CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP030194	Salmonella enterica strain SA20080453 chromosome, complete genome	1 crisprs	WYL,csa3,cas3,DEDDh,DinG	1	2	6	0
CP030195	Salmonella enterica strain SA20080453 plasmid pSA20080453.1, complete sequence	1 crisprs	NA	0	1	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP030194_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP030194_1

892119-892206

Orphan

I-E

Consensus_repeat	Method
GAGTTCCCCGCGCCAGCGGGGATAAAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP030194_1

>merge|CP030194|1|892119-892206|CRISPRCasFinder
GAGTTCCCCGCGCCAGCGGGGATAAACCGATTATTTTAAATCCATTGCAACCATGATTGAAGAGTTCCCCGCGCCAGCGGGGATAAAC

>CP030194|1|1|892119-892206|CRISPRCasFinder
GAGTTCCCCGCGCCAGCGGGGATAAAC	CGATTATTTTAAATCCATTGCAACCATGATTGAA
GAGTTCCCCGCGCCAGCGGGGATAAAC

Protein	Signature genes	Signature genes Name	Protein_function
CP030194.1\|AXD27853.1\|894438_895878_+\|sulfate-adenylyltransferase-subunit-CysN	unknown	unknown	gnl\|CDD\|235349
CP030194.1\|AXD27851.1\|892222_893269_-\|aminopeptidase	unknown	unknown	gnl\|CDD\|182299
CP030194.1\|AXD27847.1\|885917_887717_+\|NADPH-dependent-assimilatory-sulfite-reductase-flavoprotein-subunit	unknown	unknown	gnl\|CDD\|182862
CP030194.1\|AXD27846.1\|885249_885615_-\|6-carboxytetrahydropterin-synthase-QueD	unknown	unknown	gnl\|CDD\|238264
CP030194.1\|AXD27859.1\|898550_899600_+\|tRNA-pseudouridine(13)-synthase-TruD	unknown	unknown	gnl\|CDD\|234884
CP030194.1\|AXD27849.1\|889528_890263_+\|phosphoadenosine-phosphosulfate-reductase	unknown	unknown	gnl\|CDD\|234997
CP030194.1\|AXD27852.1\|893520_894429_+\|sulfate-adenylyltransferase-subunit-2	unknown	unknown	gnl\|CDD\|235375
CP030194.1\|AXD27848.1\|887716_889429_+\|assimilatory-sulfite-reductase-(NADPH)-hemoprotein-subunit	unknown	unknown	gnl\|CDD\|237402
CP030194.1\|AXD27845.1\|884500_885172_+\|7-carboxy-7-deazaguanine-synthase-QueE	unknown	unknown	gnl\|CDD\|275126
CP030194.1\|AXD27854.1\|895864_896470_+\|adenylyl-sulfate-kinase	unknown	unknown	gnl\|CDD\|179661
CP030194.1\|AXD27856.1\|897034_897346_+\|cell-division-protein-FtsB	unknown	unknown	gnl\|CDD\|179156
CP030194.1\|AXD27843.1\|881042_882341_+\|enolase	unknown	unknown	gnl\|CDD\|234617
CP030194.1\|AXD27857.1\|897364_898075_+\|2-C-methyl-D-erythritol-4-phosphate-cytidylyltransferase	unknown	unknown	gnl\|CDD\|234670
CP030194.1\|AXD27842.1\|879322_880960_+\|CTP-synthase-(glutamine-hydrolyzing)	unknown	unknown	gnl\|CDD\|235437
CP030194.1\|AXD27844.1\|883641_883989_+\|hypothetical-protein	unknown	unknown	unknown
CP030194.1\|AXD27855.1\|896487_896844_+\|DUF3561-family-protein	unknown	unknown	gnl\|CDD\|371891
CP030194.1\|AXD27858.1\|898074_898554_+\|2-C-methyl-D-erythritol-2,4-cyclodiphosphate-synthase	unknown	unknown	gnl\|CDD\|178851
CP030194.1\|AXD27850.1\|890352_891306_-\|type-III-secretion-system-effector-SopD	unknown	unknown	gnl\|CDD\|185277
CP030194.1\|AXD27860.1\|899580_900342_+\|5'/3'-nucleotidase-SurE	unknown	unknown	gnl\|CDD\|234732
CP030194.1\|AXD27841.1\|878303_879095_+\|nucleoside-triphosphate-pyrophosphohydrolase	unknown	unknown	gnl\|CDD\|236569

Protein	Function_ID	Function_description	E-value
CP030194.1\|AXD27853.1\|894438_895878_+\|sulfate-adenylyltransferase-subunit-CysN	gnl\|CDD\|235349	PRK05124, cysN, sulfate adenylyltransferase subunit 1; Provisional.	0
CP030194.1\|AXD27851.1\|892222_893269_-\|aminopeptidase	gnl\|CDD\|182299	PRK10199, PRK10199, alkaline phosphatase isozyme conversion aminopeptidase; Provisional.	0
CP030194.1\|AXD27847.1\|885917_887717_+\|NADPH-dependent-assimilatory-sulfite-reductase-flavoprotein-subunit	gnl\|CDD\|182862	PRK10953, cysJ, NADPH-dependent assimilatory sulfite reductase flavoprotein subunit.	0
CP030194.1\|AXD27846.1\|885249_885615_-\|6-carboxytetrahydropterin-synthase-QueD	gnl\|CDD\|238264	cd00470, PTPS, 6-pyruvoyl tetrahydropterin synthase (PTPS). Folate derivatives are essential cofactors in the biosynthesis of purines, pyrimidines, and amino acids, as well as formyl-tRNA. Mammalian cells are able to utilize pre-formed folates after uptake by a carrier-mediated active transport system. Most microbes and plants lack this system and must synthesize folates de novo from guanosine triphosphate. One enzyme from this pathway is PTPS which catalyzes the conversion of dihydroneopterin triphosphate to 6-pyruvoyl tetrahydropterin. The functional enzyme is a hexamer of identical subunits.	4.27114e-59
CP030194.1\|AXD27859.1\|898550_899600_+\|tRNA-pseudouridine(13)-synthase-TruD	gnl\|CDD\|234884	PRK00984, truD, tRNA pseudouridine synthase D; Reviewed.	0
CP030194.1\|AXD27849.1\|889528_890263_+\|phosphoadenosine-phosphosulfate-reductase	gnl\|CDD\|234997	PRK02090, PRK02090, phosphoadenylyl-sulfate reductase.	5.48132e-137
CP030194.1\|AXD27852.1\|893520_894429_+\|sulfate-adenylyltransferase-subunit-2	gnl\|CDD\|235375	PRK05253, PRK05253, sulfate adenylyltransferase subunit CysD.	0
CP030194.1\|AXD27848.1\|887716_889429_+\|assimilatory-sulfite-reductase-(NADPH)-hemoprotein-subunit	gnl\|CDD\|237402	PRK13504, PRK13504, NADPH-dependent assimilatory sulfite reductase hemoprotein subunit.	0
CP030194.1\|AXD27845.1\|884500_885172_+\|7-carboxy-7-deazaguanine-synthase-QueE	gnl\|CDD\|275126	TIGR04322, organic_radical_activating_enzyme, putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE. Members of this radical SAM domain protein family appear to be the E. coli form of the queuosine biosynthesis protein QueE. QueE is involved in making preQ0 (7-cyano-7-deazaquanine), a precursor of both the bacterial/eukaryotic modified tRNA base queuosine and the archaeal modified base archaeosine. Members occur in species that lack known forms of QueE but usually are not found in queuosine biosynthesis operons. Members of this family tend to form bi-directional best hit matches to members of known (TIGR03365) and putative (TIGR03963) QueE families from other lineages.	4.81131e-156
CP030194.1\|AXD27854.1\|895864_896470_+\|adenylyl-sulfate-kinase	gnl\|CDD\|179661	PRK03846, PRK03846, adenylylsulfate kinase; Provisional.	1.34007e-142
CP030194.1\|AXD27856.1\|897034_897346_+\|cell-division-protein-FtsB	gnl\|CDD\|179156	PRK00888, ftsB, cell division protein FtsB; Reviewed.	1.08865e-64
CP030194.1\|AXD27843.1\|881042_882341_+\|enolase	gnl\|CDD\|234617	PRK00077, eno, enolase; Provisional.	0
CP030194.1\|AXD27842.1\|879322_880960_+\|CTP-synthase-(glutamine-hydrolyzing)	gnl\|CDD\|235437	PRK05380, pyrG, CTP synthetase; Validated.	0
CP030194.1\|AXD27857.1\|897364_898075_+\|2-C-methyl-D-erythritol-4-phosphate-cytidylyltransferase	gnl\|CDD\|234670	PRK00155, ispD, D-ribitol-5-phosphate cytidylyltransferase.	6.15245e-118
CP030194.1\|AXD27855.1\|896487_896844_+\|DUF3561-family-protein	gnl\|CDD\|371891	pfam12084, DUF3561, Protein of unknown function (DUF3561). This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are about 110 amino acids in length.	2.00529e-49
CP030194.1\|AXD27858.1\|898074_898554_+\|2-C-methyl-D-erythritol-2,4-cyclodiphosphate-synthase	gnl\|CDD\|178851	PRK00084, ispF, 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase; Reviewed.	3.77176e-104
CP030194.1\|AXD27850.1\|890352_891306_-\|type-III-secretion-system-effector-SopD	gnl\|CDD\|185277	PRK15379, PRK15379, type III secretion system effector SopD.	0
CP030194.1\|AXD27860.1\|899580_900342_+\|5'/3'-nucleotidase-SurE	gnl\|CDD\|234732	PRK00346, surE, 5'(3')-nucleotidase/polyphosphatase; Provisional.	6.02604e-147
CP030194.1\|AXD27841.1\|878303_879095_+\|nucleoside-triphosphate-pyrophosphohydrolase	gnl\|CDD\|236569	PRK09562, mazG, nucleoside triphosphate pyrophosphohydrolase; Reviewed.	1.30554e-156

>CP030194.1|AXD27850.1|890352_891306_-|type-III-secretion-system-effector-SopD
MPVTLNFGNHHNYTLNESRLSHLLSADKEKATRMGSWDKLQDHFRSERKDHALEVLYSIIHGQGRGEPGEMEVNIEDMGKIYAFKKLQHLACPAHQDLFKIKMDASQTQFLFMVGDTVISQSRIQDILNLSDNVVVESMNSEERQLFLQICEIIGSNIAWHPELLQASVSTLRKEVTSNVQIKEAVYGLVRPAEAPDHQFVEWQSSLSDDEKSMLTCINAGNFDPITQFCKIGYQEVQGEVAFCMMHPCISYLLHTYSPFAEFKETNAGFLKELNQDYKDYHKNKVFIDAILEKIYLTHERSLHIGENECSRNILLA
>CP030194.1|AXD27849.1|889528_890263_+|phosphoadenosine-phosphosulfate-reductase
MSKLDLNALNDLPKVERVMALAETNSQLEKLSAEERVAWALENLPGEYVLSSSFGIQAAVSLHLVNQLSPDIPVILTDTGYLFPETYQFIDELTDKLKLNLKVYRANESAAWQEARYGKLWEQGVEGIEKYNDINKVEPMNRALEELNAQTWFAGLRREQSGSRAHLPVLAIQRGVFKVLPIIDWDNRTVYQYLQKQGLKYHPLWDQGYLSVGDTHTTRKWEPGMAEEETRFFGLKRECGLHEG
>CP030194.1|AXD27848.1|887716_889429_+|assimilatory-sulfite-reductase-(NADPH)-hemoprotein-subunit
MSEKHPGPLVVEGKLSDAERMKLESNYLRGTITEDLNDGLTGGFHGDNFLLIRFHGMYQQDDRDIRAERAAQKLEPRHAMLLRCRLPGGVITTKQWQAIDKFAADNTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLHSVGLDALATANDMNRNVLCTSNPYESELHAEAYEWAKKISEHLLPRTRAYAEIWLDQKKVATTDEEPILGATYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAENGKLVGFNLLVGGGLSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGVETFKEEVERRAGIKFEPIRPYEFTGRGDRIGWVKGIDNNWHLTLFIENGRILDYPGRPLKSGLLEIAKIHKGDFRITANQNLIIAGVPESQKAKIEKLARDHGLMNAVKPQRENSMACVSFPTCPLAMAEAERFLPSFTDKVEAILEKHGIPDEHIVMRVTGCPNGCGRAMLAELGLVGKAPGRYNVHLGGNRMGTRIPRMYRENITESEILDSVDELVGRWAKEREAGEGFGDFTVRAGIIRPVLDPARDFWE
>CP030194.1|AXD27847.1|885917_887717_+|NADPH-dependent-assimilatory-sulfite-reductase-flavoprotein-subunit
MTTQAPPSALFPLNPEQLARLQAATTDLTPAQLAWVSGYFWGVLNHQPGANATVPAPAVEMPGITLISASQTGNARRVAEALRDDLIAAKLNVTLINAGDYKFKQIANEKLLVVVASTQGEGEPAEEAVALHKFLLSKKAPKLDNTAFAVFGLGDTSYEFFCQAGKDFDSRLAELGGERLLDRVDADVEYQAAAAEWRARLVEVLKARAPAAPSVQAAASGAVNDVHSSPYTKEAPLTATLAVNQKITGRESEKDVRHIEIDLGDSGLRYQPGDALGVWYQNDPALVKELVELLWLKGDEPVTVDGKTLPLAEALEWHFELTVNTANIVENYATLTRSESLLPLVGDKAQLQHYAATTPIVDMVRFSPAQLDADALIGLLRPLTPRLYSIASSQAEVESEVHVTVGVVRYDIEGRARAGGASSFLADRVEEEGDVRVFIEHNDNFRLPANPQTSVIMIGPGTGIAPFRAFMQQRAADGAEGKNWLFFGNPHFTEDFLYQVEWQRYVKEGVLSRIDMAWSRDQKEKIYVQDKLREQGAELWRWINDGAHIYVCGDANRMAKDVEQALLEVIAEFGGMDIEAADEFLSELRVERRYQRDVY
>CP030194.1|AXD27846.1|885249_885615_-|6-carboxytetrahydropterin-synthase-QueD
MMSTTLFKDFTFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWIMDFADLKAAFKPTYDRLDHYYLNDIPGLENPTSEVLAKWIWDQVKPVVPLLSAVMVKETCTAGCVYRGQ
>CP030194.1|AXD27845.1|884500_885172_+|7-carboxy-7-deazaguanine-synthase-QueE
MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPVGCAWCDTKHTWDKLEDREVSLYSILAKTKESDKWGAASSEDLLAVIQRQGYTARHVVITGGEPCIHDLMPLTSLLEKNGFSCQIETSGTHEVRCTPNTWVTVSPKVNMRGGYNVLSQALERANEIKHPVGRVRDIEALDELLATLSDDKLRVIALQPISQKEDATRLCIETCIARNWRLSMQTHKYLNIA
>CP030194.1|AXD27844.1|883641_883989_+|hypothetical-protein
MLFKEYDQNDKSLVESIKIAGLGEHKAQKLIRLANKNKINIQKAYLLTDASIIKVDIVLLFVMSFFIFSIAQQDFSEVWAFFLIFGLLFFVIELTCRFHKNYFKVWMVYIKLRGL
>CP030194.1|AXD27843.1|881042_882341_+|enolase
MSKIVKVIGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTGSREALELRDGDKSRFLGKGVTKAVGAVNGPIAQAILGKDAKDQAGIDKIMIDLDGTENKSNFGANAILAVSLANAKAAAAAKGMPLYEHIAELNGTPGKYSMPVPMMNIINGGEHADNNVDIQEFMIQPVGAKTVKEAIRMGSEVFHHLAKVLKGKGMNTAVGDEGGYAPNLGSNAEALAVIAEAVKAAGYELGKDITLAMDCAASEFYKDGKYVLAGEGNKAFTSEEFTHFLEELTKQYPIVSIEDGLDESDWDGFAYQTKVLGDKIQLVGDDLFVTNTKILKEGIEKGIANSILIKFNQIGSLTETLAAIKMAKDAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRVAKYNQLIRIEEALGEKAPYNGRKEIKGQA
>CP030194.1|AXD27842.1|879322_880960_+|CTP-synthase-(glutamine-hydrolyzing)
MTTNYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAETDLDLGHYERFIRTKMSRRNNFTTGRIYSDVLRKERRGDYLGATVQVIPHITNAIKERVLEGGEGHDVVLVEIGGTVGDIESLPFLEAIRQLAVDIGREHALFMHLTLVPYLAAAGEVKTKPTQHSVKELLSIGIQPDILICRSDRAVPANERAKIALFCNVPEKAVISMKDVDSIYKIPGLLKSQGLDDYICKRFSLNCPEANLSEWEQVIYEEANPAGEVTIGMVGKYIELPDAYKSVIEALKHGGLKNRVTVNIKLIDSQDVETRGVEILKDLDAILIPGGFGYRGVEGKIATARYARENNIPYLGICLGMQVALIEFARNVAGMDNANSTEFVPDCKYPVVALITEWRDEDGNVEVRSEKSDLGGTMRLGAQQCQLSDDSLVRQLYGAQTIVERHRHRYEVNNMLLKQIEAAGLRVAGRSGDDQLVEIIEVPNHPWFVACQFHPEFTSTPRDGHPLFAGFVKAACEHQKRQAK
>CP030194.1|AXD27841.1|878303_879095_+|nucleoside-triphosphate-pyrophosphohydrolase
MNQIDRLLNIMQRLRDPESGCPWDKEQTFASIAAYTLEETYEVLDAIAREDFDDLRGELGDLLFQVVFYAQMAQEEGRFDFNDICAAISDKLERRHPHVFGELSADNSEEVLVRWEQIKTEERAQKAQYSALDDIPRSLPALMRAQKIQKRCSNVGFDWTTLGPVVDKVYEEIDEVMFEARQAVVDQAKLEEEMGDLLFATVNMARHLGTKAELALQKANDKFERRFREVERIVAARGLEMTGVDLETMEEVWQEVKRQEIDL
>CP030194.1|AXD27851.1|892222_893269_-|aminopeptidase
MFSATRRFTVILALGVGFILPAQAASPGPGEIANTQARHIATFFPGRMTGSPAEMLSADYLRQQFTRMGYQSDIRTFNSRFIYTTKDNRKNWHNVTGSTVIAAHEGRVPQQIIIMAHLDTYAPQSDADVDANLGGLTLQGMDDNAAGLGVMLELAARLKDIPTHYGIRFIATSGEEEGKLGAENLLKRMSDAEKKNTLLVINLDNLIVGDKLYFNSGKNTPEAVRTLTRDRALAIARRYDIAANTNPGRNPSYPKGTGCCNDAEVFDKAGMSVLSVEATNWNLGKKDGYQQRMKNASFPNGNSWHDVRLDNQQHIDKALPGRIERRSRDVVRIMLPLVKELAKAEKTS
>CP030194.1|AXD27852.1|893520_894429_+|sulfate-adenylyltransferase-subunit-2
MDQKRLTHLRQLEAESIHIIREVAAEFANPVMLYSIGKDSSVMLHLARKAFYPGTLPFPLLHVDTGWKFREMYAFRDRTANAYGCELLVHKNPEGVAMGINPFVHGSAKHTDIMKTEGLKQALNKYGFDAAFGGARRDEEKSRAKERIYSFRDRFHRWDPKNQRPELWRNYNGQINKGESIRVFPLSNWTEQDIWQYIWLENIDIVPLYLAAERPVLERDGMLMMVDDDRIDLQPGEVIKKRMVRFRTLGCWPLTGAVESHAQTLPEIIEEMLVSTTSERQGRMIDRDQAGSMELKKRQGYF
>CP030194.1|AXD27853.1|894438_895878_+|sulfate-adenylyltransferase-subunit-CysN
MNTILAQQIANEGGVEAWMIAQQHKSLLRFLTCGSVDDGKSTLIGRLLHDTRQIYEDQLSSLHNDSKRHGTQGEKLDLALLVDGLQAEREQGITIDVAYRYFSTEKRKFIIADTPGHEQYTRNMATGASTCDLAILLIDARKGVLDQTRRHSFISTLLGIKHLVVAINKMDLVDYREETFARIREDYLTFAEQLPGDLDIRFVPLSALEGDNVAAQSANMRWYSGPTLLEVLETVDIQRAVDRQPMRFPVQYVNRPNLDFRGYAGSLASGSVNVGERIKVLPSGVESSVARIVTFDGDKEEAYAGEAITLVLNDDIDISRGDLLLAANETLAPARHAAIDVVWMAEQPLAPGQNYDVKLAGKKTRARIETIRYQIDINNLTQRDVESLPLNGIGLVEMTFDEPLALDIYQQNPVTGGLIFIDRLSNVTVGAGMVRELVECGVAPPVEYSAFELELNALVRRHFPHWDARDLLGDKHGAA
>CP030194.1|AXD27854.1|895864_896470_+|adenylyl-sulfate-kinase
MARHDENVVWHSHPVTVAAREQLHGHRGVVLWFTGLSGSGKSTVAGALEEALHHRGVSTYLLDGDNVRHGLCRDLGFSDADRQENIRRVGEVASLMADAGLIILTAFISPHRAERQLVQERVGHDRFIEIYIDTPLAICEQRDPKGLYKKARAGELRHFTGIDDIYEAPESPQVHLNGEQLVTNLVSQLLDLLRRRDIIRS
>CP030194.1|AXD27855.1|896487_896844_+|DUF3561-family-protein
MPGMVKVTGFDMRNSHNITFTRSDAFIVDDDTTSSLPGAVVGFVSWLLALGIPFLLYGPNTLFFFLYTWPFFLALMPVSVIIGIALHLLVKGKMLFSIMFTLLAVGALFGALFIWLLG
>CP030194.1|AXD27856.1|897034_897346_+|cell-division-protein-FtsB
MGKLTLLLLALLVWLQYSLWFGKNGIHDYSRVNDDVVAQQATNAKLKARNDQLFAEIDDLNGGQEAIEERARNELSMTKPGETFYRLVPDASKRAATAGQTHR
>CP030194.1|AXD27857.1|897364_898075_+|2-C-methyl-D-erythritol-4-phosphate-cytidylyltransferase
MAATLLDVCAVVPAAGFGRRMQTECPKQYLSIGNKTILEHSVHALLAHPRVTRVVIAISPGDHRFAQLPLANHPQITVVDGGNERADSVLAGLRAIAEAPWVLVHDAARPCLHQDDLARLLAISENSRVGGILASPVRDTMKRGEPGKTAIAHTVERADLWHALTPQFFPRELLHDCLTRALHEGATITDEASALEYCGFHPALVEGRADNIKVTRPEDLALAEFYLTRTIHQEKT
>CP030194.1|AXD27858.1|898074_898554_+|2-C-methyl-D-erythritol-2,4-cyclodiphosphate-synthase
MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRIFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLMKAAK
>CP030194.1|AXD27859.1|898550_899600_+|tRNA-pseudouridine(13)-synthase-TruD
MTEFDNLTWLHGKPQGSGLLKANPEDFVVVEDLGFTPDGEGEHILLRILKNGCNTRFVADALAKFLKIHAREVSFAGQKDKHAVTEQWLCARVPGKEMPDFSAFQLEGCKVLEYARHKRKLRLGALKGNAFTLVLREISDRRDVETRLQAIRDGGVPNYFGAQRFGIGGSNLQGALRWAQSDAPVRDRNKRSFWLSAARSALFNQIVHQRLKKPDFNQVVDGDALQLAGRGSWFVATSEELPELQRRVDEKELMITASLPGSGEWGTQRAALTFEQDAIAHETVLQSLLLREKVEASRRAMLLYPQQLSWNWWDDVTVELRFWLPAGSFATSVVRELINTMGDYAHIAE
>CP030194.1|AXD27860.1|899580_900342_+|5'/3'-nucleotidase-SurE
MRILLSNDDGVHAPGIQTLAKALREFADVQVVAPDRNRSGASNSLTLESSLRTFTFDNGDIAVQMGTPTDCVYLGVNALMRPRPDIVVSGINAGPNLGDDVIYSGTVAAAMEGRHLGFPALAVSLDGYQHYDTAAAVTCALLRGLSREPLRTGRILNVNVPDLPLAQIKGIRVTRCGSRHPADKVIPQEDPRGNTLYWIGPPGDKYDAGPDTDFAAVDEGYVSVTPLHVDLTAHSAHDVVSDWLDSVGVGTQW

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
CP030194_3	3.2\|3138298\|36\|CP030194\|CRISPRCasFinder	3138298-3138333	36	CP030194.1	3138343-3138378	1	0.972

1. spacer 3.2|3138298|36|CP030194|CRISPRCasFinder matches to position: 3138343-3138378, mismatch: 1, identity: 0.972

ttcttcgcgtccgccgccgctttcgccgcctcggct	CRISPR spacer
ttcttcgcatccgccgccgctttcgccgcctcggct	Protospacer
********.***************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP030194_3	3.1\|3138232\|33\|CP030194\|CRISPRCasFinder	3138232-3138264	33	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2757373-2757405	7	0.788
CP030194_3	3.2\|3138298\|36\|CP030194\|CRISPRCasFinder	3138298-3138333	36	NZ_CP054618	Azospirillum oryzae strain KACC 14407 plasmid unnamed4, complete sequence	416538-416573	9	0.75
CP030194_3	3.2\|3138298\|36\|CP030194\|CRISPRCasFinder	3138298-3138333	36	NC_016585	Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence	904593-904628	9	0.75
CP030194_3	3.2\|3138298\|36\|CP030194\|CRISPRCasFinder	3138298-3138333	36	NZ_CP016453	Sphingobium sp. RAC03 plasmid pBSY17_1, complete sequence	374342-374377	9	0.75
CP030194_3	3.2\|3138298\|36\|CP030194\|CRISPRCasFinder	3138298-3138333	36	NZ_CP014600	Yangia sp. CCB-MM3 plasmid unnamed4, complete sequence	121077-121112	11	0.694

1. spacer 3.1|3138232|33|CP030194|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.788

gccgcctcggcctccgctctcttcttcgcctca	CRISPR spacer
gccgcctcggcctccgcttccttctgggacgcc	Protospacer
******************..*****  * * *

2. spacer 3.2|3138298|36|CP030194|CRISPRCasFinder matches to NZ_CP054618 (Azospirillum oryzae strain KACC 14407 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.75

ttcttcgcgtccgccgccgctttcgccgcctcggct	CRISPR spacer
cgcatggcgtccgccgccgcttccgccgcctccagc	Protospacer
. * * ****************.********* . .

3. spacer 3.2|3138298|36|CP030194|CRISPRCasFinder matches to NC_016585 (Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence) position: , mismatch: 9, identity: 0.75

ttcttcgcgtccgccgccgctttcgccgcctcggct	CRISPR spacer
cgcatggcgtccgccgccgcttccgccgcctccagc	Protospacer
. * * ****************.********* . .

4. spacer 3.2|3138298|36|CP030194|CRISPRCasFinder matches to NZ_CP016453 (Sphingobium sp. RAC03 plasmid pBSY17_1, complete sequence) position: , mismatch: 9, identity: 0.75

ttcttcgcgtccgccgccgctttcgccgcctcggct	CRISPR spacer
agcgccgcgtccgccgccgcgatcgccgcctgcgtt	Protospacer
  * .***************  *********  *.*

5. spacer 3.2|3138298|36|CP030194|CRISPRCasFinder matches to NZ_CP014600 (Yangia sp. CCB-MM3 plasmid unnamed4, complete sequence) position: , mismatch: 11, identity: 0.694

ttcttcgcgtccgccgccgctttcgccgcctcggct	CRISPR spacer
cttccgagatccgccgccgctttcccggcctcggcc	Protospacer
.*... . .*************** * ********.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1060296 : 1123643

Salmonella_phage(88.64%)

tRNA,lysis,tail,portal,integrase,transposase,capsid,head,plate

attL 1048742:1048757|attR 1077939:1077954

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1048742:1048757	attL	NA	NA	NA	NA
AXD28004.1\|1060296_1061396_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.1e-47	42.6
AXD28005.1\|1061779_1062805_-\|integrase	site-specific integrase	A0A1S6L016	Salmonella_phage	1.4e-201	99.1
AXD28006.1\|1062808_1063441_-	phage repressor protein	A0A1S6KZZ7	Salmonella_phage	3.3e-116	99.5
AXD28007.1\|1063560_1063803_+	Rha family transcriptional regulator	A0A1S6KZZ6	Salmonella_phage	1.1e-38	100.0
AXD28008.1\|1063835_1064345_+	hypothetical protein	A0A1S6L008	Salmonella_phage	5.4e-85	95.3
AXD28009.1\|1064431_1064707_-	hypothetical protein	NA	NA	NA	NA
AXD31102.1\|1064791_1064986_+	DUF2724 domain-containing protein	E5G6L4	Salmonella_phage	5.3e-25	84.1
AXD28010.1\|1064949_1065291_+	hypothetical protein	E5G6L5	Salmonella_phage	6.0e-48	84.1
AXD28011.1\|1065358_1065586_+	DUF2732 domain-containing protein	A0A0M3UL87	Salmonella_phage	8.1e-17	64.0
AXD28012.1\|1065585_1065813_+	TraR/DksA family transcriptional regulator	E5G6L7	Salmonella_phage	5.4e-21	66.7
AXD28013.1\|1065809_1066667_+	DNA adenine methylase	E5G6L8	Salmonella_phage	4.2e-114	70.2
AXD28014.1\|1066663_1069057_+	replication endonuclease	A0A1S6L028	Salmonella_phage	0.0e+00	88.8
AXD28015.1\|1069076_1069304_-	hypothetical protein	NA	NA	NA	NA
AXD28016.1\|1069441_1069630_+	hypothetical protein	E5G6M0	Salmonella_phage	5.7e-24	91.7
AXD28017.1\|1069960_1071163_+	DNA (cytosine-5-)-methyltransferase	M1PSQ0	Streptococcus_phage	5.6e-64	37.1
AXD28018.1\|1071125_1072043_+	restriction endonuclease	NA	NA	NA	NA
AXD28019.1\|1072089_1073124_-\|portal	phage portal protein	E5G6M3	Salmonella_phage	4.8e-189	95.0
AXD28020.1\|1073123_1074890_-	oxidoreductase	A0A1S6KZW3	Salmonella_phage	0.0e+00	96.6
AXD28021.1\|1075032_1075866_+\|capsid	capsid protein	E5G6M5	Salmonella_phage	8.5e-128	95.3
AXD28022.1\|1075882_1076950_+\|capsid	phage major capsid protein, P2 family	A0A1S6KZZ3	Salmonella_phage	2.8e-192	98.0
AXD28023.1\|1076953_1077604_+	hypothetical protein	A0A1S6KZX1	Salmonella_phage	1.6e-113	98.6
AXD28024.1\|1077697_1078162_+\|head	head completion/stabilization protein	A0A1S6KZW8	Salmonella_phage	6.0e-83	96.1
1077939:1077954	attR	NA	NA	NA	NA
AXD28025.1\|1078161_1078365_+\|tail	phage tail protein	E5G6M9	Salmonella_phage	3.8e-34	100.0
AXD28026.1\|1078368_1078584_+	hypothetical protein	E5G6N0	Salmonella_phage	5.9e-33	100.0
AXD28027.1\|1078564_1079074_+	lysozyme	A0A1S6KZY9	Salmonella_phage	1.9e-93	98.2
AXD28028.1\|1079078_1079453_+	hypothetical protein	NA	NA	NA	NA
AXD28029.1\|1079449_1079878_+\|lysis	LysB family phage lysis regulatory protein	A0A1S6KZX8	Salmonella_phage	8.0e-66	96.4
AXD28030.1\|1079807_1080011_+	hypothetical protein	A0A1S6KZX6	Salmonella_phage	2.2e-29	95.5
AXD28031.1\|1079973_1080405_+\|tail	phage tail protein	A0A1S6KZY0	Salmonella_phage	3.8e-71	93.7
AXD28032.1\|1080397_1080841_+	phage virion morphogenesis protein	A0A1S6L001	Salmonella_phage	5.4e-57	81.0
AXD28033.1\|1081935_1082514_+\|plate	phage baseplate assembly protein V	A0A1S6KZX7	Salmonella_phage	1.8e-92	85.4
AXD28034.1\|1082510_1082870_+\|plate	baseplate assembly protein	A0A1S6KZZ4	Salmonella_phage	6.1e-51	85.7
AXD28035.1\|1082856_1083765_+\|plate	baseplate assembly protein	A0A1S6KZY6	Salmonella_phage	5.2e-147	92.7
AXD28036.1\|1083757_1084363_+\|tail	phage tail protein I	E5G6N9	Salmonella_phage	1.2e-115	98.0
AXD28037.1\|1084359_1086015_+\|tail	phage tail protein	A0A1S6KZZ8	Salmonella_phage	6.1e-312	97.6
AXD28038.1\|1086017_1086557_+\|tail	tail fiber assembly protein	A0A1S6KZZ1	Salmonella_phage	5.5e-96	98.9
AXD28039.1\|1086560_1087178_-\|tail	tail fiber assembly protein	A0A1S6KZY8	Salmonella_phage	2.2e-112	99.5
AXD28040.1\|1087147_1088137_-\|tail	phage tail protein	A0A1S6KZZ0	Salmonella_phage	3.7e-191	98.8
AXD28041.1\|1088166_1088724_+	recombinase family protein	A0A1S6L009	Salmonella_phage	2.5e-99	98.9
AXD28042.1\|1088826_1089999_+\|tail	phage tail protein	A0A1S6KZY7	Salmonella_phage	4.9e-222	99.5
AXD28043.1\|1090008_1090524_+\|tail	phage major tail tube protein	E5G6P8	Salmonella_phage	2.7e-92	99.4
AXD28044.1\|1090578_1090881_+\|tail	phage tail assembly protein	A0A1S6KZZ9	Salmonella_phage	2.5e-45	100.0
AXD28045.1\|1090895_1091015_+\|tail	GpE family phage tail protein	E5G6Q0	Salmonella_phage	1.8e-15	100.0
AXD28046.1\|1093810_1094296_+\|tail	phage tail protein	E5G6Q2	Salmonella_phage	8.3e-67	99.2
AXD28047.1\|1094292_1095393_+	phage late control D family protein	E5G6Q3	Salmonella_phage	9.0e-194	95.6
AXD31103.1\|1095461_1095680_+	levansucrase regulator	Q53ZE7	Salmonella_virus	2.1e-38	100.0
AXD31104.1\|1096231_1097395_-	secretion protein HlyD	NA	NA	NA	NA
AXD28048.1\|1097402_1099583_-	type I secretion system permease/ATPase	F2Y2R6	Organic_Lake_phycodnavirus	9.9e-19	27.8
AXD28049.1\|1099579_1100989_-	type I secretion protein TolC	NA	NA	NA	NA
AXD28050.1\|1101053_1111961_-	type I secretion C-terminal target domain-containing protein	NA	NA	NA	NA
AXD31105.1\|1112574_1113057_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	5.2e-29	47.4
AXD28051.1\|1113206_1113683_+	type II toxin-antitoxin system RatA family toxin	NA	NA	NA	NA
AXD28052.1\|1113672_1113963_+	RnfH family protein	NA	NA	NA	NA
AXD28053.1\|1114124_1114463_-	outer membrane protein assembly factor BamE	NA	NA	NA	NA
AXD28054.1\|1114611_1116273_-	DNA repair protein RecN	NA	NA	NA	NA
AXD28055.1\|1116358_1117237_-	NAD(+) kinase	NA	NA	NA	NA
AXD31106.1\|1117168_1117363_+	molecular chaperone GrpE	NA	NA	NA	NA
AXD28056.1\|1117359_1117953_+	nucleotide exchange factor GrpE	NA	NA	NA	NA
AXD28057.1\|1118013_1119255_-	DUF21 domain-containing protein	NA	NA	NA	NA
AXD28058.1\|1119319_1120111_-	inner membrane protein YpjD	NA	NA	NA	NA
AXD28059.1\|1120056_1120353_-	hypothetical protein	NA	NA	NA	NA
AXD28060.1\|1120276_1121638_+	signal recognition particle protein	NA	NA	NA	NA
AXD28061.1\|1121889_1122138_+	30S ribosomal protein S16	NA	NA	NA	NA
AXD28062.1\|1122156_1122705_+	ribosome maturation factor RimM	NA	NA	NA	NA
AXD28063.1\|1122875_1123643_+\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA

DBSCAN-SWA_2

1561092 : 1602564

Salmonella_phage(66.04%)

plate,holin,tail,portal,transposase,capsid,head,protease,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXD28428.1\|1561092_1562277_-	recombinase	A0A2D1GN00	Marinobacter_phage	1.3e-33	30.2
AXD28429.1\|1562278_1562488_-	hypothetical protein	NA	NA	NA	NA
AXD28430.1\|1562527_1562956_-	3'-5' exoribonuclease	K7PLW7	Enterobacteria_phage	7.5e-64	77.6
AXD28431.1\|1563033_1564074_-\|transposase	IS481 family transposase	A0A077SLK2	Escherichia_phage	9.4e-185	88.7
AXD28432.1\|1564301_1564664_-	DUF551 domain-containing protein	S4TSR6	Salmonella_phage	2.2e-32	81.6
AXD28433.1\|1564660_1565242_-	hypothetical protein	Q5G8V2	Enterobacteria_phage	1.0e-55	65.1
AXD28434.1\|1565234_1565546_-	hypothetical protein	Q5G8V1	Enterobacteria_phage	3.2e-32	64.3
AXD28435.1\|1565549_1565738_-	diguanylate phosphodiesterase	A0A192Y8X2	Salmonella_phage	1.0e-25	98.4
AXD28436.1\|1565740_1566256_-	ead/Ea22-like family protein	C6ZR30	Salmonella_phage	4.5e-31	54.5
AXD28437.1\|1566252_1566474_-	hypothetical protein	A0A222YYR6	Escherichia_phage	2.6e-28	80.6
AXD28438.1\|1566544_1567084_-	HD family hydrolase	A0A192Y8M4	Salmonella_phage	2.6e-98	100.0
AXD28439.1\|1567220_1568048_-	DUF2303 family protein	Q8HAA2	Salmonella_phage	3.2e-151	98.5
AXD28440.1\|1568105_1568477_-	hypothetical protein	Q8HAA1	Salmonella_phage	1.1e-63	100.0
AXD28441.1\|1568574_1568760_+	hypothetical protein	NA	NA	NA	NA
AXD28442.1\|1569291_1569987_-	helix-turn-helix transcriptional regulator	Q8HAA0	Salmonella_phage	4.6e-127	99.6
AXD28443.1\|1570084_1570309_+	XRE family transcriptional regulator	A0A1C9IHV8	Salmonella_phage	1.9e-34	100.0
AXD28444.1\|1570337_1570892_+	hypothetical protein	A0A1C9II13	Salmonella_phage	6.9e-102	100.0
AXD28445.1\|1570888_1572031_+	peptidase	A0A1C9IHV9	Salmonella_phage	1.6e-206	97.4
AXD28446.1\|1572027_1572252_+	hypothetical protein	A0A1C9II64	Salmonella_phage	3.3e-39	100.0
AXD28447.1\|1572248_1573193_+	helix-turn-helix domain-containing protein	U5P0A0	Shigella_phage	3.3e-120	81.5
AXD28448.1\|1573152_1573677_+	PerC family transcriptional regulator	Q8HA95	Salmonella_phage	4.5e-95	98.3
AXD28449.1\|1573676_1574330_+	phage N-6-adenine-methyltransferase	A5LH72	Enterobacteria_phage	1.4e-114	88.9
AXD28450.1\|1574326_1574716_+	RusA family crossover junction endodeoxyribonuclease	A0A1C9IIA0	Salmonella_phage	2.4e-61	86.0
AXD28451.1\|1574687_1575593_+	KilA-N domain-containing protein	A0A192Y6F8	Salmonella_phage	1.4e-160	98.3
AXD31121.1\|1575600_1576590_+	DUF968 domain-containing protein	A0A1C9IHZ5	Salmonella_phage	2.0e-192	98.8
AXD28452.1\|1576604_1577183_+	DUF1133 family protein	A0A0U2S606	Escherichia_phage	9.3e-49	56.7
AXD28453.1\|1577902_1579126_+	amidohydrolase	NA	NA	NA	NA
AXD28454.1\|1579239_1579629_+	hypothetical protein	K7PHB9	Enterobacterial_phage	8.1e-41	71.8
AXD28455.1\|1579615_1579897_+\|holin	phage holin family protein	K7PKN9	Enterobacterial_phage	2.6e-36	80.6
AXD28456.1\|1579896_1580514_+	glycoside hydrolase family 19 protein	Q8HA86	Salmonella_phage	1.7e-93	81.3
AXD28457.1\|1580510_1581029_+	DUF2514 domain-containing protein	NA	NA	NA	NA
AXD28458.1\|1581071_1581422_+	HNH endonuclease	Q8HA82	Salmonella_phage	3.1e-63	95.7
AXD28459.1\|1581573_1582011_+\|terminase	phage terminase small subunit P27 family	A0A1J0GV10	Halomonas_phage	9.2e-33	63.7
AXD28460.1\|1582010_1583741_+\|terminase	terminase large subunit	Q8W631	Enterobacteria_phage	2.1e-197	58.5
AXD31122.1\|1584011_1585106_+\|portal	phage portal protein	A0A1W6JP33	Morganella_phage	1.3e-179	82.7
AXD28461.1\|1585098_1585701_+\|head,protease	HK97 family phage prohead protease	Q8SBH9	Shigella_phage	6.0e-99	91.5
AXD28462.1\|1585710_1586940_+\|capsid	phage major capsid protein	Q8SBH8	Shigella_phage	1.1e-208	91.2
AXD28463.1\|1587019_1587343_+\|head,tail	phage gp6-like head-tail connector protein	Q8SBH7	Shigella_phage	7.2e-43	80.4
AXD28464.1\|1587339_1587744_+\|head,tail	head-tail adaptor protein	A0A192Y6C2	Salmonella_phage	3.0e-54	76.1
AXD28465.1\|1587715_1588228_+	hypothetical protein	Q8HAC8	Salmonella_phage	9.6e-82	88.2
AXD28466.1\|1588224_1588782_+	hypothetical protein	A0A192Y5U4	Salmonella_phage	3.0e-97	94.0
AXD28467.1\|1588803_1588968_+	DUF2635 domain-containing protein	Q8HAC6	Salmonella_phage	2.5e-23	96.3
AXD28468.1\|1588957_1590454_+\|tail	phage tail protein	Q8HAC5	Salmonella_phage	4.8e-275	98.6
AXD28469.1\|1590453_1590810_+\|tail	phage tail protein	A0A192Y8K0	Salmonella_phage	2.6e-62	100.0
AXD28470.1\|1590806_1591133_+\|tail	phage tail assembly protein	Q8HAC3	Salmonella_phage	2.3e-52	99.1
AXD28471.1\|1591217_1593146_+\|tail	phage tail tape measure protein	A0A192Y6D8	Salmonella_phage	0.0e+00	97.0
AXD28472.1\|1593179_1594520_+	DNA circularization protein	A0A192Y5U9	Salmonella_phage	4.5e-248	98.7
AXD28473.1\|1594516_1595575_+\|plate	baseplate protein	A0A192Y7L7	Salmonella_phage	8.6e-202	99.4
AXD28474.1\|1595574_1596108_+\|plate	phage baseplate assembly protein V	Q8HAB9	Salmonella_phage	2.3e-94	97.7
AXD28475.1\|1596112_1596526_+	hypothetical protein	A0A192Y6D0	Salmonella_phage	3.1e-75	100.0
AXD28476.1\|1596518_1597598_+\|plate	phage baseplate protein	A0A192Y6E4	Salmonella_phage	2.7e-203	98.9
AXD28477.1\|1597600_1598188_+	DUF2313 domain-containing protein	A0A192Y5V3	Salmonella_phage	6.6e-111	97.4
AXD28478.1\|1598174_1599527_+\|tail	phage tail protein	S4TP62	Salmonella_phage	1.5e-137	86.5
AXD28479.1\|1599541_1600060_+\|tail	phage tail protein	A0A0U2QV64	Escherichia_phage	9.5e-45	51.4
AXD28480.1\|1600295_1600493_+	hypothetical protein	NA	NA	NA	NA
AXD28481.1\|1600584_1601118_-\|tail	tail fiber assembly protein	A0A1S6KZZ1	Salmonella_phage	1.1e-83	86.5
AXD28482.1\|1601120_1601984_-\|tail	phage tail protein	A0A1S6KZZ8	Salmonella_phage	3.2e-154	94.7
AXD31123.1\|1602012_1602564_+	DNA-invertase	A0A1S6L009	Salmonella_phage	4.1e-86	88.8

DBSCAN-SWA_3

1676030 : 1684587

Enterobacteria_phage(66.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXD28550.1\|1676030_1676978_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.9e-24	31.2
AXD28551.1\|1676961_1677693_+	ABC transporter permease	NA	NA	NA	NA
AXD28552.1\|1677673_1677781_-	hypothetical protein	NA	NA	NA	NA
AXD28553.1\|1677840_1678572_-	HTH-type transcriptional regulator MlrA	Q9EYF2	Enterobacteria_phage	4.1e-102	88.4
AXD28554.1\|1678794_1680480_+	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	3.8e-276	90.7
AXD28555.1\|1680476_1681196_+	DNA-binding response regulator	NA	NA	NA	NA
AXD28556.1\|1681242_1681713_+	DUF1456 family protein	Q9EYF4	Enterobacteria_phage	3.0e-74	92.1
AXD28557.1\|1681854_1682313_-	DUF1307 domain-containing protein	Q9EYF5	Enterobacteria_phage	1.2e-54	74.5
AXD28558.1\|1682553_1684587_-\|tRNA	methionine--tRNA ligase	A0A1V0SDF2	Indivirus	4.7e-55	27.6

DBSCAN-SWA_4

1929576 : 1991504

Phage_Gifsy-2(18.18%)

tail,tRNA,integrase,transposase

attL 1964795:1964811|attR 1978797:1978813

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXD28756.1\|1929576_1930548_-\|tRNA	tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB	NA	NA	NA	NA
AXD28757.1\|1930544_1931288_-	carboxy-S-adenosyl-L-methionine synthase CmoA	F5B419	Synechococcus_phage	9.2e-25	30.9
AXD28758.1\|1931327_1931723_-	hypothetical protein	NA	NA	NA	NA
AXD28759.1\|1931970_1932744_-	DUF72 domain-containing protein	Q859D1	Escherichia_coli_phage	4.2e-57	79.5
AXD28760.1\|1933761_1934929_+\|transposase	IS3 family transposase	Q716C2	Shigella_phage	2.1e-177	96.7
AXD31137.1\|1934987_1935293_+\|tail	phage tail protein	S4TUB9	Salmonella_phage	2.8e-44	93.8
AXD28761.1\|1936462_1937146_-	SOS response-associated peptidase	A0A2H4J5W2	uncultured_Caudovirales_phage	2.7e-79	60.8
AXD28762.1\|1937466_1938033_-	hydrolase	NA	NA	NA	NA
AXD28763.1\|1938357_1940130_+\|tRNA	aspartate--tRNA ligase	NA	NA	NA	NA
AXD28764.1\|1940232_1940685_+	dihydroneopterin triphosphate diphosphatase	NA	NA	NA	NA
AXD28765.1\|1940714_1941455_+	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
AXD28766.1\|1941491_1942013_+	crossover junction endodeoxyribonuclease RuvC	G3MA90	Bacillus_virus	4.5e-10	35.1
AXD31138.1\|1942094_1942706_+	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
AXD28767.1\|1942714_1943725_+	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	2.4e-07	25.9
AXD28768.1\|1943776_1944562_-	zinc ABC transporter permease subunit ZnuB	NA	NA	NA	NA
AXD28769.1\|1944558_1945314_-	zinc ABC transporter ATP-binding protein ZnuC	G3M9Y6	Bacillus_virus	3.2e-17	29.4
AXD28770.1\|1945377_1946337_+	zinc ABC transporter substrate-binding protein ZnuA	NA	NA	NA	NA
AXD28771.1\|1946352_1947672_+	murein DD-endopeptidase MepM	A8ATH6	Listeria_phage	2.6e-14	40.9
AXD28772.1\|1947562_1947790_-	hypothetical protein	NA	NA	NA	NA
AXD28773.1\|1947788_1948760_+	lauroyl-Kdo(2)-lipid IV(A) myristoyltransferase	NA	NA	NA	NA
AXD28774.1\|1948831_1950274_-	pyruvate kinase II	NA	NA	NA	NA
AXD28775.1\|1950397_1951267_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
AXD28776.1\|1951450_1951636_-	hypothetical protein	NA	NA	NA	NA
AXD28777.1\|1951608_1953084_+	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	2.6e-79	37.5
AXD28778.1\|1953318_1955130_+	phosphogluconate dehydratase	NA	NA	NA	NA
AXD28779.1\|1955167_1955809_+	keto-hydroxyglutarate-aldolase/keto-deoxy- phosphogluconate aldolase	NA	NA	NA	NA
AXD28780.1\|1955907_1957086_-	formate-dependent phosphoribosylglycinamide formyltransferase	NA	NA	NA	NA
AXD28781.1\|1957217_1957508_+	damage-inducible protein YebG	NA	NA	NA	NA
AXD28782.1\|1957575_1957929_+	hypothetical protein	NA	NA	NA	NA
AXD28783.1\|1958022_1958682_+	tellurite resistance TerB family protein	NA	NA	NA	NA
AXD28784.1\|1958894_1960946_+	oligopeptidase B	NA	NA	NA	NA
AXD28785.1\|1960981_1961680_-	exodeoxyribonuclease X	Q6UAU3	Klebsiella_phage	4.3e-08	41.6
AXD28786.1\|1961703_1962360_-	carbon-nitrogen hydrolase family protein	NA	NA	NA	NA
AXD28787.1\|1962466_1962697_-	DNA polymerase III subunit theta	H9C187	Pectobacterium_phage	2.9e-14	60.3
AXD28788.1\|1962834_1963209_+	CopC domain-containing protein YobA	NA	NA	NA	NA
AXD28789.1\|1963209_1964085_+	hypothetical protein	NA	NA	NA	NA
AXD28790.1\|1964101_1964452_+	DUF2511 domain-containing protein	NA	NA	NA	NA
AXD28791.1\|1964512_1964632_+	hypothetical protein	NA	NA	NA	NA
1964795:1964811	attL	NA	NA	NA	NA
AXD28792.1\|1964818_1965220_-\|integrase	integrase	A0A2H4IYC8	uncultured_Caudovirales_phage	4.5e-26	47.7
AXD31139.1\|1965864_1966203_+	hypothetical protein	B6DZB9	Enterobacteria_phage	2.4e-20	48.4
AXD28793.1\|1966361_1966646_-	addiction module antidote protein, HigA family	A0A2L1IV52	Escherichia_phage	1.1e-21	53.4
AXD28794.1\|1966645_1966924_-	Killer protein	A0A2L1IV28	Escherichia_phage	1.8e-26	55.4
AXD28795.1\|1967173_1967434_+	hypothetical protein	NA	NA	NA	NA
AXD28796.1\|1967504_1968188_-	PipA/GogA/GtgA family type III secretion system effector	Q9MBM0	Phage_Gifsy-2	1.0e-86	73.8
AXD31140.1\|1970169_1972440_+	E3 ubiquitin--protein ligase	Q9MBL9	Phage_Gifsy-2	3.1e-23	48.7
AXD31141.1\|1973758_1974001_+	hypothetical protein	Q8HAB3	Salmonella_phage	1.2e-05	70.3
AXD28797.1\|1974248_1976360_+	E3 ubiquitin--protein ligase	Q9MBL9	Phage_Gifsy-2	6.9e-25	45.7
AXD28798.1\|1977327_1977885_-\|transposase	transposase	NA	NA	NA	NA
AXD28799.1\|1979035_1981102_+	E3 ubiquitin--protein ligase	Q9MBL9	Phage_Gifsy-2	5.1e-57	69.9
1978797:1978813	attR	NA	NA	NA	NA
AXD28800.1\|1981281_1982253_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AXD28801.1\|1982279_1983068_-	transcriptional regulator	NA	NA	NA	NA
AXD28802.1\|1983069_1983561_-	CaiF/GrlA family transcriptional regulator	NA	NA	NA	NA
AXD28803.1\|1983656_1984817_-	hypothetical protein	NA	NA	NA	NA
AXD28804.1\|1984809_1985556_-	fimbrial chaperone protein StdC	NA	NA	NA	NA
AXD28805.1\|1985597_1988087_-	fimbrial outer membrane usher protein StdB	NA	NA	NA	NA
AXD31142.1\|1988271_1988772_-	long polar fimbrial protein LpfA	NA	NA	NA	NA
AXD28806.1\|1989842_1990319_-	hypothetical protein	NA	NA	NA	NA
AXD28807.1\|1990405_1991504_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.1e-47	42.6

DBSCAN-SWA_5

3331367 : 3342006

Salmonella_phage(42.86%)

tail,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXD29977.1\|3331367_3332408_+\|transposase	IS481 family transposase	A0A077SLK2	Escherichia_phage	7.2e-185	89.0
AXD29978.1\|3335042_3337040_-	lytic transglycosylase domain-containing protein	Q716G2	Shigella_phage	0.0e+00	95.0
AXD31201.1\|3337039_3338266_-	acyltransferase	E7C9U5	Salmonella_phage	1.8e-126	66.5
AXD29979.1\|3338308_3338998_-	DNA transfer protein	B9UDK9	Salmonella_phage	1.4e-88	81.7
AXD29980.1\|3339000_3339456_-	DUF2824 family protein	I6R0L6	Salmonella_phage	4.4e-86	98.7
AXD29981.1\|3339455_3340094_-\|tail	phage tail protein	A0A088CPT1	Enterobacteria_phage	1.9e-87	97.6
AXD29982.1\|3341523_3342006_-	packaged DNA stabilization protein p27	Q716G8	Shigella_phage	2.5e-76	83.6

DBSCAN-SWA_6

3551600 : 3586245

Wolbachia_phage(20.0%)

plate,integrase,transposase

attL 3585071:3585086|attR 3589306:3589321

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXD30169.1\|3551600_3552602_-\|transposase	IS110 family transposase	Q75QL1	Wolbachia_phage	6.8e-15	27.5
AXD30170.1\|3554040_3554325_-	type VI secretion system PAAR protein	NA	NA	NA	NA
AXD30171.1\|3554518_3554707_-	hypothetical protein	NA	NA	NA	NA
AXD30172.1\|3554876_3555371_-	hypothetical protein	NA	NA	NA	NA
AXD30173.1\|3555367_3555580_-	hypothetical protein	NA	NA	NA	NA
AXD30174.1\|3556111_3556351_-	hypothetical protein	NA	NA	NA	NA
AXD30175.1\|3557111_3558965_-	LysM peptidoglycan-binding domain-containing protein	A0A2P1CFS5	Microbacterium_phage	3.1e-05	51.0
AXD30176.1\|3558964_3559387_-	DUF4431 domain-containing protein	NA	NA	NA	NA
AXD30177.1\|3559389_3561933_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	2.9e-22	25.2
AXD30178.1\|3562158_3562677_-	type VI secretion system tube protein Hcp	NA	NA	NA	NA
AXD30179.1\|3563354_3563855_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
AXD31210.1\|3563892_3565368_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
AXD30180.1\|3565370_3565799_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
AXD30181.1\|3565798_3567634_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
AXD31211.1\|3567600_3568647_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
AXD31212.1\|3568663_3569953_+	type VI secretion system-associated FHA domain protein TagH	NA	NA	NA	NA
AXD30182.1\|3569949_3570483_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
AXD30183.1\|3570485_3571829_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
AXD31213.1\|3571908_3572646_+	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
AXD30184.1\|3572654_3575405_+	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	8.2e-87	31.6
AXD30185.1\|3575401_3576163_+	type VI secretion system-associated protein TagO	NA	NA	NA	NA
AXD30186.1\|3576167_3577571_+	type VI secretion system protein TssA	NA	NA	NA	NA
AXD30187.1\|3577587_3581112_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
AXD30188.1\|3581122_3582472_+	hypothetical protein	NA	NA	NA	NA
AXD30189.1\|3582496_3582976_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
AXD30190.1\|3583010_3583874_+	flagellar biosynthesis protein FlgJ	NA	NA	NA	NA
AXD30191.1\|3583876_3584215_+	hypothetical protein	NA	NA	NA	NA
AXD30192.1\|3584252_3584525_+	hypothetical protein	NA	NA	NA	NA
AXD30193.1\|3584561_3585419_-	hypothetical protein	NA	NA	NA	NA
3585071:3585086	attL	NA	NA	NA	NA
AXD30194.1\|3585969_3586245_-\|integrase	integrase	A0A1B5FPC6	Escherichia_phage	8.4e-08	41.0
AXD30194.1\|3585969_3586245_-\|integrase	integrase	A0A1B5FPC6	Escherichia_phage	8.4e-08	41.0
3589306:3589321	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP030195

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP030195_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP030195_1

116-235

Orphan

Consensus_repeat	Method
TGAAAGGTGGATGGGTACGCACTGAAAGGTGGATGGGTACGCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP030195_1

>merge|CP030195|1|116-235|CRISPRCasFinder
TGAAAGGTGGATGGGTACGCACTGAAAGGTGGATGGGTACGCACTGTGATTTTCATGAAAGGTGGATGGCTGCGCACTGAAAGGTGGATGGGTACGCATTGAAAGGTGGATGGGTACGCA

>CP030195|1|1|116-235|CRISPRCasFinder
TGAAAGGTGGATGGGTACGCACTGAAAGGTGGATGGGTACGCA	CTGTGATTTTCATGAAAGGTGGATGGCTGCGCAC
TGAAAGGTGGATGGGTACGCATTGAAAGGTGGATGGGTACGCA

Protein	Signature genes	Signature genes Name	Protein_function
CP030195.1\|AXD31261.1\|3526_3808_-\|CopG-family-transcriptional-regulator	unknown	unknown	unknown
CP030195.1\|AXD31307.1\|4948_5611_+\|resolvase	unknown	unknown	gnl\|CDD\|239736
CP030195.1\|AXD31262.1\|3905_4568_-\|peptidyl-arginine-deiminase	unknown	unknown	gnl\|CDD\|222854
CP030195.1\|AXD31263.1\|5687_7091_-\|ISKra4-family-transposase	unknown	unknown	unknown
CP030195.1\|AXD31258.1\|487_1327_+\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376444
CP030195.1\|AXD31306.1\|2171_2528_+\|DNA-distortion-polypeptide-3	unknown	unknown	unknown
CP030195.1\|AXD31265.1\|9259_9463_+\|hypothetical-protein	unknown	unknown	unknown
CP030195.1\|AXD31264.1\|7753_8344_-\|plasmid-pRiA4b-ORF-3-family-protein	unknown	unknown	gnl\|CDD\|377943
CP030195.1\|AXD31259.1\|1540_1984_+\|hypothetical-protein	unknown	unknown	unknown
CP030195.1\|AXD31260.1\|2524_3502_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP030195.1\|AXD31307.1\|4948_5611_+\|resolvase	gnl\|CDD\|239736	cd03767, SR_Res_par, Serine recombinase (SR) family, Partitioning (par)-Resolvase subfamily, catalytic domain; Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. This subgroup is composed of proteins similar to the E. coli resolvase found in the par region of the RP4 plasmid, which encodes a highly efficient partitioning system. This protein is part of a complex stabilization system involved in the resolution of plasmid dimers during cell division. Similar to Tn3 and other resolvases, members of this family may contain a C-terminal DNA binding domain.	7.86002e-74
CP030195.1\|AXD31262.1\|3905_4568_-\|peptidyl-arginine-deiminase	gnl\|CDD\|222854	PHA02518, PHA02518, ParA-like protein; Provisional.	3.31211e-18
CP030195.1\|AXD31258.1\|487_1327_+\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	3.14677e-22
CP030195.1\|AXD31264.1\|7753_8344_-\|plasmid-pRiA4b-ORF-3-family-protein	gnl\|CDD\|377943	pfam07929, PRiA4_ORF3, Plasmid pRiA4b ORF-3-like protein. Members of this family are similar to the protein product of ORF-3 found on plasmid pRiA4 in the bacterium Agrobacterium rhizogenes. This plasmid is responsible for tumorigenesis at wound sites of plants infected by this bacterium, but the ORF-3 product does not seem to be involved in the pathogenetic process. Other proteins found in this family are annotated as being putative TnpR resolvases, but no further evidence was found to back this. Moreover, another member of this family is described as a probable lexA repressor and in fact carries a LexA DNA binding domain (pfam01726), but no references were found to expand on this.	3.49717e-37

>CP030195.1|AXD31258.1|487_1327_+|replication-initiation-protein
MNLLSVTKKTKIRHRNEINSTFSSLPLSARRILFMAMAQIDSREELSEGATFRITAREYAFIADIDVTGAYRQLKEGAEELQASVIRIPRNQLLTAQGDQSSERVKKRRKLPSDAVRLMNLTAFCDYVESEGYIEIAFSHVIEPYITMLKDSYTTQVLISSVRLADPNSNMLYQFIRKQYSSGKKTFFDIEVDVLKDELELFKMDDGEKVYLYQNFKDFNKVFLQKNIEKINQYTEINNLTVKIVERIARRASKLRFSYKIDKESEGLDTRIPYGFRGA
>CP030195.1|AXD31259.1|1540_1984_+|hypothetical-protein
MAKIYQFPQGEERGKFRKEIARERKKRLRVKNGNPFIRHVKWFWFYLRLATAGALHLVSVIALAVLGAFSKVIFWIGGLICVVTWFHLERQFWTPQNFTIPVIVTLWGLSLFATPLMELLNKKMPWYRLLVPDAKDTSTEASKDDQL
>CP030195.1|AXD31306.1|2171_2528_+|DNA-distortion-polypeptide-3
MKYQVREFITDKYAKAVNILKDNLKENHHVFYGVRLSEILFPASEYGTDAFFKEFELINSVILPLVIFDLTQRKPMMIISFDKIPDASLLEGTNIVVLECTTLADLLTNDNIGFLYKS
>CP030195.1|AXD31260.1|2524_3502_-|hypothetical-protein
MRYLTELICQLYRLTDHHKLTAATFKNLADIKLVEPTADADTILQLENIFSEYSLRYIDRDLAEILSNIITTDKNHSLDFDFNKIQSLTASKSFGCGWNKVINGSWFKNLYSWGEGMYPAKNLKAENISDWEDNIWHIEHEGFNPRDPINVKYYSWLDRYVALNSGGSHHAAMVVYQSVRDKLEYKREAVIEQLSINSNTVEILGQNYYSFIFQIKHPSNKTENYTSEYEFTDALKDFGQNRHTTLKPVNYVSNIKLAFIPKDALKTNSETFRNWFYSAISYGKIISLPDYLKNPAHYHTYHYSHELDSITLGNPSRKYKLRGDS
>CP030195.1|AXD31261.1|3526_3808_-|CopG-family-transcriptional-regulator
MALKLNRPNIDKSQQPATNAETARFISGATRAPVVGKPKLMNFRLSAHFEDILEAEAIRTGQSKTTVLKAALAMYNSQDENIKNHWLLESAKF
>CP030195.1|AXD31262.1|3905_4568_-|peptidyl-arginine-deiminase
MGKILLVVSDKGGVGKSTYVANTGSMLVNKGKSVIILKTDKNHDLLSWNEKRTDNGLLTIPVHAAYGNVSNEIKRLSKLCEVLIVDCPGHDSQEFRSALTVSDIVVTLVKPSSDFESETLTSVTEKIRTAQKANAALEPWVLFTRINSAKPRHRKAAIDLDKLLRSDNIWIQPLKTRISELDVYESACNEGAGVHDVSRASSLSTAKAQIELVAQEIGIL
>CP030195.1|AXD31307.1|4948_5611_+|resolvase
MTQTVPKGFVRAYLRASTTEQDATRALDTINTFAIERGLSICNYYIENESGSKLERPELFRLLKDCQQNDILLVEDVDRLSRLVGEDWNTLKKMIRQKDIRVVAVNVPTTWLASGHNDFDSRMFSAINDMLLDMLAAVARRDYEQRRERQQQGIARAKREGKYKGRQVNQSRYDAINRLIASGSSWSQIQKVLGCSRATISKAVKQRTAGKISTEQEEYE
>CP030195.1|AXD31263.1|5687_7091_-|ISKra4-family-transposase
MKLTFQIVITDESGSSRTEELMSLQKSGDALNDIGLSVSESKQLLGAVQKSLVQQQADEYIHQNIRCPHCLTKRRIKGQQKIQYRTLFGVIPVSGLRVYRCHCEESATKTVSLLSDWAGDHTHPALKYIETRWASLISYEMMVRLLKDVLPVGYSLNASTVRNHLCRVAQRLDSEAESHSGFISGCPRDWGNLPKPGKPLVVGIDGGYIRDRDDKKRNFEIIAGKSFSIGAPADARRFGFVQKSDCHPERRLMAHLSAQGMQANQQIFFLSDGADNLRELQFGMYPESIHVLDWFHITMRLTVLMQYAKGLQASDPATGSKVLSLLESCKRYLWHGNVATALDRIDDCVMYCDDPELNYANLKALQKQLDEMYTYIRNNQMMIPNYGEMRRYGEPVSTAFVESTINEVIARRMAKKQQMQWSRKGAHYLLQTRTAVLNNELQDKFASWYPGCTIDAQSRGTLSAMAA
>CP030195.1|AXD31264.1|7753_8344_-|plasmid-pRiA4b-ORF-3-family-protein
MKVYVIKIAVRGVSPMVWRRLRIAADTSLAALHFIIQIIQGWGDDHLHQFHIYGKDYGITYDGGIGFPDNPFQVVIDDFEFDVGDRFTYEYNFFEHWIHDTRVEAIYENSTLKTPFCISGHGMPGATVADEFDKTLAFLEAIVNANDETTIGEIHPFADDLDAVWFNRNKINRQLSKLDLASPALEPEVIWLGRRR
>CP030195.1|AXD31265.1|9259_9463_+|hypothetical-protein
MRYVNSEILREGLGARIYERAPGNAGINKPSPVKGTPDSARTRAMILTFIVASQFKHNIHAVPELLH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP030195	Salmonella enterica strain SA20080453 plasmid pSA20080453.1, complete sequence	159-192	0	1.0
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_KX518744	Escherichia coli strain HYEC7 plasmid pHYEC7-110, complete sequence	63874-63907	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP041286	Escherichia coli strain 54 plasmid p54-tetX, complete sequence	64169-64202	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_KU321583	Escherichia coli strain E80 plasmid pE80, complete sequence	38215-38248	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_KT990220	Escherichia coli strain 42-2 plasmid p42-2, complete sequence	37006-37039	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP010164	Escherichia coli strain H2 plasmid A, complete sequence	20751-20784	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP019647	Salmonella enterica subsp. enterica serovar Typhimurium strain TW-Stm6 plasmid pSTM6-275, complete sequence	239581-239614	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP022964	Salmonella enterica subsp. enterica serovar Pullorum strain QJ-2D-Sal plasmid pQJDsal1, complete sequence	30266-30299	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP024467	Shigella dysenteriae strain BU53M1 plasmid unnamed1, complete sequence	17630-17663	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_LS999563	Escherichia coli isolate EC-TO143 plasmid 4, complete sequence	16611-16644	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_LS999563	Escherichia coli isolate EC-TO143 plasmid 4, complete sequence	53074-53107	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP019284	Escherichia coli strain 13P484A plasmid p13P484A-4, complete sequence	32601-32634	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP047093	Salmonella sp. S13 plasmid pS13-4, complete sequence	1762-1795	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP051432	Escherichia sp. SCLE84 plasmid pSCLE2, complete sequence	23725-23758	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP046002	Escherichia coli strain 1916D6 plasmid p1916D6-2, complete sequence	35337-35370	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP045188	Escherichia coli strain NT1F31 plasmid pNT1F31-tetX4, complete sequence	26770-26803	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP031548	Escherichia coli strain cq9 plasmid unnamed2, complete sequence	41390-41423	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP031548	Escherichia coli strain cq9 plasmid unnamed2, complete sequence	60962-60995	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP032386	Salmonella enterica subsp. enterica serovar Dublin strain CVM N53043 plasmid pN53043_2, complete sequence	39391-39424	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP032389	Salmonella enterica subsp. enterica serovar Dublin strain CVM N45955 plasmid pN45955_2, complete sequence	9889-9922	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_LT904873	Salmonella enterica subsp. enterica serovar Typhi strain ERL11909 plasmid 2	5696-5729	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_KT754163	Shigella dysenteriae 1 strain A5468 plasmid pA5468, complete sequence	12265-12298	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP033383	Salmonella enterica subsp. enterica strain CFSA300 plasmid pCFSA300-2, complete sequence	7366-7399	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP020836	Escherichia coli strain CFSAN051542 plasmid pCFSAN051542, complete sequence	20407-20440	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP038140	Escherichia coli strain G3X16-2 plasmid pG3X16-2-3, complete sequence	93494-93527	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP043216	Salmonella enterica subsp. enterica serovar Heidelberg strain SL-312 plasmid pET8.2-IncX1, complete sequence	32193-32226	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP042617	Escherichia coli strain NCYU-26-73 plasmid pNCYU-26-73-2, complete sequence	25537-25570	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP031361	Salmonella enterica subsp. enterica serovar Heidelberg strain 5 plasmid p2, complete sequence	27033-27066	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP044153	Shigella flexneri strain AR-0425 plasmid pAR-0425-1, complete sequence	25749-25782	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP040929	Escherichia coli strain YY76-1 plasmid pYY76-1-2, complete sequence	2187-2220	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP033386	Salmonella enterica subsp. enterica strain CFSA1007 plasmid pCFSA1007-2, complete sequence	34721-34754	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP041177	Salmonella enterica subsp. enterica serovar Enteritidis strain SJTUF12367v2 plasmid p12367A, complete sequence	4942-4975	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP034761	Klebsiella pneumoniae strain NB5306 plasmid unnamed2, complete sequence	47580-47613	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP050707	Salmonella enterica subsp. enterica serovar Enteritidis strain SE124 plasmid pSE124-1, complete sequence	14631-14664	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP047339	Klebsiella pneumoniae strain 2019036D plasmid p2019036D-35kb, complete sequence	28949-28982	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NC_010860	Salmonella enterica subsp. enterica serovar Enteritidis plasmid pSE34, complete sequence	32623-32656	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP022453	Salmonella enterica subsp. enterica serovar Indiana strain D90 plasmid pD90-3, complete sequence	5893-5926	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP024153	Escherichia coli strain 14EC033 plasmid p14EC033f, complete sequence	53536-53569	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP030208	Salmonella enterica strain SA19992307 plasmid pSA19992307.1, complete sequence	39815-39848	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP005994	Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002064 plasmid unnamed, complete sequence	30028-30061	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP032450	Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69838 plasmid pSDU1-USMARC-69838, complete sequence	29110-29143	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP010155	Escherichia coli strain D9 plasmid C, complete genome	14497-14530	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP050174	Escherichia coli strain STB20-1 plasmid pSTB20-1T, complete sequence	58667-58700	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP029061	Escherichia coli strain FORC_081 plasmid pFORC_081_4, complete sequence	10786-10819	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP042589	Escherichia coli strain PK6 plasmid pRHEcCUB-1, complete sequence	29459-29492	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP025677	Escherichia albertii strain ChinaSP140150 plasmid pEA-1, complete sequence	79278-79311	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP041453	Escherichia coli strain YPE3 plasmid pYPE3-92k-tetX4, complete sequence	54169-54202	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	MN816373	Escherichia coli strain A127 plasmid pA127-X1, complete sequence	29459-29492	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP052879	Escherichia coli strain C21 plasmid pC21-2, complete sequence	61147-61180	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP033379	Escherichia coli strain L73 plasmid pL73-2, complete sequence	99797-99830	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP033632	Escherichia coli isolate ECCNB12-2 plasmid pTB-nb1, complete sequence	88012-88045	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP050724	Salmonella enterica subsp. enterica serovar Enteritidis strain SE74 plasmid pSE74-1, complete sequence	41949-41982	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP047573	Escherichia coli strain 2EC1 plasmid p2EC1-2, complete sequence	53619-53652	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NC_019106	Salmonella enterica subsp. enterica serovar Dublin plasmid pSD_77, complete sequence	32551-32584	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP010127	Escherichia coli strain C8 plasmid B, complete genome	33248-33281	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP027138	Escherichia coli strain AR_0369 plasmid unnamed2	85971-86004	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP022072	Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_321 plasmid unnamed2, complete sequence	18650-18683	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP043935	Klebsiella pneumoniae strain 555 plasmid pSCKLB555-3, complete sequence	20398-20431	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP043935	Klebsiella pneumoniae strain 555 plasmid pSCKLB555-3, complete sequence	147056-147089	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP045998	Escherichia coli strain 1916D18 plasmid p1916D18-1, complete sequence	35339-35372	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP032394	Salmonella enterica subsp. enterica serovar Dublin strain CVM 22453 plasmid p22453_2, complete sequence	32800-32833	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NC_019256	Shigella sp. LN126 plasmid pLN126_33, complete sequence	2112-2145	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	MH884649	Salmonella sp. strain Sa21 plasmid pSa21-IncX1-28K, complete sequence	16816-16849	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	MH884651	Salmonella sp. strain Sa21 plasmid pSa21-TC-CIP, complete sequence	68260-68293	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	MH229869	Escherichia coli plasmid pKANJ7, complete sequence	90-123	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP050713	Salmonella enterica subsp. enterica serovar Enteritidis strain SE104 plasmid pSE104-1, complete sequence	33434-33467	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP041439	Escherichia coli strain YPE12 plasmid pYPE12-106k, complete sequence	96892-96925	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP041443	Escherichia coli strain YPE12 plasmid pYPE12-101k-tetX4, complete sequence	63333-63366	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_MK461931	Escherichia coli strain F2_14D plasmid pF2_14D_HI2, complete sequence	238663-238696	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_MK656937	Escherichia coli strain T3 plasmid pT3, complete sequence	37880-37913	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_MK731977	Escherichia coli strain ENV103 plasmid pSGMCR103, complete sequence	22155-22188	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_MK673546	Salmonella enterica subsp. enterica serovar Typhimurium strain GDD27-24 plasmid pGDD27-24, complete sequence	28203-28236	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP032447	Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69840 plasmid pSDU1-USMARC-69840, complete sequence	18380-18413	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_MH179305	Salmonella enterica subsp. enterica serovar Indiana strain JT01 plasmid pJT01, complete sequence	118004-118037	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_MH179305	Salmonella enterica subsp. enterica serovar Indiana strain JT01 plasmid pJT01, complete sequence	151970-152003	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_MH287085	Escherichia coli strain F2_12B plasmid pSDC-F2_12BHI2, complete sequence	243053-243086	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_MH287084	Escherichia coli O157 strain SvETEC plasmid pSDE-SvHI2, complete sequence	241163-241196	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP025558	Salmonella enterica subsp. enterica serovar Enteritidis strain PIR00532 plasmid p2PIR00532, complete sequence	11939-11972	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	MT219825	Escherichia coli strain RW7-1 plasmid pRW7-1_235k_tetX, complete sequence	90443-90476	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	MT219826	Escherichia coli strain RW8-1 plasmid pRW8-1_122k_tetX, complete sequence	43726-43759	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_MG904998	Escherichia coli strain 15OD0495 plasmid p15ODTXV, complete sequence	48918-48951	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_MG197491	Escherichia coli strain FKU92 plasmid pHNFKU92, complete sequence	33352-33385	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_MG197498	Escherichia coli strain HZMCC14 plasmid pHNMCC14, complete sequence	58347-58380	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_MG197503	Escherichia coli strain ZYTM118 plasmid pHNZY118, complete sequence	61256-61289	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_MG197495	Escherichia coli strain AHC24 plasmid pHNAH24, complete sequence	61256-61289	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_MF589339	Escherichia coli strain 2271 plasmid pCTXM-2271, complete sequence	27964-27997	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_MG197502	Escherichia coli strain ZYTF32 plasmid pHNZY32, complete sequence	61256-61289	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	MT219818	Escherichia coli strain RF148-1 plasmid pRF148-1_119k_tetX, complete sequence	43736-43769	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	MT219820	Escherichia coli strain RF108-2 plasmid pRF108-2_97k_tetX, complete sequence	80789-80822	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	MT219822	Escherichia coli strain RF14-1 plasmid pRF14-1_50k_tetX, complete sequence	38970-39003	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	MT219823	Escherichia coli strain RF10-1 plasmid pRF10-1_119k_tetX, complete sequence	73817-73850	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NC_023323	Escherichia coli ACN001 plasmid pACN001-A, complete sequence	18865-18898	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	MF554637	uncultured bacterium clone AA-100 plasmid pPIMMR, complete sequence	14942-14975	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP016575	Salmonella enterica subsp. enterica serovar Heidelberg strain AMR588-04-00435 plasmid pAMR588-04-00435_37, complete sequence	296-329	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP020060	Escherichia coli strain AR_0061 plasmid unitig_2, complete sequence	30572-30605	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP032994	Escherichia coli strain W5-6 plasmid p2_W5-6, complete sequence	10049-10082	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	MN783746	Escherichia coli plasmid pIncX1_p1, complete sequence	5290-5323	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_KX815983	Salmonella enterica subsp. enterica serovar Dublin strain N13-01125 plasmid pN13-01125, complete sequence	40397-40430	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_KU254580	Escherichia coli strain YD786 plasmid pYD786-3, complete sequence	25507-25540	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP042633	Escherichia coli strain NCYU-25-82 plasmid pNCYU-25-82-6, complete sequence	38916-38949	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP032392	Salmonella enterica subsp. enterica serovar Dublin strain CVM 34981 plasmid p34981_2, complete sequence	67739-67772	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP019272	Escherichia coli strain 13P460A plasmid p13P460A-1, complete sequence	35028-35061	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP053728	Escherichia coli strain CP61_Sichuan plasmid pCP61-IncN, complete sequence	69102-69135	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP037995	Salmonella enterica subsp. enterica serovar Brancaster strain sg_ww281 plasmid psg_ww281	7255-7288	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP053740	Escherichia coli strain CP8-3_Sichuan plasmid pCP8-3-IncX1, complete sequence	9971-10004	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP016580	Salmonella enterica subsp. enterica serovar Heidelberg strain SH13-006 plasmid pSH13-006_37, complete sequence	23703-23736	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP046001	Escherichia coli strain 1916D6 plasmid p1916D6-1, complete sequence	49989-50022	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP021103	Escherichia coli strain 13P477T plasmid p13P477T-7, complete sequence	56470-56503	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP029182	Escherichia coli strain H9Ecoli plasmid p3-H9, complete sequence	2302-2335	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	MN086778	Escherichia coli plasmid p16EC-IncN, complete sequence	90173-90206	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP053047	Escherichia fergusonii strain HNCF11W plasmid pHNCF11W-tetX4, complete sequence	9874-9907	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP014974	Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1898 isolate ST073 plasmid pSTY3-1898, complete sequence	295-328	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP032397	Salmonella enterica subsp. enterica serovar Dublin strain CVM 22429 plasmid p22429, complete sequence	220331-220364	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP035774	Klebsiella pneumoniae strain R46 plasmid pR46-27, complete sequence	12757-12790	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP044182	Salmonella enterica subsp. enterica serovar Heidelberg strain AR-0404 plasmid pAR-0404-1, complete sequence	25543-25576	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP042608	Escherichia coli strain NCYU-29-19 plasmid pNCYU-29-19-2_MCR3, complete sequence	7171-7204	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	MK461930	Escherichia coli strain 2009_36 plasmid p2009_36_HI2, complete sequence	45261-45294	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NC_019046	Escherichia coli plasmid pNMEC31_31, complete sequence	31361-31394	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP047460	Escherichia coli strain ZF31 plasmid pZF31-tetX-119kb, complete sequence	89191-89224	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP047466	Escherichia coli strain ZF34 plasmid pZF34-tetX-114kb, complete sequence	30748-30781	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP035315	Escherichia coli strain D72 plasmid pD72-IncX1, complete sequence	28493-28526	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP050748	Salmonella enterica subsp. enterica serovar Typhimurium strain ST53 plasmid pST53-3, complete sequence	5878-5911	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NC_024961	Escherichia coli plasmid pIS15_43, strain ISI5, complete sequence	905-938	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NC_021842	Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069 plasmid pCFSAN002069_02, complete sequence	4017-4050	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_LT985261	Escherichia coli strain 657 plasmid RCS50_p, complete sequence	42585-42618	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_AP019678	Escherichia coli strain GSH8M-2 plasmid pGSH8M-2-3, complete sequence	49115-49148	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP009074	Escherichia coli ATCC 25922 plasmid unnamed, complete sequence	21137-21170	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP010168	Escherichia coli strain H3 plasmid A, complete genome	25682-25715	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NC_010378	Escherichia coli plasmid pOLA52, complete sequence	34562-34595	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	CP016512	Salmonella enterica subsp. enterica serovar Heidelberg strain SH14-028 plasmid pSH14-028_37, complete sequence	23704-23737	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP016529	Salmonella enterica subsp. enterica serovar Heidelberg strain 09-036813-1A plasmid p09-036813-1A_42, complete sequence	23704-23737	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP016518	Salmonella enterica subsp. enterica serovar Heidelberg strain CE-R2-11-0435 plasmid pCE-R2-11-0435_37, complete sequence	23705-23738	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP032988	Escherichia coli strain BE2-5 plasmid p2_BE2-5, complete sequence	50710-50743	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP017633	Escherichia coli strain SLK172 plasmid pSLK172-2, complete sequence	23885-23918	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP012922	Salmonella enterica subsp. enterica serovar Heidelberg strain SA02DT10168701 plasmid pSA02DT10168701_37, complete sequence	23704-23737	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP033093	Escherichia coli strain CP53 plasmid pCP53-38k, complete sequence	19532-19565	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP012926	Salmonella enterica subsp. enterica serovar Heidelberg strain 12-4374 plasmid p12-4374_37, complete sequence	37369-37402	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP023360	Escherichia coli strain 1943 plasmid p54, complete sequence	52726-52759	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	CP043734	Escherichia coli strain CVM N17EC1164 plasmid pN17EC1164-1, complete sequence	37807-37840	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP039600	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014867 plasmid p12-6334.1, complete sequence	32872-32905	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP030283	Escherichia coli strain E308 plasmid pLKSZ02, complete sequence	49947-49980	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NC_011204	Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 plasmid pCT02021853_74, complete sequence	70648-70681	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NC_017624	Salmonella enterica subsp. enterica serovar Heidelberg str. B182 plasmid pB182_37, complete sequence	23689-23722	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP050710	Salmonella enterica subsp. enterica serovar Enteritidis strain SE109 plasmid pSE109-1, complete sequence	15569-15602	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP024290	Escherichia coli O178:H19 strain 2012C-4431 plasmid unnamed1, complete sequence	33653-33686	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP048777	Salmonella enterica subsp. enterica serovar Agona strain SG17-135 plasmid pSG17-135-X, complete sequence	1446-1479	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP041631	Escherichia coli strain PE15 plasmid pPE15-27K, complete sequence	4799-4832	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP050773	Salmonella enterica subsp. enterica serovar Indiana strain SI102 plasmid pSI102-2, complete sequence	30707-30740	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP041444	Escherichia coli strain YPE10 plasmid pYPE10-78k, complete sequence	38005-38038	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP019180	Salmonella enterica subsp. enterica serovar Dublin str. ATCC 39184 plasmid pATCC39184, complete sequence	24566-24599	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP050765	Salmonella enterica subsp. enterica serovar Indiana strain SI111 plasmid pSI111-1, complete sequence	6593-6626	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NC_010422	Salmonella enterica subsp. enterica serovar Dublin plasmid pOU1115, complete sequence	59434-59467	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP050759	Salmonella enterica subsp. enterica serovar Indiana strain SI173 plasmid pSI173-2, complete sequence	5734-5767	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_AP022652	Escherichia coli strain 09-02E plasmid p2-09-02E, complete sequence	295-328	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP024136	Escherichia coli strain 14EC017 plasmid p14EC017b, complete sequence	79478-79511	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_LT985315	Escherichia coli strain ECOR 70 plasmid RCS99_p, complete sequence	47119-47152	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	MN436006	Escherichia coli strain JS1-EC05 plasmid pEC05-X4, complete sequence	27492-27525	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	MN436007	Escherichia coli strain JS3-EC12 plasmid pEC12-X4, complete sequence	27131-27164	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_MK360096	Salmonella enterica strain 13-SA02717 plasmid pSE13-SA02717, complete sequence	44664-44697	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP045839	Citrobacter sp. H12-3-2 plasmid pH12-2, complete sequence	48284-48317	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP032381	Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69807 plasmid pSDU2-USMARC-69807, complete sequence	12454-12487	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_MG825381	Escherichia coli strain 1108 plasmid p1108-NDM, complete sequence	43402-43435	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	MT197111	Escherichia coli strain RB3-1 plasmid pRB3-1_31K_tetX, complete sequence	12897-12930	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	MT219817	Escherichia coli strain RF148-2 plasmid pRF148-2_101k_tetX, complete sequence	59284-59317	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	MT219819	Escherichia coli strain RF52-1 plasmid pRF52-1_119k_tetX, complete sequence	118931-118964	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	MT219821	Escherichia coli strain RF45-1 plasmid pRF45-1_31k_tetX, complete sequence	3734-3767	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_MG288677	Klebsiella pneumoniae strain F160070 plasmid p160070-CTXM, complete sequence	29004-29037	1	0.971
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	CP031285	Escherichia fergusonii strain 40A plasmid p46_40A, complete sequence	9827-9860	2	0.941
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP022502	Salmonella enterica subsp. enterica serovar Kentucky str. SA20030505 plasmid unnamed2, complete sequence	19165-19198	2	0.941
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP022502	Salmonella enterica subsp. enterica serovar Kentucky str. SA20030505 plasmid unnamed2, complete sequence	66613-66646	2	0.941
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP033353	Salmonella enterica subsp. enterica strain CFSA664 plasmid pCFSA664-1, complete sequence	78450-78483	3	0.912
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP050780	Salmonella enterica subsp. enterica serovar Indiana strain SI85 plasmid pSI85-1, complete sequence	203947-203980	3	0.912
CP030195_1	1.1\|159\|34\|CP030195\|CRISPRCasFinder	159-192	34	NZ_CP044292	Escherichia coli strain P43A plasmid pP43A-1, complete sequence	44259-44292	5	0.853

1. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP030195 (Salmonella enterica strain SA20080453 plasmid pSA20080453.1, complete sequence) position: , mismatch: 0, identity: 1.0

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtgattttcatgaaaggtggatggctgcgcac	Protospacer
**********************************

2. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_KX518744 (Escherichia coli strain HYEC7 plasmid pHYEC7-110, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

3. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP041286 (Escherichia coli strain 54 plasmid p54-tetX, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

4. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_KU321583 (Escherichia coli strain E80 plasmid pE80, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

5. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_KT990220 (Escherichia coli strain 42-2 plasmid p42-2, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

6. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP010164 (Escherichia coli strain H2 plasmid A, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

7. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP019647 (Salmonella enterica subsp. enterica serovar Typhimurium strain TW-Stm6 plasmid pSTM6-275, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

8. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP022964 (Salmonella enterica subsp. enterica serovar Pullorum strain QJ-2D-Sal plasmid pQJDsal1, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

9. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP024467 (Shigella dysenteriae strain BU53M1 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

10. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_LS999563 (Escherichia coli isolate EC-TO143 plasmid 4, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

11. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_LS999563 (Escherichia coli isolate EC-TO143 plasmid 4, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

12. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP019284 (Escherichia coli strain 13P484A plasmid p13P484A-4, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

13. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP047093 (Salmonella sp. S13 plasmid pS13-4, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

14. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP051432 (Escherichia sp. SCLE84 plasmid pSCLE2, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

15. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP046002 (Escherichia coli strain 1916D6 plasmid p1916D6-2, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

16. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP045188 (Escherichia coli strain NT1F31 plasmid pNT1F31-tetX4, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

17. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP031548 (Escherichia coli strain cq9 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

18. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP031548 (Escherichia coli strain cq9 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

19. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP032386 (Salmonella enterica subsp. enterica serovar Dublin strain CVM N53043 plasmid pN53043_2, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

20. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP032389 (Salmonella enterica subsp. enterica serovar Dublin strain CVM N45955 plasmid pN45955_2, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

21. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_LT904873 (Salmonella enterica subsp. enterica serovar Typhi strain ERL11909 plasmid 2) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

22. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_KT754163 (Shigella dysenteriae 1 strain A5468 plasmid pA5468, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

23. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP033383 (Salmonella enterica subsp. enterica strain CFSA300 plasmid pCFSA300-2, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

24. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP020836 (Escherichia coli strain CFSAN051542 plasmid pCFSAN051542, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

25. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP038140 (Escherichia coli strain G3X16-2 plasmid pG3X16-2-3, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

26. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP043216 (Salmonella enterica subsp. enterica serovar Heidelberg strain SL-312 plasmid pET8.2-IncX1, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

27. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP042617 (Escherichia coli strain NCYU-26-73 plasmid pNCYU-26-73-2, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

28. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP031361 (Salmonella enterica subsp. enterica serovar Heidelberg strain 5 plasmid p2, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

29. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP044153 (Shigella flexneri strain AR-0425 plasmid pAR-0425-1, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

30. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP040929 (Escherichia coli strain YY76-1 plasmid pYY76-1-2, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

31. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP033386 (Salmonella enterica subsp. enterica strain CFSA1007 plasmid pCFSA1007-2, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

32. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP041177 (Salmonella enterica subsp. enterica serovar Enteritidis strain SJTUF12367v2 plasmid p12367A, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

33. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP034761 (Klebsiella pneumoniae strain NB5306 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

34. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP050707 (Salmonella enterica subsp. enterica serovar Enteritidis strain SE124 plasmid pSE124-1, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

35. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP047339 (Klebsiella pneumoniae strain 2019036D plasmid p2019036D-35kb, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

36. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NC_010860 (Salmonella enterica subsp. enterica serovar Enteritidis plasmid pSE34, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

37. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP022453 (Salmonella enterica subsp. enterica serovar Indiana strain D90 plasmid pD90-3, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

38. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP024153 (Escherichia coli strain 14EC033 plasmid p14EC033f, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

39. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP030208 (Salmonella enterica strain SA19992307 plasmid pSA19992307.1, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

40. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP005994 (Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002064 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

41. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP032450 (Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69838 plasmid pSDU1-USMARC-69838, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

42. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP010155 (Escherichia coli strain D9 plasmid C, complete genome) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

43. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP050174 (Escherichia coli strain STB20-1 plasmid pSTB20-1T, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

44. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP029061 (Escherichia coli strain FORC_081 plasmid pFORC_081_4, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

45. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP042589 (Escherichia coli strain PK6 plasmid pRHEcCUB-1, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

46. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP025677 (Escherichia albertii strain ChinaSP140150 plasmid pEA-1, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

47. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP041453 (Escherichia coli strain YPE3 plasmid pYPE3-92k-tetX4, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

48. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to MN816373 (Escherichia coli strain A127 plasmid pA127-X1, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

49. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP052879 (Escherichia coli strain C21 plasmid pC21-2, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

50. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP033379 (Escherichia coli strain L73 plasmid pL73-2, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

51. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP033632 (Escherichia coli isolate ECCNB12-2 plasmid pTB-nb1, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

52. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP050724 (Salmonella enterica subsp. enterica serovar Enteritidis strain SE74 plasmid pSE74-1, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

53. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP047573 (Escherichia coli strain 2EC1 plasmid p2EC1-2, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

54. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NC_019106 (Salmonella enterica subsp. enterica serovar Dublin plasmid pSD_77, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

55. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP010127 (Escherichia coli strain C8 plasmid B, complete genome) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

56. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP027138 (Escherichia coli strain AR_0369 plasmid unnamed2) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

57. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP022072 (Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_321 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

58. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP043935 (Klebsiella pneumoniae strain 555 plasmid pSCKLB555-3, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

59. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP043935 (Klebsiella pneumoniae strain 555 plasmid pSCKLB555-3, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

60. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP045998 (Escherichia coli strain 1916D18 plasmid p1916D18-1, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

61. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP032394 (Salmonella enterica subsp. enterica serovar Dublin strain CVM 22453 plasmid p22453_2, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

62. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NC_019256 (Shigella sp. LN126 plasmid pLN126_33, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

63. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to MH884649 (Salmonella sp. strain Sa21 plasmid pSa21-IncX1-28K, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

64. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to MH884651 (Salmonella sp. strain Sa21 plasmid pSa21-TC-CIP, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

65. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to MH229869 (Escherichia coli plasmid pKANJ7, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

66. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP050713 (Salmonella enterica subsp. enterica serovar Enteritidis strain SE104 plasmid pSE104-1, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

67. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP041439 (Escherichia coli strain YPE12 plasmid pYPE12-106k, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

68. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP041443 (Escherichia coli strain YPE12 plasmid pYPE12-101k-tetX4, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

69. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_MK461931 (Escherichia coli strain F2_14D plasmid pF2_14D_HI2, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

70. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_MK656937 (Escherichia coli strain T3 plasmid pT3, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

71. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_MK731977 (Escherichia coli strain ENV103 plasmid pSGMCR103, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

72. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_MK673546 (Salmonella enterica subsp. enterica serovar Typhimurium strain GDD27-24 plasmid pGDD27-24, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

73. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP032447 (Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69840 plasmid pSDU1-USMARC-69840, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

74. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_MH179305 (Salmonella enterica subsp. enterica serovar Indiana strain JT01 plasmid pJT01, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

75. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_MH179305 (Salmonella enterica subsp. enterica serovar Indiana strain JT01 plasmid pJT01, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

76. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_MH287085 (Escherichia coli strain F2_12B plasmid pSDC-F2_12BHI2, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

77. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_MH287084 (Escherichia coli O157 strain SvETEC plasmid pSDE-SvHI2, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

78. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP025558 (Salmonella enterica subsp. enterica serovar Enteritidis strain PIR00532 plasmid p2PIR00532, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

79. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to MT219825 (Escherichia coli strain RW7-1 plasmid pRW7-1_235k_tetX, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

80. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to MT219826 (Escherichia coli strain RW8-1 plasmid pRW8-1_122k_tetX, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

81. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_MG904998 (Escherichia coli strain 15OD0495 plasmid p15ODTXV, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

82. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_MG197491 (Escherichia coli strain FKU92 plasmid pHNFKU92, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

83. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_MG197498 (Escherichia coli strain HZMCC14 plasmid pHNMCC14, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

84. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_MG197503 (Escherichia coli strain ZYTM118 plasmid pHNZY118, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

85. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_MG197495 (Escherichia coli strain AHC24 plasmid pHNAH24, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

86. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_MF589339 (Escherichia coli strain 2271 plasmid pCTXM-2271, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

87. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_MG197502 (Escherichia coli strain ZYTF32 plasmid pHNZY32, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

88. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to MT219818 (Escherichia coli strain RF148-1 plasmid pRF148-1_119k_tetX, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

89. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to MT219820 (Escherichia coli strain RF108-2 plasmid pRF108-2_97k_tetX, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

90. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to MT219822 (Escherichia coli strain RF14-1 plasmid pRF14-1_50k_tetX, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

91. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to MT219823 (Escherichia coli strain RF10-1 plasmid pRF10-1_119k_tetX, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

92. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NC_023323 (Escherichia coli ACN001 plasmid pACN001-A, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

93. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to MF554637 (uncultured bacterium clone AA-100 plasmid pPIMMR, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

94. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP016575 (Salmonella enterica subsp. enterica serovar Heidelberg strain AMR588-04-00435 plasmid pAMR588-04-00435_37, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

95. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP020060 (Escherichia coli strain AR_0061 plasmid unitig_2, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

96. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP032994 (Escherichia coli strain W5-6 plasmid p2_W5-6, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

97. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to MN783746 (Escherichia coli plasmid pIncX1_p1, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

98. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_KX815983 (Salmonella enterica subsp. enterica serovar Dublin strain N13-01125 plasmid pN13-01125, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

99. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_KU254580 (Escherichia coli strain YD786 plasmid pYD786-3, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

100. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP042633 (Escherichia coli strain NCYU-25-82 plasmid pNCYU-25-82-6, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

101. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP032392 (Salmonella enterica subsp. enterica serovar Dublin strain CVM 34981 plasmid p34981_2, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

102. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP019272 (Escherichia coli strain 13P460A plasmid p13P460A-1, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

103. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP053728 (Escherichia coli strain CP61_Sichuan plasmid pCP61-IncN, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

104. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP037995 (Salmonella enterica subsp. enterica serovar Brancaster strain sg_ww281 plasmid psg_ww281) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

105. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP053740 (Escherichia coli strain CP8-3_Sichuan plasmid pCP8-3-IncX1, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

106. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP016580 (Salmonella enterica subsp. enterica serovar Heidelberg strain SH13-006 plasmid pSH13-006_37, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

107. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP046001 (Escherichia coli strain 1916D6 plasmid p1916D6-1, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

108. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP021103 (Escherichia coli strain 13P477T plasmid p13P477T-7, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

109. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP029182 (Escherichia coli strain H9Ecoli plasmid p3-H9, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

110. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to MN086778 (Escherichia coli plasmid p16EC-IncN, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

111. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP053047 (Escherichia fergusonii strain HNCF11W plasmid pHNCF11W-tetX4, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

112. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP014974 (Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1898 isolate ST073 plasmid pSTY3-1898, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

113. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP032397 (Salmonella enterica subsp. enterica serovar Dublin strain CVM 22429 plasmid p22429, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

114. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP035774 (Klebsiella pneumoniae strain R46 plasmid pR46-27, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

115. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP044182 (Salmonella enterica subsp. enterica serovar Heidelberg strain AR-0404 plasmid pAR-0404-1, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

116. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP042608 (Escherichia coli strain NCYU-29-19 plasmid pNCYU-29-19-2_MCR3, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

117. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to MK461930 (Escherichia coli strain 2009_36 plasmid p2009_36_HI2, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

118. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NC_019046 (Escherichia coli plasmid pNMEC31_31, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

119. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP047460 (Escherichia coli strain ZF31 plasmid pZF31-tetX-119kb, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

120. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP047466 (Escherichia coli strain ZF34 plasmid pZF34-tetX-114kb, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

121. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP035315 (Escherichia coli strain D72 plasmid pD72-IncX1, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

122. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP050748 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST53 plasmid pST53-3, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

123. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NC_024961 (Escherichia coli plasmid pIS15_43, strain ISI5, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

124. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NC_021842 (Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069 plasmid pCFSAN002069_02, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

125. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_LT985261 (Escherichia coli strain 657 plasmid RCS50_p, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

126. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_AP019678 (Escherichia coli strain GSH8M-2 plasmid pGSH8M-2-3, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

127. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP009074 (Escherichia coli ATCC 25922 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

128. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP010168 (Escherichia coli strain H3 plasmid A, complete genome) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

129. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NC_010378 (Escherichia coli plasmid pOLA52, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

130. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to CP016512 (Salmonella enterica subsp. enterica serovar Heidelberg strain SH14-028 plasmid pSH14-028_37, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

131. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP016529 (Salmonella enterica subsp. enterica serovar Heidelberg strain 09-036813-1A plasmid p09-036813-1A_42, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

132. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP016518 (Salmonella enterica subsp. enterica serovar Heidelberg strain CE-R2-11-0435 plasmid pCE-R2-11-0435_37, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

133. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP032988 (Escherichia coli strain BE2-5 plasmid p2_BE2-5, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

134. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP017633 (Escherichia coli strain SLK172 plasmid pSLK172-2, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

135. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP012922 (Salmonella enterica subsp. enterica serovar Heidelberg strain SA02DT10168701 plasmid pSA02DT10168701_37, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

136. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP033093 (Escherichia coli strain CP53 plasmid pCP53-38k, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

137. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP012926 (Salmonella enterica subsp. enterica serovar Heidelberg strain 12-4374 plasmid p12-4374_37, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

138. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP023360 (Escherichia coli strain 1943 plasmid p54, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

139. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to CP043734 (Escherichia coli strain CVM N17EC1164 plasmid pN17EC1164-1, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

140. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP039600 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014867 plasmid p12-6334.1, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

141. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP030283 (Escherichia coli strain E308 plasmid pLKSZ02, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

142. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NC_011204 (Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 plasmid pCT02021853_74, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

143. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NC_017624 (Salmonella enterica subsp. enterica serovar Heidelberg str. B182 plasmid pB182_37, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

144. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP050710 (Salmonella enterica subsp. enterica serovar Enteritidis strain SE109 plasmid pSE109-1, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

145. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP024290 (Escherichia coli O178:H19 strain 2012C-4431 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

146. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP048777 (Salmonella enterica subsp. enterica serovar Agona strain SG17-135 plasmid pSG17-135-X, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

147. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP041631 (Escherichia coli strain PE15 plasmid pPE15-27K, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

148. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP050773 (Salmonella enterica subsp. enterica serovar Indiana strain SI102 plasmid pSI102-2, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

149. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP041444 (Escherichia coli strain YPE10 plasmid pYPE10-78k, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

150. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP019180 (Salmonella enterica subsp. enterica serovar Dublin str. ATCC 39184 plasmid pATCC39184, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

151. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP050765 (Salmonella enterica subsp. enterica serovar Indiana strain SI111 plasmid pSI111-1, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

152. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NC_010422 (Salmonella enterica subsp. enterica serovar Dublin plasmid pOU1115, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

153. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP050759 (Salmonella enterica subsp. enterica serovar Indiana strain SI173 plasmid pSI173-2, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

154. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_AP022652 (Escherichia coli strain 09-02E plasmid p2-09-02E, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

155. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP024136 (Escherichia coli strain 14EC017 plasmid p14EC017b, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

156. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_LT985315 (Escherichia coli strain ECOR 70 plasmid RCS99_p, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

157. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to MN436006 (Escherichia coli strain JS1-EC05 plasmid pEC05-X4, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

158. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to MN436007 (Escherichia coli strain JS3-EC12 plasmid pEC12-X4, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

159. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_MK360096 (Salmonella enterica strain 13-SA02717 plasmid pSE13-SA02717, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

160. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP045839 (Citrobacter sp. H12-3-2 plasmid pH12-2, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

161. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP032381 (Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69807 plasmid pSDU2-USMARC-69807, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

162. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_MG825381 (Escherichia coli strain 1108 plasmid p1108-NDM, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

163. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to MT197111 (Escherichia coli strain RB3-1 plasmid pRB3-1_31K_tetX, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

164. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to MT219817 (Escherichia coli strain RF148-2 plasmid pRF148-2_101k_tetX, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

165. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to MT219819 (Escherichia coli strain RF52-1 plasmid pRF52-1_119k_tetX, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

166. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to MT219821 (Escherichia coli strain RF45-1 plasmid pRF45-1_31k_tetX, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

167. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_MG288677 (Klebsiella pneumoniae strain F160070 plasmid p160070-CTXM, complete sequence) position: , mismatch: 1, identity: 0.971

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgcac	Protospacer
****.*****************************

168. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to CP031285 (Escherichia fergusonii strain 40A plasmid p46_40A, complete sequence) position: , mismatch: 2, identity: 0.941

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtgattttcatcaaaggtggatggctgtgcac	Protospacer
************* ***************.****

169. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP022502 (Salmonella enterica subsp. enterica serovar Kentucky str. SA20030505 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.941

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtgattttcatcaaaggtggatggctgtgcac	Protospacer
************* ***************.****

170. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP022502 (Salmonella enterica subsp. enterica serovar Kentucky str. SA20030505 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.941

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtgattttcatcaaaggtggatggctgtgcac	Protospacer
************* ***************.****

171. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP033353 (Salmonella enterica subsp. enterica strain CFSA664 plasmid pCFSA664-1, complete sequence) position: , mismatch: 3, identity: 0.912

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgggc	Protospacer
****.************************** .*

172. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP050780 (Salmonella enterica subsp. enterica serovar Indiana strain SI85 plasmid pSI85-1, complete sequence) position: , mismatch: 3, identity: 0.912

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgcgggc	Protospacer
****.************************** .*

173. spacer 1.1|159|34|CP030195|CRISPRCasFinder matches to NZ_CP044292 (Escherichia coli strain P43A plasmid pP43A-1, complete sequence) position: , mismatch: 5, identity: 0.853

ctgtgattttcatgaaaggtggatggctgcgcac	CRISPR spacer
ctgtaattttcatgaaaggtggatggctgttcga	Protospacer
****.************************. *.

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP030194

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP030195

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection