISPRCasFinder	3177305-3177364	60	NZ_CP024037	Bacillus aryabhattai strain K13 plasmid unnamed2	10417-10476	7	0.883
CP030937_2	2.1\|3177305\|60\|CP030937\|CRISPRCasFinder	3177305-3177364	60	NZ_CP026740	Bacillus megaterium strain YC4-R4 plasmid unnamed4	70764-70823	7	0.883
CP030937_2	2.1\|3177305\|60\|CP030937\|CRISPRCasFinder	3177305-3177364	60	NC_017139	Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence	1318-1377	7	0.883
CP030937_2	2.1\|3177305\|60\|CP030937\|CRISPRCasFinder	3177305-3177364	60	NZ_CP010587	Bacillus megaterium Q3 plasmid p1, complete sequence	838-897	7	0.883
CP030937_2	2.1\|3177305\|60\|CP030937\|CRISPRCasFinder	3177305-3177364	60	NZ_CP023319	Bacillus megaterium strain A plasmid p2, complete sequence	75825-75884	7	0.883
CP030937_2	2.1\|3177305\|60\|CP030937\|CRISPRCasFinder	3177305-3177364	60	NC_020451	Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence	1960-2019	9	0.85
CP030937_2	2.1\|3177305\|60\|CP030937\|CRISPRCasFinder	3177305-3177364	60	NZ_CP015440	Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence	64773-64832	12	0.8
CP030937_2	2.1\|3177305\|60\|CP030937\|CRISPRCasFinder	3177305-3177364	60	NZ_CP033045	Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence	483791-483850	13	0.783
CP030937_2	2.1\|3177305\|60\|CP030937\|CRISPRCasFinder	3177305-3177364	60	NZ_LR134399	Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence	57361-57420	14	0.767

1. spacer 2.1|3177305|60|CP030937|CRISPRCasFinder matches to NZ_CP024037 (Bacillus aryabhattai strain K13 plasmid unnamed2) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

2. spacer 2.1|3177305|60|CP030937|CRISPRCasFinder matches to NZ_CP026740 (Bacillus megaterium strain YC4-R4 plasmid unnamed4) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

3. spacer 2.1|3177305|60|CP030937|CRISPRCasFinder matches to NC_017139 (Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

4. spacer 2.1|3177305|60|CP030937|CRISPRCasFinder matches to NZ_CP010587 (Bacillus megaterium Q3 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

5. spacer 2.1|3177305|60|CP030937|CRISPRCasFinder matches to NZ_CP023319 (Bacillus megaterium strain A plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

6. spacer 2.1|3177305|60|CP030937|CRISPRCasFinder matches to NC_020451 (Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence) position: , mismatch: 9, identity: 0.85

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcattttagttatggcccggg	Protospacer
****************************************** ***   * ***  **.

7. spacer 2.1|3177305|60|CP030937|CRISPRCasFinder matches to NZ_CP015440 (Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence) position: , mismatch: 12, identity: 0.8

cagcttggaaggctgaggttttaccactaaactacacccgca-------atttttatttg	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcataataatatataccattg	Protospacer
******************************************       ** * .  ***

8. spacer 2.1|3177305|60|CP030937|CRISPRCasFinder matches to NZ_CP033045 (Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence) position: , mismatch: 13, identity: 0.783

cagcttggaaggctgaggttttaccactaaactacacccgc--------aatttttattt	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatggttaaaagttttgcca	Protospacer
*****************************************        ** ****...

9. spacer 2.1|3177305|60|CP030937|CRISPRCasFinder matches to NZ_LR134399 (Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence) position: , mismatch: 14, identity: 0.767

cagcttggaaggctgaggttttaccactaaactacacccgc---------aatttttatt	CRISPR spacer
cagcttggaaggctgtagttttaccactaaactacacccgcatagtaagtagttcttagt	Protospacer
*************** .************************         *.**.*** *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

669049 : 677415

Synechococcus_phage(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXF31949.1\|669049_670345_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	1.7e-18	25.4
AXF31950.1\|670418_671144_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3G7P8	Synechococcus_phage	7.0e-46	44.1
AXF31951.1\|671136_671391_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
AXF31952.1\|671387_672071_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
AXF31953.1\|672054_674283_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	5.0e-159	40.1
AXF31954.1\|674258_675689_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.2e-52	32.5
AXF31955.1\|675790_676831_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.8e-64	42.0
AXF31956.1\|676827_677415_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	3.1e-28	41.0

DBSCAN-SWA_2

1176449 : 1210355

Planktothrix_phage(20.0%)

tRNA,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXF35425.1\|1176449_1177442_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
AXF32429.1\|1178186_1179824_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
AXF32430.1\|1179931_1180867_+	peptide ABC transporter permease	NA	NA	NA	NA
AXF32431.1\|1180870_1181788_+	peptide ABC transporter permease	NA	NA	NA	NA
AXF32432.1\|1181792_1182869_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.1e-17	30.8
AXF32433.1\|1182870_1183788_+	ATP-binding cassette domain-containing protein	M1HP82	Acanthocystis_turfacea_Chlorella_virus	1.2e-05	24.6
AXF32434.1\|1183894_1185112_+	MFS transporter	NA	NA	NA	NA
AXF32435.1\|1185275_1185854_+	N-acetyltransferase	NA	NA	NA	NA
AXF32436.1\|1186034_1186430_+	transcriptional regulator Spx	NA	NA	NA	NA
AXF32437.1\|1186472_1187129_-	TerC family protein	A0A2R2YAT9	Pseudomonas_phage	1.1e-29	38.0
AXF32438.1\|1187405_1188062_+	adaptor protein MecA	NA	NA	NA	NA
AXF32439.1\|1188222_1189374_+	competence protein CoiA	NA	NA	NA	NA
AXF32440.1\|1189420_1191433_+	oligoendopeptidase F	NA	NA	NA	NA
AXF32441.1\|1191470_1191638_-	hypothetical protein	NA	NA	NA	NA
AXF32442.1\|1191733_1191937_-	hypothetical protein	NA	NA	NA	NA
AXF32443.1\|1191951_1192851_-	DsbA family protein	NA	NA	NA	NA
AXF32444.1\|1192847_1193246_-	group 2 truncated hemoglobin YjbI	NA	NA	NA	NA
AXF35426.1\|1193500_1194046_-	lytic transglycosylase domain-containing protein	A0A1P8CWQ1	Bacillus_phage	4.8e-39	61.0
AXF32445.1\|1194249_1194822_-	CYTH domain-containing protein	NA	NA	NA	NA
AXF32446.1\|1194946_1195315_+	hypothetical protein	NA	NA	NA	NA
AXF32447.1\|1195343_1195979_+	GTP pyrophosphokinase YjbM	NA	NA	NA	NA
AXF32448.1\|1195997_1196798_+	NAD(+) kinase	NA	NA	NA	NA
AXF35427.1\|1196860_1197712_+	RluA family pseudouridine synthase	NA	NA	NA	NA
AXF32449.1\|1197724_1198459_-	bis(5'-nucleosyl)-tetraphosphatase PrpE [asymmetrical]	A8E2N0	Enterococcus_phage	7.2e-06	24.8
AXF32450.1\|1198693_1200538_+	sodium:proton antiporter	NA	NA	NA	NA
AXF32451.1\|1200786_1201497_+	thiaminase II	NA	NA	NA	NA
AXF32452.1\|1201471_1202089_+	thiazole tautomerase TenI	NA	NA	NA	NA
AXF32453.1\|1202072_1203182_+	glycine oxidase ThiO	NA	NA	NA	NA
AXF35428.1\|1203181_1203382_+	sulfur carrier protein ThiS	NA	NA	NA	NA
AXF32454.1\|1203378_1204149_+	thiazole synthase	NA	NA	NA	NA
AXF32455.1\|1204145_1205156_+	thiamine biosynthesis protein ThiS	NA	NA	NA	NA
AXF32456.1\|1205174_1205990_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
AXF32457.1\|1206125_1206902_+	enoyl-[acyl-carrier-protein] reductase FabI	NA	NA	NA	NA
AXF32458.1\|1207002_1207686_+\|coat	spore coat protein	NA	NA	NA	NA
AXF32459.1\|1207778_1208228_-\|coat	spore coat protein	NA	NA	NA	NA
AXF32460.1\|1208355_1208844_-\|coat	spore coat protein	NA	NA	NA	NA
AXF32461.1\|1208994_1209510_-\|coat	spore coat protein	NA	NA	NA	NA
AXF32462.1\|1209598_1209928_-\|coat	spore coat protein	NA	NA	NA	NA
AXF32463.1\|1209968_1210355_-\|coat	spore coat protein V	NA	NA	NA	NA

DBSCAN-SWA_3

1221313 : 1269027

uncultured_Caudovirales_phage(59.57%)

terminase,holin,coat,plate,portal,integrase

attL 1221153:1221212|attR 1269263:1269346

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1221153:1221212	attL	NA	NA	NA	NA
AXF32475.1\|1221313_1222525_-\|integrase	site-specific integrase	A0A2I7SC08	Paenibacillus_phage	3.2e-91	44.7
AXF32476.1\|1222527_1223022_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	2.6e-60	69.2
AXF32477.1\|1223090_1223573_-	hypothetical protein	O64019	Bacillus_phage	5.1e-77	92.5
AXF32478.1\|1223589_1224480_-	endonuclease	A0A1P8CWK6	Bacillus_phage	5.2e-91	80.8
AXF32479.1\|1224738_1225122_-	XRE family transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	2.1e-20	45.0
AXF32480.1\|1225256_1225493_+	XRE family transcriptional regulator	NA	NA	NA	NA
AXF32481.1\|1225504_1225696_+	DNA-binding protein	NA	NA	NA	NA
AXF32482.1\|1225697_1226426_+	phage regulatory protein	A0A2H4J4N4	uncultured_Caudovirales_phage	8.3e-79	61.3
AXF32483.1\|1226482_1227052_+	XRE family transcriptional regulator	A0A2H4J884	uncultured_Caudovirales_phage	1.9e-62	56.9
AXF32484.1\|1227048_1227306_+	hypothetical protein	A0A2H4J4M9	uncultured_Caudovirales_phage	2.2e-10	42.2
AXF32485.1\|1227302_1227521_+	hypothetical protein	NA	NA	NA	NA
AXF32486.1\|1227480_1227684_+	hypothetical protein	NA	NA	NA	NA
AXF32487.1\|1227786_1227978_+	hypothetical protein	NA	NA	NA	NA
AXF32488.1\|1227974_1228892_+	hypothetical protein	A0A0A7RUE9	Clostridium_phage	3.2e-88	62.8
AXF32489.1\|1228911_1229649_+	hypothetical protein	A0A0A7RUC1	Clostridium_phage	5.1e-60	48.1
AXF32490.1\|1229648_1229837_+	hypothetical protein	NA	NA	NA	NA
AXF32491.1\|1229844_1230543_+	DNA-binding protein	A0A2H4J6G9	uncultured_Caudovirales_phage	1.2e-42	42.4
AXF32492.1\|1230472_1231366_+	ATP-binding protein	A0A0K2CPA5	Brevibacillus_phage	4.9e-57	51.1
AXF32493.1\|1231593_1231962_+	hypothetical protein	R4JMS5	Bacillus_phage	3.0e-13	42.4
AXF32494.1\|1231948_1232407_+	DUF1064 domain-containing protein	A0A2H4J891	uncultured_Caudovirales_phage	4.6e-59	81.3
AXF32495.1\|1232360_1232570_+	hypothetical protein	NA	NA	NA	NA
AXF32496.1\|1232775_1232982_+	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	8.4e-21	78.9
AXF35431.1\|1233052_1233385_+	hypothetical protein	NA	NA	NA	NA
AXF32497.1\|1233381_1233630_+	hypothetical protein	A0A2H4JA61	uncultured_Caudovirales_phage	1.2e-05	42.3
AXF32498.1\|1233641_1234466_+	DNA adenine methylase	Q24LC8	Clostridium_phage	2.0e-57	44.0
AXF32499.1\|1234591_1235386_+	hypothetical protein	NA	NA	NA	NA
AXF32500.1\|1235517_1235646_+	hypothetical protein	NA	NA	NA	NA
AXF32501.1\|1235659_1236175_+	Fis family transcriptional regulator	A0A1L2JY33	Aeribacillus_phage	8.0e-28	42.6
AXF32502.1\|1236509_1236701_+	hypothetical protein	NA	NA	NA	NA
AXF35432.1\|1236707_1236923_+	DNA-binding protein	A0A1Z1LZP5	Bacillus_phage	7.5e-12	48.6
AXF32503.1\|1237033_1237897_+	hypothetical protein	A0A167RC64	Powai_lake_megavirus	1.9e-21	29.4
AXF32504.1\|1238249_1239062_+	hypothetical protein	NA	NA	NA	NA
AXF32505.1\|1239086_1239806_+	hypothetical protein	NA	NA	NA	NA
AXF32506.1\|1239955_1240153_+	hypothetical protein	NA	NA	NA	NA
AXF32507.1\|1240438_1241173_+	hypothetical protein	A0A2P1JTW4	Anoxybacillus_phage	1.1e-59	55.1
AXF32508.1\|1241165_1242404_+\|terminase	PBSX family phage terminase large subunit	A0A0S0KEN9	Bacillus_phage	6.4e-140	58.4
AXF32509.1\|1242415_1243774_+\|portal	phage portal protein	A0A2H4J4Q7	uncultured_Caudovirales_phage	2.1e-152	61.2
AXF32510.1\|1243956_1244676_+	DUF4355 domain-containing protein	A0A1L2K2N1	Aeribacillus_phage	2.4e-62	55.8
AXF32511.1\|1244690_1245551_+\|coat	P22 coat protein - protein 5 domain protein	A0A1L2JY55	Aeribacillus_phage	1.8e-128	78.5
AXF32512.1\|1245741_1246620_+	hypothetical protein	A0A2H4JD21	uncultured_Caudovirales_phage	1.3e-49	42.2
AXF32513.1\|1246634_1246970_+	hypothetical protein	A0A2H4J6J9	uncultured_Caudovirales_phage	2.8e-29	56.8
AXF32514.1\|1246974_1247478_+	hypothetical protein	A0A2H4J4S5	uncultured_Caudovirales_phage	5.2e-48	57.1
AXF32515.1\|1247477_1247867_+	hypothetical protein	A0A2H4JDP3	uncultured_Caudovirales_phage	6.1e-28	57.0
AXF32516.1\|1247823_1248294_+	hypothetical protein	A0A2H4J4R9	uncultured_Caudovirales_phage	2.9e-53	62.0
AXF32517.1\|1248299_1249334_+	DUF3383 family protein	A0A2H4J8B9	uncultured_Caudovirales_phage	1.8e-127	65.4
AXF32518.1\|1249348_1249738_+	DUF3277 domain-containing protein	A0A2H4J4R5	uncultured_Caudovirales_phage	3.8e-38	63.3
AXF35433.1\|1249835_1250135_+	hypothetical protein	NA	NA	NA	NA
AXF32519.1\|1250293_1254985_+	hypothetical protein	A0A2H4JA91	uncultured_Caudovirales_phage	1.8e-118	60.0
AXF32520.1\|1254985_1255540_+	LysM domain-containing protein	A0A2H4JD33	uncultured_Caudovirales_phage	9.1e-62	66.8
AXF32521.1\|1255553_1255910_+	hypothetical protein	A0A2H4J6L1	uncultured_Caudovirales_phage	1.0e-45	74.6
AXF32522.1\|1255896_1256862_+	hypothetical protein	A0A2H4J4T4	uncultured_Caudovirales_phage	4.4e-104	60.1
AXF32523.1\|1256861_1257209_+	hypothetical protein	A0A2H4JDQ2	uncultured_Caudovirales_phage	1.2e-30	60.0
AXF32524.1\|1257205_1257562_+	DUF2634 domain-containing protein	A0A2H4J4S8	uncultured_Caudovirales_phage	2.6e-33	61.0
AXF32525.1\|1257554_1258730_+\|plate	baseplate J/gp47 family protein	A0A2H4J8D2	uncultured_Caudovirales_phage	2.1e-156	72.9
AXF32526.1\|1258726_1259356_+	hypothetical protein	A0A2H4J4S3	uncultured_Caudovirales_phage	8.1e-91	82.3
AXF32527.1\|1260996_1261458_+	hypothetical protein	NA	NA	NA	NA
AXF32528.1\|1261447_1261642_+	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	4.3e-19	67.7
AXF32529.1\|1261705_1261984_+	protein xhlA	A0A2H4JD40	uncultured_Caudovirales_phage	2.8e-27	69.6
AXF32530.1\|1261999_1262263_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	6.1e-24	69.0
AXF32531.1\|1262315_1263137_+	N-acetylmuramoyl-L-alanine amidase	A0A218KC88	Bacillus_phage	1.5e-65	73.9
AXF32532.1\|1263175_1263475_-	hypothetical protein	NA	NA	NA	NA
AXF32533.1\|1263529_1263838_-	hypothetical protein	NA	NA	NA	NA
AXF32534.1\|1263871_1264264_-	hypothetical protein	NA	NA	NA	NA
AXF35434.1\|1264275_1266054_-	hypothetical protein	A0A1P8CWI7	Bacillus_phage	7.6e-126	57.6
AXF32535.1\|1266400_1268098_-	hypothetical protein	NA	NA	NA	NA
AXF32536.1\|1268131_1268584_-	DUF4065 domain-containing protein	I6R0L8	Salmonella_phage	5.2e-23	37.3
AXF32537.1\|1268697_1269027_-	YolD-like family protein	O64030	Bacillus_phage	5.5e-14	41.9
1269263:1269346	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1324868 : 1358482

Bacillus_phage(27.27%)

portal,holin,plate,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXF32588.1\|1324868_1326140_+	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	A0A1V0SEI6	Indivirus	3.3e-14	36.4
AXF32589.1\|1326284_1327421_+	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	4.9e-94	47.4
AXF32590.1\|1327410_1327545_+	phosphatase RapA inhibitor	NA	NA	NA	NA
AXF32591.1\|1327575_1327833_-	hypothetical protein	NA	NA	NA	NA
AXF32592.1\|1327953_1328907_+	LysM peptidoglycan-binding domain-containing protein	A0A218KC88	Bacillus_phage	1.6e-66	73.8
AXF32593.1\|1328946_1329324_-	PH domain-containing protein	A5GYQ0	Lactococcus_phage	2.1e-17	43.3
AXF32594.1\|1329428_1330031_+	hypothetical protein	F8WQ53	Bacillus_phage	2.0e-46	49.7
AXF32595.1\|1330107_1330944_+	manganese catalase family protein	NA	NA	NA	NA
AXF32596.1\|1330987_1331584_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	8.1e-40	51.7
AXF32597.1\|1331746_1332088_-	transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	1.3e-18	45.8
AXF32598.1\|1332266_1332446_+	hypothetical protein	NA	NA	NA	NA
AXF32599.1\|1332432_1333269_+	phage-like element PBSX protein XkdB	S6BFM4	Thermus_phage	1.8e-24	28.2
AXF32600.1\|1333168_1333969_+	ATP-binding protein	A6XMI1	Bacillus_virus	1.1e-60	51.7
AXF32601.1\|1333968_1334136_+	hypothetical protein	NA	NA	NA	NA
AXF32602.1\|1334220_1334571_+\|portal	phage portal protein	NA	NA	NA	NA
AXF32603.1\|1334567_1334774_+	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	7.1e-12	50.0
AXF32604.1\|1334889_1335399_+	Fis family transcriptional regulator	A0A1L2JY33	Aeribacillus_phage	1.9e-21	38.6
AXF32605.1\|1335515_1336313_+\|terminase	terminase	A0A0S2MVB6	Bacillus_phage	2.7e-59	51.0
AXF32606.1\|1336309_1337611_+\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	6.3e-154	60.5
AXF32607.1\|1337614_1339102_+	phage-like element PBSX protein XkdE	A0A1B1P7C8	Bacillus_phage	1.7e-139	55.7
AXF32608.1\|1339121_1339949_+\|portal	phage portal protein	A0A1B1P7E4	Bacillus_phage	2.1e-54	58.7
AXF32609.1\|1339974_1340910_+	phage-like element PBSX protein XkdG	A0A1B1P7E3	Bacillus_phage	1.1e-104	63.8
AXF32610.1\|1340931_1341315_+	DUF3199 family protein	A0A1B1P7D6	Bacillus_phage	3.7e-14	41.1
AXF32611.1\|1341311_1341668_+	phage-like element PBSX protein XkdH	NA	NA	NA	NA
AXF32612.1\|1341664_1342150_+	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	8.0e-38	47.0
AXF32613.1\|1342162_1342603_+	phage-like element PBSX protein XkdJ	NA	NA	NA	NA
AXF32614.1\|1342606_1342825_+	hypothetical protein	NA	NA	NA	NA
AXF32615.1\|1342821_1344222_+	phage-like element PBSX protein XkdK	A0A0A7S087	Clostridium_phage	2.3e-77	39.3
AXF32616.1\|1344223_1344667_+	phage-like element PBSX protein XkdM	A0A0K2CNG3	Brevibacillus_phage	8.4e-26	45.2
AXF32617.1\|1344759_1345206_+	phage-like element PBSX protein XkdN	A0A249XXA9	Clostridium_phage	7.5e-14	33.6
AXF32618.1\|1345235_1345385_+	hypothetical protein	NA	NA	NA	NA
AXF32619.1\|1345386_1349268_+	lytic transglycosylase	A0A1L2JY60	Aeribacillus_phage	3.5e-43	44.9
AXF32620.1\|1349260_1349920_+	phage-like element PBSX protein XkdP	A0A090DBR9	Clostridium_phage	3.7e-25	34.0
AXF32621.1\|1349935_1350913_+	phage-like element PBSX protein XkdQ	H7BV96	unidentified_phage	1.0e-39	32.6
AXF32622.1\|1350912_1351179_+	phage-like element PBSX protein XkdR	S6C459	Thermus_phage	1.7e-05	35.2
AXF32623.1\|1351235_1351661_+	DUF2634 domain-containing protein	A0A2H4J6K5	uncultured_Caudovirales_phage	2.3e-12	38.7
AXF32624.1\|1351653_1352700_+\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	8.3e-72	44.0
AXF32625.1\|1352683_1353262_+	DUF2313 domain-containing protein	A0A2H4J717	uncultured_Caudovirales_phage	5.1e-15	33.1
AXF32626.1\|1353258_1353531_+	hypothetical protein	NA	NA	NA	NA
AXF32627.1\|1353533_1355591_+\|terminase	terminase	A0A2H4J4R1	uncultured_Caudovirales_phage	6.9e-30	34.9
AXF32628.1\|1355604_1355934_+\|portal	phage portal protein	NA	NA	NA	NA
AXF32629.1\|1355930_1356095_+	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	7.2e-15	66.0
AXF32630.1\|1356138_1356978_+\|portal	phage portal protein	NA	NA	NA	NA
AXF32631.1\|1357030_1357300_+	protein xhlA	A0A2H4JD40	uncultured_Caudovirales_phage	6.2e-24	64.8
AXF32632.1\|1357312_1357576_+\|holin	holin	A0A2H4J6M0	uncultured_Caudovirales_phage	4.7e-24	65.5
AXF32633.1\|1357588_1358482_+	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	5.2e-83	69.2

DBSCAN-SWA_5

1883721 : 1890285

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXF33081.1\|1883721_1884114_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	G3MBF1	Bacillus_virus	2.5e-29	58.3
AXF33082.1\|1884073_1886176_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	U5PY35	Bacillus_phage	0.0e+00	86.8
AXF33083.1\|1886193_1887183_+	ribonucleoside-diphosphate reductase subunit beta	F8WQ21	Bacillus_phage	1.9e-155	83.5
AXF33084.1\|1887232_1887853_+	hypothetical protein	A0A127AYS1	Bacillus_phage	1.6e-46	48.4
AXF33085.1\|1887916_1888684_-	N-acetylmuramoyl-L-alanine amidase	E5DV68	Deep-sea_thermophilic_phage	7.0e-52	50.0
AXF33086.1\|1889316_1890285_+	stage V sporulation protein K	G3MAX6	Bacillus_virus	5.2e-52	40.5

DBSCAN-SWA_6

2164994 : 2283474

163

Bacillus_phage(96.9%)

holin,tail,integrase

attL 2213694:2213713|attR 2259187:2259206

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXF35471.1\|2164994_2165237_+	XRE family transcriptional regulator	A0A1P8CX60	Bacillus_phage	2.1e-39	97.5
AXF35472.1\|2165238_2165424_-	hypothetical protein	O64193	Bacillus_phage	3.3e-24	96.6
AXF33326.1\|2165419_2165629_-	hypothetical protein	NA	NA	NA	NA
AXF33327.1\|2165644_2167705_-	hypothetical protein	NA	NA	NA	NA
AXF33328.1\|2167953_2168631_-	DUF559 domain-containing protein	A0A0S2SXZ1	Bacillus_phage	9.9e-10	37.3
AXF33329.1\|2168666_2168972_-	hypothetical protein	NA	NA	NA	NA
AXF33330.1\|2169241_2169454_+	small acid-soluble spore protein	A0A1P8CX76	Bacillus_phage	4.1e-31	100.0
AXF33331.1\|2169534_2169723_-	hypothetical protein	A0A1P8CX75	Bacillus_phage	1.2e-26	100.0
AXF33332.1\|2169969_2170323_-	hypothetical protein	A0A1P8CX43	Bacillus_phage	2.5e-33	62.4
AXF33333.1\|2170357_2170627_-	hypothetical protein	NA	NA	NA	NA
AXF33334.1\|2170747_2171269_-	dihydrofolate reductase	A0A0H3UYW4	Geobacillus_virus	5.2e-35	44.1
AXF33335.1\|2171268_2172108_-	thymidylate synthase	A0A1P8CX42	Bacillus_phage	2.9e-160	96.4
AXF33336.1\|2172183_2172789_+	DUF1643 domain-containing protein	NA	NA	NA	NA
AXF35473.1\|2172797_2173139_-	hypothetical protein	O64181	Bacillus_phage	3.3e-54	99.1
AXF33337.1\|2173281_2173575_-	hypothetical protein	A0A1P8CX63	Bacillus_phage	6.1e-41	88.7
AXF33338.1\|2173900_2174515_+	VanZ family protein	NA	NA	NA	NA
AXF33339.1\|2174608_2175037_-	deoxyuridine 5'-triphosphate nucleotidohydrolase	A0A1P8CX51	Bacillus_phage	8.9e-73	92.3
AXF33340.1\|2175087_2175330_-	thioredoxin	A0A1P8CX24	Bacillus_phage	1.4e-35	92.5
AXF33341.1\|2175326_2176331_-	class 1b ribonucleoside-diphosphate reductase subunit beta	R4JMU8	Bacillus_phage	3.8e-151	81.7
AXF33342.1\|2176448_2176880_+	hypothetical protein	NA	NA	NA	NA
AXF33343.1\|2176936_2180191_-	hypothetical protein	A0A1P8CX40	Bacillus_phage	0.0e+00	98.7
AXF35474.1\|2180153_2180543_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A1P8CX56	Bacillus_phage	6.4e-62	92.2
AXF33344.1\|2180548_2180902_-	hypothetical protein	O64171	Bacillus_phage	2.7e-59	98.3
AXF33345.1\|2180952_2181153_-	hypothetical protein	O64169	Bacillus_phage	9.6e-30	93.8
AXF33346.1\|2181172_2181307_-	hypothetical protein	O64168	Bacillus_phage	1.8e-16	90.9
AXF33347.1\|2181332_2181800_-	hypothetical protein	O64167	Bacillus_phage	9.1e-63	78.8
AXF33348.1\|2181814_2182027_-	DUF1653 domain-containing protein	A0A1P8CX21	Bacillus_phage	2.3e-29	81.2
AXF33349.1\|2182268_2182559_-	hypothetical protein	NA	NA	NA	NA
AXF33350.1\|2182615_2183038_-	hypothetical protein	A0A1P8CX27	Bacillus_phage	4.1e-62	82.9
AXF33351.1\|2183050_2183371_-	hypothetical protein	A0A1P8CX20	Bacillus_phage	3.3e-56	99.1
AXF33352.1\|2183991_2184204_-	hypothetical protein	O64159	Bacillus_phage	1.1e-31	91.4
AXF33353.1\|2184270_2184453_-	hypothetical protein	O64158	Bacillus_phage	2.2e-25	95.0
AXF33354.1\|2184465_2184693_-	hypothetical protein	A0A1P8CX31	Bacillus_phage	2.7e-36	100.0
AXF33355.1\|2184732_2185098_-	hypothetical protein	O64156	Bacillus_phage	2.1e-62	97.5
AXF33356.1\|2185100_2185319_-	hypothetical protein	A0A1P8CX26	Bacillus_phage	1.2e-30	98.6
AXF33357.1\|2185362_2186682_-	DNA cytosine methyltransferase	Q02778	Bacillus_phage	4.6e-168	63.1
AXF33358.1\|2186734_2187382_-	HNH endonuclease	O64121	Bacillus_phage	7.0e-29	40.5
AXF33359.1\|2187434_2187662_-	hypothetical protein	NA	NA	NA	NA
AXF33360.1\|2187690_2188188_-	hypothetical protein	A0A1P8CX28	Bacillus_phage	2.1e-78	87.9
AXF33361.1\|2188187_2188343_-	hypothetical protein	A0A1P8CX36	Bacillus_phage	2.4e-20	92.2
AXF35475.1\|2188335_2188551_-	hypothetical protein	O64150	Bacillus_phage	3.0e-37	98.6
AXF33362.1\|2188583_2188781_-	hypothetical protein	O64149	Bacillus_phage	2.1e-29	96.9
AXF33363.1\|2188815_2188965_-	hypothetical protein	O64148	Bacillus_phage	2.0e-19	98.0
AXF35476.1\|2189082_2189799_-	hypothetical protein	O64147	Bacillus_phage	7.6e-109	85.3
AXF33364.1\|2189827_2193745_-	DNA polymerase III subunit alpha	A0A1P8CX14	Bacillus_phage	0.0e+00	96.5
AXF33365.1\|2193757_2195488_-	single-stranded-DNA-specific exonuclease RecJ	A0A1P8CX07	Bacillus_phage	0.0e+00	98.4
AXF33366.1\|2195487_2196624_-	hypothetical protein	A0A1P8CX05	Bacillus_phage	1.2e-225	100.0
AXF33367.1\|2196639_2198154_-	hypothetical protein	A0A1P8CWZ7	Bacillus_phage	2.3e-285	99.4
AXF33368.1\|2198168_2198639_-	hypothetical protein	A0A1P8CX08	Bacillus_phage	1.5e-86	98.7
AXF33369.1\|2198681_2199653_-	ATP-binding protein	A0A1P8CX29	Bacillus_phage	1.7e-180	100.0
AXF33370.1\|2199735_2200650_-	hypothetical protein	O64140	Bacillus_phage	4.7e-156	89.5
AXF33371.1\|2200671_2201043_-	hypothetical protein	O64139	Bacillus_phage	5.2e-61	94.3
AXF33372.1\|2201216_2201531_-	SPBc2 prophage-derived stress response protein SCP1	NA	NA	NA	NA
AXF33373.1\|2201606_2201987_-	hypothetical protein	A0A1P8CX06	Bacillus_phage	9.3e-66	96.8
AXF33374.1\|2202226_2203261_-	hypothetical protein	NA	NA	NA	NA
AXF33375.1\|2203482_2204520_-	hypothetical protein	NA	NA	NA	NA
AXF33376.1\|2204552_2204774_-	hypothetical protein	A0A1P8CWZ6	Bacillus_phage	7.9e-33	93.2
AXF33377.1\|2204841_2205516_+	SOS response-associated peptidase	A0A1P8CX02	Bacillus_phage	6.1e-76	95.8
AXF33378.1\|2205585_2206398_+	ATP-dependent DNA ligase	O64130	Bacillus_phage	4.2e-148	94.4
AXF33379.1\|2206637_2206790_+	hypothetical protein	O64128	Bacillus_phage	1.3e-15	84.0
AXF33380.1\|2206863_2207073_-	hypothetical protein	NA	NA	NA	NA
AXF33381.1\|2207104_2207395_-	hypothetical protein	A0A1P8CWY9	Bacillus_phage	1.5e-47	95.8
AXF33382.1\|2207508_2207883_+	hypothetical protein	A0A1P8CWZ2	Bacillus_phage	3.7e-59	99.2
AXF33383.1\|2207899_2208115_-	hypothetical protein	A0A1P8CX01	Bacillus_phage	1.0e-32	98.6
AXF33384.1\|2208092_2208311_-	hypothetical protein	NA	NA	NA	NA
AXF33385.1\|2208303_2208696_-	hypothetical protein	A0A0A8WEI8	Clostridium_phage	1.1e-24	46.6
AXF33386.1\|2208745_2208940_-	hypothetical protein	O64118	Bacillus_phage	9.7e-27	90.6
AXF33387.1\|2208988_2209441_-	hypothetical protein	O64117	Bacillus_phage	5.7e-78	99.3
AXF35477.1\|2209523_2209781_-	hypothetical protein	O64116	Bacillus_phage	3.5e-40	92.9
AXF33388.1\|2210016_2210391_+	hypothetical protein	NA	NA	NA	NA
AXF33389.1\|2210508_2211264_-	SPBc2 prophage-derived antirepressor protein YoqD	A0A1P8CWY0	Bacillus_phage	1.1e-137	100.0
AXF33390.1\|2211337_2211535_-	hypothetical protein	NA	NA	NA	NA
AXF33391.1\|2211531_2211909_-	hypothetical protein	A0A1P8CWX8	Bacillus_phage	1.0e-48	84.7
AXF35478.1\|2211875_2212085_-	hypothetical protein	NA	NA	NA	NA
AXF33392.1\|2212071_2212476_-	hypothetical protein	A0A1P8CWX0	Bacillus_phage	7.2e-16	40.3
AXF35479.1\|2212472_2212841_-	hypothetical protein	A0A024B0P0	Bacillus_phage	5.9e-17	61.3
AXF33393.1\|2213062_2213257_-	hypothetical protein	O64105	Bacillus_phage	1.9e-27	100.0
AXF33394.1\|2213368_2213566_-	hypothetical protein	O64104	Bacillus_phage	6.8e-28	98.5
AXF33395.1\|2213635_2213854_-	hypothetical protein	O64103	Bacillus_phage	2.5e-31	98.6
2213694:2213713	attL	NA	NA	NA	NA
AXF33396.1\|2214036_2214261_+	XRE family transcriptional regulator	O64102	Bacillus_phage	1.9e-34	100.0
AXF33397.1\|2214449_2215427_-	hypothetical protein	O64101	Bacillus_phage	8.8e-177	99.4
AXF33398.1\|2215450_2216833_-	hypothetical protein	O64100	Bacillus_phage	3.7e-261	99.3
AXF33399.1\|2216939_2218016_-\|integrase	SPBc2 prophage-derived probable integrase/recombinase YopP	O64099	Bacillus_phage	2.0e-198	99.7
AXF33400.1\|2218005_2218218_-	XRE family transcriptional regulator	O64098	Bacillus_phage	1.6e-27	95.7
AXF33401.1\|2218266_2218584_-	hypothetical protein	NA	NA	NA	NA
AXF33402.1\|2218586_2218787_-	hypothetical protein	O64096	Bacillus_phage	3.4e-27	98.5
AXF33403.1\|2219114_2219240_-	hypothetical protein	NA	NA	NA	NA
AXF33404.1\|2219253_2220414_-	hypothetical protein	NA	NA	NA	NA
AXF33405.1\|2220662_2221127_-	hypothetical protein	NA	NA	NA	NA
AXF33406.1\|2221190_2221529_-	hypothetical protein	A0A1P8CWV8	Bacillus_phage	8.4e-18	43.6
AXF33407.1\|2221593_2221971_-	hypothetical protein	NA	NA	NA	NA
AXF33408.1\|2221963_2222647_-	hypothetical protein	NA	NA	NA	NA
AXF33409.1\|2222699_2222831_-	hypothetical protein	A0A1P8CWV9	Bacillus_phage	4.7e-17	90.7
AXF33410.1\|2222841_2223057_-	hypothetical protein	O64089	Bacillus_phage	2.3e-29	91.5
AXF33411.1\|2223381_2223561_+	hypothetical protein	A0A1P8CWV7	Bacillus_phage	1.2e-28	98.3
AXF33412.1\|2223847_2224078_-	hypothetical protein	NA	NA	NA	NA
AXF33413.1\|2224095_2225793_-	hypothetical protein	X2KLG0	Campylobacter_phage	3.3e-09	27.1
AXF33414.1\|2225838_2226075_-	hypothetical protein	NA	NA	NA	NA
AXF35480.1\|2226169_2226397_-	XRE family transcriptional regulator	O64085	Bacillus_phage	6.6e-35	97.3
AXF33415.1\|2226489_2226927_-	hypothetical protein	NA	NA	NA	NA
AXF35481.1\|2227017_2227401_-	hypothetical protein	O64087	Bacillus_phage	4.0e-08	34.2
AXF33416.1\|2227480_2227816_-	hypothetical protein	NA	NA	NA	NA
AXF33417.1\|2227853_2228150_-	hypothetical protein	NA	NA	NA	NA
AXF33418.1\|2228225_2228471_-	hypothetical protein	NA	NA	NA	NA
AXF33419.1\|2228669_2228951_-	hypothetical protein	NA	NA	NA	NA
AXF35482.1\|2228984_2229239_-	hypothetical protein	NA	NA	NA	NA
AXF33420.1\|2229594_2230812_-	hypothetical protein	A0A1P8CWT6	Bacillus_phage	2.1e-199	82.9
AXF33421.1\|2230893_2231082_-	hypothetical protein	O64081	Bacillus_phage	9.7e-24	96.8
AXF33422.1\|2231126_2231378_-	hypothetical protein	A0A1P8CWU4	Bacillus_phage	8.4e-31	97.2
AXF33423.1\|2231396_2231573_-	hypothetical protein	O64080	Bacillus_phage	1.3e-09	92.3
AXF33424.1\|2232527_2232722_+	hypothetical protein	O64077	Bacillus_phage	7.9e-29	98.4
AXF33425.1\|2232761_2235281_+	hypothetical protein	O64076	Bacillus_phage	0.0e+00	99.8
AXF33426.1\|2235524_2235803_+	SPBc2 prophage-derived DNA-binding protein HU 2	A0A1P8CWT5	Bacillus_phage	1.2e-30	76.9
AXF33427.1\|2236338_2236602_-	hypothetical protein	A0A1P8CWT2	Bacillus_phage	1.4e-39	97.6
AXF33428.1\|2237493_2237685_+	hypothetical protein	A0A1P8CWT3	Bacillus_phage	1.9e-27	100.0
AXF33429.1\|2237697_2238915_+	hypothetical protein	A0A1P8CWS1	Bacillus_phage	5.6e-229	99.5
AXF33430.1\|2239151_2239481_+	hypothetical protein	NA	NA	NA	NA
AXF33431.1\|2239518_2240043_+	hypothetical protein	U5J9P3	Bacillus_phage	5.7e-21	38.4
AXF33432.1\|2240145_2241066_+	hypothetical protein	A0A1P8CWS6	Bacillus_phage	2.1e-175	99.7
AXF33433.1\|2241052_2242822_+	hypothetical protein	O64069	Bacillus_phage	0.0e+00	99.8
AXF33434.1\|2242839_2244360_+	hypothetical protein	O64068	Bacillus_phage	2.3e-280	99.0
AXF33435.1\|2244390_2245827_+	hypothetical protein	A0A1P8CWR1	Bacillus_phage	1.7e-264	99.0
AXF33436.1\|2245851_2246388_+	hypothetical protein	A0A1P8CWS2	Bacillus_phage	3.0e-94	98.9
AXF33437.1\|2246426_2247443_+	hypothetical protein	A0A1P8CWR9	Bacillus_phage	6.4e-186	99.4
AXF33438.1\|2247478_2247949_+	hypothetical protein	A0A1P8CWS5	Bacillus_phage	1.1e-81	99.4
AXF33439.1\|2247963_2248359_+	hypothetical protein	A0A1P8CWR5	Bacillus_phage	2.5e-69	100.0
AXF33440.1\|2248355_2248610_+	hypothetical protein	A0A1P8CWS7	Bacillus_phage	2.2e-39	100.0
AXF33441.1\|2248593_2249244_+	hypothetical protein	A0A1P8CWR8	Bacillus_phage	3.2e-122	100.0
AXF33442.1\|2249240_2249747_+	hypothetical protein	O64060	Bacillus_phage	2.9e-91	99.4
AXF33443.1\|2249743_2250454_+	hypothetical protein	A0A1P8CWQ7	Bacillus_phage	1.8e-131	100.0
AXF33444.1\|2250496_2251294_+	hypothetical protein	A0A1P8CWR0	Bacillus_phage	4.6e-91	99.6
AXF33445.1\|2251311_2251923_+	hypothetical protein	A0A1P8CWQ5	Bacillus_phage	2.4e-63	75.9
AXF33446.1\|2251922_2252150_+	hypothetical protein	A0A1P8CWR2	Bacillus_phage	6.4e-38	100.0
AXF33447.1\|2252213_2252570_+	hypothetical protein	O64055	Bacillus_phage	2.3e-58	99.2
AXF33448.1\|2252571_2253789_+	hypothetical protein	A0A1P8CWR7	Bacillus_phage	1.1e-168	98.3
AXF33449.1\|2253799_2254150_+	hypothetical protein	O64053	Bacillus_phage	3.9e-58	97.4
AXF33450.1\|2254146_2254338_+	XkdX family protein	A0A1P8CWR4	Bacillus_phage	1.3e-28	98.4
AXF33451.1\|2254389_2254878_+	hypothetical protein	A0A1P8CWQ6	Bacillus_phage	3.5e-57	72.4
AXF35484.1\|2254877_2255297_+	hypothetical protein	A0A1P8CWQ4	Bacillus_phage	3.7e-55	78.3
AXF35483.1\|2255310_2256318_+\|integrase	site-specific integrase	A0A0H3V0P2	Geobacillus_virus	9.9e-123	65.7
AXF33452.1\|2256445_2257132_-	hypothetical protein	O64048	Bacillus_phage	2.2e-126	100.0
AXF33453.1\|2257156_2257333_-	hypothetical protein	NA	NA	NA	NA
AXF33454.1\|2257678_2258125_+	hypothetical protein	O64047	Bacillus_phage	8.1e-77	100.0
AXF33455.1\|2258206_2258890_+	immunity protein	Q37974	Bacillus_phage	2.1e-116	100.0
AXF33456.1\|2258943_2265840_+\|tail	phage tail tape measure protein	A0A1P8CWQ1	Bacillus_phage	0.0e+00	70.2
2259187:2259206	attR	NA	NA	NA	NA
AXF33457.1\|2265883_2266645_+\|tail	phage tail protein	A0A1P8CWP8	Bacillus_phage	1.6e-128	96.6
AXF33458.1\|2266657_2269300_+	hypothetical protein	A0A1P8CWQ0	Bacillus_phage	0.0e+00	96.0
AXF35485.1\|2269315_2270137_+	hypothetical protein	A0A1P8CWP7	Bacillus_phage	3.5e-134	99.3
AXF33459.1\|2270173_2272108_+	hypothetical protein	A0A1P8CWN9	Bacillus_phage	0.0e+00	99.8
AXF33460.1\|2272251_2272572_-	hypothetical protein	NA	NA	NA	NA
AXF33461.1\|2272742_2273846_+	N-acetylmuramoyl-L-alanine amidase family protein	A0A1P8CWN6	Bacillus_phage	2.0e-177	94.8
AXF33462.1\|2273961_2274354_+	hypothetical protein	A0A1P8CWP1	Bacillus_phage	2.9e-62	99.2
AXF33463.1\|2274374_2274626_+\|holin	phage holin	A0A1P8CWN5	Bacillus_phage	4.3e-35	92.8
AXF33464.1\|2274752_2275889_+	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	8.9e-213	98.7
AXF33465.1\|2275878_2276055_+	aspartate phosphatase	A0A1P8CWP3	Bacillus_phage	6.9e-24	98.3
AXF33466.1\|2276095_2277346_-	UV damage repair protein UvrX	O64031	Bacillus_phage	9.4e-232	95.9
AXF33467.1\|2277338_2277671_-	YolD-like family protein	A0A1P8CWP2	Bacillus_phage	1.4e-54	98.2
AXF33468.1\|2277844_2278180_+	hypothetical protein	A0A1P8CWM9	Bacillus_phage	4.2e-54	100.0
AXF33469.1\|2278223_2278583_-	hypothetical protein	A0A1P8CWJ9	Bacillus_phage	3.5e-62	100.0
AXF33470.1\|2279051_2279510_-	SMI1/KNR4 family protein	A0A1P8CWJ1	Bacillus_phage	1.5e-70	83.6
AXF33471.1\|2279522_2281409_-	hypothetical protein	A0A1P8CWI7	Bacillus_phage	1.6e-161	82.1
AXF33472.1\|2281541_2282075_-	SMI1/KNR4 family protein	A0A1P8CWM2	Bacillus_phage	2.8e-07	96.3
AXF33473.1\|2282589_2283474_+	endonuclease	A0A1P8CWK6	Bacillus_phage	2.2e-110	93.2

DBSCAN-SWA_7

2424913 : 2431010

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXF33626.1\|2424913_2425507_-	segregation/condensation protein B	A0A1B1IVT7	uncultured_Mediterranean_phage	2.0e-14	35.4
AXF35495.1\|2425496_2426252_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	5.5e-09	29.2
AXF33627.1\|2426533_2427058_+	DUF309 domain-containing protein	NA	NA	NA	NA
AXF33628.1\|2427071_2427446_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AXF33629.1\|2427558_2428023_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	5.5e-44	60.0
AXF33630.1\|2428055_2429252_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	5.9e-114	54.7
AXF33631.1\|2429266_2429914_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	8.5e-43	45.9
AXF33632.1\|2429924_2431010_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	6.6e-56	36.1

DBSCAN-SWA_8

2658376 : 2696523

uncultured_Caudovirales_phage(30.3%)

terminase,holin,tail,plate,portal,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXF33876.1\|2658376_2659972_+	ribonuclease YqcG	A0A1P8CWI7	Bacillus_phage	6.9e-78	61.3
AXF33877.1\|2659986_2660565_+	suppressor of fused domain protein	NA	NA	NA	NA
AXF33878.1\|2660825_2661188_-	hypothetical protein	NA	NA	NA	NA
AXF33879.1\|2661203_2661683_-	hypothetical protein	NA	NA	NA	NA
AXF33880.1\|2661847_2662666_-	N-acetylmuramoyl-L-alanine amidase	A0A218KC88	Bacillus_phage	3.8e-64	73.8
AXF33881.1\|2662710_2663133_-\|holin	holin	D6R405	Bacillus_phage	1.7e-47	72.9
AXF33882.1\|2663178_2664072_-\|portal	phage portal protein	NA	NA	NA	NA
AXF33883.1\|2664159_2664324_-	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	2.7e-14	67.9
AXF33884.1\|2664320_2664656_-\|portal	phage portal protein	NA	NA	NA	NA
AXF33885.1\|2664665_2665766_-	hypothetical protein	M4ZRP1	Bacillus_phage	1.7e-19	56.1
AXF33886.1\|2665769_2666042_-	hypothetical protein	NA	NA	NA	NA
AXF33887.1\|2666038_2666617_-	DUF2313 domain-containing protein	A0A2H4J717	uncultured_Caudovirales_phage	1.9e-14	33.8
AXF33888.1\|2666600_2667647_-\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	4.8e-72	44.0
AXF33889.1\|2667639_2668065_-	DUF2634 domain-containing protein	A0A0A8WJV8	Clostridium_phage	5.6e-11	33.3
AXF33890.1\|2668077_2668344_-	DUF2577 domain-containing protein	NA	NA	NA	NA
AXF33891.1\|2668340_2669321_-\|portal	phage portal protein	H7BV96	unidentified_phage	1.6e-40	32.3
AXF33892.1\|2669333_2669993_-	LysM peptidoglycan-binding domain-containing protein	A0A090DBR9	Clostridium_phage	2.1e-25	34.7
AXF33893.1\|2669985_2674743_-	hypothetical protein	A0A1L2JY60	Aeribacillus_phage	1.8e-44	47.2
AXF33894.1\|2674745_2674883_-	hypothetical protein	NA	NA	NA	NA
AXF33895.1\|2674924_2675374_-\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	2.7e-11	41.1
AXF33896.1\|2675519_2675699_+	toxic peptide TxpA	NA	NA	NA	NA
AXF33897.1\|2676078_2676168_+\|holin	putative holin-like toxin	NA	NA	NA	NA
AXF33898.1\|2676421_2676865_-\|portal	phage portal protein	A0A0K2CNG3	Brevibacillus_phage	3.2e-25	45.4
AXF33899.1\|2676867_2678268_-\|tail	phage tail sheath protein	S5MNC1	Brevibacillus_phage	4.1e-74	39.1
AXF33900.1\|2678268_2678460_-	hypothetical protein	NA	NA	NA	NA
AXF33901.1\|2678456_2678894_-\|portal	phage portal protein	NA	NA	NA	NA
AXF33902.1\|2678906_2679410_-	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	8.3e-38	46.9
AXF33903.1\|2679406_2679769_-	DUF3599 family protein	A0A249XXE9	Clostridium_phage	6.9e-10	39.3
AXF33904.1\|2679765_2680161_-	DUF3199 family protein	NA	NA	NA	NA
AXF33905.1\|2680164_2680476_-	hypothetical protein	NA	NA	NA	NA
AXF33906.1\|2680486_2681422_-\|capsid	phage major capsid protein	A0A1B1P7E3	Bacillus_phage	8.6e-105	65.0
AXF33907.1\|2681440_2682409_-\|portal	phage portal protein	A0A1B1P7E4	Bacillus_phage	7.4e-59	57.3
AXF33908.1\|2682441_2683095_-	hypothetical protein	NA	NA	NA	NA
AXF33909.1\|2683135_2684053_-	hypothetical protein	A0A1B1P7D7	Bacillus_phage	2.4e-51	39.1
AXF33910.1\|2684049_2685582_-\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	4.7e-148	51.9
AXF33911.1\|2685585_2686881_-\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	1.1e-155	63.4
AXF33912.1\|2686873_2687593_-	hypothetical protein	A0A2P1JTW4	Anoxybacillus_phage	1.7e-55	55.9
AXF33913.1\|2687660_2688125_-	hypothetical protein	NA	NA	NA	NA
AXF33914.1\|2688268_2688724_-	sigma-70 family RNA polymerase sigma factor	A0A2H4J4R7	uncultured_Caudovirales_phage	2.4e-60	74.8
AXF33915.1\|2688921_2689851_+	hypothetical protein	NA	NA	NA	NA
AXF33916.1\|2689924_2690131_-	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	5.5e-20	71.6
AXF33917.1\|2690212_2690641_-	RusA family crossover junction endodeoxyribonuclease	S6B1L9	Thermus_phage	5.6e-43	65.7
AXF33918.1\|2690736_2690886_-	hypothetical protein	NA	NA	NA	NA
AXF33919.1\|2690876_2691818_-	ATP-binding protein	A6XMI1	Bacillus_virus	8.0e-58	52.2
AXF33920.1\|2691699_2692401_-	DnaD domain protein	A0A2H4J6G9	uncultured_Caudovirales_phage	1.2e-05	31.8
AXF33921.1\|2692452_2693307_-	recombinase RecT	A0A2H4JCY8	uncultured_Caudovirales_phage	7.1e-122	79.0
AXF33922.1\|2693309_2694269_-	hypothetical protein	A0A2H4JA52	uncultured_Caudovirales_phage	2.2e-135	72.9
AXF33923.1\|2694374_2694569_-	hypothetical protein	NA	NA	NA	NA
AXF33924.1\|2694698_2694956_-	hypothetical protein	A0A2H4J4M9	uncultured_Caudovirales_phage	6.4e-10	42.2
AXF33925.1\|2694952_2695522_-	transcriptional regulator	A0A2H4J884	uncultured_Caudovirales_phage	1.5e-64	61.0
AXF33926.1\|2695595_2695736_-	hypothetical protein	NA	NA	NA	NA
AXF33927.1\|2695765_2695996_-	XRE family transcriptional regulator	A8ATK0	Listeria_phage	1.1e-08	53.4
AXF33928.1\|2696172_2696523_+	helix-turn-helix domain-containing protein	A0A2H4J6F9	uncultured_Caudovirales_phage	2.0e-06	30.6

DBSCAN-SWA_9

3861506 : 3870852

Staphylococcus_phage(100.0%)

tRNA,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXF35014.1\|3861506_3863177_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
AXF35015.1\|3863173_3863602_-	DUF1934 domain-containing protein	NA	NA	NA	NA
AXF35016.1\|3863914_3864046_+\|bacteriocin	subtilosin A family bacteriocin	NA	NA	NA	NA
AXF35017.1\|3864002_3864155_+\|bacteriocin	bacteriocin-like protein SboX	NA	NA	NA	NA
AXF35018.1\|3864179_3865526_+	subtilosin maturase AlbA	NA	NA	NA	NA
AXF35019.1\|3865538_3865700_+\|bacteriocin	bacteriocin biosynthesis protein AlbB	NA	NA	NA	NA
AXF35020.1\|3865696_3866416_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.3e-19	27.2
AXF35021.1\|3866408_3867719_+\|bacteriocin	bacteriocin biosynthesis protein AlbD	NA	NA	NA	NA
AXF35566.1\|3867708_3868869_+\|bacteriocin	bacteriocin biosynthesis zinc-dependent peptidase AlbE	NA	NA	NA	NA
AXF35022.1\|3868873_3870154_+	insulinase family protein	NA	NA	NA	NA
AXF35023.1\|3870150_3870852_+\|bacteriocin	bacteriocin biosynthesis protein AlbG	NA	NA	NA	NA

DBSCAN-SWA_10

3884667 : 3925934

Enterobacteria_phage(20.0%)

tRNA,protease,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXF35040.1\|3884667_3885327_-\|protease	site-2 protease family protein	NA	NA	NA	NA
AXF35041.1\|3885435_3885624_+	2-hydroxymuconate tautomerase	NA	NA	NA	NA
AXF35042.1\|3885666_3886086_-	MarR family transcriptional regulator	NA	NA	NA	NA
AXF35043.1\|3886205_3888122_-\|tRNA	threonine--tRNA ligase	A0A2K9L6B6	Tupanvirus	2.4e-141	43.0
AXF35044.1\|3888966_3890367_-	MFS transporter	NA	NA	NA	NA
AXF35045.1\|3890366_3890837_-	transcriptional regulator	NA	NA	NA	NA
AXF35046.1\|3890948_3891449_-	YwgA family protein	NA	NA	NA	NA
AXF35047.1\|3891484_3892786_-	HD domain-containing protein	E3T4P8	Cafeteria_roenbergensis_virus	4.2e-25	28.9
AXF35048.1\|3892947_3893172_-	DUF1450 domain-containing protein	NA	NA	NA	NA
AXF35049.1\|3893386_3894163_+	prespore-specific transcriptional regulator RsfA	A0A1D6X8E5	Bacillus_phage	7.6e-06	50.0
AXF35050.1\|3894306_3895197_-	EamA family transporter	NA	NA	NA	NA
AXF35051.1\|3895364_3896210_-	octanoyl-[GcvH]:protein N-octanoyltransferase	NA	NA	NA	NA
AXF35052.1\|3896258_3897158_-	transcriptional regulator	A0A2H4J8I9	uncultured_Caudovirales_phage	3.6e-07	42.5
AXF35053.1\|3897304_3898276_-	phosphate acetyltransferase	NA	NA	NA	NA
AXF35567.1\|3898560_3899310_+	heme-dependent peroxidase	NA	NA	NA	NA
AXF35054.1\|3899441_3900221_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AXF35055.1\|3900235_3901435_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
AXF35056.1\|3901435_3902620_-	MFS transporter	NA	NA	NA	NA
AXF35057.1\|3902616_3904035_-	alanine-anticapsin ligase BacD	NA	NA	NA	NA
AXF35058.1\|3904053_3904821_-	dihydroanticapsin 7-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	3.4e-22	31.3
AXF35059.1\|3904817_3905525_-	bacilysin biosynthesis protein BacB	NA	NA	NA	NA
AXF35060.1\|3905514_3906129_-	bacilysin biosynthesis protein BacA	NA	NA	NA	NA
AXF35061.1\|3906280_3907519_-	MFS transporter	NA	NA	NA	NA
AXF35062.1\|3907727_3909140_-	amino acid permease	NA	NA	NA	NA
AXF35063.1\|3909139_3910840_-	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
AXF35064.1\|3910913_3912461_-	L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
AXF35065.1\|3912687_3913962_-	catabolic NAD-specific glutamate dehydrogenase RocG	NA	NA	NA	NA
AXF35066.1\|3914138_3914603_-	hypothetical protein	NA	NA	NA	NA
AXF35067.1\|3914926_3915382_-\|coat	spore coat polysaccharide biosynthesis protein SpsL	NA	NA	NA	NA
AXF35068.1\|3915374_3916226_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	4.1e-37	38.5
AXF35069.1\|3916239_3917187_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	4.4e-72	43.8
AXF35070.1\|3917186_3917927_-	glucose-1-phosphate thymidylyltransferase	I7I009	Enterobacteria_phage	2.6e-48	41.9
AXF35071.1\|3917951_3918971_-\|coat	spore coat protein	NA	NA	NA	NA
AXF35072.1\|3918973_3919696_-\|coat	spore coat polysaccharide biosynthesis protein SpsF	NA	NA	NA	NA
AXF35073.1\|3919688_3920810_-\|coat	spore coat protein	NA	NA	NA	NA
AXF35074.1\|3920809_3921679_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AXF35075.1\|3921679_3922849_-	DegT/DnrJ/EryC1/StrS aminotransferase family protein	A0A1D8KU11	Synechococcus_phage	2.5e-16	26.9
AXF35076.1\|3922869_3924294_-	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
AXF35077.1\|3924298_3925069_-	glycosyltransferase family 2 protein	A0A0F7L2F7	uncultured_marine_virus	5.8e-06	28.6
AXF35078.1\|3925034_3925241_-	hypothetical protein	NA	NA	NA	NA
AXF35079.1\|3925388_3925934_+\|coat	spore coat protein GerQ	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP030938

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 65093

Enterococcus_phage(29.55%)

integrase,capsid,portal,tail,head,protease,terminase

attL 16921:16937|attR 69138:69154

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXF35576.1\|1260_2943_-	PHP domain-containing protein	W5RV95	Staphylococcus_phage	1.5e-176	53.3
AXF35577.1\|3058_3511_-	hypothetical protein	NA	NA	NA	NA
AXF35578.1\|3510_4485_-	FAD-dependent thymidylate synthase	NA	NA	NA	NA
AXF35579.1\|4581_4818_-	hypothetical protein	NA	NA	NA	NA
AXF35580.1\|4814_5282_-	ribonuclease HI	A0A0H3UZB5	Geobacillus_virus	1.8e-39	53.0
AXF35581.1\|5278_5740_-	hypothetical protein	NA	NA	NA	NA
AXF35582.1\|5932_6721_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
AXF35583.1\|7639_8200_-	HD domain-containing protein	NA	NA	NA	NA
AXF35584.1\|8267_8543_-	thioredoxin	A0A0K2FLN5	Brevibacillus_phage	2.9e-08	33.3
AXF35585.1\|8648_9107_-	hypothetical protein	NA	NA	NA	NA
AXF35586.1\|9266_9791_+	DUF3967 domain-containing protein	A0A1Z1LZN4	Bacillus_phage	2.3e-06	28.2
AXF35587.1\|9863_11615_-	hypothetical protein	A0A1G5SBU4	Enterococcus_phage	1.4e-84	37.0
AXF35588.1\|11604_11808_-	hypothetical protein	NA	NA	NA	NA
AXF35589.1\|11868_12909_-	hypothetical protein	A0A1G5SB33	Enterococcus_phage	7.6e-94	51.1
AXF35590.1\|12989_14582_-	hypothetical protein	A0A1G5SC52	Enterococcus_phage	9.1e-155	52.6
AXF35591.1\|14578_15067_-	hypothetical protein	A0A1G5SA84	Enterococcus_phage	2.9e-27	40.9
AXF35592.1\|15165_16236_-	hypothetical protein	NA	NA	NA	NA
AXF35593.1\|16469_16856_-	hypothetical protein	NA	NA	NA	NA
16921:16937	attL	NA	NA	NA	NA
AXF35594.1\|16954_17461_-	hypothetical protein	A0A0S2SY00	Bacillus_phage	6.7e-11	35.8
AXF35595.1\|17707_18133_-	flavodoxin	A0A249XZV0	Enterococcus_phage	1.1e-14	35.2
AXF35596.1\|18134_19178_-	ribonucleotide-diphosphate reductase subunit beta	W5RVC6	Staphylococcus_phage	4.3e-105	53.0
AXF35597.1\|19281_21651_-	ribonucleoside-diphosphate reductase subunit alpha	W5RV23	Staphylococcus_phage	7.4e-278	59.5
AXF35598.1\|21722_22757_-	hypothetical protein	A0A1D3SNC4	Enterococcus_phage	1.1e-87	47.3
AXF35599.1\|22824_23064_-	hypothetical protein	NA	NA	NA	NA
AXF35600.1\|23152_23515_-	hypothetical protein	NA	NA	NA	NA
AXF35601.1\|23511_24033_-	nucleoside 2-deoxyribosyltransferase	A0A218KC29	Bacillus_phage	1.5e-42	56.7
AXF35670.1\|24107_24635_-	hypothetical protein	A0A1G5S9X3	Enterococcus_phage	1.7e-25	46.5
AXF35602.1\|25132_25342_-	hypothetical protein	NA	NA	NA	NA
AXF35603.1\|25534_25897_-	hypothetical protein	A0A075M0D6	Bacillus_phage	1.3e-40	69.1
AXF35604.1\|26065_26395_-	DUF2653 family protein	NA	NA	NA	NA
AXF35605.1\|26397_27174_-	hypothetical protein	NA	NA	NA	NA
AXF35606.1\|27213_27792_-	hypothetical protein	S5M867	Bacillus_phage	3.4e-19	42.1
AXF35607.1\|27796_28321_-	HAD family hydrolase	A0A0H3UZF4	Geobacillus_virus	5.4e-48	60.6
AXF35608.1\|28332_28563_-	hypothetical protein	NA	NA	NA	NA
AXF35609.1\|28592_29291_-	hypothetical protein	NA	NA	NA	NA
AXF35610.1\|29347_30382_-	hypothetical protein	A0A060AL21	Staphylococcus_phage	4.5e-54	38.5
AXF35611.1\|30640_31213_+\|integrase	site-specific integrase	A3F636	Streptococcus_phage	2.2e-34	43.4
AXF35612.1\|31250_31586_+	hypothetical protein	NA	NA	NA	NA
AXF35613.1\|31874_32117_+	hypothetical protein	NA	NA	NA	NA
AXF35671.1\|32250_32682_-	LysM peptidoglycan-binding domain-containing protein	S5MM68	Bacillus_phage	5.5e-14	48.9
AXF35614.1\|32920_34201_-	hypothetical protein	A0A0K2FLM0	Brevibacillus_phage	1.6e-72	37.2
AXF35615.1\|34330_34630_-	hypothetical protein	NA	NA	NA	NA
AXF35616.1\|35579_36419_+	hypothetical protein	NA	NA	NA	NA
AXF35617.1\|36570_37734_-	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	2.1e-44	30.1
AXF35618.1\|37883_38204_-	hypothetical protein	NA	NA	NA	NA
AXF35619.1\|38410_38590_+	hypothetical protein	NA	NA	NA	NA
AXF35620.1\|38564_38978_+	HNH endonuclease	W5RV32	Staphylococcus_phage	6.6e-33	50.0
AXF35621.1\|38989_39481_+\|terminase	phage terminase small subunit P27 family	A0A1G5SA54	Enterococcus_phage	4.3e-47	60.1
AXF35622.1\|39714_41415_+\|terminase	terminase	A0A1G5SA94	Enterococcus_phage	2.9e-207	64.4
AXF35623.1\|41437_42817_+\|portal	phage portal protein	A0A060AFC9	Staphylococcus_phage	1.6e-107	49.4
AXF35624.1\|42858_43800_+\|head,protease	HK97 family phage prohead protease	A0A060AB24	Staphylococcus_phage	4.7e-42	45.2
AXF35625.1\|43820_44969_+\|capsid	phage major capsid protein	A0A060AEU4	Staphylococcus_phage	1.1e-66	47.5
AXF35626.1\|45070_45286_+	hypothetical protein	NA	NA	NA	NA
AXF35627.1\|45275_45608_+\|head,tail	phage gp6-like head-tail connector protein	Q0SPK5	Clostridium_phage	5.6e-06	33.7
AXF35628.1\|45607_45946_+\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
AXF35629.1\|45945_46326_+	hypothetical protein	A0A0M5M1E5	Enterococcus_phage	4.9e-06	30.3
AXF35630.1\|46322_46727_+	hypothetical protein	NA	NA	NA	NA
AXF35631.1\|46757_47408_+\|tail	phage tail protein	A0A249XUT9	Enterococcus_phage	1.6e-20	36.4
AXF35632.1\|47485_47812_+	hypothetical protein	A0A0M4R2F4	Enterococcus_phage	8.7e-12	41.1
AXF35633.1\|48009_53094_+\|tail	phage tail tape measure protein	A8ATA7	Listeria_phage	2.9e-106	49.4
AXF35634.1\|53090_54755_+\|tail	phage tail protein	A0A059T682	Listeria_phage	2.5e-86	35.6
AXF35635.1\|54770_57101_+	hypothetical protein	A0A059T7Y6	Listeria_phage	1.5e-137	37.0
AXF35636.1\|57097_57490_+	hypothetical protein	U5J9M3	Bacillus_phage	9.1e-24	49.1
AXF35637.1\|57507_59175_+	hypothetical protein	U5PU90	Bacillus_phage	2.7e-77	57.9
AXF35638.1\|59183_59663_+	hypothetical protein	R4JMW6	Bacillus_phage	1.8e-34	44.9
AXF35639.1\|59701_59908_+	hypothetical protein	NA	NA	NA	NA
AXF35640.1\|59949_60219_+	hypothetical protein	A0A1L2JY68	Aeribacillus_phage	1.4e-12	47.3
AXF35641.1\|60220_60517_+	hypothetical protein	NA	NA	NA	NA
AXF35642.1\|60488_61844_+	LysM peptidoglycan-binding domain-containing protein	A0A060AFE7	Listeria_phage	2.6e-09	57.8
AXF35643.1\|61953_62931_+\|integrase	site-specific integrase	A0A1D3SNK9	Enterococcus_phage	6.4e-119	64.0
AXF35644.1\|63045_64665_+	hypothetical protein	A0A1P8CWI7	Bacillus_phage	1.6e-77	61.3
AXF35645.1\|64676_65093_+	hypothetical protein	A0A2H4J4V0	uncultured_Caudovirales_phage	4.2e-27	45.0
69138:69154	attR	NA	NA	NA	NA

DBSCAN-SWA_2

69898 : 77350

Lactococcus_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXF35655.1\|69898_70810_-	DUF1738 domain-containing protein	A0A1B1IRD0	uncultured_Mediterranean_phage	2.2e-36	36.7
AXF35656.1\|70920_72915_-	DNA topoisomerase	E0YIY2	Lactococcus_phage	2.7e-148	42.9
AXF35657.1\|73035_74952_-	DNA topoisomerase	V9VEW1	Lactococcus_phage	4.9e-187	51.9
AXF35658.1\|75065_75929_-	hypothetical protein	A0A286QTB6	Streptococcus_phage	1.6e-12	40.6
AXF35659.1\|76287_76782_-	hypothetical protein	NA	NA	NA	NA
AXF35660.1\|76762_77350_-	thymidine kinase	A0A291LB21	Escherichia_phage	1.9e-09	31.7

DBSCAN-SWA_3

81299 : 81848

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXF35665.1\|81299_81848_-	guanylate kinase/L-type calcium channel region	A0A1D3SNH1	Enterococcus_phage	4.7e-26	37.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP030937

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP030938

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection