CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP030099	Roseovarius sp. AK1035 chromosome, complete genome	1 crisprs	csa3,DEDDh,WYL	0	0	3	1
CP030100	Roseovarius sp. AK1035 plasmid unnamed, complete sequence	0 crisprs	csa3	0	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP030099_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP030099_1

531760-531914

Orphan

Consensus_repeat	Method
GTAGGGTGCGCAGTCATTGCGCACC	CRISPRCasFinder

2 spacers

The CRISPR arrays of CP030099_1

>merge|CP030099|1|531760-531914|CRISPRCasFinder
GTAGGGTGCGCAGTCATTGCGCACCTGCGGCCTTCCCCCTCTCGCCCGAGGTCTGGCTACACGAACGCCTCATCCTCCAGCGCCCGTAGGGTGCGCATTCATTGCGCACCAACCAACCACTCCCCAATCAACCCGGTGCGCAATGAAGGCGCACC

>CP030099|1|1|531760-531914|CRISPRCasFinder
GTAGGGTGCGCAGTCATTGCGCACC	TGCGGCCTTCCCCCTCTCGCCCGAGGTCTGGCTACACGAACGCCTCATCCTCCAGCGCCC
GTAGGGTGCGCATTCATTGCGCACC	AACCAACCACTCCCCAATCA
ACCCGGTGCGCAATGAAGGCGCACC

Protein	Signature genes	Signature genes Name	Protein_function
CP030099.1\|AWZ19237.1\|519360_519744_-\|Response-regulator-receiver-protein-in-cluster-with-DNA-polymerase-III-epsilon-subunit	unknown	unknown	gnl\|CDD\|381116
CP030099.1\|AWZ19253.1\|537560_538373_-\|Ser/Thr-protein-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|379099
CP030099.1\|AWZ19243.1\|525049_526990_-\|Acetyl-coenzyme-A-synthetase	unknown	unknown	gnl\|CDD\|234677
CP030099.1\|AWZ19256.1\|539429_540467_-\|Hypothetical-protein	unknown	unknown	gnl\|CDD\|320691
CP030099.1\|AWZ19249.1\|532486_533227_-\|Hypothetical-protein	unknown	unknown	gnl\|CDD\|234640
CP030099.1\|AWZ19239.1\|520284_522123_-\|putative-signal-transduction-protein	unknown	unknown	gnl\|CDD\|225457
CP030099.1\|AWZ19240.1\|522241_524005_-\|Acetate-permease-ActP-(cation/acetate-symporter)	unknown	unknown	gnl\|CDD\|274698
CP030099.1\|AWZ19248.1\|532020_532392_+\|Putative-exported-protein	unknown	unknown	gnl\|CDD\|226074
CP030099.1\|AWZ19254.1\|538427_538772_-\|Transthyretin-family-protein	unknown	unknown	gnl\|CDD\|376352
CP030099.1\|AWZ19255.1\|538878_539391_+\|Uricase-(urate-oxidase)	unknown	unknown	gnl\|CDD\|225736
CP030099.1\|AWZ19252.1\|535635_537417_-\|TrkA-domain-protein	unknown	unknown	gnl\|CDD\|238535
CP030099.1\|AWZ19251.1\|535035_535632_+\|Protein-BchJ,-involved-in-reduction-of-C-8-vinyl-of-divinyl-protochlorophyllide	unknown	unknown	gnl\|CDD\|131074
CP030099.1\|AWZ19246.1\|528218_529436_-\|Putative-metal-chaperone,-involved-in-Zn-homeostasis	unknown	unknown	gnl\|CDD\|223597
CP030099.1\|AWZ19257.1\|540723_541536_+\|N-formylglutamate-deformylase	unknown	unknown	gnl\|CDD\|131072
CP030099.1\|AWZ19238.1\|519774_520281_-\|Hypothetical-protein	unknown	unknown	unknown
CP030099.1\|AWZ19241.1\|524020_524215_-\|Hypothetical-protein	unknown	unknown	gnl\|CDD\|132686
CP030099.1\|AWZ19242.1\|524349_525036_-\|Adenylate-kinase	unknown	unknown	gnl\|CDD\|234711
CP030099.1\|AWZ19250.1\|533381_535043_+\|Mg-protoporphyrin-IX-monomethyl-ester-oxidative-cyclase-(anaerobic)	unknown	unknown	gnl\|CDD\|131081
CP030099.1\|AWZ19245.1\|527588_528215_-\|Hypothetical-protein	unknown	unknown	gnl\|CDD\|378067
CP030099.1\|AWZ19244.1\|527308_527599_-\|Hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP030099.1\|AWZ19237.1\|519360_519744_-\|Response-regulator-receiver-protein-in-cluster-with-DNA-polymerase-III-epsilon-subunit	gnl\|CDD\|381116	cd17574, REC_OmpR, phosphoacceptor receiver (REC) domain of OmpR family response regulators. OmpR-like proteins are one of the most widespread transcriptional regulators. OmpR family members contain REC and winged helix-turn-helix (wHTH) DNA-binding output effector domain. They are involved in the control of environmental stress tolerance (such as the oxidative, osmotic and acid stress response), motility, virulence, outer membrane biogenesis and other processes. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	1.27649e-31
CP030099.1\|AWZ19253.1\|537560_538373_-\|Ser/Thr-protein-phosphatase-family-protein	gnl\|CDD\|379099	pfam13277, YmdB, YmdB-like protein. This family of putative phosphoesterases contains the B. subtilis protein YmdB.	3.40444e-143
CP030099.1\|AWZ19243.1\|525049_526990_-\|Acetyl-coenzyme-A-synthetase	gnl\|CDD\|234677	PRK00174, PRK00174, acetyl-CoA synthetase; Provisional.	0
CP030099.1\|AWZ19239.1\|520284_522123_-\|putative-signal-transduction-protein	gnl\|CDD\|225457	COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms].	8.99314e-149
CP030099.1\|AWZ19240.1\|522241_524005_-\|Acetate-permease-ActP-(cation/acetate-symporter)	gnl\|CDD\|274698	TIGR03648, Na_symport_lg, probable sodium:solute symporter, VC_2705 subfamily. This family belongs to a larger family of transporters of the sodium:solute symporter superfamily, TC 2.A.21. Members of this strictly bacterial protein subfamily are found almost invariably immediately downstream from a member of family TIGR03647. Occasionally, the two genes are fused.	0
CP030099.1\|AWZ19248.1\|532020_532392_+\|Putative-exported-protein	gnl\|CDD\|226074	COG3544, COG3544, Uncharacterized protein conserved in bacteria [Function unknown].	8.14692e-23
CP030099.1\|AWZ19254.1\|538427_538772_-\|Transthyretin-family-protein	gnl\|CDD\|376352	pfam00576, Transthyretin, HIUase/Transthyretin family. This family includes transthyretin that is a thyroid hormone-binding protein that transports thyroxine from the bloodstream to the brain. However, most of the sequences listed in this family do not bind thyroid hormones. They are actually enzymes of the purine catabolism that catalyze the conversion of 5-hydroxyisourate (HIU) to OHCU. HIU hydrolysis is the original function of the family and is conserved from bacteria to mammals; transthyretins arose by gene duplications in the vertebrate lineage. HIUases are distinguished in the alignment from the conserved C-terminal YRGS sequence.	3.52717e-52
CP030099.1\|AWZ19255.1\|538878_539391_+\|Uricase-(urate-oxidase)	gnl\|CDD\|225736	COG3195, COG3195, Uncharacterized protein conserved in bacteria [Function unknown].	4.27027e-67
CP030099.1\|AWZ19252.1\|535635_537417_-\|TrkA-domain-protein	gnl\|CDD\|238535	cd01115, SLC13_permease, Permease SLC13 (solute carrier 13). The sodium/dicarboxylate cotransporter NaDC-1 has been shown to translocate Krebs cycle intermediates such as succinate, citrate, and alpha-ketoglutarate across plasma membranes rabbit, human, and rat kidney. It is related to renal and intestinal Na+/sulfate cotransporters and a few putative bacterial permeases. The SLC13-type proteins belong to the ArsB/NhaD superfamily of permeases that translocate sodium and various anions across biological membranes in all three kingdoms of life. A typical ArsB/NhaD permease is composed of 8-13 transmembrane helices.	3.68938e-39
CP030099.1\|AWZ19251.1\|535035_535632_+\|Protein-BchJ,-involved-in-reduction-of-C-8-vinyl-of-divinyl-protochlorophyllide	gnl\|CDD\|131074	TIGR02019, Bacteriochlorophyll_synthase_23_kDa_chain, bacteriochlorophyll 4-vinyl reductase. This model represents the component of bacteriochlorophyll synthetase responsible for reduction of the B-ring pendant ethylene (4-vinyl) group. It appears that this step must precede the reduction of ring D, at least by the "dark" protochlorophyllide reductase enzymes BchN, BchB and BchL. This family appears to be present in photosynthetic bacteria except for the cyanobacterial clade. Cyanobacteria must use a non-orthologous gene to carry out this required step for the biosynthesis of both bacteriochlorophyll and chlorophyll. [Biosynthesis of cofactors, prosthetic groups, and carriers, Chlorophyll and bacteriochlorphyll].	1.46602e-49
CP030099.1\|AWZ19246.1\|528218_529436_-\|Putative-metal-chaperone,-involved-in-Zn-homeostasis	gnl\|CDD\|223597	COG0523, COG0523, Putative GTPases (G3E family) [General function prediction only].	1.38428e-113
CP030099.1\|AWZ19257.1\|540723_541536_+\|N-formylglutamate-deformylase	gnl\|CDD\|131072	TIGR02017, hutG_amidohyd, N-formylglutamate amidohydrolase. In some species, histidine is converted to via urocanate and then formimino-L-glutamate to glutamate in four steps, where the fourth step is conversion of N-formimino-L-glutamate to L-glutamate and formamide. In others, that pathway from formimino-L-glutamate may differ, with the next enzyme being formiminoglutamate hydrolase (HutF) yielding N-formyl-L-glutamate. This model represents the enzyme N-formylglutamate deformylase, also called N-formylglutamate amidohydrolase, which then produces glutamate. [Energy metabolism, Amino acids and amines].	1.21488e-115
CP030099.1\|AWZ19249.1\|532486_533227_-\|Hypothetical-protein	gnl\|CDD\|234640	PRK00110, PRK00110, YebC/PmpR family DNA-binding transcriptional regulator.	4.05677e-158
CP030099.1\|AWZ19241.1\|524020_524215_-\|Hypothetical-protein	gnl\|CDD\|132686	TIGR03647, Na_symport_sm, putative solute:sodium symporter small subunit. Members of this family are highly hydrophobic bacterial proteins of about 90 amino acids in length. Members usually are found immediately upstream (sometimes fused to) a member of the solute:sodium symporter family, and therefore are a putative sodium:solute symporter small subunit. Members tend to be found in aquatic species, especially those from marine or other high salt environments. [Transport and binding proteins, Unknown substrate].	5.95608e-24
CP030099.1\|AWZ19242.1\|524349_525036_-\|Adenylate-kinase	gnl\|CDD\|234711	PRK00279, adk, adenylate kinase; Reviewed.	8.39236e-113
CP030099.1\|AWZ19250.1\|533381_535043_+\|Mg-protoporphyrin-IX-monomethyl-ester-oxidative-cyclase-(anaerobic)	gnl\|CDD\|131081	TIGR02026, BchE, magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase. This model represents the cobalamin-dependent oxidative cyclase, a radical SAM enzyme responsible for forming the distinctive E-ring of the chlorin ring system under anaerobic conditions. This step is essential in the biosynthesis of both bacteriochlorophyll and chlorophyll under anaerobic conditions (a separate enzyme, AcsF, acts under aerobic conditions). This model identifies two clades of sequences, one from photosynthetic, non-cyanobacterial bacteria and another including Synechocystis and several non-photosynthetic bacteria. The function of the Synechocystis gene is supported by gene clustering with other photosynthetic genes, so the purpose of the gene in the non-photosynthetic bacteria is uncertain. Note that homologs of this gene are not found in plants which rely solely on the aerobic cyclase.	0
CP030099.1\|AWZ19245.1\|527588_528215_-\|Hypothetical-protein	gnl\|CDD\|378067	pfam08856, DUF1826, Protein of unknown function (DUF1826). These proteins are functionally uncharacterized.	1.50145e-51
CP030099.1\|AWZ19256.1\|539429_540467_-\|Hypothetical-protein	gnl\|CDD\|320691	cd07332, M48C_Oma1_like, Peptidase M48C Ste24p, integral membrane endopeptidase. This subfamily contains peptidase M48C Oma1 (also called mitochondrial metalloendopeptidase OMA1) protease homologs that are mostly uncharacterized. Oma1 is part of the quality control system in the inner membrane of mitochondria, with its catalytic site facing the matrix space. It cleaves and thereby promotes the turnover of mistranslated or misfolded membrane proteins. Oma1 can cleave the misfolded multi-pass membrane protein Oxa1, thus exerting a function similar to the ATP-dependent m-AAA protease for quality control of inner membrane proteins; it cleaves a misfolded polytopic membrane protein at multiple sites. It has been proposed that in the absence of m-AAA protease, proteolysis of Oxa1 is mediated by Oma1 in an ATP-independent manner. Oma1 is part of highly conserved mitochondrial metallopeptidases, with homologs present in higher eukaryotes, eubacteria and archaebacteria, all containing the zinc binding motif (HEXXH). It forms a high molecular mass complex in the inner membrane, possibly a homo-hexamer.	0.000272358

>CP030099.1|AWZ19246.1|528218_529436_-|Putative-metal-chaperone,-involved-in-Zn-homeostasis
MQPRDLRLPVTVLSGFLGAGKTTLLNAVLNNRDGRRVAVIVNDMSEVNIDADLVREGGANLSHTDEALVEMSNGCICCTLRDDLLKEVRKLAGEGRFDYLLIESTGVSEPLPVATTFEFRDEAGESLSDVARLDTLVTVVDAVNLLENYSSHDFLSDRGEVAGEGDTRTLVDLLVDQIEFADVIVLNKVSDAGPARRDAARSIIVALNPDAQIIETDYAQVDPARIFDTGLFDFATAHDHPLWAKELYGFAEHVPETEEYGVTSFVYRARRPFDPAAVHAVLNGPLPGVIRAKGHFWVATRPEWVAEFSLAGALSKVGPLGTWWASVPEERWPTHPQARDYVMRHWAAPYGDRRQELVFIGAGMDQAAITAALDAALVGSETVFDPLVFRGLPDPFPVWRRSEAA
>CP030099.1|AWZ19245.1|527588_528215_-|Hypothetical-protein
MRDHGMTLATGVARGDSPGILHQVTRAGQAAAIWTRQREAGLAEWIDGVAVENLPQARCYCTAQRARAVAQAACEGAGLPIGRAHEVLCDDIGALAVLFGQVMGRSALHLRLEVVRDDACRKFHMDQVPARLLCSYRGAGTEYGLMRAQGDPQPVCRMATGDVGIFRGALWSGDEMSGVVHRSPPIAGFGAARLLLVLDVLGAAQHGR
>CP030099.1|AWZ19244.1|527308_527599_-|Hypothetical-protein
MAGNLRSPAMRRRRAHGLTEYDRLPGPLRRWVAQAALPWSARSVRAVWARALRAAGGCEAAALARLNRIEARALEREASVVWGMGYPTPDLTGDES
>CP030099.1|AWZ19243.1|525049_526990_-|Acetyl-coenzyme-A-synthetase
MSDANATAGAKKAGFHIDQAKYERMYADSISNPEAFWGEHGKRLDWIKPYTKVKNTSFAYDNVSIKWFEDGTLNVSANCIDRHLATRGDQTAIIWEADDPNETPQHISYKELHAQTCKMANVLKAMGVGKGDRVVIYMPMIPEAAYAMLACARIGAIHSIVFAGFSPDALGARINGCDAKVVITADHAPRGGRKTKLKDNVNQALLHDTSDVKCLVVQRTGDQVAWRRDLDFWWHEEAEKVSADCPPEEMNAEDPLFILYTSGSTGMPKGVVHTTGGYLTYASMTHEYIFDYHEGDIYWCTADVGWVTGHSYIVYGPLANGATTLMFEGVPTYPDAGRFWQVCERHKVTQFYTAPTAIRALMGKGTGPVEGSDLSSLRILGSVGEPINPEAWNWYNENVGKGKCPIVDTWWQTETGGILITPLPGVIDTPKPGSATKPFFGVKPVVLDDQGNELDGETSGVLALKDSWPGQMRTVWGDHSRFVSTYFEMFKGYYFSGDGCRRDADGDYWITGRVDDVINVSGHRMGTAEVESALVAHATVSEAAVVGYPHDIKGQGIYCYVTLMDGVEATEALRTELGNWVRQEIGPIAKPDVIQWAPGLPKTRSGKIMRRILRKIAENDFDSLGDTSTLADPSVVDELIANRTKA
>CP030099.1|AWZ19242.1|524349_525036_-|Adenylate-kinase
MDGSDTPRNAANLVLLGPPGAGKGTQARMLEEQFGLVQLSTGDLLRAAVAAGTEAGRAAKAVMEAGDLVSDAIVIAILRDRLAEPDCAKGVILDGFPRTTVQAEALDGLLAEIGQGIRSAISLEVDDAAMVTRISGRYTCGGCGEGYHDSFKMPNVAGICDKCGGTEMKRRADDNAETVEQRLRAYHAQTAPLISYYESRGVLARVDAMAEIEAVARELNAIVAKAVA
>CP030099.1|AWZ19241.1|524020_524215_-|Hypothetical-protein
MVWFFASFGFGILLRPMLSGIAIGGTDLGFWFAQQGSIIVFLILIFFYAWRMNKLDAEHGVGEE
>CP030099.1|AWZ19240.1|522241_524005_-|Acetate-permease-ActP-(cation/acetate-symporter)
MDQTTLNIIVVGLSFVLYFGIAIWAKAGSTAEFYAAGRGVNPVVNGMATAADWMSAASFISMAGLIAFVGYNNSTFLMGWTGGYVLMAMLLAPYLRKFGKYTVPEFVGDRFYSNKARVVAVIALITMSVTYVIGQMAGAGVAFSRFLEVDNTTGLLIASAVVFVYAVLGGMKGITYTQVAQYCVLIVAYTIPAIFISLQLTGHVLPQLGLFGEHTASGQYLLVTLDGLLNDLGFNQYTSGSSPWLMALFTLSLMIGTAGLPHVIIRFFTVPKVSDARWSAGWALVFIALLYLTAPAVGAMARLNIMTTMWPQGVQGEAVAVDELPDWFRTWSATGLLAVEDKNGDGKIQYYNEKSEAMTALAAERGWQGNELVTFNQDILVLANPEIAGLPGWVIALIAAGGIAAALSTAAGLLLAISSAVSHDLIKSTINPGISEKGELLAARISMAAAIVVATYLGLNPPGFAAQVVALAFGLAAASLFPTLMMGIFSKRMNSAGATAGMLAGLLSTTLYLFLFLGWFFIPGTNMLTPDQYLFGIPPTHFGPIGALLNFGVAFIVASMTAEPPQEIQDLVESVRIPRGAGTAVNH
>CP030099.1|AWZ19239.1|520284_522123_-|putative-signal-transduction-protein
MSDVKPDPIDSLTRHAPFSGLPHVLRSALAPKLARVVLEQGVVLFEKGAPLAGLYVVETGGLDIETGHADLVSHRGPGDIMGERGLLRDGNALLTARAAEPSELVVVPREAFLDLMEQSDEIARWFARARPTAQGDDGPYATGLTALQVSDLMTATPITCTPDATVKDVARLMRDNVISSVVVMEGARLAGIITVRDLANKVLAEGLGGDIRVAQVMTPDPVTIEPGRLGLDALMLLSELKVNHLPVAQGGRVLGMIGKTDLFRQQAATASHMVADIASADTAEDMAHVMERVPMLLVQLVQAGVRPQSITRRITDITDAITRRLLRLAEQQLGPAPVPYLWAACGSQGRREQTGVSDQDNCLIIDDSVLPEHDAYFAALAKYVSDGLNTCGFFYCPGDMMATNPRWRQPRRVWRSYFARWIAQPDTEAQMLASVMFDLRAIAGENALFDDLQAEVLASARKNSIFVAHMVSNSLKHTVPLGLLRGFALIRSGEHKNTIDLKHSGVVPVVDLGRIYALLGSLEVAGTRERITGARAGAVISESGARDLLDAYDLIAETRLRHQAARIRAGRSPDNFMAPADLSDLERNHLRDAFMVVKTMQSAIAQSRGAPG
>CP030099.1|AWZ19238.1|519774_520281_-|Hypothetical-protein
MFFELIATFAVGIAAAGLALVAGHLSRGRLPRYSAPILAGIAMLCYAIWSEYTWADRTLSTLPESVEVVSAVEEARFWKPWTYVVPQVTRMMVLDRAGVQTNPTVPEILLADIYLFGRWAVPVKRPQLVDCAKAARADVSEAALADPSQAEWLVVGVEDPVITALCQS
>CP030099.1|AWZ19237.1|519360_519744_-|Response-regulator-receiver-protein-in-cluster-with-DNA-polymerase-III-epsilon-subunit
MPEKTVLLVEDEDNIALALEHLIGRAGYRLRRVATGNAALEAMAEDRPDLVVLDVMLPERSGYEICQMIRADAALKGIKVLMMTAGGGEVERRKGLAVGADAFMTKPFATADLTAQIGELLAGADHD
>CP030099.1|AWZ19248.1|532020_532392_+|Putative-exported-protein
MRIPLTAALLAFTLSPALADSHGHGTDHSNHSAHATHGLPASTQAYIEANAAMHGAMDIDFTGDADVDFLRGMIPHHEGAVAMARIVLEHGKDPEVRKLAEDVITAQEAEIAWMRARLTELGH
>CP030099.1|AWZ19249.1|532486_533227_-|Hypothetical-protein
MAGHSKWANIQHRKGRQDAVRAKLFSKFSKEITVAAKMGDPDPDKNPRLRLAIKEAKAQSMPKDNIERAIKKAMGGDAEDYEEIRYEGYGPNGVAIIVEAMTDNRNRTASNVRSTFTKNGGNLGETGSVAFMFERKGEVTYAASVGDADTVMMAALEAGAEDVESGEDGHTIWCADTDLSEVASGLEGALGESTSTKLVWKPTTTTEMDLESMQKLMKLIEALEDDDDVQRVTTNFEASDAVMEQL
>CP030099.1|AWZ19250.1|533381_535043_+|Mg-protoporphyrin-IX-monomethyl-ester-oxidative-cyclase-(anaerobic)
MRIVLIHPNYHSGGAEIAGSWPPAWVAYLAGHLRDAGYTDVTFIDAMTNHLDDDSLRARLRDLNPDVVGVTAITPSIYVAENILKLAQEVVPDALRVLGGVHATFMYKQVLSEAPWVDVIVRGEGEEIFLNLIRAADSGHWLGKRKSIKGLAYLDGETITATPAASTVKDLDAINPDWSLLEWEKYIYVPLGKRVAIPNMARGCPFTCSFCSQWKFWRDYRVRDPKKVVDEIENLVNNHGVGFFILADEEPTINKKKFVQFCEELIARDLPRRVQWGINTRVTDIYRDRDLLKFYRKAGLVHVSLGTEAAAQLKLDQFNKETTVAQNKEAIQLLREADIFTEAQFIVGLDNETPETLEETFQMAWDWQPDLANWAMYTPWPFTPLFQELRDQVEVFDFSKYNFVTPIMKPATMTRGELLDGVMKNYRRFYMRKALFHYPWRGTGYRRRYLLGCLKAFLKAGVSRTFYDLGKAGYWGPQTKNSVTFDFDETRTIAEAQMEDWEASADRAARAAERREAVRTQMKDRASERNEGFKMPNGAEVRACGGSTQQMDA
>CP030099.1|AWZ19251.1|535035_535632_+|Protein-BchJ,-involved-in-reduction-of-C-8-vinyl-of-divinyl-protochlorophyllide
MPDGSQITARIGPNAVLQLAPAMDRIVGADARRTLFAPLGFDPLPDSNAMINEARVAALHGALRQQHSENARKIAIAAGQGTGDYILAHRIPRAAQTLLRALPARVAAPILTRAILAHSWTFCGTGTLAAKSGPPVVFTLADNPIIRGEHATAPLCHWHAAVFERLFSRLVHPRSQAIETTCCATGASACRFEIDWRH
>CP030099.1|AWZ19252.1|535635_537417_-|TrkA-domain-protein
MIEMLGVSQTGQALLTLLVVAAMFVLFVREIYPTEVVAIAGVAVLLALGVLPYGAALDVFSNPAPWTIAAMFIVMGALVRTGALDAFTTLADQQAKHNPRLAIAMLLISVVIGSAFMNNTPVVVVMIPVFVQLARTLKIPASKLLIPLSYAAILGGTTTLIGTSTNLLVDGVARSAGMAPFTIFEVTPLGIVLVIWGAIYLRFFGPFLLPARDSMADLLSDRSKMKFFTEAVIPPESNLIGRDVTGVQLFKREGVRLIDVIRGDQSLRRNLADVTLQVGDRVVLRTQMTELLSLQRNKSLKRVDQVSAVETTTVEVLITPGCKMVGRSLGALRLRRRYGVYPLAVHRRNQNIGRQLDELVVRVGDTLLLEGAPEDIQRLSREMEMVDVSHPSARAFRRGHAPLAVLSLAGIVVLAALGVAPILALAVIAVAMVLLARCIDADEAFSFIDGQLLALIFAMLAIGAALQTSGAVELLVGGIAPTLSVMPGFLVVWAIYLLTSFLTELISNNAVAVVVTPIAIGLADAMGIDARPLVVAVMVAASASFATPIGYQTNTLVYGPGGYKFTDFLRVGIPLNLSIGLLASALIPLLWPL
>CP030099.1|AWZ19253.1|537560_538373_-|Ser/Thr-protein-phosphatase-family-protein
MKILFLGDVMGRAGRAAVAERLPKLRDAWKLDFVVVNGENASGGMGLTAAHAKDLFEAGADCVTLGDHAFDQKDMMQAVEREGRLIRPLNYAKAAPGRGHRVFTDGRGRKVLVAQVLGNVFMRRAYDDPFSAIDAILRVHPLGGAVQAAVVDMHCEATSEKMAMGHFCDGRASLVVGTHTHIPTADAQILPGGTAFQGDAGMCGDYLSVIGMDKAEPMRRFVTGMTKDRFTPAMGAVTVSGVYIETDDATGRATRIEMVRQGGRLEQSGP
>CP030099.1|AWZ19254.1|538427_538772_-|Transthyretin-family-protein
MSGYLTTHVLDTARGCPAPGLLIRLSRITDSGPVLLCERRTNADGRTDGPILTEADFAAGPYELLFHAGEYLRLMGVESGFLDLIPIRFSMTQAVHYHVPLLLSPYGYTTYRGS
>CP030099.1|AWZ19255.1|538878_539391_+|Uricase-(urate-oxidase)
MAQDRPSQMDRDRFVAQFGGVFEHSPWIAERAYDLGISPRHDSALGLHDALCRVFRDATEVERLTVLRAHPDLAGKLAQARRLTAASSHEQASAGLDALTDAERAAFERLNAAYIARHGFPFIIAVRDHDKAGIRDAFARRIDQDSATEQAEACRQVERIAFWRLQDMLA
>CP030099.1|AWZ19256.1|539429_540467_-|Hypothetical-protein
MKKTALTRYQRLEAAGLWRANPDAQRVDVIVSVGEATLTITDMRERVQAHWSIAAVARANPGQYPAIYNPDGDPGETLELAEDEADMIAAIETLRGAVARQRPKPGRLRLVGMLASVAAVAALVLFWLPGAARQHALEVVPMVKRAEIGRALLGHLQRVTGPVCEGPGGAAALAQLARRLPSRAGGAAEFLVVRGGIEGALRLPGGAVLINTDLVEDHNEPDVLAGHIIAAYLRAEAHDPLSKLLEEGGLSATLRLLATGLLPDDVLRAHAERLMRDAPEAVAPDAMLAGFAQWQVRARPYAYAEDITGETTVTLIEADPFAGTAPPPPLLSDADWLRLQEICGG
>CP030099.1|AWZ19257.1|540723_541536_+|N-formylglutamate-deformylase
MPASATDSVVSVHSGESPLVLAMPHAGTDLPADIAARLNDTGRALSDTDWHIDRLYDGLVPEASVVAARFHRYVIDANRDPSGTSLYPGQNTTSLVPLTDFDGAPLWSTPPTEADTAERLAQFHGPYHAALSAELDRVQRRHGFAILYDCHSIRSEIPFLFDGRLPDFNIGTNDGATCAPALAALTERHCHAASRYTTVTNGRFRGGWTTRHYGRPKDGLHAIQMELAQATYMHEAAPWDYAPDRATDLRAVLAPMLREIATLDLSASHA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2438931 : 2467431

Thiobacimonas_phage(39.13%)

tail,terminase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWZ21074.1\|2438931_2442729_-	Exoglucanase A precursor	A0A0U2C146	Paracoccus_phage	2.4e-89	33.4
AWZ21075.1\|2442725_2443127_-	Hypothetical protein	NA	NA	NA	NA
AWZ21076.1\|2443123_2443780_-	Hypothetical protein	A0A0U2C133	Paracoccus_phage	3.3e-34	43.5
AWZ21077.1\|2443776_2444451_-	Hypothetical protein	NA	NA	NA	NA
AWZ21078.1\|2444447_2447258_-	Hypothetical protein	A0A1B0T6D4	Thiobacimonas_phage	2.8e-21	31.3
AWZ21079.1\|2447259_2447388_-	Hypothetical protein	NA	NA	NA	NA
AWZ21080.1\|2447612_2447942_-	Hypothetical protein	NA	NA	NA	NA
AWZ21081.1\|2447991_2448927_-	Hypothetical protein	A0A1B0T6E1	Thiobacimonas_phage	1.2e-90	53.5
AWZ21082.1\|2448923_2449049_-	Hypothetical protein	NA	NA	NA	NA
AWZ21083.1\|2449045_2449480_-	Hypothetical protein	A0A1B0T6E9	Thiobacimonas_phage	6.5e-31	44.6
AWZ21084.1\|2449476_2449974_-\|tail	Phage virion morphogenesis (putative tail completion) protein	A0A2K9VH22	Faecalibacterium_phage	3.3e-18	45.7
AWZ21085.1\|2449975_2450401_-	Mu-like prophage protein GP36	NA	NA	NA	NA
AWZ21086.1\|2450467_2450824_-	Hypothetical protein	NA	NA	NA	NA
AWZ21087.1\|2450820_2451780_-	Hypothetical protein	A0A219VH83	Ochrobactrum_phage	5.4e-70	45.4
AWZ21088.1\|2451799_2452150_-	Hypothetical protein	NA	NA	NA	NA
AWZ21089.1\|2452157_2453243_-	Hypothetical protein	A4JWJ9	Burkholderia_virus	1.3e-51	38.7
AWZ21090.1\|2453540_2453759_-	Hypothetical protein	NA	NA	NA	NA
AWZ21091.1\|2453762_2455088_-	Phage (Mu-like) virion morphogenesis protein	A0A1B1P712	Rhodovulum_phage	6.3e-85	42.9
AWZ21092.1\|2455084_2456614_-	Mu-like prophage FluMu protein gp29	Q5ZQY4	Pseudomonas_phage	4.6e-103	47.6
AWZ21093.1\|2456636_2458277_-\|terminase	Phage terminase, large subunit	A0A219VH72	Ochrobactrum_phage	2.5e-184	60.7
AWZ21094.1\|2458273_2458840_-	Protein gp27	A0A1B1P730	Rhodovulum_phage	3.2e-54	71.9
AWZ21095.1\|2458841_2459144_-	Hypothetical protein	A0A1B1P718	Rhodovulum_phage	1.3e-25	63.6
AWZ21096.1\|2459140_2459485_-	Hypothetical protein	A0A1B0T6K8	Pelagibaca_phage	2.0e-19	49.0
AWZ21097.1\|2459481_2460054_-	Methionine synthase I, cobalamin-binding domain	NA	NA	NA	NA
AWZ21098.1\|2460044_2460656_-	Secretion activator protein	G8DH66	Emiliania_huxleyi_virus	1.1e-55	57.8
AWZ21099.1\|2460697_2461087_-	Hypothetical protein	A0A1B1P702	Rhodovulum_phage	1.1e-10	34.5
AWZ21100.1\|2461096_2461549_-	Protein of unknown function DUF1018	A0A1B0T6H1	Thiobacimonas_phage	2.4e-44	61.0
AWZ21101.1\|2461553_2462204_-	Hypothetical protein	A0A1B0T6L8	Pelagibaca_phage	2.6e-76	63.2
AWZ21102.1\|2462205_2462406_-	Hypothetical protein	NA	NA	NA	NA
AWZ21103.1\|2462402_2462753_-	Hypothetical protein	NA	NA	NA	NA
AWZ21104.1\|2462739_2463114_-	Hypothetical protein	A0A1B0T6G8	Thiobacimonas_phage	2.1e-38	62.3
AWZ21105.1\|2463110_2463644_-	Hypothetical protein	A0A1B0T6J7	Thiobacimonas_phage	8.8e-38	48.5
AWZ21106.1\|2463640_2464438_-	Hypothetical protein	A0A1B0T6H3	Thiobacimonas_phage	4.0e-111	82.4
AWZ21107.1\|2464456_2466580_-	Hypothetical protein	A0A1B0T6H2	Thiobacimonas_phage	9.7e-253	62.8
AWZ21108.1\|2466576_2467431_-	ParB-like nuclease domain protein	A0A1B0T6H9	Thiobacimonas_phage	1.4e-53	46.1

DBSCAN-SWA_2

2644624 : 2649917

Staphylococcus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWZ21273.1\|2644624_2646103_+	Long-chain-fatty-acid--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	7.4e-26	27.8
AWZ21274.1\|2646190_2646889_+	Queuosine Biosynthesis QueC ATPase	A0A2P1JXV3	Rhodococcus_phage	1.1e-51	48.9
AWZ21275.1\|2646888_2647245_+	6-carboxytetrahydropterin synthase, Queuosine biosynthesis QueD, PTPS-I	NA	NA	NA	NA
AWZ21276.1\|2647241_2647964_+	Queuosine Biosynthesis QueE Radical SAM	A0A1U9WRB6	Streptococcus_virus	1.3e-36	36.1
AWZ21277.1\|2647975_2648440_+	NADPH dependent preQ0 reductase	E7DN65	Pneumococcus_phage	5.7e-25	53.3
AWZ21278.1\|2648491_2649181_-	Benzoate transport, ATP binding protein	G3M9Y6	Bacillus_virus	3.7e-12	29.8
AWZ21279.1\|2649173_2649917_-	Benzoate transport, ATPase component	W6JKT0	Anomala_cuprea_entomopoxvirus	1.0e-15	29.1

DBSCAN-SWA_3

3585249 : 3607686

Paracoccus_phage(33.33%)

tail,protease,head,capsid,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWZ22182.1\|3585249_3585897_-\|protease	Uncharacterized protein, similar to the N-terminal domain of Lon protease	NA	NA	NA	NA
AWZ22183.1\|3585923_3586841_-	Thioredoxin domain-containing	A0A1J0GW78	Streptomyces_phage	8.4e-12	42.4
AWZ22184.1\|3586893_3587682_-	Exodeoxyribonuclease III	NA	NA	NA	NA
AWZ22185.1\|3587911_3588598_-	DNA-binding response regulator	NA	NA	NA	NA
AWZ22186.1\|3588754_3589843_+	3,4-dihydroxy-2-butanone 4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	1.3e-35	49.3
AWZ22187.1\|3589856_3591464_-	Peptide chain release factor 3	D0R0F5	Streptococcus_phage	2.4e-30	27.4
AWZ22188.1\|3591551_3591686_+	Hypothetical protein	NA	NA	NA	NA
AWZ22189.1\|3591929_3593723_+	Hypothetical protein	NA	NA	NA	NA
AWZ22190.1\|3593810_3595118_+	Adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	1.8e-15	30.1
AWZ22191.1\|3595149_3595320_+	Adenylosuccinate lyase	NA	NA	NA	NA
AWZ22192.1\|3595392_3599400_-	Gene Transfer Agent host specificity protein	A0A0B5A7K5	Paracoccus_phage	5.9e-227	35.9
AWZ22193.1\|3599403_3599847_-	Gene Transfer Agent NlpC/P60 family peptidase	A0A1V0DYB6	Dinoroseobacter_phage	9.6e-30	48.2
AWZ22194.1\|3599843_3600719_-	Gene Transfer Agent FAD/FMN-containing dehydrogenase	A0A0B5A5B8	Paracoccus_phage	5.5e-53	39.7
AWZ22195.1\|3600715_3601348_-	Gene Transfer Agent (GTA) ORFG12	A0A0B5A2K3	Paracoccus_phage	3.7e-59	51.0
AWZ22196.1\|3601361_3602003_-\|tail	Gene Transfer Agent tail tape measure	D6PFD6	uncultured_phage	7.2e-18	43.5
AWZ22197.1\|3601995_3602202_-	Gene Transfer Agent (GTA) ORFG10b	NA	NA	NA	NA
AWZ22198.1\|3602198_3602522_-	Gene Transfer Agent (GTA) ORFG10	NA	NA	NA	NA
AWZ22199.1\|3602526_3602940_-\|tail	Gene Transfer Agent tail protein	NA	NA	NA	NA
AWZ22200.1\|3602964_3603378_-	Gene Transfer Agent (GTA) ORFG08	NA	NA	NA	NA
AWZ22201.1\|3603374_3603713_-	Gene Transfer Agent (GTA) ORFG07	NA	NA	NA	NA
AWZ22202.1\|3603712_3604312_-	Gene Transfer Agent (GTA) ORFG06	NA	NA	NA	NA
AWZ22203.1\|3604461_3605640_-\|capsid	Phage major capsid protein	B0VK33	Azospirillum_phage	5.5e-64	41.5
AWZ22204.1\|3605676_3606234_-\|head,protease	Gene Transfer Agent prohead protease	A0A0U2BX10	Paracoccus_phage	5.6e-35	50.9
AWZ22205.1\|3606257_3606503_-	Gene Transfer Agent associated protein Pden 2900	NA	NA	NA	NA
AWZ22206.1\|3606495_3607686_-\|portal	Gene Transfer Agent portal protein ORFG03	W8ECU7	Geobacillus_phage	1.4e-59	36.0

Anti-CRISPR protein detection

Acr_ID: CP030099.1|AWZ21113.1|2468870_2469083_-|Hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

CP030099.1|AWZ21113.1|2468870_2469083_-|Hypothetical-protein

2468870_2469083_-

70 aa aa

hit_Aca_id	identity	query_coverage	hit_coverage
gnl\|BL_ORD_ID\|85	0.855072463768116	1.0	0.8117647058823529

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP030099

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information