CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
CP030342	Klebsiella pneumoniae strain AR_362 plasmid unnamed2, complete sequence	0 crisprs	NA	0	2
CP030344	Klebsiella pneumoniae strain AR_362 plasmid unnamed3	0 crisprs	NA	0	0
CP030341	Klebsiella pneumoniae strain AR_362 chromosome, complete genome	1 crisprs	csa3,cas3,DEDDh,RT,DinG,WYL	1	12
CP030343	Klebsiella pneumoniae strain AR_362 plasmid unnamed1, complete sequence	0 crisprs	csa3,c2c9_V-U4,RT,cas3	0	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

27785 : 39877

Escherichia_phage(25.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWZ77988.1\|27785_28415_-	DNA methylase family protein	A0A2I7RE86	Vibrio_phage	1.5e-20	36.0
AWZ77959.1\|28923_29154_-	putative membrane protein	NA	NA	NA	NA
AWZ78043.1\|29214_29886_-	plasmid stability family protein	NA	NA	NA	NA
AWZ77967.1\|29888_30863_-	plasmid segregation protein ParM	A0A222YXF2	Escherichia_phage	1.4e-73	46.8
AWZ78023.1\|31091_31523_+	protein UmuD	A0A1W6JNS2	Morganella_phage	1.0e-28	52.5
AWZ77998.1\|31522_32794_+	impB/mucB/samB family protein	F1C5A5	Cronobacter_phage	3.6e-154	63.7
AWZ77944.1\|33194_34091_+	replication protein RepA	Q71TL8	Escherichia_phage	3.3e-69	53.8
AWZ78040.1\|34475_35618_+	plasmid partition protein A	Q1MVJ3	Enterobacteria_phage	7.6e-196	90.0
AWZ77964.1\|35614_36589_+	parB	Q1MVJ4	Enterobacteria_phage	1.4e-105	62.3
AWZ77965.1\|37849_39877_+	N-6 DNA Methylase family protein	A0A220A2U5	Liberibacter_phage	2.1e-26	26.6

DBSCAN-SWA_2

44452 : 73354

Escherichia_phage(35.29%)

integrase,transposase

attL 53132:53146|attR 75236:75250

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWZ78000.1\|44452_45721_+\|transposase	transposase family protein	Q6V7R1	Burkholderia_virus	5.2e-60	34.7
AWZ77987.1\|47026_47143_-	hypothetical protein	NA	NA	NA	NA
AWZ78013.1\|47527_48310_-\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	4.6e-51	90.2
AWZ77997.1\|48309_48642_-	hypothetical protein	NA	NA	NA	NA
AWZ78039.1\|48648_49047_-	hypothetical protein	NA	NA	NA	NA
AWZ78025.1\|49072_49318_-	hypothetical protein	NA	NA	NA	NA
AWZ78012.1\|49429_49702_-	hypothetical protein	NA	NA	NA	NA
AWZ77957.1\|49783_49903_-	hypothetical protein	NA	NA	NA	NA
AWZ78003.1\|50224_50659_-	hypothetical protein	NA	NA	NA	NA
AWZ78027.1\|50642_50873_+	antidote-toxin recognition MazE family protein	NA	NA	NA	NA
AWZ77958.1\|50869_51286_+	PIN domain protein	NA	NA	NA	NA
AWZ78015.1\|51359_52070_+	AAA domain protein	NA	NA	NA	NA
AWZ78008.1\|52154_52379_+	insA C-terminal domain protein	A0A2L1IV22	Escherichia_phage	1.7e-35	94.6
AWZ77948.1\|52423_52801_+\|transposase	putative transposase	Q71TF0	Escherichia_phage	1.9e-63	93.6
AWZ78045.1\|52962_53385_+	merC mercury resistance family protein	NA	NA	NA	NA
53132:53146	attL	NA	NA	NA	NA
AWZ78010.1\|53436_55131_+	mercuric reductase	A0A2K5B2C5	Erysipelothrix_phage	8.8e-39	27.6
AWZ77996.1\|55148_55511_+	mercuric resistance transcriptional repressor protein MerD	NA	NA	NA	NA
AWZ77978.1\|55507_55744_+	merE family protein	NA	NA	NA	NA
AWZ77949.1\|55779_56448_+	EAL domain protein	NA	NA	NA	NA
AWZ78050.1\|56738_57791_+\|integrase	integrase core domain protein	NA	NA	NA	NA
AWZ78006.1\|57837_58248_+\|integrase	integrase core domain protein	A0A077SL39	Escherichia_phage	1.9e-72	100.0
AWZ78005.1\|58358_59219_-	beta-lactamase TEM	Q1MVP3	Enterobacteria_phage	4.6e-161	100.0
AWZ77963.1\|59401_59524_-	helix-turn-helix domain of resolvase family protein	Q1MVP4	Enterobacteria_phage	1.0e-13	97.5
AWZ77962.1\|60962_61667_-\|transposase	transposase IS66 family protein	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AWZ77966.1\|61739_64637_+\|transposase	tn3 transposase DDE domain protein	A0A1B0V7H9	Salmonella_phage	2.7e-181	37.7
AWZ77955.1\|64725_65346_+	resolvase, N terminal domain protein	A0A219Y912	Aeromonas_phage	2.0e-09	31.5
AWZ78041.1\|65735_65855_+	putative membrane protein	NA	NA	NA	NA
AWZ78001.1\|66144_66279_-	hypothetical protein	NA	NA	NA	NA
AWZ77956.1\|66511_66871_-	hypothetical protein	A0A218MND9	uncultured_virus	3.6e-19	62.0
AWZ77975.1\|67042_67264_-\|transposase	putative transposase	A0A1V0E8E1	Vibrio_phage	2.4e-13	64.3
AWZ78061.1\|67374_68559_+\|transposase	transposase DDE domain protein	NA	NA	NA	NA
AWZ78028.1\|68835_70155_+\|transposase	transposase DDE domain protein	Q9MBP7	Staphylococcus_prophage	1.9e-12	24.2
AWZ77980.1\|70404_71286_-	carbapenem-hydrolyzing beta-lactamase Sme-1	A0A1B0VBP7	Salmonella_phage	2.2e-73	52.2
AWZ77953.1\|71573_72353_-	istB-like ATP binding family protein	A0A2L1IVB6	Escherichia_phage	2.5e-89	61.8
AWZ78024.1\|72349_73354_-\|integrase	integrase core domain protein	A0A2L1IVA1	Escherichia_phage	8.7e-87	50.8
75236:75250	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP030341

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP030341_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP030341_2

4823303-4823397

Orphan

Consensus_repeat	Method
ACTATGGTTTTTATGGTTTTTATT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP030341_2

>merge|CP030341|2|4823303-4823397|CRISPRCasFinder
TTAATGGTCACTATGGTTTTTATGGTTTTTATTCGCTGAACTGCCCGGGAGTGATATATCTCTGATTTATGACTGTGGTTTTTATGGTTTTTATT

>CP030341|2|2|4823303-4823397|CRISPRCasFinder
TTAATGGTCACTATGGTTTTTATG	GTTTTTATTCGCTGAACTGCCCGGGAGTGATATATCTCTGATTTATG
ACTGTGGTTTTTATGGTTTTTATT

Protein	Signature genes	Signature genes Name	Protein_function
CP030341.1\|AWZ74553.1\|4817477_4820384_+\|RNA-polymerase-associated-protein-RapA	unknown	unknown	gnl\|CDD\|235319
CP030341.1\|AWZ76871.1\|4814061_4814757_+\|L-ribulose-5-phosphate-4-epimerase	unknown	unknown	gnl\|CDD\|236181
CP030341.1\|AWZ76602.1\|4826988_4829304_+\|LPS-assembly-protein-LptD	unknown	unknown	gnl\|CDD\|235158
CP030341.1\|AWZ76957.1\|4832842_4833691_+\|bis(5'-nucleosyl)-tetraphosphatase	unknown	unknown	gnl\|CDD\|273208
CP030341.1\|AWZ77125.1\|4833946_4834426_-\|dihydrofolate-reductase	unknown	unknown	gnl\|CDD\|182714
CP030341.1\|AWZ77745.1\|4810701_4812411_+\|L-ribulokinase	unknown	unknown	gnl\|CDD\|235221
CP030341.1\|AWZ76164.1\|4832460_4832838_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|180098
CP030341.1\|AWZ72827.1\|4831636_4832458_+\|dimethyladenosine-transferase	unknown	unknown	gnl\|CDD\|234708
CP030341.1\|AWZ72824.1\|4820396_4821056_+\|pseudouridine-synthase,-RluA-family-protein	unknown	unknown	gnl\|CDD\|236659
CP030341.1\|AWZ77568.1\|4810349_4810520_+\|hypothetical-protein	unknown	unknown	unknown
CP030341.1\|AWZ75420.1\|4809518_4810364_-\|arabinose-operon-regulatory-protein	unknown	unknown	gnl\|CDD\|236717
CP030341.1\|AWZ76831.1\|4829358_4830645_+\|chaperone-SurA	unknown	unknown	gnl\|CDD\|236758
CP030341.1\|AWZ75300.1\|4830650_4831640_+\|4-hydroxythreonine-4-phosphate-dehydrogenase-PdxA	unknown	unknown	gnl\|CDD\|234696
CP030341.1\|AWZ75859.1\|4814932_4817290_+\|DNA-polymerase-B-family-protein	unknown	unknown	gnl\|CDD\|235595
CP030341.1\|AWZ74597.1\|4823538_4825164_+\|sensor-histidine-kinase-CitA	unknown	unknown	gnl\|CDD\|225827
CP030341.1\|AWZ74301.1\|4821130_4821664_-\|holo-ACP-synthase-CitX	unknown	unknown	gnl\|CDD\|163145
CP030341.1\|AWZ76132.1\|4821849_4823214_-\|citrate/malate-transporter	unknown	unknown	gnl\|CDD\|377030
CP030341.1\|AWZ74199.1\|4825153_4825852_+\|response-regulator	unknown	unknown	gnl\|CDD\|226931
CP030341.1\|AWZ77534.1\|4812421_4813924_+\|L-arabinose-isomerase	unknown	unknown	gnl\|CDD\|179503
CP030341.1\|AWZ76427.1\|4825884_4826712_-\|dnaJ-like-protein-DjlA	unknown	unknown	gnl\|CDD\|236512

Protein	Function_ID	Function_description	E-value
CP030341.1\|AWZ74553.1\|4817477_4820384_+\|RNA-polymerase-associated-protein-RapA	gnl\|CDD\|235319	PRK04914, PRK04914, RNA polymerase-associated protein RapA.	0
CP030341.1\|AWZ76871.1\|4814061_4814757_+\|L-ribulose-5-phosphate-4-epimerase	gnl\|CDD\|236181	PRK08193, araD, L-ribulose-5-phosphate 4-epimerase AraD.	0
CP030341.1\|AWZ76602.1\|4826988_4829304_+\|LPS-assembly-protein-LptD	gnl\|CDD\|235158	PRK03761, PRK03761, LPS assembly outer membrane complex protein LptD; Provisional.	0
CP030341.1\|AWZ76957.1\|4832842_4833691_+\|bis(5'-nucleosyl)-tetraphosphatase	gnl\|CDD\|273208	TIGR00668, Bis5'-nucleosyl-tetraphosphatase_symmetrical, bis(5'-nucleosyl)-tetraphosphatase (symmetrical). Diadenosine 5',5"'-P1,P4-tetraphosphate (Ap4A) is a regulatory metabolite of stress conditions. It is hydrolyzed to two ADP by this enzyme. Alternate names include diadenosine-tetraphosphatase and Ap4A hydrolase. [Cellular processes, Adaptations to atypical conditions].	0
CP030341.1\|AWZ77125.1\|4833946_4834426_-\|dihydrofolate-reductase	gnl\|CDD\|182714	PRK10769, folA, type 3 dihydrofolate reductase.	1.71656e-127
CP030341.1\|AWZ77745.1\|4810701_4812411_+\|L-ribulokinase	gnl\|CDD\|235221	PRK04123, PRK04123, ribulokinase; Provisional.	0
CP030341.1\|AWZ76164.1\|4832460_4832838_+\|hypothetical-protein	gnl\|CDD\|180098	PRK05461, apaG, CO2+/MG2+ efflux protein ApaG; Reviewed.	7.84855e-74
CP030341.1\|AWZ72827.1\|4831636_4832458_+\|dimethyladenosine-transferase	gnl\|CDD\|234708	PRK00274, ksgA, 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase RsmA.	3.65731e-147
CP030341.1\|AWZ72824.1\|4820396_4821056_+\|pseudouridine-synthase,-RluA-family-protein	gnl\|CDD\|236659	PRK10158, PRK10158, bifunctional tRNA pseudouridine(32) synthase/23S rRNA pseudouridine(746) synthase RluA.	2.4454e-161
CP030341.1\|AWZ75300.1\|4830650_4831640_+\|4-hydroxythreonine-4-phosphate-dehydrogenase-PdxA	gnl\|CDD\|234696	PRK00232, pdxA, 4-hydroxythreonine-4-phosphate dehydrogenase; Reviewed.	0
CP030341.1\|AWZ75420.1\|4809518_4810364_-\|arabinose-operon-regulatory-protein	gnl\|CDD\|236717	PRK10572, PRK10572, arabinose operon transcriptional regulator AraC.	0
CP030341.1\|AWZ76831.1\|4829358_4830645_+\|chaperone-SurA	gnl\|CDD\|236758	PRK10770, PRK10770, peptidyl-prolyl cis-trans isomerase SurA; Provisional.	0
CP030341.1\|AWZ75859.1\|4814932_4817290_+\|DNA-polymerase-B-family-protein	gnl\|CDD\|235595	PRK05762, PRK05762, DNA polymerase II; Reviewed.	0
CP030341.1\|AWZ74597.1\|4823538_4825164_+\|sensor-histidine-kinase-CitA	gnl\|CDD\|225827	COG3290, CitA, Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms].	6.55037e-173
CP030341.1\|AWZ74301.1\|4821130_4821664_-\|holo-ACP-synthase-CitX	gnl\|CDD\|163145	TIGR03124, citrate_citX, holo-ACP synthase CitX. Members of this protein family are the CitX protein, or CitX domain of the CitXG bifunctional protein, of the citrate lyase system. CitX transfers the prosthetic group 2'-(5''-triphosphoribosyl)-3'-dephospho-CoA to the citrate lyase gamma chain, an acyl carrier protein. This enzyme may be designated holo-ACP synthase, holo-citrate lyase synthase, or apo-citrate lyase phosphoribosyl-dephospho-CoA transferase. In a few genera, including Haemophilus, this protein occurs as a fusion protein with CitG (2.7.8.25), an enzyme involved in prosthetic group biosynthesis. This CitX family is easily separated from the holo-ACP synthases of other enzyme systems. [Energy metabolism, Fermentation, Protein fate, Protein modification and repair].	8.0322e-86
CP030341.1\|AWZ76132.1\|4821849_4823214_-\|citrate/malate-transporter	gnl\|CDD\|377030	pfam03390, 2HCT, 2-hydroxycarboxylate transporter family. The 2-hydroxycarboxylate transporter family is a family of secondary transporters found exclusively in the bacterial kingdom. They function in the metabolism of the di- and tricarboxylates malate and citrate, mostly in fermentative pathways involving decarboxylation of malate or oxaloacetate.	4.87969e-169
CP030341.1\|AWZ74199.1\|4825153_4825852_+\|response-regulator	gnl\|CDD\|226931	COG4565, CitB, Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms].	5.03078e-66
CP030341.1\|AWZ77534.1\|4812421_4813924_+\|L-arabinose-isomerase	gnl\|CDD\|179503	PRK02929, PRK02929, L-arabinose isomerase; Provisional.	0
CP030341.1\|AWZ76427.1\|4825884_4826712_-\|dnaJ-like-protein-DjlA	gnl\|CDD\|236512	PRK09430, djlA, co-chaperone DjlA.	2.63694e-164

>CP030341.1|AWZ76132.1|4821849_4823214_-|citrate/malate-transporter
MSTTDNAFSATLEPIDTPKTTLKQRWWHIMDNWKVGIVPLPLFLLAGGLIALDCLGGKLPSDIVVMVATLAFFGFACGEFGKRLPVLGKLGAAAICATFIPSALVHYGLLPDVVIESTTKFYKSTNILYLYICCIIVGSIMSMNRTTLIQGFLKIFFPMLCGEVVGMLVGIGVGTLLGMEPFQVFFFIVLPIMAGGVGEGAIPLSMGYAALMHMEQGVALGRVLPMVMLGSLTAIVISGCLNQLGKRFPHLTGEGQLMPNRSHETRSLSESEGVSGKTDVGTLASGALLAVLLYMMGMLGHKLIGLPAPVGMLFLAVLLKLANVVSPRLQEGSQMVYKFFRTAVTYPILFAVGVAITPWQELVNAFTLTNLLVIVSTVSALVATGFLVGKKIGMHPIDVAIVSCCQSGQGGTGDVAILTAGNRMSLMPFAQIATRIGGAINVSLGLLFLSHYLA
>CP030341.1|AWZ74301.1|4821130_4821664_-|holo-ACP-synthase-CitX
MDTPAQAGVSIDALLAAKEQRAARQADWLAHYQQPVISLTLVTPGAVKDSIRYRNMMGVALQACDQLLWKHRWQTLDRQVLWLPTGPEALWCVAHPASEIKAMCSTLEQSHPLGRLWDIDVICPQNGLVGRQSLGESQRRCLLCDEPAHACARSRRHDTDLVVARVEQMIDAWFARD
>CP030341.1|AWZ72824.1|4820396_4821056_+|pseudouridine-synthase,-RluA-family-protein
MAMENYNPPQDPWLVILYQDEHIMVVNKPSGLLSVPGRLEEHKDSVMTRIQRDFPQAESVHRLDMATSGVIVVALNKAAERELKRQFREREPKKQYVARVWGHPQPAEGLVDLPLICDWPNRPKQKVCYETGKAAQTEYEVLEYAEDNTARVRLKPITGRSHQLRVHMLALGHPILGDRFYATPEALAMAPRLLLHAETLTITHPAYGNAMTFRAPIDF
>CP030341.1|AWZ74553.1|4817477_4820384_+|RNA-polymerase-associated-protein-RapA
MPFTLGQRWISDTESELGLGTVVALDARMVTLLFPAIGENRLYSRNDSPITRVMFNPGDTITSHEGWQLHVDKVNEENGLLSYTGTRLDTQEANVTLREVLLDSKLVFSKPQDRLFAGQIDRMDRFALRYRARKFQSEQYRMPWSGLRGQRTSLIPHQLHIAHDVGRRHAPRVLLADEVGLGKTIEAGMILHQQLLSGAAERVLIVVPETLQHQWLVEMLRRFNLRFSLFDDERYAEAQHDAYNPFETEQLVICSLDFVRRSKQRLEHLCDAEWDLMVVDEAHHLVWSEEAPSREYQAIEQLAERVPGILLLTATPEQLGMESHFARLRLLDPNRFHDFEQFVEEQQNYRPVADAVALLLAGNKLSDSELNTLGDLIGEQDIEPLLQAANSDREDAQAARQELISMLMDRHGTSRVLFRNTRNGVKGFPKRELHTIRLPLPTQYQTAIKVSGIMGARKTAEERARDMLYPEQIYQEFEGDTGTWWNFDPRVEWLMGYLTSHRSQKVLVICAKAATALQLEQVLREREGIRAAVFHEGMSIIERDRAAAWFAEEDTGAQVLLCSEIGSEGRNFQFASNLVMFDLPFNPDLLEQRIGRLDRIGQAHDIQIHVPYLEKTAQSVLVRWYHEGLDAFEHTCPTGRTVYDSVHDELINYLAAPESIDGFDDLIKSCRQQHDALKAQLEQGRDRLLEIHSNGGEKAQALAESIEEQDDDTSLIAFSMNLFDIVGINQDDRGENLIVLTPSDHMLVPDFPGLPEDGCTITFERDVALSREDAQFITWEHPLIRNGLDLILSGDTGSSTISLLKNKALPVGTLLLELIYVVEAQAPKQLQLNRFLPATPVRMLLDKNGNNLAAQVEFESFNRQLSAVNRHTGSKLVNAVQQDVHAILQQGEAQIAKAAQGLIDAARNEADEKLTAELSRLEALKAVNPNIRDDELAGIESNRQQVMDALAQAGWRLDALRLIVVTHQ
>CP030341.1|AWZ75859.1|4814932_4817290_+|DNA-polymerase-B-family-protein
MTQPRAGFLLTRHWRDTPQGTELSFWLATDDGPLQVTLPPQESVAFIPEAQRAQAERLLQGEKGLRFAPLALKDFHRQPIVGLYCRAHRQLMRLEKMLRDSGVTVYEGDIRPPERYLMERFITAPVWVEGETRGSQLVNARMKPNPDYRPPLKWVSLDIETSRHGELYCIGLEGCGQRVVYMLGPEPETPPDVDFELVFIASRPLLLEKLNAWFAEHDPDVLIGWNVVQFDLRVLQKHAERYRIPLRLGRGNSELEWREHGFKNGVFFAQANGRLIIDGIDALKSAFWNFSSFSLEAVARELLGEGKAIDNPWDRMDEIDRRFHEDKPALAIYNLQDCELVTRIFHKTEIMPFLLERATVNGLPADRHGGSVAAFSHLYFPRMHRLGYVAPNLGDVPPQASPGGYVMDSRPGLYDSVLVLDYKSLYPSIIRTFLIDPVGLIEGLAQPDDQHSIEGFLGARFSRDKHCLPGIVSQIWHGRDEAKRQHNKPLSQALKIIMNAFYGVLGTSACRFFDPRLASSITMRGHAIMRQTKALIEAKGYDVIYGDTDSTFVWLKRPHSEAQAAEIGRELVSHVNAWWAQELSKSQLTSALELEYETHFCRFLMPTIRGADTGSKKRYAGMIQEGDAQRMVFKGLETVRTDWTPLAQQFQQELYLRIFRNQPYQDYVRETIARLMNGELDEQLVYRKRLRRPLAEYQRNVPPHVRAARLADEHNLKLGRAQQYQQRGTIKYVWTTSGPEPVDYQQSPLDYDHYLTKQLQPVAEGILPFVNDDFATIVTGQLGLF
>CP030341.1|AWZ76871.1|4814061_4814757_+|L-ribulose-5-phosphate-4-epimerase
MLEDLKRQVLEANLALPKHNLVTLTWGNVSAVDREKGVFVIKPSGVDYRVMTADDMVVVSLESGEVVEGNKKPSSDTPTHRLLYQAFPTLGGIVHTHSRHATIWAQAGQSIPATGTTHADYFYGPVPCTRLMTDAEINGDYEWETGNVIVETFRQQGIDPAQMPGVLVHSHGPFAWGKNAEDAVHNAIVLEEIAYMGIFCRQLAPQLPAMQQTLLDKHYLRKHGAKAYYGQ
>CP030341.1|AWZ77534.1|4812421_4813924_+|L-arabinose-isomerase
MTIFDNYEVWFVIGSQHLYGPEALRQVTKHAEHVVNSLNAEAKLPCKLVLKPLGTTPDEITHICRDANYDDKCAGLVVWLHTFSPAKMWINGLTILNKPLLQFHTQYNAALPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHSVVTGHWQDKEAHQRIGGWMRQAVSKQDTRHLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVVNSISDGDISALVDEYESSYRLTPAAQVHGEKRQNVLDAARIELGMKRFLEQGGFHAFTTTFEDLHGLKQLPGLAVQRLMQQGYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTYHFDNGNDLVLGSHMLEVCPTIATVEKPILDVQPLGIGGKADPARLIFNTQTGPAIVASLIDLGDRFRLLVNTIETVPTPHDLPKLPVANALWKAQPDLRTASEAWIIAGGAHHTVFSHALNLDDMRQFAELHDIELTVIDNDTRLPSFKDALRWNEVYYGSKR
>CP030341.1|AWZ77745.1|4810701_4812411_+|L-ribulokinase
MAIAIGLDFGSDSVRALAVECASGAELATSVEWYPRWREGQYCDGANNRFRHHPRDYIESMEAALKSVLASLSAEQRADVVGIGVDSTGSTPAPVDAEGNVLALREEFADNPNAMFVLWKDHTAVEEAEAITRLCHQPGKEDYSRYIGGIYSSEWFWAKILHVTREDSAVAQAAASWVELCDWVPALLSGTTRPQDLRRGRCSAGHKSLWHESWGGLPPASFFDELDPIINQHLAWPLFTDTWTADVPVGTLSAEWAQRLGLSQSVAISGGAFDCHMGAVGAGAQPNALVKVIGTSTCDILIADKESVGERTVKGICGQVDGSVVPHFIGMEAGQSAFGDIYAWFGRILGWPLEQLAQQQPALREQIKASQKQLLPALTEAWANNPSLEHLPVVLDWFNGRRTPNANQRLKGVITDLNLATDAPALFGGLIAATAFGARAIMECFTEQGIPVNNVMALGGIARKNQVIMQACCDVLNRPLQIVASDQCCALGAAIFAAVAAGVYDDIPAAQQRMASQVETTLQPRPAQAQRFEQLYQRYQQWSVSAEQHYLPSAAKAEKAPQSKAALTH
>CP030341.1|AWZ77568.1|4810349_4810520_+|hypothetical-protein
MRFGHTRGSPRRYQWHQLSIFIILSLSALSRLRRRWEFGEKPAQQAKKAPAACIPP
>CP030341.1|AWZ75420.1|4809518_4810364_-|arabinose-operon-regulatory-protein
MAETQNDPLLPGYSFNAHLVTGLTPIEAQGYLDFFIDRPLGMKGYILNLTIRGEGVINNHGEQFVCRPGDMLLFPPGEIHHYGRHPDASEWYHQWVYFRPRAYWHEWLNWPTIFAQTGFFRPDEQWQARFGELFGQIVDAGQGAGRYSELLAINLLEQLLLRRMEAINESLHPPLDNRVREACQYISDHLADSHFDIASVAQHVCLSPSRLSHLFRQQLGVSVLGWREDQRISQAKLLLSTTRMPIATVGRNVGFEDQLYFSRVFKKCTGASPSEFRAGCE
>CP030341.1|AWZ74597.1|4823538_4825164_+|sensor-histidine-kinase-CitA
MKLSFQYKLFISLVAFFSVLFIALGIYYYFDASRQLYQEMSARAKIQAEEIALMPNLRQQVSRHDPQAIQAFMQQIAAHSDASFIVIGDRQGVHLFHSVHPEWVGTRLVGGDNQAVLEGKSITTIRKGGLGVSLRSKTPIVDDAGRVIGIVSVGYLTSYLDSITLTKVINIFIAAVLLLIALFIFSWYFTRSIKKQIFSLEPREIGLLVRQQKAMMESIFEGVIVIDRQRRIEVINHAARSLLGLSQPARQLRGQSIDSVISPQPFFASGDMLERDTHDELCRFNQLTVLASRVRIMLENTLQGWVITFRDRNEINALTAQLSQVKRYVDNLRIMRHEQLNRMTTLSGLLHMGHYDEAIRYIQAQSEHAQELLDFISSHFHSPTLCGLLLGKATRAREKGVALSFDPACRIDRPLPSLMESELISIIGNLLDNAIEATQRAELPHEPVEVLIQLNARELIIEVADRGVGIRPDIRERIFERGVTTKTRGDHGIGLYLIEHYVTQAGGTIEVADNAPRGTIFTLFIPADAHACPQPEAHDAS
>CP030341.1|AWZ74199.1|4825153_4825852_+|response-regulator
MHHDLVDVLIIEDESELARLHAELVQKHPRLRLAGMAASLAQARQLLHATPPQLVLLDNYLPDGKGVTLMTDPALATSQCSVIFITAASDMETCSQAIRNGAFDYILKPVSWKRLSQSLERFIQFYDQQREWKIVDQQNVDSLYQLQAKNYRVDSGSKGIEEKTLALVQGLFSDREAHCFSVDEVVSAAGLSKTTARRYLEHGVETGFLEVEMLYGKIGHPRRLYRRAKVKS
>CP030341.1|AWZ76427.1|4825884_4826712_-|dnaJ-like-protein-DjlA
MQYLGKVIGVAVALLMGGGFWGVVLGFLVGHMFDRARSRRLNLFANQQERQSLFFSTTFEVMGHLTKSKGRVTEADIHVANVLMDRMNLHGASRTAAQQAFRDGKADNYPLREKMRQLRSVCFGRFDLIRMFLEIQLQAAFADGELHPNEREVLFVIADELGISRAQFDQFLRMMQGGAQFGGGSQQRSYGQHGGNAGWQQAQRGPTLEDACNVLGVKPTDDAATVKRAYRKLMNEHHPDKLVAKGLPPEMMEMAKQKAQEIQKAWELIKEQRGF
>CP030341.1|AWZ76602.1|4826988_4829304_+|LPS-assembly-protein-LptD
MIASALYSQQGLAADLATQCMLGVPSYDRPLVEGRPGDLPVTINADHAKGNYPDNAVFTGNVDINQGNSRLRADEVQLHQQQAAGQAQPVRTVDALGNVHYDDNQVILKGPKAWSNLNTKDTNVWQGDYQMVGRQGRGTADLMKQRGENRYTILENGSFTSCLPGSDTWSVVGSEVIHDREEQVAEIWNARFKLGSVPIFYSPYLQLPVGDKRRSGFLIPNAKYSTKNGVEFSLPYYWNIAPNFDATITPHYMNKRGGVMWENEFRYLTQLGSGLTEFDYLPSDKVYEDDHSSDSNSRRWLFYWNHSGVIDQVWRLNADYTKVSDPDYFNDFSSKYGSSTDGYATQKFSAGYVNQNFDATVSTKQFQVFDRESSNSYSAEPQLDVNYYQNDVGPFDTHLYGQVAHFVNSNNNMPEATRVHFEPTINLPLSNGWGSLNTEAKLLATHYQQSNLDKYNAANGTDYKESVSRVMPQFKVDGKMVFERDLQEGFTQTLEPRVQYLYVPYRDQSEIGNYDSTLLQSDYTGLFRDRTYSGLDRIASANQVTTGLTSRVYDAAAVERFNISVGQIYYFTESRTGDDNINWENNDTTGSLVWAGDTYWRIADEWGLRGGIQYDTRLDNVATGNGTIEYRRDENRLVQLNYRYASPEYIQATLPSYSTAAQYKQGISQVGMTASWPIVDRWSVVGAYYYDTNTRKAANQMLGVQYNSCCYAIRLGYERKVNGWNSNDNGGESKYDNTFGINIELRGLSSNYGLGTQQMLRSNILPYQSSL
>CP030341.1|AWZ76831.1|4829358_4830645_+|chaperone-SurA
MKNWKTLLLGIAMIANTSFAAPQVVDKVAAVVNNGVVLESDVDGLMQSVKLNAGQAGQQLPDDATLRHQILERLIMDQIVLQMGQKMGVKISDDQLDQAIANIAKQNNMTLDQMRSRLAYEGINYNTYRNQIRKEMLISEVRNNEVRRRITVLPQEVEALAKQIGDQNDASTELNLSHILIPLPENPTSDEVAAAQEQANSIVEQARNGANFGKLAITYSADQQALKGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLRGGTQNISVTEVHARHILLKPSPIMNDAQAQAKLEQIAAEIKSGKITFAQAAKTYSEDPGSANQGGDLGWATPDIFDPAFRDALMRLNKGQTSGPVHSSFGWHLIELLDSRQVDRTDAAQKDRAYRMLMNRKFSEEAATWMQEQRASAYVKILSN
>CP030341.1|AWZ75300.1|4830650_4831640_+|4-hydroxythreonine-4-phosphate-dehydrogenase-PdxA
MPETRKVVITPGEPAGIGPDLVVQLAQRDWPVELVICADGALLTDRAKRLGLPLSLLPYDPAQPPVPQRAGTLTLLNVPLNVPAEPGVLNVQNGAYVVETLARACDGCLSGEFAALVTGPVHKGNINDAGIAFTGHTEFFEERAKASKVVMMLATEELRVALVTTHLPLKAISEAITPELLREIITILDHDLRTKFGIAQPHVLVCGLNPHAGEGGHMGTEEIDTIIPVLEEMRAKGMNLSGPLPADTLFQPKYLDHADAVLAMYHDQGLPVLKYQGFGRGVNITLGLPFIRTSVDHGTALELAGQGKADVGSFITALNLAIKMIVNTQ
>CP030341.1|AWZ72827.1|4831636_4832458_+|dimethyladenosine-transferase
MNNRVHQGHLARKRFGQNFLNDQFVIDSIVSAINPQKGQAMVEIGPGLAALTEPVGERLDQLTVIELDRDLAARLQTHPFLGPKLTIYQQDAMTMNFGELAEKMGQPLRVFGNLPYNISTPLMFHLFSYTDAIADMHFMLQKEVVNRLVAGPNSKAYGRLSVMAQYYCQVIPVLEVPPSAFTPPPKVDSAVVRLVPHSTMPYPVKEIRVLSRITTEAFNQRRKTIRNSLGNLFSVEVLTELGIDPAMRAENISVAQYCLMANWLSDNLPTKES
>CP030341.1|AWZ76164.1|4832460_4832838_+|hypothetical-protein
MIHSPRVCVQVQSVYIESQSSPEEERYVFAYTVTIRNLGRSQVQLLGRYWLITNGHGRETEVQGEGVVGEQPHIPAGGEYQYTSGAVIETPLGTMQGHYEMIDIDGAPFRIEIPVFRLAVPTLIH
>CP030341.1|AWZ76957.1|4832842_4833691_+|bis(5'-nucleosyl)-tetraphosphatase
MSTYLIGDVHGCYDELIALLAQVEFDPRRDTLWLTGDLVARGPGSLEVLRYVKSLGDSVRLVLGNHDLHLLAVFAGISRNKPKDRLKPLLEAPDADELLNWLRRQPLLQVDEEKKLVMAHAGITPQWDLETAQQCARDVEAVLSSDSYPFFLDAMYGDMPNHWSNELSGLARLRFISNAFTRMRYCFPNGQLDMYSKEAPEDAPAPLKPWFAIPGPVSNAYSIAFGHWASLEGRGTPEGIYALDTGCCWGGELTCLRWEDKQYFTQPSNRQKSLDEGEAVAS
>CP030341.1|AWZ77125.1|4833946_4834426_-|dihydrofolate-reductase
MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGRLTWESIGRPLPGRKNIVISSKPGSDDRVQWVSSVEEAIAACGDVEEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYDPDEWESVFSEFHDADAQNSHSYCFEILERR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Identity
CP030341_1	1.1\|4339361\|36\|CP030341\|CRISPRCasFinder	4339361-4339396	36	MK448233	Klebsiella phage ST11-VIM1phi8.1, complete genome	8447-8482	1.0
CP030341_1	1.1\|4339361\|36\|CP030341\|CRISPRCasFinder	4339361-4339396	36	MK448235	Klebsiella phage ST512-KPC3phi13.1, complete genome	8447-8482	1.0
CP030341_1	1.1\|4339361\|36\|CP030341\|CRISPRCasFinder	4339361-4339396	36	MK448231	Klebsiella phage ST101-KPC2phi6.1, complete genome	11383-11418	1.0

1. spacer 1.1|4339361|36|CP030341|CRISPRCasFinder matches to MK448233 (Klebsiella phage ST11-VIM1phi8.1, complete genome) position: , mismatch: 0, identity: 1.0

cctcgccggtacgcagcgtggttactgggtttgcgt	CRISPR spacer
cctcgccggtacgcagcgtggttactgggtttgcgt	Protospacer
************************************

2. spacer 1.1|4339361|36|CP030341|CRISPRCasFinder matches to MK448235 (Klebsiella phage ST512-KPC3phi13.1, complete genome) position: , mismatch: 0, identity: 1.0

cctcgccggtacgcagcgtggttactgggtttgcgt	CRISPR spacer
cctcgccggtacgcagcgtggttactgggtttgcgt	Protospacer
************************************

3. spacer 1.1|4339361|36|CP030341|CRISPRCasFinder matches to MK448231 (Klebsiella phage ST101-KPC2phi6.1, complete genome) position: , mismatch: 0, identity: 1.0

cctcgccggtacgcagcgtggttactgggtttgcgt	CRISPR spacer
cctcgccggtacgcagcgtggttactgggtttgcgt	Protospacer
************************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

739109 : 772367

uncultured_Caudovirales_phage(68.75%)

integrase,head,tRNA,portal,terminase,capsid,protease,tail

attL 756717:756734|attR 772712:772729

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWZ75005.1\|739109_740057_-\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	2.2e-07	37.2
AWZ77767.1\|740071_740566_-	peptide deformylase	E3SLL2	Synechococcus_phage	2.5e-18	40.3
AWZ72611.1\|740709_741834_+	DNA protecting protein DprA	NA	NA	NA	NA
AWZ75079.1\|741805_742279_+	hypothetical protein	NA	NA	NA	NA
AWZ73658.1\|742304_742847_+	topoisomerase DNA binding C4 zinc finger family protein	NA	NA	NA	NA
AWZ75349.1\|742851_743424_+\|tRNA	tRNA threonylcarbamoyladenosine biosynthesis protein RimN	NA	NA	NA	NA
AWZ77859.1\|743427_744246_+	shikimate dehydrogenase	NA	NA	NA	NA
AWZ73258.1\|744242_744500_+	hypothetical protein	NA	NA	NA	NA
AWZ76902.1\|744475_745030_-	bacterial transferase hexapeptide family protein	NA	NA	NA	NA
AWZ77730.1\|750825_751047_-	prokaryotic membrane lipolipid attachment site family protein	NA	NA	NA	NA
AWZ72828.1\|751340_754451_-	RND transporter, hydrophobe/amphiphile efflux-1 family protein	NA	NA	NA	NA
AWZ75744.1\|754463_755603_-	efflux transporter, RND family, MFP subunit	NA	NA	NA	NA
AWZ75446.1\|755981_756632_+	putative acrEF/envCD operon repressor	NA	NA	NA	NA
756717:756734	attL	NA	NA	NA	NA
AWZ77448.1\|756907_758134_+\|integrase	phage integrase family protein	A0A2H4JB45	uncultured_Caudovirales_phage	1.8e-150	62.2
AWZ74488.1\|758226_759168_+	hypothetical protein	NA	NA	NA	NA
AWZ72636.1\|759349_759634_+	prophage CP4-57 regulatory family protein	NA	NA	NA	NA
AWZ72606.1\|759644_760424_+	phage antirepressor KilAC domain protein	Q8HA02	Enterobacteria_phage	6.2e-40	51.5
AWZ75979.1\|760965_761145_+	hypothetical protein	A0A2H4JGW3	uncultured_Caudovirales_phage	2.6e-26	94.9
AWZ73223.1\|761137_761326_+	hypothetical protein	NA	NA	NA	NA
AWZ75563.1\|761318_761633_+	hypothetical protein	NA	NA	NA	NA
AWZ76433.1\|761629_761998_+	hypothetical protein	A0A2H4JCX7	uncultured_Caudovirales_phage	3.7e-51	81.1
AWZ76681.1\|761994_762360_+	hypothetical protein	NA	NA	NA	NA
AWZ77143.1\|762365_764495_+	hypothetical protein	A0A1W6JPG0	Morganella_phage	3.4e-205	62.4
AWZ77655.1\|764837_765173_+	hypothetical protein	NA	NA	NA	NA
AWZ77646.1\|765221_765734_-	hypothetical protein	NA	NA	NA	NA
AWZ74782.1\|765997_767164_+\|capsid	phage major capsid protein, HK97 family	A0A2H4JED2	uncultured_Caudovirales_phage	9.8e-207	95.9
AWZ74991.1\|767215_767776_+\|head,protease	phage prohead protease, HK97 family	A0A2H4JB68	uncultured_Caudovirales_phage	1.2e-98	95.7
AWZ75765.1\|767777_769019_+\|portal	phage portal protein, HK97 family	A0A2H4JFJ9	uncultured_Caudovirales_phage	1.0e-230	96.5
AWZ77599.1\|769195_769351_+\|head,tail	phage head-tail joining family protein	A0A1P8DTK6	Proteus_phage	7.2e-09	54.0
AWZ76299.1\|769347_769647_+\|head,tail	phage gp6-like head-tail connector family protein	A0A2H4JD08	uncultured_Caudovirales_phage	3.4e-39	80.8
AWZ77541.1\|769697_770090_+	HNH endonuclease family protein	A0A2H4JAS8	uncultured_Caudovirales_phage	1.4e-64	90.0
AWZ73522.1\|770076_770235_+	hypothetical protein	A0A2H4JCY9	uncultured_Caudovirales_phage	2.5e-17	88.0
AWZ76566.1\|770365_770722_+\|terminase	phage terminase, small subunit, P27 family	A0A2H4JHS3	uncultured_Caudovirales_phage	5.5e-60	99.2
AWZ77726.1\|770705_772367_+	phage Terminase family protein	A0A2H4JB64	uncultured_Caudovirales_phage	0.0e+00	97.8
772712:772729	attR	NA	NA	NA	NA

DBSCAN-SWA_2

1528943 : 1575178

Salmonella_phage(87.5%)

head,integrase,tRNA,portal,terminase,capsid,lysis,tail,plate

attL 1527237:1527283|attR 1563804:1563850

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1527237:1527283	attL	NA	NA	NA	NA
AWZ75808.1\|1528943_1529969_-\|integrase	phage integrase family protein	A0A1S6L016	Salmonella_phage	1.5e-190	93.8
AWZ73086.1\|1529971_1530289_-	putative phage regulatory protein cI	A0A1S6KZZ7	Salmonella_phage	1.5e-24	49.5
AWZ77145.1\|1530723_1530966_+	putative bacteriophage regulatory protein	A0A1S6KZZ6	Salmonella_phage	4.0e-38	98.8
AWZ72883.1\|1530998_1531508_+	phage regulatory CII family protein	A0A1S6L008	Salmonella_phage	1.1e-77	85.8
AWZ76603.1\|1531593_1531716_+	hypothetical protein	A0A1S6L005	Salmonella_phage	5.9e-06	60.5
AWZ76907.1\|1531679_1532018_+	putative prophage protein	A0A218M4I7	Erwinia_phage	6.2e-29	58.0
AWZ73625.1\|1532085_1532319_+	hypothetical protein	A0A1S6L021	Salmonella_phage	6.0e-31	90.9
AWZ74354.1\|1532318_1532546_+	phage/conjugal plasmid C-4 type zinc finger, TraR family protein	A0A1S6L007	Salmonella_phage	5.1e-35	92.0
AWZ75594.1\|1532542_1533394_+	DNA adenine methylase family protein	A0A1S6L011	Salmonella_phage	2.2e-115	75.4
AWZ75445.1\|1533390_1535775_+	bacteriophage replication protein A	A0A1S6L028	Salmonella_phage	0.0e+00	87.9
AWZ74363.1\|1535937_1536126_+	putative levan regulatory protein	A0A1S6L006	Salmonella_phage	2.2e-23	90.3
AWZ73761.1\|1536137_1536371_+	dinI-like family protein	A0A0M4S6H1	Salmonella_phage	2.0e-34	96.1
AWZ77265.1\|1536466_1537150_-	hypothetical protein	NA	NA	NA	NA
AWZ75236.1\|1537136_1538216_-	hypothetical protein	NA	NA	NA	NA
AWZ73610.1\|1538215_1539217_-	hypothetical protein	NA	NA	NA	NA
AWZ77226.1\|1540064_1540967_-\|portal	phage portal protein, PBSX family	A0A1S6KZW5	Salmonella_phage	4.7e-156	89.1
AWZ73678.1\|1541107_1542862_-\|terminase	terminase-like family protein	A0A1S6KZW3	Salmonella_phage	0.0e+00	91.8
AWZ73155.1\|1543011_1543845_+\|capsid	phage capsid scaffolding (GPO) serine peptidase family protein	A0A1S6KZW9	Salmonella_phage	4.4e-100	77.6
AWZ75575.1\|1543861_1544914_+\|capsid	phage major capsid protein, P2 family	A0A1S6KZZ3	Salmonella_phage	6.8e-175	91.0
AWZ77459.1\|1544917_1545571_+\|terminase	phage small terminase subunit	A0A1S6KZX1	Salmonella_phage	1.9e-90	80.0
AWZ72798.1\|1545666_1546131_+\|head	phage head completion family protein	A0A1S6KZW8	Salmonella_phage	1.5e-73	85.7
AWZ77685.1\|1546130_1546334_+	phage Tail Protein X family protein	E5G6M9	Salmonella_phage	9.8e-30	89.6
AWZ75798.1\|1546337_1546553_+	putative membrane protein	E5G6N0	Salmonella_phage	6.1e-30	88.7
AWZ75447.1\|1546533_1547043_+	phage lysozyme family protein	E5G6N1	Salmonella_phage	1.6e-81	85.2
AWZ74814.1\|1547047_1547431_+	putative membrane protein	A0A1S6KZZ2	Salmonella_phage	1.9e-18	45.4
AWZ77170.1\|1547427_1547856_+\|lysis	phage lysis regulatory, LysB family protein	A0A1S6KZX8	Salmonella_phage	7.1e-54	82.5
AWZ73827.1\|1547951_1548374_+\|tail	P2 phage tail completion R family protein	A0A1S6KZY0	Salmonella_phage	8.2e-63	83.2
AWZ74525.1\|1548366_1548813_+	phage virion morphogenesis protein	A0A1S6L001	Salmonella_phage	2.5e-54	72.3
AWZ75363.1\|1548835_1549702_-	hypothetical protein	NA	NA	NA	NA
AWZ73866.1\|1549796_1550369_+\|plate	phage baseplate assembly V family protein	E5G6N6	Salmonella_phage	1.4e-76	70.8
AWZ75621.1\|1550365_1550728_+	lysozyme family protein	A0A1S6KZZ4	Salmonella_phage	8.4e-48	85.6
AWZ76778.1\|1550714_1551623_+\|plate	baseplate J-like family protein	E5G6N8	Salmonella_phage	1.9e-109	68.9
AWZ76177.1\|1551663_1552287_+\|tail	phage tail protein I	A0A1S6L000	Salmonella_phage	6.7e-53	56.0
AWZ75324.1\|1552288_1554238_+	cotH family protein	Q6QI97	Burkholderia_phage	1.0e-06	38.9
AWZ73084.1\|1554247_1555366_+	hypothetical protein	A0A248XD67	Klebsiella_phage	4.4e-55	38.0
AWZ76735.1\|1555417_1556491_+\|tail	phage tail-collar fiber family protein	A0A1S6KZZ8	Salmonella_phage	6.6e-40	53.6
AWZ76095.1\|1556639_1557812_+\|tail	phage tail sheath family protein	A0A1S6KZY7	Salmonella_phage	3.4e-207	91.5
AWZ76311.1\|1557821_1558337_+\|tail	phage major tail tube protein	E5G6P8	Salmonella_phage	1.4e-80	84.2
AWZ73533.1\|1558389_1558689_+	mu-like prophage FluMu gp41 family protein	E5G6P9	Salmonella_phage	8.2e-33	78.0
AWZ77088.1\|1558703_1558823_+	phage P2 GpE family protein	E5G6Q0	Salmonella_phage	2.2e-13	87.2
AWZ77441.1\|1558815_1561446_+\|tail	phage tail tape measure protein, TP901 family, core region	E5FFG5	Burkholderia_phage	8.9e-115	41.9
AWZ77113.1\|1561442_1561928_+	phage P2 GpU family protein	E5G6Q2	Salmonella_phage	5.2e-61	80.1
AWZ76768.1\|1561924_1563019_+	phage late control D family protein	E5G6Q3	Salmonella_phage	2.4e-170	83.6
AWZ73577.1\|1563331_1563499_-	hypothetical protein	NA	NA	NA	NA
AWZ73332.1\|1563632_1563779_-	hypothetical protein	NA	NA	NA	NA
AWZ74430.1\|1564312_1564795_-	ssrA-binding protein	W5RAM5	Staphylococcus_phage	2.3e-29	47.4
1563804:1563850	attR	NA	NA	NA	NA
AWZ72940.1\|1564944_1565382_+	ribosome association toxin RatA	NA	NA	NA	NA
AWZ74864.1\|1565371_1565662_+	hypothetical protein	NA	NA	NA	NA
AWZ74937.1\|1565728_1566070_-	smpA / OmlA family protein	NA	NA	NA	NA
AWZ75332.1\|1566217_1567879_-	DNA repair protein RecN	NA	NA	NA	NA
AWZ76530.1\|1567965_1568844_-	ATP-NAD kinase family protein	NA	NA	NA	NA
AWZ73300.1\|1568968_1569559_+	protein GrpE	NA	NA	NA	NA
AWZ74827.1\|1569678_1570920_-	hypothetical protein	NA	NA	NA	NA
AWZ75720.1\|1570984_1571776_-	inner membrane protein YpjD	NA	NA	NA	NA
AWZ75710.1\|1571939_1573304_+	signal recognition particle protein	NA	NA	NA	NA
AWZ74231.1\|1573563_1573812_+	ribosomal protein S16	NA	NA	NA	NA
AWZ76757.1\|1573920_1574379_+	16S rRNA processing protein RimM	NA	NA	NA	NA
AWZ75419.1\|1574410_1575178_+\|tRNA	tRNA (guanine(37)-N(1))-methyltransferase	NA	NA	NA	NA

DBSCAN-SWA_3

1679903 : 1724746

Salmonella_phage(38.78%)

integrase,head,terminase,protease,tail

attL 1682467:1682481|attR 1693647:1693661

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWZ76028.1\|1679903_1681370_+	inosine-5'-monophosphate dehydrogenase	A0A1V0SHK8	Klosneuvirus	1.2e-87	38.7
AWZ77123.1\|1681437_1683015_+	GMP synthase	NA	NA	NA	NA
1682467:1682481	attL	NA	NA	NA	NA
AWZ74228.1\|1683207_1684458_+\|integrase	phage integrase family protein	A0A1X9TCT6	Enterobacter_phage	1.4e-206	85.3
AWZ72876.1\|1684474_1684666_-	putative cell division initiation protein	NA	NA	NA	NA
AWZ73710.1\|1684841_1685435_-	MT-A70 family protein	T1SA14	Salmonella_phage	4.3e-110	92.4
AWZ75711.1\|1685431_1685590_-	hypothetical protein	T1SAR0	Salmonella_phage	1.9e-17	78.8
AWZ76399.1\|1685582_1685867_-	perC transcriptional activator family protein	T1S9J5	Salmonella_phage	5.6e-31	72.3
AWZ73161.1\|1685985_1686234_-	prophage CP4-57 regulatory family protein	A0A0F6TJ45	Escherichia_coli_O157_typing_phage	1.1e-27	69.5
AWZ76996.1\|1686285_1686738_-	recombinase, phage RecT family protein	Q858E1	Salmonella_phage	5.7e-70	91.9
AWZ75260.1\|1687317_1688217_-	putative phage-type endonuclease domain protein	Q858E0	Salmonella_phage	1.5e-159	93.0
AWZ74949.1\|1688213_1688513_-	hypothetical protein	A0A0F6R7M4	Escherichia_coli_O157_typing_phage	2.1e-20	54.5
AWZ77521.1\|1688509_1688659_-	hypothetical protein	G9L6A5	Escherichia_phage	7.9e-13	84.2
AWZ75221.1\|1688879_1689461_-	helix-turn-helix family protein	Q858D7	Salmonella_phage	1.9e-65	64.8
AWZ77122.1\|1689614_1689848_+	hypothetical protein	T1SAR5	Salmonella_phage	9.2e-24	66.2
AWZ77111.1\|1689994_1690204_+	hypothetical protein	A0A193GYW4	Enterobacter_phage	1.8e-26	78.3
AWZ72672.1\|1690203_1690971_+	putative primosomal protein I	A0A193GZ86	Enterobacter_phage	8.9e-140	91.4
AWZ73838.1\|1690967_1691753_+	replication P family protein	A0A193GYX1	Enterobacter_phage	8.2e-133	87.4
AWZ73672.1\|1691917_1692220_+	hypothetical protein	A0A0F6R8N5	Escherichia_coli_O157_typing_phage	1.4e-43	83.0
AWZ73603.1\|1692281_1692416_+	putative membrane protein	NA	NA	NA	NA
AWZ75816.1\|1692412_1692823_+	hypothetical protein	A0A2P1MXC5	Escherichia_phage	3.1e-14	42.2
AWZ77580.1\|1692806_1692998_+	hypothetical protein	NA	NA	NA	NA
AWZ74919.1\|1692994_1693420_+	hypothetical protein	NA	NA	NA	NA
AWZ74935.1\|1693416_1694160_+	hypothetical protein	A6N3G8	Burkholderia_virus	1.5e-19	59.5
1693647:1693661	attR	NA	NA	NA	NA
AWZ75855.1\|1694159_1694330_+	hypothetical protein	A0A2R2Z308	Escherichia_phage	2.5e-15	69.6
AWZ77560.1\|1694330_1694543_+	hypothetical protein	A0A0F6TJE4	Escherichia_coli_O157_typing_phage	8.1e-11	45.5
AWZ72930.1\|1694539_1695208_+	hypothetical protein	Q6UAT8	Klebsiella_phage	1.5e-05	52.5
AWZ77564.1\|1695200_1695440_+	hypothetical protein	G8C7S3	Escherichia_phage	4.6e-10	48.0
AWZ73559.1\|1695439_1695778_+	hypothetical protein	A0A193GYX4	Enterobacter_phage	4.7e-45	80.0
AWZ73406.1\|1695852_1696110_+	hypothetical protein	NA	NA	NA	NA
AWZ76090.1\|1696187_1696772_+\|terminase	terminase small subunit	T1SBI8	Salmonella_phage	2.4e-89	88.1
AWZ77591.1\|1696768_1698244_+	hypothetical protein	Q858H3	Salmonella_phage	3.8e-280	93.1
AWZ75611.1\|1698310_1698622_-	phage family protein	A0A0F6TJP2	Escherichia_coli_O157_typing_phage	2.5e-16	45.2
AWZ73860.1\|1699423_1699630_+	hypothetical protein	T1SA67	Salmonella_phage	4.8e-08	88.2
AWZ76007.1\|1699644_1701327_+\|head,tail	bacteriophage head to tail connecting family protein	A0A0F6TJD8	Escherichia_coli_O157_typing_phage	2.3e-265	84.6
AWZ76648.1\|1701323_1701620_+	hypothetical protein	T1SBI9	Salmonella_phage	1.2e-33	70.4
AWZ75521.1\|1701622_1702303_+\|protease	putative endoprotease	G9L6C4	Escherichia_phage	4.0e-75	83.5
AWZ75526.1\|1702317_1703304_+	hypothetical protein	A0A193GZ49	Enterobacter_phage	1.6e-178	93.9
AWZ76982.1\|1703357_1703795_+	hypothetical protein	A0A193GYT9	Enterobacter_phage	4.8e-66	91.0
AWZ72895.1\|1703805_1704147_+	hypothetical protein	G9L6C7	Escherichia_phage	4.0e-36	70.8
AWZ74759.1\|1704197_1704521_+	hypothetical protein	G9L6C8	Escherichia_phage	5.3e-46	85.0
AWZ73030.1\|1704520_1705126_+	hypothetical protein	A0A0F6TJN5	Escherichia_coli_O157_typing_phage	2.8e-88	78.5
AWZ72730.1\|1705125_1707624_+	hypothetical protein	Q858G3	Salmonella_phage	0.0e+00	84.0
AWZ73237.1\|1707833_1708088_+	hypothetical protein	Q858G2	Salmonella_phage	2.2e-39	83.3
AWZ77133.1\|1708087_1708627_+	hypothetical protein	A0A0F6TJ56	Escherichia_coli_O157_typing_phage	6.1e-71	80.0
AWZ76925.1\|1708637_1711469_+	hypothetical protein	Q858G0	Salmonella_phage	0.0e+00	75.7
AWZ75533.1\|1711468_1713379_+	hypothetical protein	Q858F9	Salmonella_phage	5.2e-290	81.9
AWZ73893.1\|1713378_1716144_+	hypothetical protein	Q858F8	Salmonella_phage	0.0e+00	94.5
AWZ74749.1\|1716140_1716260_-	putative membrane protein	NA	NA	NA	NA
AWZ74177.1\|1716755_1717445_-	BRO family, N-terminal domain protein	G9L6E2	Escherichia_phage	1.6e-79	65.2
AWZ77166.1\|1718212_1720579_+	putative endo-N-acetylneuraminidase	A0A2H5BN49	Klebsiella_phage	9.1e-268	79.5
AWZ72988.1\|1720587_1720740_+	hypothetical protein	A0A2H5BN82	Klebsiella_phage	1.9e-06	54.3
AWZ77065.1\|1720863_1721268_+	putative membrane protein	T1SA79	Salmonella_phage	9.3e-56	84.1
AWZ75453.1\|1721254_1721560_+	hypothetical protein	A0A193GYK3	Enterobacter_phage	2.7e-39	82.4
AWZ73702.1\|1721549_1722179_+	chitinase class I family protein	Q858F0	Salmonella_phage	3.1e-90	76.4
AWZ75685.1\|1722175_1722658_+	hypothetical protein	Q858E9	Salmonella_phage	3.0e-61	80.6
AWZ74240.1\|1722877_1724746_-	type I phosphodiesterase / nucleotide pyrophosphatase family protein	A0A2P0VMN7	Tetraselmis_virus	2.6e-07	22.6

DBSCAN-SWA_4

2053642 : 2060549

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWZ77239.1\|2053642_2054506_+	ABC transporter family protein	G9BWD6	Planktothrix_phage	5.7e-10	27.5
AWZ75610.1\|2054516_2055290_+	ABC transporter family protein	G9BWD6	Planktothrix_phage	1.5e-25	36.3
AWZ74419.1\|2055400_2055532_+	hypothetical protein	NA	NA	NA	NA
AWZ77689.1\|2055532_2056426_-	lipid kinase YegS	A0A1V0SBJ0	Catovirus	6.1e-15	29.8
AWZ72706.1\|2056671_2058033_-	peptidase U32 family protein	Q6DW11	Phage_TP	2.5e-206	94.5
AWZ75149.1\|2058351_2059074_-	transcriptional regulatory, C terminal family protein	W8CYM9	Bacillus_phage	6.4e-31	33.2
AWZ74035.1\|2059070_2060549_-	signal transduction histidine-protein kinase BaeS	W8CYF6	Bacillus_phage	1.1e-29	28.3

DBSCAN-SWA_5

2097080 : 2104705

Enterobacteria_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWZ74628.1\|2097080_2098487_+	6-phosphogluconate dehydrogenase	M4QQM4	Ostreococcus_lucimarinus_virus	4.7e-38	28.7
AWZ76851.1\|2098711_2099776_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	3.4e-105	55.0
AWZ74599.1\|2099802_2100672_+	glucose-1-phosphate thymidylyltransferase	I7I009	Enterobacteria_phage	9.8e-111	67.0
AWZ73041.1\|2100703_2101594_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	2.8e-28	33.6
AWZ73454.1\|2101608_2102163_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	3.8e-52	58.2
AWZ77020.1\|2102343_2103510_+	nucleotide sugar dehydrogenase family protein	M1I798	Paramecium_bursaria_Chlorella_virus	4.1e-112	54.7
AWZ76728.1\|2103703_2104705_+	polysaccharide biosynthesis family protein	E3T4Y8	Cafeteria_roenbergensis_virus	1.2e-30	28.6

DBSCAN-SWA_6

3077257 : 3088144

Escherichia_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWZ76021.1\|3077257_3080365_+	beta-galactosidase	L0N6M2	Herpes_simplex_virus	0.0e+00	59.6
AWZ77420.1\|3080419_3081685_+	lactose permease	NA	NA	NA	NA
AWZ72971.1\|3081715_3082804_-	AAA domain protein	A0A077SLJ9	Escherichia_phage	8.0e-211	100.0
AWZ73633.1\|3082890_3083151_-	hypothetical protein	A0A077SK33	Escherichia_phage	3.5e-40	97.7
AWZ75908.1\|3083448_3084309_+	beta-lactamase SHV-1	A0A077SL40	Escherichia_phage	2.2e-155	99.3
AWZ76228.1\|3084329_3085091_-	deoR-like helix-turn-helix domain protein	A0A077SK06	Escherichia_phage	1.9e-134	100.0
AWZ75970.1\|3085351_3086254_+	NAD binding domain of 6-phosphogluconate dehydrogenase family protein	A0A077SLF7	Escherichia_phage	7.7e-159	99.3
AWZ76978.1\|3086265_3087531_+	hypothetical protein	A0A077SLJ7	Escherichia_phage	6.6e-233	99.5
AWZ74125.1\|3087523_3088144_+	class II Aldolase and Adducin N-terminal domain protein	A0A077SK32	Escherichia_phage	8.0e-115	100.0

DBSCAN-SWA_7

3312364 : 3355412

uncultured_Caudovirales_phage(31.11%)

integrase,protease,transposase,terminase,lysis

attL 3346525:3346539|attR 3352534:3352548

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWZ76064.1\|3312364_3315388_-	hypothetical protein	A0A286S1P0	Klebsiella_phage	1.6e-22	44.7
AWZ74683.1\|3315443_3315641_-	hypothetical protein	NA	NA	NA	NA
AWZ76614.1\|3315615_3315747_-	hypothetical protein	NA	NA	NA	NA
AWZ74699.1\|3315867_3316032_-	hypothetical protein	NA	NA	NA	NA
AWZ74848.1\|3316506_3316953_-	hypothetical protein	A0A0M5M1K4	Salmonella_phage	1.1e-28	46.0
AWZ77741.1\|3317276_3318467_-	putative bacteriophage protein	A0A0M4RD32	Salmonella_phage	1.9e-157	72.7
AWZ72760.1\|3318472_3318826_-	putative bacteriophage protein	A0A2H4J629	uncultured_Caudovirales_phage	2.3e-50	80.3
AWZ77594.1\|3318827_3319481_-	putative translation initiation factor IF-2	A0A2H4J8H6	uncultured_Caudovirales_phage	1.0e-59	63.5
AWZ74040.1\|3319534_3319885_-	hypothetical protein	NA	NA	NA	NA
AWZ73360.1\|3320137_3320323_+	hypothetical protein	NA	NA	NA	NA
AWZ73198.1\|3320375_3320717_-	hypothetical protein	A0A2H4J1A5	uncultured_Caudovirales_phage	1.8e-23	46.6
AWZ75230.1\|3320716_3321739_-	putative bacteriophage protein	A0A2H4J1B2	uncultured_Caudovirales_phage	9.2e-100	54.2
AWZ72684.1\|3321741_3321969_-	putative bacteriophage protein	A0A2H4J495	uncultured_Caudovirales_phage	4.6e-20	56.0
AWZ72637.1\|3322044_3322458_-	hypothetical protein	A0A2H4J1B3	uncultured_Caudovirales_phage	8.1e-31	55.9
AWZ74509.1\|3322643_3324647_-	transglycosylase SLT domain protein	A0A2H4J9N7	uncultured_Caudovirales_phage	1.2e-247	63.6
AWZ72874.1\|3324636_3324789_-	putative nTP pyrophosphohydrolase including oxidative damage repair enzyme	A0A2H4J1A2	uncultured_Caudovirales_phage	7.6e-19	88.0
AWZ74049.1\|3324824_3325250_-	putative bacteriophage protein	A0A2H4J2V6	uncultured_Caudovirales_phage	2.6e-40	63.4
AWZ74875.1\|3325253_3325454_-	hypothetical protein	A0A0M5M1K6	Salmonella_phage	1.6e-24	80.3
AWZ73447.1\|3325651_3325894_+\|transposase	transposase family protein	Q6H9S4	Enterobacteria_phage	2.0e-05	37.0
AWZ72761.1\|3325890_3326769_+\|integrase	integrase core domain protein	U5P429	Shigella_phage	2.6e-50	43.5
AWZ75943.1\|3327010_3328156_-	hypothetical protein	A0A2H4J8G4	uncultured_Caudovirales_phage	6.3e-166	76.9
AWZ76296.1\|3328159_3328600_-	putative bacteriophage protein	A0A2H4J1A0	uncultured_Caudovirales_phage	1.6e-40	51.7
AWZ75699.1\|3328694_3329081_-	putative phage protein	A0A2H4J1A4	uncultured_Caudovirales_phage	1.1e-48	78.2
AWZ77584.1\|3329080_3329587_-	hypothetical protein	NA	NA	NA	NA
AWZ76617.1\|3329583_3330003_-	hypothetical protein	A0A0M5M3S2	Salmonella_phage	3.3e-40	60.7
AWZ76030.1\|3329971_3330253_-	hypothetical protein	NA	NA	NA	NA
AWZ72932.1\|3330292_3331228_-	hypothetical protein	A0A2H4J191	uncultured_Caudovirales_phage	2.3e-137	77.1
AWZ73003.1\|3331245_3331740_-	putative bacteriophage protein	A0A2H4JHM9	uncultured_Caudovirales_phage	4.2e-50	62.7
AWZ75567.1\|3331743_3332730_-	hypothetical protein	A0A0M4R5A6	Salmonella_phage	1.7e-79	52.6
AWZ76905.1\|3333601_3335053_-	hypothetical protein	A0A0M4S6U1	Salmonella_phage	3.8e-192	68.8
AWZ76586.1\|3335290_3336691_-\|terminase	phage terminase, large subunit, PBSX family	A0A077KAW0	Edwardsiella_phage	9.4e-188	69.0
AWZ77146.1\|3336641_3337130_-	putative bacteriophage protein	NA	NA	NA	NA
AWZ77373.1\|3338050_3338440_-	putative rz1 lytic protein	A0A192Y6H8	Salmonella_phage	9.4e-21	49.2
AWZ73852.1\|3338436_3338967_-	phage lysozyme family protein	K7PLY1	Enterobacteria_phage	2.7e-79	77.1
AWZ74390.1\|3338969_3339218_-\|lysis	lysis S family protein	NA	NA	NA	NA
AWZ73188.1\|3339235_3339364_+	hypothetical protein	NA	NA	NA	NA
AWZ74835.1\|3339401_3339557_-	hypothetical protein	NA	NA	NA	NA
AWZ75741.1\|3339623_3340406_-	antitermination family protein	F1C595	Cronobacter_phage	7.2e-113	76.8
AWZ77430.1\|3340402_3340879_-	hypothetical protein	A0A286N2Q1	Klebsiella_phage	1.8e-90	100.0
AWZ76129.1\|3340875_3341838_-	toprim domain protein	A0A286N2Q0	Klebsiella_phage	4.8e-183	99.4
AWZ72961.1\|3341839_3343453_-	DEAD/DEAH box helicase family protein	A0A286N2P9	Klebsiella_phage	2.1e-311	95.9
AWZ75977.1\|3344339_3344507_-	hypothetical protein	NA	NA	NA	NA
AWZ72639.1\|3345232_3345547_+	hypothetical protein	A0A286S1T9	Klebsiella_phage	1.0e-49	100.0
AWZ77556.1\|3345539_3345728_+	hypothetical protein	A0A286S1P8	Klebsiella_phage	4.6e-26	100.0
AWZ73065.1\|3346101_3346263_+	hypothetical protein	A0A286S1Q6	Klebsiella_phage	1.5e-20	96.2
3346525:3346539	attL	NA	NA	NA	NA
AWZ74252.1\|3346577_3346700_+	hypothetical protein	A0A286S1P6	Klebsiella_phage	1.3e-16	100.0
AWZ77209.1\|3346696_3347122_+	hypothetical protein	A0A286S1S2	Klebsiella_phage	3.5e-53	77.9
AWZ73751.1\|3347118_3347313_+	putative membrane protein	NA	NA	NA	NA
AWZ75074.1\|3347309_3348137_+	SPFH domain / Band 7 family protein	Q8W654	Enterobacteria_phage	5.5e-111	84.0
AWZ77811.1\|3348241_3348760_+	hypothetical protein	A0A286S1S7	Klebsiella_phage	1.7e-94	98.8
AWZ75429.1\|3348771_3349476_+	phage regulatory Rha family protein	A0A286S260	Klebsiella_phage	4.7e-111	88.2
AWZ75504.1\|3349465_3349690_+	hypothetical protein	A0A286S2B3	Klebsiella_phage	3.1e-29	89.2
AWZ75577.1\|3349743_3349899_+	hypothetical protein	A0A286S2B6	Klebsiella_phage	2.8e-21	100.0
AWZ72966.1\|3349895_3350375_+	hypothetical protein	NA	NA	NA	NA
AWZ73037.1\|3350447_3350594_+	putative bacteriophage protein	A0A1B5FPC2	Escherichia_phage	2.9e-15	70.8
AWZ74456.1\|3350604_3350796_+	hypothetical protein	A0A0M4RTZ2	Salmonella_phage	3.9e-20	73.8
AWZ73785.1\|3350776_3351958_-\|integrase	phage integrase family protein	A0A0M4QX09	Salmonella_phage	5.6e-202	84.2
AWZ74276.1\|3352154_3352703_+\|protease	intracellular protease, PfpI family protein	NA	NA	NA	NA
3352534:3352548	attR	NA	NA	NA	NA
AWZ76453.1\|3352901_3354434_-	HD domain protein	A0A1B1ISR1	uncultured_Mediterranean_phage	1.1e-21	30.0
AWZ72997.1\|3354650_3355412_-	enoyl-(Acyl carrier) reductase family protein	Q06VL0	Trichoplusia_ni_ascovirus	2.4e-20	32.5

DBSCAN-SWA_8

3778850 : 3860066

Salmonella_phage(64.81%)

head,integrase,tRNA,protease,portal,terminase,capsid,lysis,tail,plate

attL 3822641:3822659|attR 3860141:3860159

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWZ75369.1\|3778850_3780572_+	thiol reductant ABC exporter, CydC subunit	A0A2R8FG22	Brazilian_cedratvirus	1.5e-14	34.3
AWZ76856.1\|3780616_3781318_+\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
AWZ73952.1\|3781671_3781890_+	translation initiation factor IF-1	NA	NA	NA	NA
AWZ76963.1\|3782010_3784290_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.6e-165	42.0
AWZ75652.1\|3784320_3784638_-\|protease	ATP-dependent Clp protease adaptor ClpS family protein	A0A1B1IT64	uncultured_Mediterranean_phage	2.0e-13	45.7
AWZ73380.1\|3784963_3785185_+	cold shock domain protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	1.3e-16	61.2
AWZ74629.1\|3785261_3787202_-	macrolide export ATP-binding/permease protein MacB	G9BWD6	Planktothrix_phage	1.9e-37	40.5
AWZ77925.1\|3787198_3788314_-	macrolide-specific efflux protein MacA	A0A140XAI1	Dickeya_phage	1.3e-06	52.7
AWZ75540.1\|3788460_3790119_-	hypothetical protein	NA	NA	NA	NA
AWZ73373.1\|3790311_3790485_+	hypothetical protein	NA	NA	NA	NA
AWZ73187.1\|3790538_3791234_+	aquaporin Z	NA	NA	NA	NA
AWZ77849.1\|3791230_3791344_-	hypothetical protein	NA	NA	NA	NA
AWZ74111.1\|3791349_3792249_+	hypothetical protein	NA	NA	NA	NA
AWZ73514.1\|3792392_3794045_+	hydroxylamine reductase	NA	NA	NA	NA
AWZ73081.1\|3794055_3795024_+	NADH oxidoreductase hcr	NA	NA	NA	NA
AWZ77117.1\|3795235_3795670_-	doxX family protein	NA	NA	NA	NA
AWZ73943.1\|3795821_3797540_+	pyruvate dehydrogenase	NA	NA	NA	NA
AWZ74245.1\|3797578_3798580_+	low specificity L-threonine aldolase	NA	NA	NA	NA
AWZ75297.1\|3798590_3800033_+	NAD dependent epimerase/dehydratase family protein	NA	NA	NA	NA
AWZ75906.1\|3800120_3801134_+	NAD dependent epimerase/dehydratase family protein	NA	NA	NA	NA
AWZ72682.1\|3801130_3801961_-	N-acetylmuramoyl-L-alanine amidase AmiD	A0A1B0UZW5	Roseobacter_phage	4.1e-05	31.6
AWZ73475.1\|3801992_3803132_-	diguanylate cyclase domain protein	NA	NA	NA	NA
AWZ73955.1\|3804009_3804525_+	hypothetical protein	NA	NA	NA	NA
AWZ74059.1\|3804751_3805480_+	ABC transporter family protein	G9BWD6	Planktothrix_phage	1.2e-29	37.1
AWZ76954.1\|3805500_3806232_+	lysine-arginine-ornithine-binding periplasmic family protein	NA	NA	NA	NA
AWZ75780.1\|3806238_3806955_+	amino ABC transporter, permease, 3-TM region, His/Glu/Gln/Arg/opine family domain protein	NA	NA	NA	NA
AWZ73117.1\|3806954_3807623_+	amino ABC transporter, permease, 3-TM region, His/Glu/Gln/Arg/opine family domain protein	NA	NA	NA	NA
AWZ75651.1\|3807806_3808538_+	lysine-arginine-ornithine-binding periplasmic family protein	NA	NA	NA	NA
AWZ75774.1\|3808580_3810053_-	histidine kinase-, DNA gyrase B-, and HSP90-like ATPase family protein	W8CYF6	Bacillus_phage	7.9e-28	31.8
AWZ74549.1\|3810049_3810766_-	response regulator	W8CYM9	Bacillus_phage	2.1e-34	36.9
AWZ77899.1\|3810844_3811972_-	23S rRNA (uracil-5-)-methyltransferase RumB	A0A2K5B251	Erysipelothrix_phage	1.3e-19	25.6
AWZ72869.1\|3812013_3812502_-	inner membrane protein YbjO	NA	NA	NA	NA
AWZ75111.1\|3812559_3813405_-	binding-protein-dependent transport system inner membrane component family protein	NA	NA	NA	NA
AWZ76635.1\|3813401_3814355_-	binding-protein-dependent transport system inner membrane component family protein	NA	NA	NA	NA
AWZ75783.1\|3814365_3815499_-	polyamine ABC transporter, ATP-binding family protein	G3M9Y6	Bacillus_virus	2.2e-30	34.9
AWZ76445.1\|3815662_3816775_-	bacterial extracellular solute-binding family protein	NA	NA	NA	NA
AWZ74786.1\|3817123_3817603_-	bacterial sensory transduction regulator family protein	NA	NA	NA	NA
AWZ77258.1\|3817691_3818594_-	alpha-L-glutamate ligase, RimK family protein	A0A1D7SR78	Cyanophage	2.0e-34	35.3
AWZ77072.1\|3818708_3819038_-	oxygen-insensitive NADPH nitroreductase	NA	NA	NA	NA
AWZ76931.1\|3819273_3819432_-	NADPH-flavin oxidoreductase domain protein	NA	NA	NA	NA
AWZ77179.1\|3819415_3819703_-	hypothetical protein	NA	NA	NA	NA
AWZ72629.1\|3819905_3820169_+	glutaredoxin, GrxA family	A0A2I7SAE2	Vibrio_phage	1.6e-27	73.1
AWZ74598.1\|3820175_3820559_-	inner membrane protein YbjM	NA	NA	NA	NA
AWZ76659.1\|3820825_3822511_+	aspT/YidE/YbjL antiporter duplication domain protein	NA	NA	NA	NA
AWZ75516.1\|3822502_3822625_-	hypothetical protein	NA	NA	NA	NA
3822641:3822659	attL	NA	NA	NA	NA
AWZ72908.1\|3822730_3822886_-	ogr/Delta-like zinc finger family protein	E5G6Q4	Salmonella_phage	3.8e-10	65.3
AWZ72831.1\|3823040_3824141_-	phage late control D family protein	A0A1S6KZZ5	Salmonella_phage	4.9e-176	87.4
AWZ72937.1\|3824137_3824623_-	phage P2 GpU family protein	E5G6Q2	Salmonella_phage	7.2e-63	75.6
AWZ76415.1\|3824619_3827247_-\|tail	phage tail tape measure protein, TP901 family, core region	E5FFG5	Burkholderia_phage	5.6e-117	42.0
AWZ75125.1\|3827239_3827359_-	phage P2 GpE family protein	E5G6Q0	Salmonella_phage	2.2e-13	87.2
AWZ73013.1\|3827373_3827673_-	mu-like prophage FluMu gp41 family protein	E5G6P9	Salmonella_phage	3.7e-33	79.0
AWZ74347.1\|3827725_3828241_-\|tail	phage major tail tube protein	E5G6P8	Salmonella_phage	1.3e-81	85.4
AWZ76049.1\|3828250_3829423_-\|tail	phage tail sheath family protein	A0A1S6KZY7	Salmonella_phage	1.9e-210	93.3
AWZ72612.1\|3829561_3830638_-\|tail	phage tail-collar fiber family protein	Q37842	Escherichia_phage	1.2e-25	44.8
AWZ75056.1\|3830667_3830871_-	hypothetical protein	NA	NA	NA	NA
AWZ73253.1\|3830867_3831599_-	concanavalin A-like lectin/glucanases superfamily protein	NA	NA	NA	NA
AWZ76151.1\|3831602_3834554_-	hypothetical protein	A0A2H4N7A3	Pectobacterium_phage	1.2e-06	50.9
AWZ77235.1\|3834555_3835155_-\|tail	phage tail protein I	A0A1S6L000	Salmonella_phage	1.3e-58	60.5
AWZ74160.1\|3835147_3836056_-\|plate	baseplate J-like family protein	E5G6N8	Salmonella_phage	7.6e-106	66.9
AWZ76733.1\|3836042_3836405_-	lysozyme family protein	A0A1S6KZZ4	Salmonella_phage	5.8e-49	84.7
AWZ72710.1\|3836401_3836974_-\|plate	phage baseplate assembly V family protein	E5G6N6	Salmonella_phage	4.7e-77	72.3
AWZ73641.1\|3837020_3837761_+	hypothetical protein	NA	NA	NA	NA
AWZ72754.1\|3837757_3838204_-	phage virion morphogenesis protein	A0A1S6L001	Salmonella_phage	2.2e-50	71.2
AWZ72723.1\|3838196_3838628_-\|tail	P2 phage tail completion R family protein	A0A1S6KZY0	Salmonella_phage	9.9e-64	82.5
AWZ72933.1\|3838590_3838737_-	hypothetical protein	A0A1S6KZX6	Salmonella_phage	6.0e-13	76.1
AWZ74974.1\|3838723_3839152_-\|lysis	phage lysis regulatory, LysB family protein	A0A1S6KZX8	Salmonella_phage	9.6e-51	77.9
AWZ77092.1\|3839148_3839532_-	putative membrane protein	A0A1S6KZZ2	Salmonella_phage	2.1e-17	42.0
AWZ74117.1\|3839536_3840046_-	phage lysozyme family protein	E5G6N1	Salmonella_phage	2.1e-81	83.4
AWZ75415.1\|3840026_3840149_-	putative secretory protein	E5G6N0	Salmonella_phage	2.9e-13	85.0
AWZ76402.1\|3840245_3840449_-	phage Tail Protein X family protein	A0A1S6KZY4	Salmonella_phage	1.3e-29	88.1
AWZ76162.1\|3840448_3840913_-\|head	phage head completion family protein	A0A1S6KZW8	Salmonella_phage	8.4e-77	89.0
AWZ76205.1\|3841008_3841659_-\|terminase	phage small terminase subunit	E5G6M7	Salmonella_phage	8.7e-112	96.3
AWZ77935.1\|3841662_3842721_-\|capsid	phage major capsid protein, P2 family	E5G6M6	Salmonella_phage	1.1e-180	93.1
AWZ75770.1\|3842737_3843571_-\|capsid	phage capsid scaffolding (GPO) serine peptidase family protein	A0A1S6KZW9	Salmonella_phage	6.3e-123	88.8
AWZ75550.1\|3843713_3845480_+\|terminase	terminase-like family protein	A0A1S6KZW3	Salmonella_phage	0.0e+00	99.0
AWZ77205.1\|3845479_3846505_+\|portal	phage portal protein, PBSX family	A0A1S6KZW5	Salmonella_phage	7.6e-171	86.7
AWZ74889.1\|3846566_3848309_-	AIPR family protein	NA	NA	NA	NA
AWZ75920.1\|3848584_3848773_-	putative fels-2 prophage protein	NA	NA	NA	NA
AWZ76781.1\|3849376_3849610_-	dinI-like family protein	E5G6M1	Salmonella_phage	4.7e-36	100.0
AWZ73156.1\|3849620_3849809_-	putative levan regulatory protein	E5G6M0	Salmonella_phage	5.5e-27	98.4
AWZ73252.1\|3849962_3852377_-	bacteriophage replication protein A	E5G6L9	Salmonella_phage	0.0e+00	97.5
AWZ75455.1\|3852373_3853231_-	DNA adenine methylase family protein	E5G6L8	Salmonella_phage	2.0e-156	95.4
AWZ75168.1\|3853227_3853455_-	phage/conjugal plasmid C-4 type zinc finger, TraR family protein	E5G6L7	Salmonella_phage	6.0e-36	98.7
AWZ77286.1\|3853454_3853688_-	hypothetical protein	E5G6L6	Salmonella_phage	4.1e-32	96.1
AWZ74410.1\|3853755_3854097_-	putative fels-2 prophage protein	E5G6L5	Salmonella_phage	4.6e-56	99.1
AWZ73869.1\|3854060_3854261_-	protein fil	E5G6L4	Salmonella_phage	1.6e-32	97.0
AWZ76766.1\|3854268_3854778_-	phage regulatory CII family protein	E5G6L3	Salmonella_phage	5.8e-87	98.8
AWZ75093.1\|3854804_3854957_+	hypothetical protein	NA	NA	NA	NA
AWZ73543.1\|3855120_3856056_+	bacteriophage CI repressor helix-turn-helix domain protein	A0A1S6KZZ7	Salmonella_phage	1.8e-30	39.9
AWZ75502.1\|3856067_3857012_+	hypothetical protein	NA	NA	NA	NA
AWZ73508.1\|3857110_3858598_-	reverse transcriptase family protein	A0A0U4J920	Pseudomonas_phage	1.2e-31	35.5
AWZ77391.1\|3859085_3860066_+\|integrase	phage integrase family protein	A0A218M4I3	Erwinia_phage	1.4e-97	57.2
3860141:3860159	attR	NA	NA	NA	NA

DBSCAN-SWA_9

4302102 : 4350451

Cronobacter_phage(27.08%)

integrase,coat,tRNA,terminase,lysis

attL 4298389:4298435|attR 4347523:4347569

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4298389:4298435	attL	NA	NA	NA	NA
AWZ77473.1\|4302102_4305009_-	hypothetical protein	A0A286S1P0	Klebsiella_phage	1.6e-19	50.0
AWZ73844.1\|4305176_4307654_-	hypothetical protein	F1C5A7	Cronobacter_phage	2.7e-198	45.6
AWZ76827.1\|4307640_4308036_-	nlpC/P60 family protein	F1C5F2	Cronobacter_phage	8.0e-36	54.0
AWZ73181.1\|4308032_4308503_-	hypothetical protein	R9TPR6	Aeromonas_phage	2.5e-28	41.0
AWZ74360.1\|4308502_4308979_-	hypothetical protein	A0A2P1MXB5	Escherichia_phage	3.0e-37	49.7
AWZ77056.1\|4309021_4312468_-	tape measure domain protein	Q5G8W8	Enterobacteria_phage	1.4e-163	48.6
AWZ75406.1\|4312560_4312818_-	hypothetical protein	NA	NA	NA	NA
AWZ74247.1\|4313191_4313977_-	BRO family, N-terminal domain protein	A0A2L1IV39	Escherichia_phage	1.9e-84	59.7
AWZ77416.1\|4314042_4314756_-	P22AR C-terminal domain protein	H6WRU8	Salmonella_phage	3.9e-49	50.2
AWZ76409.1\|4314745_4314916_-	arc-like DNA binding domain protein	I6R9A8	Salmonella_phage	6.1e-17	87.0
AWZ77331.1\|4315177_4315375_+	hypothetical protein	NA	NA	NA	NA
AWZ76202.1\|4315391_4315862_-	hypothetical protein	NA	NA	NA	NA
AWZ75345.1\|4316155_4316353_-	hypothetical protein	K7PM89	Enterobacteria_phage	6.4e-10	68.2
AWZ73054.1\|4316412_4317168_-	kilA-N domain protein	K7PGT4	Enterobacteria_phage	2.4e-60	51.0
AWZ77706.1\|4317343_4318021_-	hypothetical protein	F1C5E8	Cronobacter_phage	4.8e-73	57.9
AWZ77197.1\|4318073_4318826_-	bacterial Ig-like domain family protein	G0ZNE6	Cronobacter_phage	5.8e-43	42.1
AWZ75690.1\|4318894_4319128_-	hypothetical protein	G0ZNE4	Cronobacter_phage	4.3e-13	47.4
AWZ73038.1\|4319283_4319709_-	hypothetical protein	R9TPP7	Aeromonas_phage	5.1e-28	47.9
AWZ77464.1\|4319711_4320074_-	hypothetical protein	A0A173GCE0	Salmonella_phage	1.8e-18	45.0
AWZ77857.1\|4320246_4320627_-	hypothetical protein	F1C5E2	Cronobacter_phage	5.3e-29	55.3
AWZ77889.1\|4320629_4320869_-	hypothetical protein	NA	NA	NA	NA
AWZ75243.1\|4320879_4321974_-\|coat	putative phage coat protein	F1C5E1	Cronobacter_phage	1.7e-123	62.8
AWZ72952.1\|4321985_4322414_-	hypothetical protein	F1C5E0	Cronobacter_phage	1.6e-42	60.8
AWZ74619.1\|4322417_4323803_-	hypothetical protein	F1C5D9	Cronobacter_phage	2.3e-154	60.0
AWZ73687.1\|4323875_4324280_-	hypothetical protein	NA	NA	NA	NA
AWZ75695.1\|4324393_4325293_-	phage Mu F like family protein	F1C5D8	Cronobacter_phage	8.0e-116	69.7
AWZ74112.1\|4325372_4326794_-	hypothetical protein	F1C5D7	Cronobacter_phage	9.6e-148	57.1
AWZ74145.1\|4326806_4328279_-\|terminase	putative terminase large subunit	A0A1W6JNY3	Morganella_phage	1.3e-248	82.5
AWZ75389.1\|4328278_4328881_-	putative dNA repair protein RecN	G8C7P2	Escherichia_phage	5.4e-76	80.9
AWZ74494.1\|4329097_4329259_+	hypothetical protein	NA	NA	NA	NA
AWZ72872.1\|4329449_4329581_+	hypothetical protein	NA	NA	NA	NA
AWZ74888.1\|4329686_4330151_-\|lysis	bacteriophage lysis family protein	Q76H63	Enterobacteria_phage	2.4e-55	73.2
AWZ77070.1\|4330147_4330678_-	phage lysozyme family protein	G9L6J6	Escherichia_phage	6.0e-79	78.5
AWZ75304.1\|4330680_4330929_-\|lysis	lysis S family protein	NA	NA	NA	NA
AWZ73737.1\|4331838_4332528_-	phage antitermination Q family protein	I6PDF8	Cronobacter_phage	1.4e-56	54.5
AWZ77159.1\|4332524_4332704_-	AP2 domain protein	NA	NA	NA	NA
AWZ76667.1\|4333181_4333817_-	bacteriophage Lambda NinG family protein	M9NYX8	Enterobacteria_phage	2.7e-81	77.9
AWZ74357.1\|4333809_4333980_-	putative NinE-like protein from lambdoid prophage DLP12	G8C7V4	Escherichia_phage	1.3e-14	73.2
AWZ75727.1\|4333979_4334435_-	putative phage protein	K7P7B8	Enterobacteria_phage	8.0e-56	69.5
AWZ73712.1\|4334935_4335583_-	hypothetical protein	A5LH60	Enterobacteria_phage	4.5e-12	32.6
AWZ73504.1\|4335755_4336598_-	ead/Ea22-like family protein	A0A2H4FRZ0	Salmonella_phage	1.8e-29	60.8
AWZ73238.1\|4336594_4336708_-	hypothetical protein	NA	NA	NA	NA
AWZ77831.1\|4336704_4337211_-	hypothetical protein	A0A0A6Z565	Enterobacter_phage	3.0e-27	59.6
AWZ73435.1\|4337207_4337501_-	putative protein ren	O48423	Enterobacteria_phage	3.3e-26	65.6
AWZ75054.1\|4337500_4338931_-	replicative DNA helicase	Q9MCT4	Escherichia_phage	2.6e-185	66.7
AWZ75486.1\|4338920_4339772_-	putative gene O protein	F1C5C3	Cronobacter_phage	5.3e-85	56.3
AWZ73742.1\|4339812_4339959_-	hypothetical protein	NA	NA	NA	NA
AWZ77347.1\|4340044_4340266_-	bacteriophage CII family protein	G8EYH8	Enterobacteria_phage	6.9e-05	41.7
AWZ76843.1\|4341096_4341357_+	peptidase S24-like family protein	A0A2I6PIE7	Escherichia_phage	2.5e-30	68.2
AWZ74672.1\|4341761_4341923_+	hypothetical protein	B5WZV1	Pseudomonas_phage	2.4e-07	56.9
AWZ76483.1\|4341940_4342078_-	hypothetical protein	NA	NA	NA	NA
AWZ74057.1\|4342058_4342217_+	hypothetical protein	NA	NA	NA	NA
AWZ72800.1\|4342305_4342590_+	hypothetical protein	G8C7T1	Escherichia_phage	8.0e-30	62.8
AWZ73048.1\|4342605_4343451_+	phage recombination protein Bet	A0A1I9KF88	Aeromonas_phage	6.9e-69	59.2
AWZ73288.1\|4343447_4344128_+	exonuclease	A0A0M3ULE0	Salmonella_phage	7.9e-124	93.4
AWZ72877.1\|4344279_4344936_+	MT-A70 family protein	G8C7S6	Escherichia_phage	2.7e-113	87.5
AWZ75178.1\|4344932_4345700_+	hypothetical protein	D5LH17	Escherichia_phage	1.7e-66	53.4
AWZ75530.1\|4345916_4346132_+	phage/conjugal plasmid C-4 type zinc finger, TraR family protein	A0A0K2FI84	Escherichia_phage	4.0e-13	52.9
AWZ73446.1\|4346345_4347509_+\|integrase	phage integrase family protein	G8C7S0	Escherichia_phage	3.3e-202	87.3
AWZ73486.1\|4347939_4348806_+	bifunctional protein FolD	A0A249XZQ2	Enterococcus_phage	1.3e-30	34.8
4347523:4347569	attR	NA	NA	NA	NA
AWZ75781.1\|4348807_4349020_+	hypothetical protein	NA	NA	NA	NA
AWZ74200.1\|4349065_4350451_-\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	3.5e-46	35.4

DBSCAN-SWA_10

4560006 : 4571660

Enterobacteria_phage(70.0%)

capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWZ75194.1\|4560006_4561110_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	4.8e-62	40.5
AWZ75231.1\|4561120_4562374_+	gamma-glutamyl phosphate reductase	A0A1X9I5D4	Streptococcus_phage	8.9e-89	44.9
AWZ73790.1\|4562726_4563917_+	hypothetical protein	Q7M297	Enterobacteria_phage	6.4e-145	62.7
AWZ73413.1\|4563904_4564855_+	cobQ/CobB/MinD/ParA nucleotide binding domain protein	A0A1X9IGI7	Lactococcus_phage	1.2e-13	27.1
AWZ75186.1\|4564854_4565280_+	hypothetical protein	NA	NA	NA	NA
AWZ74952.1\|4565626_4565776_-	hypothetical protein	NA	NA	NA	NA
AWZ76777.1\|4565848_4566415_-	polarity suppression protein	Q7M2A1	Enterobacteria_phage	1.5e-59	64.3
AWZ74261.1\|4566432_4566678_-	ogr/Delta-like zinc finger family protein	Q7M294	Enterobacteria_phage	1.9e-19	58.0
AWZ76764.1\|4566674_4567412_-\|capsid	putative glyco3, capsid size determination protein Sid	Q7M2A2	Enterobacteria_phage	9.0e-73	60.7
AWZ74883.1\|4567711_4567849_-	hypothetical protein	NA	NA	NA	NA
AWZ74860.1\|4567953_4568220_+	prophage CP4-57 regulatory family protein	Q7M299	Enterobacteria_phage	2.6e-30	71.6
AWZ74415.1\|4568579_4568774_+	putative phage immunity repressor protein	Q7M2A7	Enterobacteria_phage	3.2e-22	85.5
AWZ73132.1\|4568818_4568998_+	hypothetical protein	NA	NA	NA	NA
AWZ77834.1\|4568994_4569315_+	putative dNA replication protein	NA	NA	NA	NA
AWZ74078.1\|4569326_4571660_+	putative P4-specific DNA primase	Q7M2A8	Enterobacteria_phage	0.0e+00	82.2

DBSCAN-SWA_11

5038049 : 5045731

Enterobacteria_phage(85.71%)

integrase,capsid,transposase

attL 5030972:5030986|attR 5042806:5042820

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
5030972:5030986	attL	NA	NA	NA	NA
AWZ77426.1\|5038049_5038529_-\|integrase	integrase core domain protein	A0A0N9SIX5	Staphylococcus_phage	1.6e-06	29.7
AWZ74622.1\|5038661_5038817_+	hypothetical protein	NA	NA	NA	NA
AWZ72762.1\|5038894_5039161_-\|transposase	transposase family protein	NA	NA	NA	NA
AWZ72703.1\|5039757_5039874_-	hypothetical protein	NA	NA	NA	NA
AWZ74870.1\|5039906_5042240_-	poxvirus D5 protein-like family protein	Q7M2A8	Enterobacteria_phage	0.0e+00	83.9
AWZ73854.1\|5042254_5042575_-	DNA replication protein, phage-associated	NA	NA	NA	NA
AWZ74312.1\|5042571_5042799_-	hypothetical protein	NA	NA	NA	NA
AWZ76682.1\|5042795_5042990_-	putative phage immunity repressor protein	Q7M2A7	Enterobacteria_phage	7.2e-22	85.5
5042806:5042820	attR	NA	NA	NA	NA
AWZ76539.1\|5043340_5043607_-	prophage CP4-57 regulatory family protein	Q7M299	Enterobacteria_phage	2.0e-30	71.6
AWZ77409.1\|5044167_5044905_+\|capsid	putative glyco3, capsid size determination protein Sid	Q7M2A2	Enterobacteria_phage	1.1e-70	59.4
AWZ74558.1\|5044901_5045147_+	ogr/Delta-like zinc finger family protein	Q7M294	Enterobacteria_phage	5.5e-19	56.8
AWZ73154.1\|5045164_5045731_+	polarity suppression protein	Q7M2A1	Enterobacteria_phage	9.7e-59	63.8

DBSCAN-SWA_12

5240870 : 5245957

Escherichia_phage(33.33%)

integrase

attL 5240117:5240131|attR 5248508:5248522

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
5240117:5240131	attL	NA	NA	NA	NA
AWZ76436.1\|5240870_5241554_+	integral membrane, YjbE family protein	W8EBD0	Pseudomonas_phage	5.1e-30	42.2
AWZ76561.1\|5241510_5241624_-	hypothetical protein	NA	NA	NA	NA
AWZ77694.1\|5241699_5242617_+	curved DNA-binding protein	A0A1V0SCV5	Indivirus	2.8e-07	42.2
AWZ75555.1\|5242616_5242922_+	chaperone modulatory protein CbpM	NA	NA	NA	NA
AWZ76303.1\|5243090_5243612_+	helix-turn-helix domain protein	A0A1B1P776	Bacillus_phage	1.3e-14	33.5
AWZ77342.1\|5243668_5244454_+\|integrase	integrase core domain protein	A0A2I6AZV9	Macacine_betaherpesvirus	3.3e-73	67.7
AWZ75258.1\|5244619_5244991_-	plasmid stability family protein	A0A222YWJ6	Escherichia_phage	2.8e-22	53.7
AWZ73776.1\|5245000_5245957_-	plasmid segregation protein ParM	A0A222YXF2	Escherichia_phage	1.3e-143	78.0
5248508:5248522	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. CP030343

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

528 : 47292

Escherichia_phage(34.62%)

integrase,transposase

attL 33410:33424|attR 52106:52120

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWZ78063.1\|528_876_-\|transposase	transposase IS66 family protein	A0A0P0ZEB3	Stx2-converting_phage	2.6e-62	98.3
AWZ78064.1\|943_1462_-\|transposase	transposase IS66 family protein	A0A0P0ZEB3	Stx2-converting_phage	1.7e-86	90.1
AWZ78065.1\|1506_2481_-\|transposase	transposase IS66 family protein	A0A0P0ZBS5	Stx2-converting_phage	2.7e-149	91.8
AWZ78066.1\|2530_2878_-\|transposase	putative transposase	A0A0P0ZDM8	Stx2-converting_phage	2.0e-59	95.7
AWZ78067.1\|4440_5553_-	radical SAM superfamily protein	S5WIP3	Leptospira_phage	1.5e-47	33.8
AWZ78068.1\|5545_6934_-	4Fe-4S single cluster domain protein	S5VT21	Leptospira_phage	6.3e-51	29.0
AWZ78069.1\|7165_7669_-\|transposase	putative transposase	Q71TF0	Escherichia_phage	1.5e-95	100.0
AWZ78070.1\|8141_8801_+	chloramphenicol acetyltransferase	G3CFL0	Escherichia_phage	8.4e-131	100.0
AWZ78071.1\|9001_9379_-	acetyltransferase family protein	NA	NA	NA	NA
AWZ78072.1\|9445_12412_-\|transposase	tn3 transposase DDE domain protein	A0A1B0V7H9	Salmonella_phage	0.0e+00	73.6
AWZ78073.1\|12414_12975_-	resolvase, N terminal domain protein	A0A1B0V7I5	Salmonella_phage	4.0e-49	86.2
AWZ78074.1\|13100_13301_-	hypothetical protein	NA	NA	NA	NA
AWZ78075.1\|13653_14667_-\|integrase	integron integrase family protein	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
AWZ78076.1\|15728_16508_+	hypothetical protein	NA	NA	NA	NA
AWZ78077.1\|17012_17852_+	dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
AWZ78078.1\|18338_19544_+	chromate transporter, chromate ion transporter family protein	NA	NA	NA	NA
AWZ78079.1\|19554_19860_+	transcriptional regulator PadR-like family protein	NA	NA	NA	NA
AWZ78080.1\|20086_20851_+	DDE domain protein	A0A077SL39	Escherichia_phage	4.3e-86	65.7
AWZ78081.1\|21343_21928_-	erythromycin resistance repressor protein	NA	NA	NA	NA
AWZ78082.1\|21927_23166_-	major Facilitator Superfamily protein	NA	NA	NA	NA
AWZ78083.1\|23162_24068_-	phosphotransferase enzyme family protein	NA	NA	NA	NA
AWZ78084.1\|24189_24894_-\|integrase	integrase core domain protein	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AWZ78085.1\|25044_25860_+	phosphotransferase enzyme family protein	A0A193DTG4	Autographa_californica_nuclear_polyhedrosis_virus	6.1e-163	100.0
AWZ78086.1\|26049_26655_-\|transposase	transposase IS66 family protein	A0A077SL39	Escherichia_phage	6.4e-117	99.5
AWZ78087.1\|26765_28031_-\|transposase	tn3 transposase DDE domain protein	A0A1B0V7H9	Salmonella_phage	5.4e-142	67.1
AWZ78088.1\|28021_28726_+	DDE domain protein	A0A077SL39	Escherichia_phage	1.2e-138	99.6
AWZ78089.1\|28919_29240_-	hypothetical protein	Q38213	Escherichia_phage	3.2e-27	52.9
AWZ78090.1\|29848_30409_+	ABC transporter family protein	G9BWD6	Planktothrix_phage	1.6e-13	38.4
AWZ78091.1\|30405_31269_+	phosphate/phosphite/phosphonate ABC transporter, periplasmic binding family protein	NA	NA	NA	NA
AWZ78092.1\|31277_32105_+	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
AWZ78093.1\|32113_33124_+	phosphonate dehydrogenase	A0A1V0SBV6	Catovirus	1.4e-15	25.1
AWZ78094.1\|33117_33987_+	bacterial regulatory, arsR family protein	NA	NA	NA	NA
33410:33424	attL	NA	NA	NA	NA
AWZ78095.1\|34094_34730_+	hypothetical protein	Q38213	Escherichia_phage	1.2e-33	52.8
AWZ78096.1\|35195_36176_-\|transposase	transposase DDE domain protein	Q38213	Escherichia_phage	8.9e-185	99.1
AWZ78097.1\|36434_36938_-\|transposase	putative transposase	U5P0U6	Shigella_phage	1.8e-88	92.2
AWZ78098.1\|37067_37190_+	putative allantoinase domain protein	NA	NA	NA	NA
AWZ78099.1\|38322_38460_-	hypothetical protein	NA	NA	NA	NA
AWZ78100.1\|38478_39048_+	hsp20/alpha crystallin family protein	NA	NA	NA	NA
AWZ78101.1\|39162_41958_+	istB-like ATP binding family protein	K4FB40	Cronobacter_phage	5.2e-129	41.0
AWZ78102.1\|41954_42155_+	hypothetical protein	NA	NA	NA	NA
AWZ78103.1\|42653_43142_+	phosphate-starvation-inducible E family protein	NA	NA	NA	NA
AWZ78104.1\|43128_44091_+	peptidase M48 family protein	NA	NA	NA	NA
AWZ78105.1\|44405_44711_+\|transposase	putative transposase	NA	NA	NA	NA
AWZ78106.1\|44821_45433_+\|integrase	integrase core domain protein	A0A2I6AZV9	Macacine_betaherpesvirus	4.0e-42	45.9
AWZ78107.1\|45641_45773_-	hypothetical protein	NA	NA	NA	NA
AWZ78108.1\|45933_47292_-\|integrase	integrase core domain protein	NA	NA	NA	NA
52106:52120	attR	NA	NA	NA	NA

DBSCAN-SWA_2

61653 : 111322

Bacillus_phage(16.0%)

integrase,holin,transposase

attL 70127:70141|attR 106791:106805

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWZ78129.1\|61653_62469_+\|transposase	transposase family protein	A9YX10	Burkholderia_phage	1.7e-11	25.9
AWZ78130.1\|62770_63274_+\|transposase	transposase family protein	NA	NA	NA	NA
AWZ78131.1\|63334_63514_+	putative plasmid stabilization protein	NA	NA	NA	NA
AWZ78132.1\|63745_64180_-	putative copper-binding protein PcoE	NA	NA	NA	NA
AWZ78133.1\|64396_65797_-	heavy metal sensor kinase family protein	W8CYF6	Bacillus_phage	4.1e-18	26.3
AWZ78134.1\|65793_66474_-	response regulator	W8CYM9	Bacillus_phage	8.7e-30	34.4
AWZ78135.1\|66528_67458_-	copper resistance D family protein	NA	NA	NA	NA
AWZ78136.1\|67462_67843_-	copper resistance protein C	NA	NA	NA	NA
AWZ78137.1\|67882_68773_-	copper resistance protein B	NA	NA	NA	NA
AWZ78138.1\|68778_70596_-	copper resistance protein A	NA	NA	NA	NA
70127:70141	attL	NA	NA	NA	NA
AWZ78139.1\|70829_71279_+	putative copper resistant protein PcoE	NA	NA	NA	NA
AWZ78140.1\|71567_72305_+	peptidase M23 family protein	A0A2H4JAF5	uncultured_Caudovirales_phage	1.2e-11	32.5
AWZ78141.1\|72338_72536_-	hypothetical protein	NA	NA	NA	NA
AWZ78142.1\|72576_74937_-	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	7.3e-84	35.8
AWZ78143.1\|75150_75591_-	hypothetical protein	NA	NA	NA	NA
AWZ78144.1\|75677_78824_-	cation efflux system protein CusA	S5VTK5	Leptospira_phage	4.0e-61	22.5
AWZ78145.1\|78834_79965_-	cation efflux system protein CusB	NA	NA	NA	NA
AWZ78146.1\|80240_80594_-	cation efflux system protein CusF	NA	NA	NA	NA
AWZ78147.1\|80622_82008_-	efflux transporter, outer membrane factor (OMF) lipo, NodT family protein	NA	NA	NA	NA
AWZ78148.1\|82197_82878_+	transcriptional regulatory protein CusR	W8CYM9	Bacillus_phage	2.1e-31	35.6
AWZ78149.1\|82870_84346_+	heavy metal sensor kinase family protein	W8CYF6	Bacillus_phage	1.0e-27	30.1
AWZ78150.1\|84596_85028_+	silver-binding protein SilE	NA	NA	NA	NA
AWZ78151.1\|85323_85728_-\|transposase	transposase family protein	NA	NA	NA	NA
AWZ78152.1\|85881_86277_-\|transposase	putative transposase	Q71TF0	Escherichia_phage	5.7e-66	92.4
AWZ78153.1\|86429_86825_+\|transposase	transposase family protein	Q76S41	Shigella_phage	1.4e-43	75.4
AWZ78154.1\|86782_87664_+\|integrase	integrase core domain protein	Q9ZXG3	Shigella_phage	1.2e-100	63.2
AWZ78155.1\|88048_88552_+\|transposase	putative transposase	U5P0U6	Shigella_phage	1.6e-84	93.2
AWZ78156.1\|88703_90701_+\|holin	transporter, betaine/carnitine/choline transporter family protein	A0A2I7QNT1	Vibrio_phage	9.7e-21	25.9
AWZ78157.1\|90763_92041_+	hypothetical protein	NA	NA	NA	NA
AWZ78158.1\|93023_93860_-	EAL domain protein	NA	NA	NA	NA
AWZ78159.1\|96009_96150_-\|transposase	transposase family protein	Q9MCT5	Escherichia_phage	1.3e-17	100.0
AWZ78160.1\|96322_96934_-\|transposase	transposase DDE domain protein	Q9MCT5	Escherichia_phage	3.5e-99	99.4
AWZ78161.1\|97336_98284_-	diguanylate cyclase domain protein	G3MA91	Bacillus_virus	1.8e-12	30.6
AWZ78162.1\|99427_100168_+\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	5.4e-25	58.6
AWZ78163.1\|100884_101583_-	repFIB replication protein A	J9Q7H0	Salmonella_phage	5.2e-54	55.7
AWZ78164.1\|102646_103813_+	cobQ/CobB/MinD/ParA nucleotide binding domain protein	A0A2I6B2X3	Macacine_betaherpesvirus	1.4e-224	97.7
AWZ78165.1\|103812_104784_+	protein SopB	I3WF22	Macacine_betaherpesvirus	4.1e-150	86.6
AWZ78166.1\|104783_105746_+	hypothetical protein	NA	NA	NA	NA
AWZ78167.1\|106280_106565_+	helix-turn-helix domain protein	A0A1W6JP07	Morganella_phage	1.0e-40	86.8
AWZ78168.1\|106561_107419_+\|transposase	transposase, IS605 OrfB family	A0A1B0VCD8	Salmonella_phage	1.0e-128	80.9
106791:106805	attR	NA	NA	NA	NA
AWZ78169.1\|107441_107597_-	antitoxin, type II toxin-antitoxin system family protein	NA	NA	NA	NA
AWZ78170.1\|107735_109007_-	impB/mucB/samB family protein	F1C5A5	Cronobacter_phage	5.6e-155	63.7
AWZ78171.1\|109006_109432_-	peptidase S24-like family protein	A0A1W6JNS2	Morganella_phage	8.3e-31	49.6
AWZ78172.1\|109834_111322_+	reverse transcriptase family protein	A0A0U4J920	Pseudomonas_phage	1.2e-31	35.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP030342

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP030341

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. CP030343

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection