CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
CP022293	Lactobacillus plantarum strain DSR_M2 plasmid pDSRM202, complete sequence	0 crisprs	csa3	0	0	0
CP022292	Lactobacillus plantarum strain DSR_M2 plasmid pDSRM201, complete sequence	0 crisprs	NA	0	0	1
CP022294	Lactobacillus plantarum strain DSR_M2 chromosome, complete genome	1 crisprs	csa3,DinG,cas3,DEDDh	1	1	5

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP022294_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP022294_3

2731092-2731177

Orphan

Consensus_repeat	Method
TAAGAAACTTAAAGTGTCTTATT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP022294_3

>merge|CP022294|3|2731092-2731177|CRISPRCasFinder
TAAGAAACTTAAAGTGTCTTATTCGCATAACTGGTATAATACGCTATATAAAGAAAAAGTCAATAAGAAACTTAAAGTATCTTATT

>CP022294|3|1|2731092-2731177|CRISPRCasFinder
TAAGAAACTTAAAGTGTCTTATT	CGCATAACTGGTATAATACGCTATATAAAGAAAAAGTCAA
TAAGAAACTTAAAGTATCTTATT

Protein	Signature genes	Signature genes Name	Protein_function
CP022294.1\|AWY49228.1\|2724976_2725705_+\|NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
CP022294.1\|AWY49236.1\|2733080_2733875_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
CP022294.1\|AWY49227.1\|2724478_2724844_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
CP022294.1\|AWY49243.1\|2739313_2740150_+\|short-chain-dehydrogenase	unknown	unknown	gnl\|CDD\|212492
CP022294.1\|AWY49229.1\|2725863_2726430_-\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
CP022294.1\|AWY49234.1\|2731194_2731794_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
CP022294.1\|AWY49242.1\|2738548_2739055_-\|acetyltransferase	unknown	unknown	gnl\|CDD\|100047
CP022294.1\|AWY49232.1\|2728528_2729482_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381318
CP022294.1\|AWY49224.1\|2719359_2720772_+\|succinate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143418
CP022294.1\|AWY49233.1\|2729598_2731077_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
CP022294.1\|AWY49230.1\|2726556_2727594_+\|aldehyde-reductase	unknown	unknown	gnl\|CDD\|187538
CP022294.1\|AWY49235.1\|2731914_2732844_-\|ferrichrome-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238558
CP022294.1\|AWY49239.1\|2736105_2736618_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274100
CP022294.1\|AWY49238.1\|2734866_2735862_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
CP022294.1\|AWY49226.1\|2723910_2724195_+\|DUF1905-domain-containing-protein	unknown	unknown	gnl\|CDD\|378097
CP022294.1\|AWY49225.1\|2721042_2723625_-\|glycoside-hydrolase-family-25	unknown	unknown	gnl\|CDD\|119382
CP022294.1\|AWY49231.1\|2727742_2728309_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226078
CP022294.1\|AWY49241.1\|2737785_2738532_-\|NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
CP022294.1\|AWY49237.1\|2733871_2734870_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
CP022294.1\|AWY49240.1\|2736598_2737492_-\|short-chain-dehydrogenase	unknown	unknown	gnl\|CDD\|187572

Protein	Function_ID	Function_description	E-value
CP022294.1\|AWY49228.1\|2724976_2725705_+\|NAD(P)-dependent-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	1.6523e-89
CP022294.1\|AWY49236.1\|2733080_2733875_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	5.60764e-114
CP022294.1\|AWY49227.1\|2724478_2724844_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.16334e-31
CP022294.1\|AWY49243.1\|2739313_2740150_+\|short-chain-dehydrogenase	gnl\|CDD\|212492	cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs. Classical SDR subgroup containing retinol-DHs, LPORs, and related proteins. Retinol is processed by a medium chain alcohol dehydrogenase followed by retinol-DHs. Pchlide reductases act in chlorophyll biosynthesis. There are distinct enzymes that catalyze Pchlide reduction in light or dark conditions. Light-dependent reduction is via an NADP-dependent SDR, LPOR. Proteins in this subfamily share the glycine-rich NAD-binding motif of the classical SDRs, have a partial match to the canonical active site tetrad, but lack the typical active site Ser. This subgroup includes the human proteins: retinol dehydrogenase -12, -13 ,and -14, dehydrogenase/reductase SDR family member (DHRS)-12 , -13 and -X (a DHRS on chromosome X), and WWOX (WW domain-containing oxidoreductase), as well as a Neurospora crassa SDR encoded by the blue light inducible bli-4 gene. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.88105e-54
CP022294.1\|AWY49229.1\|2725863_2726430_-\|TetR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	9.17389e-05
CP022294.1\|AWY49234.1\|2731194_2731794_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	4.95133e-09
CP022294.1\|AWY49242.1\|2738548_2739055_-\|acetyltransferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	7.15338e-54
CP022294.1\|AWY49232.1\|2728528_2729482_-\|aldo/keto-reductase	gnl\|CDD\|381318	cd19092, AKR_BsYcsN_EcYdhF-like, Bacillus subtilis YcsN, Escherichia coli YdhF and similar proteins. Bacillus subtilis YcsN and Escherichia coli YdhF are prototypes of this family. They are uncharacterized aldo/keto reductase family oxidoreductases.	5.65843e-131
CP022294.1\|AWY49224.1\|2719359_2720772_+\|succinate-semialdehyde-dehydrogenase	gnl\|CDD\|143418	cd07100, ALDH_SSADH1_GabD1, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like. Succinate-semialdehyde dehydrogenase 1 (SSADH1, GabD1, EC=1.2.1.16) catalyzes the NADP(+)-dependent oxidation of succinate semialdehyde (SSA) to succinate. SSADH activity in Mycobacterium tuberculosis (Mtb) is encoded by both gabD1 (Rv0234c) and gabD2 (Rv1731). The Mtb GabD1 SSADH1 reportedly is an enzyme of the gamma-aminobutyrate shunt, which forms a functional link between two TCA half-cycles by converting alpha-ketoglutarate to succinate.	0
CP022294.1\|AWY49233.1\|2729598_2731077_-\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.10264e-72
CP022294.1\|AWY49230.1\|2726556_2727594_+\|aldehyde-reductase	gnl\|CDD\|187538	cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs. This subgroup contains aldehyde reductase of the extended SDR-type and related proteins. Aldehyde reductase I (aka carbonyl reductase) is an NADP-binding SDR; it has an NADP-binding motif consensus that is slightly different from the canonical SDR form and lacks the Asn of the extended SDR active site tetrad. Aldehyde reductase I catalyzes the NADP-dependent reduction of ethyl 4-chloro-3-oxobutanoate to ethyl (R)-4-chloro-3-hydroxybutanoate. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	7.62333e-95
CP022294.1\|AWY49235.1\|2731914_2732844_-\|ferrichrome-ABC-transporter-substrate-binding-protein	gnl\|CDD\|238558	cd01138, FeuA, Periplasmic binding protein FeuA. These proteins have predicted to function as initial receptors in ABC transport of metal ions in some eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.	1.50683e-56
CP022294.1\|AWY49239.1\|2736105_2736618_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|274100	TIGR02366, conserved_hypothetical_protein, probable dihydroxyacetone kinase regulator. The seed alignment for this family was built from a set of closely related uncharacterized proteins associated with operons for the type of bacterial dihydroxyacetone kinase that transfers PEP-derived phosphate from a phosphoprotein, as in phosphotransferase system transport, rather than from ATP. Members have a TetR transcriptional regulator domain (pfam00440) at the N-terminus and sequence homology throughout.	3.33884e-08
CP022294.1\|AWY49238.1\|2734866_2735862_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	6.4786e-78
CP022294.1\|AWY49226.1\|2723910_2724195_+\|DUF1905-domain-containing-protein	gnl\|CDD\|378097	pfam08922, DUF1905, Domain of unknown function (DUF1905). This domain is found in a set of hypothetical bacterial proteins.	1.07383e-22
CP022294.1\|AWY49225.1\|2721042_2723625_-\|glycoside-hydrolase-family-25	gnl\|CDD\|119382	cd06522, GH25_AtlA-like, AtlA is an autolysin found in Gram-positive lactic acid bacteria that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family includes the AtlA and Aml autolysins from Streptococcus mutans which have a C-terminal glycosyl hydrolase family 25 (GH25) catalytic domain as well as six tandem N-terminal repeats of the GBS (group B Streptococcus) Bsp-like peptidoglycan-binding domain. Other members of this family have one or more C-terminal peptidoglycan-binding domain(s) (SH3 or LysM) in addition to the GH25 domain.	2.86064e-70
CP022294.1\|AWY49231.1\|2727742_2728309_-\|hypothetical-protein	gnl\|CDD\|226078	COG3548, COG3548, Predicted integral membrane protein [Function unknown].	5.75015e-29
CP022294.1\|AWY49241.1\|2737785_2738532_-\|NAD(P)-dependent-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	2.40011e-91
CP022294.1\|AWY49237.1\|2733871_2734870_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	2.31826e-81
CP022294.1\|AWY49240.1\|2736598_2737492_-\|short-chain-dehydrogenase	gnl\|CDD\|187572	cd05262, SDR_a7, atypical (a) SDRs, subgroup 7. This subgroup contains atypical SDRs of unknown function. Members of this subgroup have a glycine-rich NAD(P)-binding motif consensus that matches the extended SDRs, TGXXGXXG, but lacks the characteristic active site residues of the SDRs. This subgroup has basic residues (HXXXR) in place of the active site motif YXXXK, these may have a catalytic role. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	7.15129e-131

>CP022294.1|AWY49233.1|2729598_2731077_-|MFS-transporter
MQAKAKISKATMTIAWVVVFGAMAPLLDSTMINIAINNLVTSFHSSVTTVQWAVTGYLLATGVAVPFSSWLLNRFDGKAVFVAGEILFGLGSIFAAVAPNIQLLIIARLVQGFAGGLIMPLLTTLLVQTAGAAVMGQMMATVGLPMILGPLIGPVIGGIIIKFASWHWIFWINVPVVLISIALILWKMPNYPAQNRTAKMDFIGILLLIVSSSAIIYSLVNAAHTDRFNNATSIEMLILGAIALISYVVWAAWQKERAVVPLHLFKFASFDGAGLGLFIAGTVLNGAMLLLPLYFQNVRGMSVINAALALLPQGAGMLVSRTLTGRLTDQIGAKYVVLGSVVITFVGTLPFYWFGQQTSYWILALILFVRGIGAGGILMPLMADAYTGMQPGQVPAATIGTRIIQNIGSAFGSALITTIVTAYSTHQVNVFERHLKAETYHVDAAHLQVFTTSHLQAIRLAAFQQGFLVIAIAAIVIILPTLLLTNKLKAAK
>CP022294.1|AWY49232.1|2728528_2729482_-|aldo/keto-reductase
MKTIQIGASQLKASAVALGIMRMVRLDTDAAANVLETVHDRGVNFIDSADIYGNGDSERIFGQALKQSSLKREDFFIQSKGGIVLDPEKSSGELVFGQRYDFSKQHLIATVDKILQRMQLDYLDSFLLHRPDPLMDPAEVAAAFDELQATGKVRHFGVSNFNPMQVEMLQAAVSQKLMINQLQFGVMHTGPIQFGLHTNMQDTASLNHDGEIIEYSRLHHMTIQAWSPYQYGMFAGTFIDNPKFPELNAKLQELADQYHVTKNAIATAWILRHPANMQVILGSMNPQHLDESIAGTDVTLTRQEWYDVYFAAGNDLP
>CP022294.1|AWY49231.1|2727742_2728309_-|hypothetical-protein
MNKARLEAFTDAIIAIVLTLLVLDLPRPQTPSVRALFAEWQSIYVYIITFTLLISIWLNHHDLFVQVKKIDRVVFWANSFWLLCQSFIPFMASWITKFPHSKWPAVFYILTGFVWMLAYQLLVAAVRRLNPHIHRMSSPALSVVFGGFLVVLTVALINPDVGLFLIPVHAFASVILATKRKWHLRKYF
>CP022294.1|AWY49230.1|2726556_2727594_+|aldehyde-reductase
MQKQLVVVTGGSGFIAIHIIRQLLQQGYAVRTTVRSLAKAPVIKEMLTNGGITDLSALEIVVADLAHDEHWSEAMAGATYAIDVASPTPKLNFKNKAEMIRPAVDGVRRVLTASRDAGVKRVVLTSAYGAIFAGHKNRTTPYTEADWSDLNWKAIHPYQESKTRAELAAWDFINHEGRGLELTTVNPVAVMGPVLSAKYSHSNIQIQQFLEGQVKAVPNVDSGYVDVRDVASLHLLAMTAPQANGERFLATTGETLSMLDVANVLRQAFPAFASQLPTKTIPNAAVKLAAKARPELRMVASLVGTYAETSNHKAQTLLDWHPRPAAESIIATAQSMIDLGIVTKP
>CP022294.1|AWY49229.1|2725863_2726430_-|TetR-family-transcriptional-regulator
MAATNHAQAIKKDPQTYLTTALLQLLRTHDLDTITVTQVVKRAGVSRMAFYRNFTTLEDLLTAYFAPAIAARFQDVLQHVPANRKLLAMGQFFSDFAPTLRLAEQRGFENIIQQLFNANMTNYYQATMTNGMLTAVQLKYWTRFMSAGVYAIWREWLLGGQLESLTTIHEILATLQTATMQALTQAQK
>CP022294.1|AWY49228.1|2724976_2725705_+|NAD(P)-dependent-oxidoreductase
MKPLVVITGASSGFGAEIAKLFAADNYPLLLLGRRQAKLAALSANFENAMIDTVDVTNYHQFETAVRKAEAKYGKTDLLVNNAGLMLLGNVQNQDPQEWQTMLNTNVMGVLNGTQIVLNDMRDREHGTILNMSSLAGKKTFVNHAAYVASKFGVHGLSETLREENAPKNVRVMLVAPGAAETELLTHVTSKSALSDYEAWKASMGGLTLDPKHVAATVKFMYDMPQNVNIREVDIAATAQDA
>CP022294.1|AWY49227.1|2724478_2724844_-|MarR-family-transcriptional-regulator
MLKERVTAQPRYRNEFDATMQLIRGKWKIMILFELAEVKVSRFADLQHHIQAVSHKTLASQLKELEQDELIERHDFKTAQPHVEYRLTAKGQSLIPILDAICTWGDQHVDPALIERSLCDE
>CP022294.1|AWY49226.1|2723910_2724195_+|DUF1905-domain-containing-protein
MKTYQFDAPIQAATIGKGGAYVACPFDIRDLFGKGRVKVHATFDEVPYNGSIVNMGVKNLDGSICYILGIRKDIRAKLHKSIGDVVAVTVTAID
>CP022294.1|AWY49225.1|2721042_2723625_-|glycoside-hydrolase-family-25
MNFKSQNPIDASQSERFKLYKSGKLWLVAGLTFFSFLGGSVLNNTNVHADATNATTTSSSAASTASSASVATSSAASDATTKATSVSSSAATQVTSAATTKTTSQAATASSSAATSQSTSTASSSTSQATKTASSAATSTSATATSQATSVASSTATTTQVSHTASSTAASAASSTATVKAVKAASSTVSSAATTATKATAKVAAVAYTAATTSSTDVWTIGDTTRPRVDVVDVASYQSTMTQSDFNKLKAAGVKTVIVKSTEGTDYTNPAALNQAKMANKAGLNVDFYHYATFSTADAAKSEATNMAGFLVKNNVSTKVLLFADMEDSSSYSVNATANLNAFWSTLDSFGYKNHGVYTSNSYLYRDAVVKTVGQSRVWRAQYPYTPSANNLWNTNDGAWQFSDTALLPSGSDYTGYIDVSIDYNGLTEDSAGTNTFVTTTSSNDTTTSEVTTDTSATTNTSTSSTTKKASGWYTFTKNTAIKSAASDSAKTVGTYSKGNRVYYNAEITTNGETWLRYLSYSGSEHFVKIAAAKTTTTKPAASTSKTVTKNETGTYKFTKTTAIKGSVSDSAKTLGTYYKGDTVYYNAKVTKNGETWLRYLSYSGAQHYVKISGAATSTTTTKPATSSSKTVTKAETGTYKFTGTTAIKGSVNDSAKTLGTYYKGDTVYYNAKVTKNGQTWLRYLSYSGAQHYVKISGAATTTTTSSKSTATASAKTVAQSGTYKFAKTTAIKSSASDAASTVGTYYKGNTVNYNAKVTTNGQTWLRYTSYSGAQHYVKVSGGAATTTSSSASKTTAAAGTYTFKTTTNIRTAASLNASVVGQYSAGESVYYIGTVSADGYQWLKYLSNSGAYHYVAKIG
>CP022294.1|AWY49224.1|2719359_2720772_+|succinate-semialdehyde-dehydrogenase
MAYQTINPYTNEVVKTYDNATTDQIEQALTTGDALYHQWRHEPVSSRAASLHKIAALLREHKDELAKIATIDMGKLLSESQGEVELCAMIADYYADHGAELLAPTPISTQATGDAEIEKQATGVLMLVEPWNFPYYQIMRVFAPNYMVGNPMILKHASNTPGSAAAFAKIVEEAGAPAGSLTNLFLNYDQVSDIIADPRIQGVALTGSKRGGQAVAKAAGANLKKSSMELGGSDAFVVLADADIDEAVNLAWRVRLYNAGQVCTSSKRFIVAADVYDDFLAKLKERFAKLVPGDPMDPQTTLAPMNSKRAKEKLQDQVDRAIAGGATVAYGNEPIDLPGQFFQPTILTDIDQDNPLFYEEMFGPVAQVFKVDSEQAAIDLANNSELGLGGIVFAGTAAHGKAVAQQIETGMVFVNTFLSSLPELPFGGVKGSGYGRELSSLGLMAFVNEKLVVTAQKPDYDNGAGGLVVL
>CP022294.1|AWY49234.1|2731194_2731794_+|TetR-family-transcriptional-regulator
MTKTRRRGAELENAIYQAARDILNQDGLEQLTFANVAEQAGTSKPVIYRRWRSPLELAIAAIQDQIITENHGQLDEVSLTGQTLSEDLFQVLKRFTVSINTFNQALVITWFHHLDQQANPEVKDLLNAVKKIDAHAIERVCQRAQQRGELRTGTLSCDLQLMPFDWLRYRAFANEPITDATLHLLVDDLLVPAYQHALG
>CP022294.1|AWY49235.1|2731914_2732844_-|ferrichrome-ABC-transporter-substrate-binding-protein
MTKRWQIVKLGLVLGLMGSLLLGACGAKQPTSTTVTRTDYLKHKVKVPKHPKRIVASYLEDDLVALGIKPVVQWSVKNGSGTQAYLKEQLKGVPLIDYSLPYEAVTKAKPDLILIGTSSAVANGKYAQYNKIAPTYVVKNGTTVTWRQTFLDVAKVVNRQAKAKKVLAKYDKQVQTTRQALKKSGQHKVAVLWVTNNTAYMVNDNSASGALLYQDLQLGEPSLVKQVSKSATADWSAVSLEKLAKLDADDIFLVNSQKSASLFKDPLWKNIKAVKNNHLYQYGDSSSWQYSGPIAYSQMIDMVKTDLLK
>CP022294.1|AWY49236.1|2733080_2733875_+|ABC-transporter-ATP-binding-protein
MNTIEAQNISIGYGDKVIVDQLSITIPHGQITTLIGPNGSGKSTLIRAIAHLLPPTTGVILLDHQNIQQIKSKTFAKKIAVLPQTNQTANDLTVEELVSFGRLPYRRPLSGLTTTDHQKIEWALTQASLQDLRQRPLSTLSGGQRQRAWIAMAVAQDTDTIILDEPTTYLDLTHQLEVMQLVKKLNEQAHRTIIMALHDLNHAARISDQLIALKDGHVLAHGPVSTVMTAANLKTIFNIDATLVDYHGTPLILTYNGCQEVAPA
>CP022294.1|AWY49237.1|2733871_2734870_+|iron-ABC-transporter-permease
MKSTSRYWGWLALSTGVLILVMGLSLRFGADQMRTATVWHALTTTHTGNLDQQIIRHIRVPRVLGAALIGAALAGSGALMQAVTRNPLADSGLLGINAGAGLMLTLCLAFFPKLSTLQTTGWAIIGAAASAGLIFSISTARHVQLDPTILVLAGIAISSLLTALSEGLALVLQLKQDLAFWYFGGLGAVSWTQLKFLGPGLVLGLLLTLLLAPQLNLAYLTDDNAQSLGKSLPLLRGLALICAVILSGISVALVGTITFVGLMIPHMARWLVGANYRNSMPLTLILGATLTVGADLIARLVNPPHETPFGIIISLIGVPCFIYLARKEPMKA
>CP022294.1|AWY49238.1|2734866_2735862_+|iron-ABC-transporter-permease
MSPNRRLIIWSLLLTASMLGLAILNLSTGTMTISWPALLGILTSRGNATDMLVLVNFRLPRIVLAIMVGWALALSGNVLQTVTNNPMADPSLLGINNGAGLAVMLLIIGAGTNASLTLSLPIVALAGAWLSTALIFLLANQRQRGISSKRLLLVGVALSGCFSALMVLMTLKLSPDNYQFVMNWLAGSLWGTDWSYIGWALPWLAVGSGILFIQLPVLDAFTLGTTTAQTLGINLKRQQLGLISVAAMLAGVSVAISGGISFIGLITPNLARRIVGSRQRYQLPLAGLLGSTLLLAADTLGKLITTTTELPAGVLVALIGVPYFIYLLVRG
>CP022294.1|AWY49239.1|2736105_2736618_+|TetR-family-transcriptional-regulator
MANQRNQRMQATILLAYENLLSDKPFRKITVQDISDAALVHRSTFYKHFQDQYDLLEALFEQKRQQSKLTIDQIFTHPFETLNSFGNARFQETLRHQFNDDAFRDAFLNYLIHLCKDTVDDDQRLVRFLAVGRIKGLTLWITVGNAPYNIFTDTATLDNIFSNPLNTVNY
>CP022294.1|AWY49240.1|2736598_2737492_-|short-chain-dehydrogenase
MKVFITGGTGFVGSAVVQELVANGFEVVGLARSETSAQKLISWGAQPVRGSLTSLSTLATAAAQADAIIHLGFNNDFRHFFQAGAMDRRAIETMGRAISGTNKPLVVTYGTTGIRKHVETEHEVADTGLLKWLTPRKSEIVARQLMAQNINAFVVRLSPAVHGAGDMGFTRTVIERAKKSHRAEYFGLGTHAWSAVHRLDAAHLFYLVTMYGLEHPTTNERVFNAVAEESITIAAIARTISRKLNVPLKAKYNPLSFGDTAMLYLINCPTSSQLTRQILGWVPVQPDLLTDISSSRY
>CP022294.1|AWY49241.1|2737785_2738532_-|NAD(P)-dependent-oxidoreductase
MSIKGKVVVITGASSGIGAATAKLLAAKGAKVVLGARREERLQALSQAIGDNAVYQVTDVTDRQQVRALIDLAVSKFGRVDVLYNNAGTMPQGNLSDREYDKWQMMLNVNIMGVLNGIGEVLPIMQKQHDGLIIATDSVAGHVVYPASAVYNGTKYAVRAIMEGLRQEEKEHGIRSTIVSPGAVRTELVNTIGNTQIQAGISELMNADDRQGLALNPEDIANAVLFAIDQPKHVAISEVLVRPAQQEV
>CP022294.1|AWY49242.1|2738548_2739055_-|acetyltransferase
MQTIQPIVDANQRRIQALNVTREPSEIRERLAEITGQTIDISVEIRVPLWTDYGRNLKIGKRVFINDNVQITDLGGIKLADDVLIGPGAMLLSVNHPLDPAKRHAVEVQPIHIERNAWIGAGAKVLAGVTVGENAVVGAGAVVTKSVPANTVVAGVPAKVIKTIEQVD
>CP022294.1|AWY49243.1|2739313_2740150_+|short-chain-dehydrogenase
MQSKLAVIIGGTSGVGKHTAIDLANQNYHVIIVGSRADKGRQAQADISQATGNQAVQLALADLSTKTGVQQFAHQLAAMTDHIDILLNSIGVILPERHLSADGYDLNLVLNYLTHFWTIQALLPLLKHSDQARILLVGALPFVINHAKVSLPDFDAPATSKYNAMTVTAQATAARVLLTLALSERLTATNVTINIFHPGYVPDSNFGAGGSWVSRLAGRILGESFSRKNSPIGAWLATAPELTHTSGHFYDDRLRQVRLSKQYTRSKANDLWRLSSQY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
CP022294_2	2.1\|2551380\|26\|CP022294\|PILER-CR	2551380-2551405	26	CP022294.1	2551296-2551321	0	1.0

1. spacer 2.1|2551380|26|CP022294|PILER-CR matches to position: 2551296-2551321, mismatch: 0, identity: 1.0

cattcaatgttccaagcccattagta	CRISPR spacer
cattcaatgttccaagcccattagta	Protospacer
**************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP022294_2	2.1\|2551380\|26\|CP022294\|PILER-CR	2551380-2551405	26	AP014283	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S23-C59, * SEQUENCING IN PROGRESS *	15532-15557	4	0.846

1. spacer 2.1|2551380|26|CP022294|PILER-CR matches to AP014283 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S23-C59, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.846

cattcaatgttccaagcccattagta	CRISPR spacer
cattaaatgttccatgcccattaaaa	Protospacer
**** ********* ********. *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

360234 : 428866

Tupanvirus(20.0%)

protease,bacteriocin,tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWY47095.1\|360234_360903_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
AWY47096.1\|360899_361073_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
AWY47097.1\|361103_361271_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
AWY47098.1\|362132_362333_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
AWY47099.1\|362460_362628_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
AWY47100.1\|362745_363945_+	pirin	NA	NA	NA	NA
AWY47101.1\|363975_364722_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AWY47102.1\|365075_365264_+	pirin	NA	NA	NA	NA
AWY47103.1\|365599_365746_+\|bacteriocin	bacteriocin plantaricin-A	NA	NA	NA	NA
AWY47104.1\|367266_368010_+	DNA-binding response regulator	NA	NA	NA	NA
AWY47105.1\|368128_368872_+	DNA-binding response regulator	NA	NA	NA	NA
AWY47106.1\|369165_369939_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AWY47107.1\|370037_370196_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
AWY47108.1\|370220_370391_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
AWY47109.1\|370657_372808_+	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	6.1e-45	27.9
AWY47110.1\|372823_374200_+	HlyD family secretion protein	NA	NA	NA	NA
AWY47111.1\|374289_374979_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AWY47112.1\|375045_375714_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AWY47113.1\|375800_376481_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AWY47114.1\|376574_377261_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AWY49640.1\|377421_377709_+	hypothetical protein	NA	NA	NA	NA
AWY47115.1\|377720_378014_+	transcriptional regulator	M9MUN2	Rhodococcus_phage	9.9e-07	48.3
AWY47116.1\|378303_380613_-	ATP-dependent DNA helicase	NA	NA	NA	NA
AWY47117.1\|380871_381648_+	carbon-nitrogen family hydrolase	NA	NA	NA	NA
AWY47118.1\|382087_383104_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
AWY47119.1\|383511_384222_+	GntR family transcriptional regulator	NA	NA	NA	NA
AWY47120.1\|384294_385656_+	PTS cellobiose transporter subunit IIC	NA	NA	NA	NA
AWY47121.1\|385662_385851_+	hypothetical protein	NA	NA	NA	NA
AWY47122.1\|385840_386263_+	hypothetical protein	NA	NA	NA	NA
AWY49641.1\|386485_387841_+	PTS cellobiose transporter subunit IIC	NA	NA	NA	NA
AWY47123.1\|387858_389295_+	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	9.7e-31	25.5
AWY47124.1\|389415_390312_+	ROK family protein	NA	NA	NA	NA
AWY47125.1\|390461_391208_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
AWY47126.1\|391320_392334_+\|tRNA	tRNA-dihydrouridine synthase	NA	NA	NA	NA
AWY47127.1\|392689_393922_+	hypothetical protein	NA	NA	NA	NA
AWY47128.1\|393926_394721_+	hypothetical protein	NA	NA	NA	NA
AWY47129.1\|394889_395807_+	exopolyphosphatase	NA	NA	NA	NA
AWY47130.1\|395852_397127_+	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
AWY47131.1\|397119_398079_+	IpaB/EvcA family protein	NA	NA	NA	NA
AWY47132.1\|398100_398805_+	NAD-dependent protein deacetylase	NA	NA	NA	NA
AWY47133.1\|398804_399647_+	DUF72 domain-containing protein	NA	NA	NA	NA
AWY47134.1\|400243_400633_+	phosphohydrolase	NA	NA	NA	NA
AWY47135.1\|400954_403006_+\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	2.7e-90	35.8
AWY47136.1\|403238_404423_+	Bcr/CflA family drug resistance efflux transporter	NA	NA	NA	NA
AWY47137.1\|404545_405322_+	TatD family deoxyribonuclease	NA	NA	NA	NA
AWY47138.1\|405308_405872_+	ribonuclease M5	NA	NA	NA	NA
AWY47139.1\|405868_406759_+	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase	NA	NA	NA	NA
AWY47140.1\|406863_407115_+	hypothetical protein	NA	NA	NA	NA
AWY47141.1\|407247_408114_+	4-diphosphocytidyl-2C-methyl-D-erythritol kinase	NA	NA	NA	NA
AWY47142.1\|408423_409368_+	alpha/beta hydrolase	NA	NA	NA	NA
AWY47143.1\|409634_410333_+	ABC transporter ATP-binding protein	A0A1V0SGN0	Hokovirus	1.2e-15	27.8
AWY47144.1\|410319_411123_+	metal ABC transporter permease	NA	NA	NA	NA
AWY47145.1\|412202_412745_+	hypothetical protein	NA	NA	NA	NA
AWY47146.1\|412759_413023_+	hypothetical protein	NA	NA	NA	NA
AWY47147.1\|413515_414352_+	pur operon repressor	NA	NA	NA	NA
AWY47148.1\|414420_415803_+	bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase	A0A2K9L140	Tupanvirus	5.7e-28	33.2
AWY47149.1\|416038_416863_+	serine hydrolase	NA	NA	NA	NA
AWY47150.1\|417228_418209_+	ribose-phosphate pyrophosphokinase 1	A0A2K9L8D8	Tupanvirus	4.9e-42	36.3
AWY47151.1\|418497_419520_+	hypothetical protein	NA	NA	NA	NA
AWY47152.1\|419602_420589_+	hypothetical protein	NA	NA	NA	NA
AWY47153.1\|420758_421568_-	sugar-phosphatase	NA	NA	NA	NA
AWY47154.1\|421587_422940_-	hypothetical protein	A0A1B1ISR1	uncultured_Mediterranean_phage	5.2e-26	32.9
AWY47155.1\|422954_423887_-	biotin/lipoate A/B protein ligase family protein	NA	NA	NA	NA
AWY47156.1\|424247_424688_+	hypothetical protein	NA	NA	NA	NA
AWY47157.1\|424732_425341_+	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
AWY47158.1\|425513_427127_+	CTP synthetase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.2e-143	49.9
AWY47159.1\|427594_428866_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	3.4e-96	43.7

DBSCAN-SWA_2

1226124 : 1235133

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWY47839.1\|1226124_1227354_+	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	2.5e-216	97.9
AWY47840.1\|1227444_1228416_-	peptidase S41	A0A2P0ZL68	Lactobacillus_phage	1.0e-180	98.5
AWY47841.1\|1228601_1229549_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.7e-178	100.0
AWY47842.1\|1229892_1230507_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
AWY47843.1\|1230509_1232948_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.8
AWY47844.1\|1233035_1233596_+	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	2.7e-101	100.0
AWY47845.1\|1233666_1234107_-	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	8.0e-77	99.3
AWY47846.1\|1234451_1234919_+	hypothetical protein	A0A2P0ZL91	Lactobacillus_phage	2.7e-83	100.0
AWY47847.1\|1234893_1235133_+	hypothetical protein	A0A2P0ZL95	Lactobacillus_phage	1.8e-35	100.0

DBSCAN-SWA_3

1719418 : 1820863

106

Lactobacillus_phage(67.92%)

tail,capsid,portal,tRNA,transposase,head,terminase,protease,integrase,holin

attL 1761316:1761333|attR 1827802:1827819

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWY48297.1\|1719418_1720573_+\|integrase	site-specific integrase	A0A0A8WIE1	Clostridium_phage	4.3e-98	44.7
AWY48298.1\|1720688_1722524_-	elongation factor 4	E4ZFJ7	Streptococcus_phage	1.5e-23	26.1
AWY48299.1\|1722687_1723965_-	D-alanyl-lipoteichoic acid biosynthesis protein DltD	NA	NA	NA	NA
AWY48300.1\|1723961_1724204_-	D-alanine--poly(phosphoribitol) ligase subunit 2	NA	NA	NA	NA
AWY48301.1\|1724227_1725442_-	D-alanyl-lipoteichoic acid biosynthesis protein DltB	A0A125RNP0	Pseudomonas_phage	1.9e-27	30.5
AWY48302.1\|1725438_1726965_-	D-alanine--poly(phosphoribitol) ligase	A0A2K9KZV5	Tupanvirus	7.6e-42	27.6
AWY48303.1\|1727007_1727157_-	teichoic acid D-Ala incorporation-associated protein DltX	NA	NA	NA	NA
AWY48304.1\|1727188_1728364_-	peptidase S12	NA	NA	NA	NA
AWY48305.1\|1728797_1729940_-	molecular chaperone DnaJ	A0A2K9L588	Tupanvirus	4.3e-21	32.0
AWY48306.1\|1730041_1731910_-	molecular chaperone DnaK	A0A2P1EIW2	Megavirus	7.7e-137	47.2
AWY48307.1\|1731953_1732553_-	nucleotide exchange factor GrpE	NA	NA	NA	NA
AWY48308.1\|1732573_1733617_-	HrcA family transcriptional regulator	NA	NA	NA	NA
AWY48309.1\|1734008_1734719_-	acetolactate decarboxylase	NA	NA	NA	NA
AWY48310.1\|1734719_1735721_-	bifunctional riboflavin kinase/FMN adenylyltransferase	NA	NA	NA	NA
AWY48311.1\|1735733_1736657_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
AWY48312.1\|1737141_1737663_-	shikimate kinase	NA	NA	NA	NA
AWY48313.1\|1737665_1738763_-	prephenate dehydrogenase	NA	NA	NA	NA
AWY48314.1\|1738765_1740064_-	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
AWY48315.1\|1740077_1740605_-	amino acid biosynthesis protein	NA	NA	NA	NA
AWY48316.1\|1740613_1741783_-	chorismate synthase	NA	NA	NA	NA
AWY48317.1\|1741775_1743230_-	MFS transporter	NA	NA	NA	NA
AWY48318.1\|1743878_1744232_-	ribosome-binding factor A	NA	NA	NA	NA
AWY48319.1\|1744254_1746831_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	9.6e-21	23.3
AWY48320.1\|1746845_1747151_-	hypothetical protein	NA	NA	NA	NA
AWY48321.1\|1747140_1747440_-	DNA-binding protein	NA	NA	NA	NA
AWY48322.1\|1747484_1748702_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
AWY48323.1\|1748722_1749199_-	ribosome maturation factor RimP	NA	NA	NA	NA
AWY48324.1\|1749494_1753808_-	DNA polymerase III subunit alpha	A0A1X9SH08	Bradyrhizobium_phage	1.0e-14	34.0
AWY48325.1\|1754301_1756011_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
AWY48326.1\|1756050_1757328_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
AWY48327.1\|1757365_1758151_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
AWY48328.1\|1758166_1758946_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	1.1e-23	43.1
AWY48329.1\|1759065_1759629_-	ribosome-recycling factor	NA	NA	NA	NA
AWY48330.1\|1759630_1760353_-	UMP kinase	NA	NA	NA	NA
AWY48331.1\|1760553_1761432_-	elongation factor Ts	NA	NA	NA	NA
1761316:1761333	attL	NA	NA	NA	NA
AWY48332.1\|1761534_1762338_-	30S ribosomal protein S2	NA	NA	NA	NA
AWY48333.1\|1762562_1763285_+	HAD family hydrolase	NA	NA	NA	NA
AWY48334.1\|1763573_1764572_-	lactate dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	2.3e-47	34.9
AWY48335.1\|1764656_1764962_-	hypothetical protein	NA	NA	NA	NA
AWY48336.1\|1764945_1765704_-	SAM-dependent methyltransferase	NA	NA	NA	NA
AWY48337.1\|1765815_1766451_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
AWY48338.1\|1766507_1766744_-	hypothetical protein	NA	NA	NA	NA
AWY48339.1\|1766841_1767081_-	DUF896 family protein	NA	NA	NA	NA
AWY48340.1\|1767232_1767865_+	LexA repressor	A0A1B2APZ1	Phage_Wrath	2.3e-16	56.2
AWY48341.1\|1768419_1769049_+	hypothetical protein	NA	NA	NA	NA
AWY48342.1\|1769098_1770268_-	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
AWY48343.1\|1770303_1770696_-	hypothetical protein	NA	NA	NA	NA
AWY48344.1\|1770859_1771252_+	hypothetical protein	NA	NA	NA	NA
AWY48345.1\|1771696_1772638_+	glycosyltransferase	V9QJB1	Oenococcus_phage	2.4e-78	49.0
AWY48346.1\|1773445_1774018_-\|transposase	transposase	NA	NA	NA	NA
AWY48347.1\|1774169_1775354_-	LytR family transcriptional regulator	NA	NA	NA	NA
AWY48348.1\|1775334_1776126_-	taurine ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.7e-30	36.3
AWY48349.1\|1776144_1777887_-	nitrate ABC transporter permease	NA	NA	NA	NA
AWY48350.1\|1778365_1779577_-	rod shape-determining protein RodA	NA	NA	NA	NA
AWY48351.1\|1780621_1781158_-\|holin	holin	E9LUS0	Lactobacillus_phage	8.6e-41	98.9
AWY48352.1\|1781169_1781433_-\|holin	holin	E9LUR9	Lactobacillus_phage	2.0e-38	100.0
AWY48353.1\|1781432_1782605_-	endolysin	E9LUR8	Lactobacillus_phage	1.2e-199	89.5
AWY48354.1\|1782616_1782976_-	hypothetical protein	A0A2P0ZLF6	Lactobacillus_phage	5.9e-46	80.7
AWY48355.1\|1783124_1783376_-	hypothetical protein	A0A2K9VDF6	Lactobacillus_phage	2.4e-30	98.6
AWY48356.1\|1783368_1785903_-\|tail	phage tail protein	A0A2K9VDD0	Lactobacillus_phage	3.8e-248	80.0
AWY48357.1\|1785919_1788331_-	hypothetical protein	A0A2P0ZLF8	Lactobacillus_phage	0.0e+00	94.0
AWY48358.1\|1788396_1790169_-\|tail	phage tail protein	A0A2P0ZLH2	Lactobacillus_phage	0.0e+00	93.4
AWY48359.1\|1790242_1795273_-	peptidase M23	A0A2P0ZLG0	Lactobacillus_phage	0.0e+00	53.0
AWY48360.1\|1795304_1795496_-	hypothetical protein	NA	NA	NA	NA
AWY48361.1\|1795534_1795909_-	hypothetical protein	A0A2P0ZLH4	Lactobacillus_phage	3.2e-58	96.0
AWY48362.1\|1795985_1796639_-\|tail	phage tail protein	A0A2P0ZLH1	Lactobacillus_phage	1.5e-111	94.0
AWY48363.1\|1796654_1797035_-\|tail	phage tail protein	A0A2P0ZLF4	Lactobacillus_phage	3.8e-59	91.3
AWY48364.1\|1797034_1797442_-	hypothetical protein	A0A2P0ZLE6	Lactobacillus_phage	9.0e-67	95.4
AWY48365.1\|1797444_1797792_-\|head,tail	head-tail adaptor protein	A0A2P0ZLF0	Lactobacillus_phage	2.7e-43	73.0
AWY48366.1\|1797781_1798114_-	DNA packaging protein	E9LUQ4	Lactobacillus_phage	1.4e-44	83.6
AWY48367.1\|1798186_1799419_-\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	3.2e-208	91.6
AWY48368.1\|1799433_1800177_-	peptidase	E9LUQ2	Lactobacillus_phage	3.5e-125	95.1
AWY48369.1\|1800154_1801348_-\|portal	phage portal protein	E9LUQ1	Lactobacillus_phage	1.2e-223	98.5
AWY48370.1\|1801526_1803425_-\|terminase	terminase	E9LUP9	Lactobacillus_phage	0.0e+00	95.9
AWY48371.1\|1803427_1803886_-\|terminase	terminase	E9LUP8	Lactobacillus_phage	5.8e-78	94.0
AWY48372.1\|1804104_1804617_-	HNH endonuclease	E9LUP7	Lactobacillus_phage	2.1e-84	96.2
AWY48373.1\|1804585_1804765_-	hypothetical protein	E9LUP6	Lactobacillus_phage	2.5e-13	67.8
AWY48374.1\|1804952_1805519_-	hypothetical protein	NA	NA	NA	NA
AWY48375.1\|1805530_1806505_-	hypothetical protein	NA	NA	NA	NA
AWY48376.1\|1806819_1807248_-	transcriptional regulator	E9LUP5	Lactobacillus_phage	8.3e-63	82.4
AWY48377.1\|1807522_1807831_-	hypothetical protein	E9LUN7	Lactobacillus_phage	3.5e-47	92.2
AWY48378.1\|1807834_1808695_-	helix-turn-helix domain-containing protein	U5U793	Lactobacillus_phage	2.0e-39	43.5
AWY48379.1\|1808712_1809405_-	hypothetical protein	E9LUU3	Lactobacillus_phage	1.4e-115	87.4
AWY48380.1\|1809419_1809881_-	single-stranded DNA-binding protein	A0A218MNB4	uncultured_virus	1.4e-39	70.9
AWY48381.1\|1809877_1810504_-	single-stranded DNA-binding protein	D7RWM8	Brochothrix_phage	1.0e-13	38.2
AWY48382.1\|1810503_1811364_-	hypothetical protein	A0A0P0IV40	Lactobacillus_phage	7.1e-37	33.7
AWY48383.1\|1811688_1811889_-	hypothetical protein	E9LUT7	Lactobacillus_phage	2.9e-26	87.9
AWY48384.1\|1811891_1812146_-	hypothetical protein	NA	NA	NA	NA
AWY48385.1\|1812158_1812362_-	DNA-binding protein	NA	NA	NA	NA
AWY48386.1\|1812527_1812818_+	hypothetical protein	NA	NA	NA	NA
AWY48387.1\|1812896_1813166_+	SinR family protein	A0A0M3LS55	Mannheimia_phage	2.1e-11	42.4
AWY48388.1\|1813410_1813671_-	hypothetical protein	NA	NA	NA	NA
AWY48389.1\|1813728_1814085_+	hypothetical protein	NA	NA	NA	NA
AWY48390.1\|1814081_1814285_-	hypothetical protein	NA	NA	NA	NA
AWY48391.1\|1814295_1815048_-	phage repressor protein/antirepressor Ant	E9LUT0	Lactobacillus_phage	9.8e-59	97.3
AWY48392.1\|1815060_1815276_-	hypothetical protein	NA	NA	NA	NA
AWY48393.1\|1815532_1815859_+	transcriptional regulator	A0A1B0Y2R0	Lactobacillus_phage	6.9e-17	44.1
AWY49667.1\|1815889_1816279_+	ImmA/IrrE family metallo-endopeptidase	D6PSS8	Lactobacillus_phage	1.0e-35	53.5
AWY48394.1\|1816341_1817220_+	hypothetical protein	A0A2H4J549	uncultured_Caudovirales_phage	3.0e-06	34.8
AWY48395.1\|1817234_1817435_+	hypothetical protein	E9LUS6	Lactobacillus_phage	4.2e-25	97.0
AWY48396.1\|1817755_1817986_+	hypothetical protein	NA	NA	NA	NA
AWY48397.1\|1818155_1818344_+	hypothetical protein	E9LUS5	Lactobacillus_phage	8.2e-23	91.9
AWY48398.1\|1818474_1818651_+	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	7.2e-21	86.2
AWY48399.1\|1818776_1819034_+	hypothetical protein	A0A2P0ZL96	Lactobacillus_phage	1.0e-31	76.2
AWY48400.1\|1819216_1819531_+	hypothetical protein	NA	NA	NA	NA
AWY48401.1\|1819699_1820863_+\|integrase	site-specific integrase	E9LUK6	Lactobacillus_phage	2.7e-63	37.6
1827802:1827819	attR	NA	NA	NA	NA

DBSCAN-SWA_4

2142502 : 2179627

Lactobacillus_phage(37.5%)

tail,capsid,portal,head,terminase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWY48695.1\|2142502_2142715_-	hypothetical protein	O03950	Lactobacillus_phage	9.3e-15	82.6
AWY48696.1\|2143393_2143771_-\|holin	holin	A0A2K9VCG4	Lactobacillus_phage	7.9e-17	67.5
AWY48697.1\|2143757_2144054_-	hypothetical protein	A0A2K9VCD4	Lactobacillus_phage	6.4e-38	74.5
AWY49676.1\|2144054_2145188_-	lysin	O03950	Lactobacillus_phage	3.1e-32	77.4
AWY48698.1\|2145348_2145783_-	hypothetical protein	NA	NA	NA	NA
AWY48699.1\|2145785_2146235_-	hypothetical protein	A0A2P0ZLE0	Lactobacillus_phage	1.8e-20	39.9
AWY48700.1\|2146256_2151512_-	hypothetical protein	Q6SE68	Lactobacillus_prophage	8.2e-144	59.4
AWY48701.1\|2151526_2151889_-	hypothetical protein	V5UQS8	Oenococcus_phage	8.6e-45	71.2
AWY48702.1\|2151902_2157734_-\|tail	phage tail protein	V5URV5	Oenococcus_phage	6.6e-227	40.9
AWY49677.1\|2157749_2158013_-	hypothetical protein	V9QKH3	Oenococcus_phage	2.3e-23	65.4
AWY48703.1\|2158120_2158519_-	hypothetical protein	V9QJA0	Oenococcus_phage	3.0e-46	74.8
AWY48704.1\|2158618_2159089_-\|tail	phage tail protein	Q6SE73	Lactobacillus_prophage	2.3e-45	60.7
AWY48705.1\|2159103_2159469_-	hypothetical protein	V5UQS4	Oenococcus_phage	3.0e-29	53.4
AWY48706.1\|2159468_2160020_-	hypothetical protein	V5URV0	Oenococcus_phage	2.0e-64	62.3
AWY48707.1\|2160021_2160369_-	hypothetical protein	V5US85	Oenococcus_phage	3.2e-36	62.3
AWY48708.1\|2160368_2160701_-	hypothetical protein	V9QJ97	Oenococcus_phage	1.8e-12	45.3
AWY48709.1\|2160712_2160889_-	conjugal transfer protein	NA	NA	NA	NA
AWY48710.1\|2160901_2161924_-\|capsid	minor capsid protein E	V5US24	Oenococcus_phage	3.7e-117	62.5
AWY48711.1\|2161943_2162291_-	hypothetical protein	V5UTH9	Oenococcus_phage	4.4e-30	63.8
AWY48712.1\|2162305_2162983_-	scaffolding protein	Q6SE80	Lactobacillus_prophage	6.0e-15	32.1
AWY48713.1\|2163155_2163362_-	hypothetical protein	NA	NA	NA	NA
AWY48714.1\|2163413_2163692_-	hypothetical protein	NA	NA	NA	NA
AWY48715.1\|2163666_2165352_-\|head	phage head morphogenesis protein	V5US81	Oenococcus_phage	6.5e-119	58.0
AWY48716.1\|2165498_2165795_-	hypothetical protein	D2J003	Enterococcus_phage	1.1e-10	40.2
AWY48717.1\|2165724_2167233_-\|portal	phage portal protein	V5US18	Oenococcus_phage	1.8e-136	52.0
AWY48718.1\|2167244_2168483_-\|terminase	terminase	M1PG09	Streptococcus_phage	7.1e-139	61.0
AWY48719.1\|2168472_2169000_-\|terminase	terminase small subunit	O03926	Lactobacillus_phage	5.0e-41	73.1
AWY48720.1\|2169177_2169357_-	hypothetical protein	E9LUP6	Lactobacillus_phage	4.6e-07	56.9
AWY48721.1\|2169466_2170288_-	hypothetical protein	NA	NA	NA	NA
AWY48722.1\|2170808_2171270_-	transcriptional regulator	D6PSV8	Lactobacillus_phage	4.1e-39	57.0
AWY48723.1\|2171480_2171861_-	hypothetical protein	NA	NA	NA	NA
AWY48724.1\|2171857_2172376_-	hypothetical protein	O03915	Lactobacillus_phage	2.9e-54	69.1
AWY48725.1\|2172372_2172660_-	hypothetical protein	NA	NA	NA	NA
AWY48726.1\|2172656_2173565_-	DNA replication protein DnaD	NA	NA	NA	NA
AWY48727.1\|2173643_2174504_-	hypothetical protein	A0A0P0IZH9	Lactobacillus_phage	7.8e-76	48.9
AWY48728.1\|2174427_2175315_-	recombinase RecT	E9LUM3	Lactobacillus_phage	4.6e-63	53.3
AWY48729.1\|2175317_2175698_-	hypothetical protein	NA	NA	NA	NA
AWY48730.1\|2175830_2176001_-	hypothetical protein	NA	NA	NA	NA
AWY48731.1\|2176068_2176581_-	transcriptional regulator	D6PST4	Lactobacillus_phage	3.5e-23	39.4
AWY48732.1\|2176648_2176954_-	DUF771 domain-containing protein	NA	NA	NA	NA
AWY48733.1\|2176965_2177136_-	hypothetical protein	NA	NA	NA	NA
AWY48734.1\|2177294_2177495_-	transcriptional regulator	NA	NA	NA	NA
AWY48735.1\|2177641_2177878_+	transcriptional regulator	A0A0K2CNE2	Brevibacillus_phage	8.5e-09	30.7
AWY48736.1\|2177915_2178230_+	hypothetical protein	NA	NA	NA	NA
AWY49678.1\|2178286_2178541_-	transcriptional regulator	NA	NA	NA	NA
AWY48737.1\|2178686_2179190_+	transcriptional regulator	S6C481	Thermus_phage	1.7e-22	42.6
AWY48738.1\|2179204_2179627_+	hypothetical protein	A0A0S2SXM3	Bacillus_phage	3.0e-12	35.1

DBSCAN-SWA_5

2379998 : 2388512

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWY48921.1\|2379998_2380577_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-21	33.9
AWY48922.1\|2380569_2381595_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.7e-59	41.0
AWY48923.1\|2381591_2383046_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	3.3e-50	34.0
AWY48924.1\|2383030_2385250_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	4.5e-144	39.3
AWY48925.1\|2385242_2385923_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
AWY48926.1\|2385922_2386177_-	phosphoribosylformylglycinamidine synthase	NA	NA	NA	NA
AWY48927.1\|2386178_2386910_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.6e-37	37.3
AWY48928.1\|2386912_2388043_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
AWY48929.1\|2388026_2388512_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP022292

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 45428

Paenibacillus_phage(18.18%)

transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWY46713.1\|1149_1323_-	hypothetical protein	NA	NA	NA	NA
AWY46714.1\|1629_2856_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	1.1e-88	48.3
AWY46715.1\|3236_4391_-	S-adenosyl-L-homocysteine hydrolase	NA	NA	NA	NA
AWY46716.1\|4380_5043_-	phosphohydrolase	A0A1Q1PP35	Noumeavirus	5.0e-14	31.4
AWY46717.1\|5042_6434_-	MFS transporter	NA	NA	NA	NA
AWY46718.1\|6721_6826_-\|holin	holin	NA	NA	NA	NA
AWY46719.1\|7104_8184_+	FRG domain-containing protein	Q9AZ51	Lactococcus_phage	9.0e-05	51.9
AWY46720.1\|8619_9795_-\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	9.1e-27	28.8
AWY46721.1\|9918_10620_+	DNA-binding response regulator	NA	NA	NA	NA
AWY46722.1\|10785_12822_+	potassium transporter Kup	M1HZV6	Acanthocystis_turfacea_Chlorella_virus	1.2e-61	33.0
AWY46723.1\|13205_13643_+	MarR family transcriptional regulator	NA	NA	NA	NA
AWY46724.1\|14020_14575_+	resolvase	A0A1J1J8Z4	Escherichia_phage	8.9e-33	45.1
AWY46725.1\|16543_16996_+	ribonucleotide reductase assembly protein NrdI	NA	NA	NA	NA
AWY46726.1\|17002_19171_+	ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	1.2e-255	60.3
AWY46727.1\|19277_20204_+	ribonucleoside-diphosphate reductase	A0A2H4P8A9	Corynebacterium_phage	5.9e-37	32.1
AWY46728.1\|20218_21169_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	1.2e-98	54.3
AWY46752.1\|21296_21926_-\|transposase	transposase	Q6J1X2	Lactobacillus_phage	6.4e-11	29.5
AWY46729.1\|22940_23843_+	YitT family protein	M1Q1P6	Streptococcus_phage	6.3e-52	40.3
AWY46730.1\|23950_24725_+\|transposase	IS5/IS1182 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2
AWY46731.1\|26329_27105_-\|transposase	IS5/IS1182 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2
AWY46732.1\|27222_28791_+	ClC family H(+)/Cl(-) exchange transporter	NA	NA	NA	NA
AWY46733.1\|29083_29257_-	hypothetical protein	NA	NA	NA	NA
AWY46734.1\|29563_30790_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	1.1e-88	48.3
AWY46735.1\|32086_32803_-	transglycosylase	K4ID66	Lactobacillus_phage	3.6e-10	55.7
AWY46736.1\|33185_34211_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	5.5e-44	36.3
AWY46753.1\|34591_35785_+	glycine betaine/L-proline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.9e-29	36.4
AWY46737.1\|35784_36624_+	glycine/betaine ABC transporter	NA	NA	NA	NA
AWY46738.1\|36631_37549_+	glycine/betaine ABC transporter	NA	NA	NA	NA
AWY46739.1\|37794_38760_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	8.3e-26	29.2
AWY46740.1\|38807_38888_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
AWY46741.1\|38914_39844_+\|transposase	IS30 family transposase	H7BW47	unidentified_phage	1.8e-25	34.4
AWY46742.1\|39881_40181_-	hypothetical protein	NA	NA	NA	NA
AWY46743.1\|40182_41043_-	ParA family protein	F0PIG8	Enterococcus_phage	1.7e-43	40.2
AWY46754.1\|41412_41625_+	hypothetical protein	NA	NA	NA	NA
AWY46744.1\|41631_41838_-	hypothetical protein	NA	NA	NA	NA
AWY46745.1\|41989_42322_+	hypothetical protein	NA	NA	NA	NA
AWY46746.1\|42989_43271_+	type II toxin-antitoxin system antitoxin, RelB/DinJ family	NA	NA	NA	NA
AWY46755.1\|43452_43767_+	hypothetical protein	NA	NA	NA	NA
AWY46747.1\|43836_44544_+\|transposase	transposase	A0A0C5AJ29	Paenibacillus_phage	1.1e-24	38.2
AWY46748.1\|44591_45428_+\|transposase	transposase	A0A0C5AEA5	Paenibacillus_phage	3.0e-24	32.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP022294

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP022292

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection